4AI3A

Flo5a showing a heptanuclear gadolinium cluster on its surface after 60 min of soaking
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 59
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ai3A02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ai3A01
4LHKA 4D3WA 4AFAA 2XJQA 2XJTA 4AI3A 2XJVA 2XJRA 4COYA 4COVA 4GQ7A 4COZA 4AHZA 4AI1A 4LHLA 4CP2A 4CP1A 5A3MA 4A3XA 4ASLA 4AF9A 2XJPA 5A3LA 4LHNA 4AHWA 2XJSA 4CP0A 4COWA 4AI0A 4AHXA 2XJUA 4AHYA 4AI2A 4COUA 4AFCA 4AFBA
chains in the Genus database with same CATH superfamily
3AMNA 3NAPB 2WBKA 3NWKA 3LOIA 4OUEA 4XYXA 3BOWA 2WS92 1R0HA 1ZREA 4FPFA 2A3YA 4XZUG 5FY8A 4D7TA 5HCFA 1DIWA 4I09A 3OPTA 3CBNA 3I3QA 3VHNA 4A3GL 2BVVA 2QUOA 2VPVA 4LHLA 3B94A 3CJXA 4Q0PA 1ZRRA 2Z5WA 2PVEA 2VMDA 3QCWA 4LHSA 1AZDA 1ZM1A 5EYYA 4ASLA 2AC1A 2JI3A 3JD71 3POEA 3RZ6A 2AYHA 3RVHA 4IETA 1RMU2 3GXUA 2TUNA 3HIFA 5FQ0B 4RD7A 5FUPA 4QPIB 3NAPA 1R64A 1PMHX 2OVUA 3ZDVA 5KHGA 4YZ3A 1CQ9A 2HWC1 2WYSA 2AUYA 1WMDA 3NSTA 2J1EA 4DO0A 5A1LA 3PURA 5GZGA 4BPZA 1IS5A 1WW5A 2VZ1A 3WUDA 5AI3A 1C5HA 3WW1A 4P9GA 1B2JA 1RITA 2HJIA 3FHIB 3BKZA 1VBC3 1H9PA 1YJLA 3WOGA 5SV5A 1W0PA 2W3JA 3LDBA 1NLRA 4UFKA 3WWLA 1POV1 4UW3A 1OPMA 4AVSA 1D4M1 4Q4V1 4HSLA 5FYIA 4RGGA 3RPQA 3MW3A 1XQNA 3ZYFA 2QQLA 4XFBA 2CY6A 3J7Z1 3AKTA 3TWIA 2XUMA 3TEZA 1L7LA 2JG8A 4DXZA 1ZX5A 3H8XA 4AQ6A 3KM5A 3M4FA 3VDAA 3I59A 4RA0A 5FXVA 1MS3A 5CKMA 1RUH3 1NLSA 3BB6A 5I0SA 1LCLA 1T9OA 3NAPC 4XOGA 5FIXA 1SZBA 2GALA 5IAXA 4BDVB 2B5HA 4MG2A 1JHNA 4PQ9A 5FY5A 1PM7A 3RMXA 4DRRA 1RUC1 1RINA 2BBAA 2I2SA 3HD8B 5L36A 2XOMA 4LK7A 4AI1A 5FZ8A 5JSPA 3BOPA 4MGTA 3HR9A 2AYJA 2CNAA 3HJRA 1JMUB 4PI2A 4CP2A 4DY5A 4FAGA 1GUIA 5LA2A 5IATA 2YU1A 1IG3A 4XIKA 3VLBB 3QACA 1QF3A 5A3LA 3EXUA 1MEC3 2PAMA 4QPIC 5I91A 1QJX1 2J1TA 1RUI3 4I0WB 2CDOA 4C3HL 3PVNA 2QKDA 4XC9A 5FZFA 2ZAAA 1BVVA 2G4IA 3PNAA 2VTXA 3VBFB 1TNRA 4CCLA 4AGGA 1IQDC 2UY8A 3KD4A 2JA6L 1A8DA 2D3SA 1GZWB 1C1LA 1W0OA 2JG8C 3ZYGA 5BYNA 1NXMA 1DFQA 3SHRA 1OKQA 4NRPA 4CPBA 1M06G 3HJWB 3H8UA 3HOXL 5A7WB 4CVUA 1LULA 1Q8OA 3LDKA 4OHWA 1AR81 2QQUA 3CDZB 3NW4A 3B7MA 3H7YA 4LITA 4YM2A 3WCSA 4DUWA 4YZ1A 2JECA 2JDNA 5RXNA 3IDAA 2ZGNA 3C2UA 1ENRA 3K77A 4BXFA 5J96B 4JAGA 5C70A 5HV4A 2VMFA 5FZKA 1V00A 3WSOA 4E4ZA 4E4SA 3AB0A 5LEJA 1DQ2A 2QQMA 2LM3A 1H0BA 1US3A 3WCRA 4F83A 1D4VB 5EYXA 3RYPA 4QDQA 4QAWA 4DUVA 2ZABA 3AXDA 5CU1A 1VBA2 2VQTA 4K7JA 5ACA1 3T4VA 2AH2A 4CEWA 4O9GA 4XF4A 2EXKA 3IDBB 4RQPA 3U4XA 1SMWA 1IPJA 4JRAA 3NFPI 5LASA 2R063 4X8NA 3NVCA 5C3PA 1OOPA 3E5QA 1XNTA 2IXLA 4A3BL 1W6PA 2G19A 4AFMA 1GWLA 1HB2A 2W2IA 4N53B 4YWLA 3KS7A 2E6VA 4LBJA 5A3NA 1ZNPA 2GP5A 1CZVA 3WF4A 1DDLA 3GYDA 2A6ZA 1RYQA 3BUCA 3IKWA 3SCHA 4IE0A 3ZXAC 1DZQA 4IE7A 2DF7A 3H1MA 3NO8A 4KU8A 3AMQA 2YXSA 2NM1A 4DEVA 5KBFA 2VBPA 1MS4A 1Q43A 4FOYA 3U10A 2XJTA 1CAWB 1ZBA3 2FDHA 2EVXA 5EXOA 5I8SA 3I3MA 4O61A 1ALYA 5TSWA 4N7IA 5JZGB 4WBBA 4CEWC 3ZSEA 5MLC3 1ZRIA 3WXPA 4BIFA 2O14A 3NV2A 4RQPC 3ZFGB 1GZ9A 4AR3A 1OI6A 2RJKA 4IEZA 2ZACA 1ULCA 4M0NA 1W2OA 4JGYA 1ND2B 3GALA 4D6QA 4GWIA 1OOPC 2HWD3 4QQHA 1FHHA 3K3OA 1W8NA 3K75B 5MF6A 4HPKB 2A69D 1UIKA 4HVRA 3ZXFA 2K9ZA 1CAWA 1E8JA 1I3HA 3E97A 4DOUA 3AYCA 5FWEA 4JHTA 2HBTA 2R1DA 3ETQA 4AFBA 3U75A 4UW5A 2AEZA 2H6CA 1FPN1 2HWE2 3TEXA 1UZZA 3LA7A 5FKBA 2VZRA 4FBFA 5BUVA 1OF3A 3AP6A 3D3AA 1HRI1 2AR6A 2VY0A 2WNUB 3LAGA 4L92A 3VDDB 5K7PA 1JZ7A 2JJ6A 1EV13 1ND2A 2ZOEB 1Y9MA 3AKPA 2P2KA 1HX6A 4SLIA 1CR7A 1H8VA 1UIJA 4XQ4A 2CR8A 3UK9A 5LRSA 3P2AA 2RS13 3ES4A 4QB2A 4HPKA 2QQPA 1ST8A 2ORZA 2OZ6A 1W8HA 5A3PA 3FZ3A 3O7OA 5L9VA 5LCWL 2VZQA 4AAXA 1YV1A 3ALQA 2JDZA 3K46A 4LO7A 4ZXKA 3UGFA 3UKTA 1RUD2 4EWEA 1UZYA 1YC61 5CFDA 4JGYC 2ZGUA 3OGRA 1HN0A 5FZ0A 1LAJA 1W6QB 3ZG6A 3FBYA 5H9RA 3O1TA 1MACA 5D21A 4QQPA 4ARYA 1C09A 1A78A 4D7SA 2BBVA 1HB4A 5F2WA 2LCQA 3PVOA 1CZTA 3UV9A 3ZFEB 3KZ4C 4DMIA 2W0XA 1T9PA 1ULGA 4GB32 4J25A 3CJIB 4UFLA 1UMZA 2A1XA 2WQZC 2OUHA 2E7TA 2GC0A 2WJSA 5FJKA 2W1UA 1R0GA 5C9AB 2BV4A 2AREA 1XJAA 5T52A 5IVFA 3U37A 1O3SA 5C4WA 1BYHA 1LESA 1ND2C 1TME1 1ZA7A 2K46A 4Q4Y1 4YW6A 1W6OB 4XXPA 1XXNA 1QXRA 4P5YA 1LTEA 2DVGA 2PHDA 2Y38A 3W58A 4CCJA 3AVRA 3KT1A 3ZFEA 5J48A 1H4HA 3IAPA 2CYFA 3P3PA 4TVMA 5KXBA 5C5UA 3CJIA 4R8HA 3N7KA 1PNFA 3HBKA 4RYDA 1O6UA 2EIEA 3KVAA 4CZSA 3FWEA 5CFDC 2VD7A 5C9AA 2HWF1 2J1UA 2VZVA 1NY71 2WN2A 1DZRA 5FZMA 3WDXA 3EB7A 1F15A 1GWKA 4P08A 1KFUL 4A7YA 1FMD1 3NV1A 4HONA 3L9JT 4IEOA 5FZAA 3UT0A 5C33A 2HVYC 3KMHA 3OBAA 4AF9A 4RFRB 2J42A 3MUZ1 2ADEA 1BBT3 2ES3A 2YUEA 3THCA 5DUVA 3POFA 4UW6A 4D0QA 1AL23 2EALA 3BU0A 2QQVA 2ZGLA 4IEYA 5CVRA 4DIQA 2VL6A 1RVF2 3UL2A 5T5OA 5C4WC 2HWB2 4IEUA 4N43A 3SCGA 3J9SA 2Q1MA 1C28A 2ZS6B 1MPXA 2WWSA 1QJU1 3M3EA 1CN1A 2BTVC 3M3QA 1LGCA 3SEEA 5BNNA 3GM8A 1GWMA 2BFUL 1VBB2 3ZFEC 2W1SA 1PIV3 3T09A 1BK1A 1IKQA 4AG4A 1VAMA 4KWUA 1PO21 3CJIC 5M5XL 3SISA 1M4WA 1S4CA 3RZGA 3VBHB 2VVEA 4PDWB 5C9AC 1FOD3 1AR61 1PO11 4XJ9A 1VBD1 3RRDA 4LBQD 4AVBA 1W6NA 1W39A 3CLPA 4P9XA 3MUY1 1F5FA 1RUF3 1YHFA 5JDBA 3C8XA 3HMYA 5GLUA 4MHUA 3A21A 1OKOA 4YFWA 1FT9A 3FC0A 4LE4A 5A3WA 5JAXA 4YVSB 3DF0A 1ODNA 3K48A 3LGRA 5C4JL 3I4ML 1OA3A 1XYPA 3LDRA 4UXAA 2VNOA 4N43C 4Y7NL 1SLBA 1SBEA 2JDUA 4IGOA 3EYPA 1H6YA 2IVJA 4Z2AA 2ZTNA 3KVBA 4F3JA 1OH3A 1UY1A 3JBG3 5F3IA 3WQ7A 4YZ2A 5BNNC 3WDWA 4CCNA 5A33A 4DNYA 1HDKA 1IGOA 4A4AA 5A1AA 1NE6A 5JVVA 1FV3A 1H1IA 3CKHA 1UAIA 1QY4A 2JEMA 5DM71 2BYVE 1NCQA 4Y52L 5EJ1B 4A2UA 5C3QA 1H8TA 1JUHA 5F9TA 1JZ8A 4QM8A 1S55A 2JDMA 4YVSA 2J1SA 3M1HA 3PIO1 1WGPA 2QQIA 1N1TA 3R0RA 5B4XA 1LU1A 1ENXA 3IDCB 4NWWA 3ZR5A 2ZAHA 4LLOA 3D5OA 2I07B 4Q4W3 2MEV1 1GOGA 4RGKA 1IS6A 3WNMA 4EN8B 2VOVA 4FVVA 1BQPA 1ULEA 2IXJA 3W21A 1MVQA 4CDWA 4BYYA 1H1MA 3WW3A 1MVEA 4FPOB 1NZCA 4XJ8A 4BXSV 2WRAA 3KQ4B 4QHZA 3WW2A 1F2NA 1REDA 4QX5A 1COV1 2GP3A 5KXDA 3H0OA 5LW9A 3F95A 4POFA 3FUQA 4XHBA 1UZ0A 2RHPA 2A70A 1YEWA 3H3UA 4ISRA 2WS93 1PK6B 2A68D 4Y1YA 2H0VA 1NCQC 1PGW1 3BTAA 2O8OA 2CWMA 1H8TC 2VNVA 3KHBA 4AXOA 3FBMA 4KGGA 2BZDA 3VBUA 2OS2A 4YVSC 5F3CA 2HR5A 1OH4A 3KF5A 5F3EA 4BH9A 5DZGA 2BNMA 4ZU4A 1V9U1 5LA1A 1MZ5A 4LA3A 3JCIA 4K1YA 5FO8B 4DUXA 3ZO0B 3HOZL 2VCAA 1RMU3 1BEV3 5KXCA 3ILFA 3ZPOA 1VBE2 1UXZA 1YUZA 1UY0A 1WW4A 4CXXA 4E9KA 1ZBE3 5A6XA 4CP9A 4ARXA 4CDWC 1Z7S1 1QJY1 2PQQA 3JXSA 4OVEA 4PIYA 4RS5B 2P37A 3KV5A 4GD4A 2RS51 4KWJA 3WP5A 5CISA 1YWKA 3ZXKA 1G86A 3BGAA 1GKBA 2FDGA 5FWJA 5A6ZA 4OI1A 3J7NA 4Q26A 1NLQA 2WFF1 1H6XA 2CGNA 4Q0VA 5FJHA 1JODA 3CNAA 5GZEA 4EROA 2BJSA 5BNQA 1BZWA 2CSGA 2RR11 4XUNA 5CB7A 3V0AA 2KM2A 2MPFA 5CA6A 2CV6A 4HOOA 4CA9A 5AC91 3WR0A 3RJ2X 5FZBA 2NMOA 2BE5D 3VBUC 2OQ6A 2X09A 3OUJA 4RS5A 2GNDA 1GP4A 4YVWA 2ZX0A 1GLHA 5FYHA 5A3MA 3OGJA 4IDZA 3BODA 5JR7B 3SMHA 1ONAA 2FCUA 4JTNA 4KI5M 3WG4A 3U0ZA 5G05L 1HRV2 1SCSA 1LEDA 4XVHA 2PYAA 3NNMA 3GTKL 4JZRA 5FPXA 2UWAA 4A7ZA 2BRTA 2PAKA 1ZRCA 5MFPA 3M3YL 1J83A 4CCDA 4QX3A 2C0ZA 3RYKA 3NJZA 1FAYA 1WCML 1WA4A 1ZA4A 3LIGA 4K9SA 2EXIA 4LULA 4EN7B 1WBLA 4I02A 2PHRA 3ABZA 5DN2A 4D69A 3IN9A 1YUXA 4CXWA 1K42A 1JYXA 2YBSA 3J7HA 3N9PA 4OHZA 4NHMA 4C0HA 2BQPA 1L7QA 4FPEA 1EPWA 4CUCA 2X29A 2W94A 3GCWA 1H9WA 4URTA 4AQSA 1WMEA 3OOXA 3M4OL 1RJ8A 1JU4A 3UGHA 4LT5A 3B0AB 4XMIA 1TNFA 3H3VM 5K0UA 4RS5C 4YVWC 3TNPB 2UURA 2Y60A 4IUGA 1KGYA 2DV9A 2PHFA 4QPGA 2YDEA 2BGPA 1I5ZA 3WEZA 2GU9A 3NV4A 2QE3A 3JD72 3K4DA 4PLMA 4FT8A 4V1PA 4Y4RA 4A3IL 2XHNA 1T6BX 2VXJA 2YB7A 2UU8A 4Q1PA 2ARAA 3WP4A 2ZJCA 5K8SA 3VD7A 2Q8EA 4NIGA 1OLMA 1YNAA 1RDGA 1JOBA 2HWC2 2Y6LA 3BTZA 5LBBA 2YPDA 1WLCA 2MHFA 1SFPA 4ZHNA 4LA2A 3LWPB 2J1RA 1QJEA 5JSOA 4XQWA 2DSXA 3GZAA 1ZZCA 5LA0A 4MGQA 3C7EA 4IGPA 3ZYRA 3P8BA 1CAXA 2K2SA 2Y64A 5LBFA 3FFQA 2VTXJ 4D94A 5IVCA 4N9IA 2GNMA 1SMMA 2XJSA 3K3NA 3ORJA 5LWBA 2DVBA 4O65A 4KNCA 2KA3A 2V73A 2SLIA 1KEXA 1SDDB 1D4M2 4Q4V2 1VAVA 4XUQA 1H4GA 1QH6A 2RMU1 5AN9H 4GMP1 5FMOL 1YFWA 3PU8A 5K0UC 5KC5A 4WVMB 4YSFA 5L19A 5ABJB 4QPGC 2PPTA 1ULDA 3AP5A 1LOFC 2OQ7A 3A0NA 2ZGKA 4JQTA 3HQRA 5CNAA 2GH8A 2V3BB 3VZKA 4H55A 2G1MA 4XJZA 1F35A 1QMJA 1POV0 2CDPA 3RI8A 1AYM1 3Q9OA 1MS8A 2D6NA 4XMAA 2R071 3MIFA 4AVVA 1NX9A 4E8CA 1WLTA 5J1XA 5APAA 2DU0A 2WZPP 4HKWA 5ERLA 2Q1ZB 3M3IA 1RUC2 5FR3A 1GZCA 3X29B 1V0AA 4BJ0A 4CTEA 4CPBD 1JBCA 1DYKA 4AK3A 4ZXEA 1G9FA 1NYWA 3MQKB 3IB3A 2JIGA 3POIA 4YW5A 4GALA 3KGZA 1DG6A 3HNMA 3LWOB 5FY9A 1C1FA 4B4QA 4I2OA 4P02B 1DLLA 4D3WA 3TEYA 1W2UA 3QVDA 2RDVA 4WV8A 3I97A 1N47A 5JMOA 1QJX2 2A73B 5JPNB 5L7OA 3WF0A 2ZX4A 1GNYA 5JVG1 2JICA 2NVYL 4GQ7A 2ZGQA 4NWVA 1IHMA 1KJRA 5E6HA 3POWA 4A7KA 2YZ4A 1RUNA 1CESA 1R081 4HKOA 1HLCA 1LOGA 4QU1A 4Q4X1 1H2MA 2V4AA 4FPJA 3ZXGA 2VOXA 2O0OA 2XPJA 2K0GA 5E88A 1UKRA 3AMHA 4A3EL 2QBXA 1AR82 3IM0A 3K51A 2F4PA 3NQHA 4HSJA 4IL7A 4BQYA 4AHXA 4IEPA 2HWE3 2OPWA 2C5DA 2YGMA 2W52A 3ITQA 2JDPA 4AFDA 3WDVA 2VMEA 1VBC1 2GNBA 4CDUA 3AZXA 4XCAA 3CIHA 3AC0A 4HVOA 3PMEA 4BY7L 4UFMA 2W46A 2C26A 5T55A 4OCTA 3FX3A 2Y0IA 1X9PA 2GH2A 1DBNA 4S2FA 3UNPA 2XH6A 4K20A 1HQLA 1UNBA 3GJBA 4FPGA 5L7OC 3OGSA 2A71A 2BNNA 5ACA2 1IKPA 1CVNA 4CU8A 3MV01 3SCFA 3MGUA 5IJRA 2JA5L 3W59A 5FOJB 1B71A 3M70A 3PL5A 3U14A 2RDNA 3FJSA 1PVC3 2W68A 4HBNA 3WVJA 1NA1B 1DLCA 3RZZA 2NYYA 2HEVF 4A3ZA 4AEDA 1Q56A 3FLPA 4M01A 1HXS3 4UF0A 1EPZA 4GB33 1RYYA 1WCDJ 3USSA 1O5LA 3U1XA 4B8EA 4AI3A 1HB3A 1WMFA 3EHKA 5GZDA 4CDUC 4CCCA 1CADA 1CJDA 4MGYE 5B4NA 2EICA 4JKKA 4QPYA 2HEYF 1US2A 5LEKA 2WZEA 1JU3A 1URXA 1RUI1 1UOFA 5C71A 5A32A 1SPPB 1E57A 2WA3A 2XR4A 1UOJA 3P3NA 1D2SA 1MS9A 1VALA 2P34A 2NQYA 3I4IA 3OEAA 3K7AL 4Y1ZA 5LATA 4QGMA 2OYZA 3POYA 3PHMA 4UAPA 4CEYB 4DFSA 1JOJA 2NLRA 2R30A 1BK0A 3D82A 1S0CA 1S0DA 2QCSB 3CZJA 3CU7A 3OEBA 4QB6A 3FUOA 3OBZA 2AEYA 5C44L 4HL0A 3KB5A 2M6PA 4M0HA 4BQXA 4NRQA 3VHRA 2A7AA 4AEDC 5M3ML 3OYWA 1H7VA 4QX1A 2HYXA 4UBHA 2G9FA 4FPKA 2FCVA 4QD2A 1GOFA 2IFWA 3MO4A 4L9BA 1FXZA 1SPPA 1VE0A 3ACGA 2QTWB 3I2JA 3ROUA 1R1ZA 2B39A 3Q8EA 1FPN2 1IROA 1I3QL 2WFPA 2CGPA 5I93A 3UESA 2GMGA 4UFHA 4R9DA 1BHGA 1HRI2 1TMF3 3W5MA 1Y9GA 4FOVA 4ORFA 2DYCA 1LHUA 1QOOA 2QQKA 2Q8OA 2W87A 1UQXA 2RV9A 4JQRA 2DBNA 1JN2P 4RR3B 1WCSA 3ZM8A 2ADDA 5EJZB 4E2QA 1VBB3 1KJLA 3WP6A 3HOVL 3KF3A 4LMFA 3S7IA 1RC6A 1WLDA 4FP2A 2D44A 4LO6B 3S30A 1P7PA 4A3FL 1JXNA 1QJFA 2JG9A 3FHQA 3N9NA 1JZ5A 3DPRA 4XXAA 1DZTA 2VUML 4KWKA 5J37A 1W6MA 1GQGA 1Z0HA 2WZR1 1PGL1 4BU2A 3PKIA 4YW7A 5A7QA 1NZIA 4NIAA 1BFYA 2DURA 2R043 4LIVA 2J22A 2YY1A 3SEPA 4G4FA 2VULA 3OUIA 2UYBA 4C8DA 4L97A 4MGKE 3S14L 1ZBA1 5GLVA 2C24A 2WZ8A 2IC1A 3S57A 1DQ5A 1JYCA 1TME2 4YM0A 4HK9A 4Q4Y2 4IXLA 2PLV1 1OQEA 1A6CA 2P1BA 3SH4A 1RIRA 4Q0SA 2QJVA 4IE4A 3K4AA 1UU6A 3USUB 4JKLA 3J8F3 4LO5B 3S2DL 3URFA 3LZZA 3ZYHA 2WSVA 1IS4A 2V4VA 4FPYA 3FMGA 2QZ2A 4RHV3 4QPIA 4QB1A 4XFAA 1IOAA 5FQ0A 2JG9C 2W1WA 1JHJA 2X5IB 3DPRC 1W06A 2JKBA 3KYUA 5A70A 2HWF2 5D8AB 5IK7A 1NY72 2LALA 2DCZA 1BXHA 4Y20B 2ZMKA 1OD3A 2ARCA 5JXHA 1FMD2 1VCXA 2LS6A 3N7LA 5FDBA 1JS9A 1GNZA 1PFWA 5FRAA 1H1AA 3GTML 1AYN1 2VOKA 4XFIA 3AFGA 3USUA 2WUHA 3H3LA 4BK5A 2A6VA 4FI9A 4Q29A 1EV11 1OA2A 1Q3EA 3AL6A 4OUSA 1RB8G 3ZOIA 2X5IA 4F7ZA 4QDRA 1UZWA 3ELNA 3NNLA 1B35B 2DUPA 5CYYA 3RFRA 2M4YA 4C3JL 2C6AA 2FZ1A 4MV2A 4NPLA 4QM9A 3AKSA 1QJU2 3GTOL 2YC4A 1VZHA 2A6HD 1AF9A 1YIPA 2WO1A 3LIHA 4WM8B 3VL8A 4BWOA 1O91A 2HYKA 5BXXA 1PO22 1TZOA 1WCQA 2IUWA 3I4NL 2WO3A 3AL5A 4FFGA 3ZLIA 2E7AA 4AL9A 1RUJ1 3QH6A 2O1QA 4KWLA 4ZONA 1UYYA 1AR62 2Y6FA 3IWZA 1PO12 1S0EA 1Q8SA 3MIDA 3B08B 4LBLA 1VBD2 2BOJA 4U671 5MGNA 3JQWA 4IV1B 3KV9A 3PVEA 1B35A 1R1A3 3VBOB 4QKFA 3GJAA 4ATEA 4L0PA 4AQTA 2BFUS 1GP6A 5LK7B 1VBE3 4WM8A 2CHHA 5I0DA 5A6YA 5I0RA 2RS33 3FFZA 1OA4A 5FFOC 5LZ6A 3E5UA 4XPVA 3SXWA 4CDXB 3AYAA 2X5IC 2WABA 3IPVB 4BY1L 3ACFA 3VBFA 4CU7A 2A6XA 4XILA 1YXWA 2R0HA 1TWGL 3AZWA 3L2YA 3I2GA 4ZU7A 1OQDA 3RJRA 1GZWA 5IYBL 1UXXX 5GZFA 4D6RA 3J4UH 3NJVA 1N1SA 5IW0A 1NXD1 1UWWA 3EMRA 4Q8LA 3ETPA 4XBLA 5A7WA 3ZVXA 3AYEA 4EN0A 5H9SA 5C7GA 2OXBA 3WHTA 1GZTA 2CU5A 4DS0A 2BU9A 1G9CA 2QQWA 2PN5A 1DYPA 4XACA 3ZDSA 5J98B 4NIIA 5FYVA 2ILMA 4A93L 4OI0A 3MSUA 2D6OX 1B35C 3OB8A 1G7YA 4YW2A 3V65A 4YARA 1HRV3 3WNNA 1U0AA 4EV0A 1QXJA 1WD4A 2DFBA 2ET1A 5CIRA 4Q1RA 4DZGA 2MEV2 3WQ1A 4WM8C 3C7FA 5CADA 2EAKA 3N7JA 1O59A 4BISA 4AI0A 4XFHA 2H0BA 4M4RA 5F39A 5IK8A 1QNWA 4X6RB 3VBFC 5IVVA 2FDKA 3WG1A 5FZ1A 4B4RA 4MHRA 1COV2 3MF9A 4ZS3A 4EN9B 4EZ4A 2RM21 2FBEA 3DXTA 5A1FA 2GZWA 5FZDA 2Z3QB 2ZKLA 2ID4A 1V70A 3J7MA 4FO9A 4XABA 4Q8KA 3S1RL 1VB4A 2CGOA 3QBQA 4K8RB 5C3RA 3RG0A 4N53A 1OT5A 4QQOA 3SLIA 1LHOA 3BYWA 1FOD1 3OCPA 5C3EL 1CPNA 1PGW2 2VXRA 1NG0A 1RHI1 3IIAA 4GKXA 4META 2IXIA 1UL9A 1J84A 1GYKA 1QDCA 3LSEA 5FZ6A 1V9U2 4SBVA 2ZX2A 3A44A 3H42B 3OG2A 4CCEA 2VU9A 4Y33A 4AI9A 4G6BA 1OFNA 4HN0A 3JD73 4QGLA 3SQOA 5JWPA 3B9CA 5C6CA 4NJ4A 3H8OA 3E5XA 4YGCA 4PIZA 2QQNA 5HXMA 2HWC3 3N3HA 3MF6A 1Z7S2 2WAQP 1QJY2 2JX9A 3H8RA 1XE0A 1MS5A 1UMHA 5JZGA 2RS52 4CDQB 3VL9A 2GDFA 5FP3A 3ZFGA 1NAEA 3GTLL 4FFIA 4E4DX 1YK4A 3SS2A 2WFF2 1W28A 1ENSA 2GC1A 5C5TA 2XLAA 4IV3B 4Z8BA 3N36A 2RR12 1POV3 4N53C 4HG6B 3S1NL 3LEIA 5EINC 2P6HA 2A6YA 1S0BA 5IFPA 4KBBA 5AC92 1UN1A 3POSA 1RUG1 4H7MA 3WF3A 2FMYA 2VZPA 4LUKA 2B46X 1NXGA 3O1SA 3LEMA 4FPLA 1O3RA 2ZMLA 3WNLA 2DUOA 1ULFA 2WNUA 2XWJB 3I3EA 3VDDA 3VKNA 1UYPA 2SBAA 4Y3OA 1Z92B 3OF1A 1SFYA 4TLFA 2RG4A 1PHMA 1ZRPA 3GHNA 4RFT0 4YG6A 1ASJ1 2I74A 1ZZ8A 2VZUA 3WD5A 4Q5OA 3THTA 1NOVA 3ZN5A 4HKLA 4P9LA 5JZGC 4B7KA 3LWCA 4PBPA 1U5ZA 3POBA 5KWRA 3PU3A 3I2HA 3SC7X 3ZFGC 2A3WA 3RZOL 1IS3A 2JDKA 4MXVA 2BOIA 4G3YC 4KG8A 1GSLA 2VNGA 4K1ZA 4L2NA 1W6QA 1JYTA 5FJ8L 1YFUA 1VZGA 1WZXA 2EXJA 2GMEA 2VOWA 3NL1A 3GZUC 1JYVA 4UY81 1NT0A 5F5AA 5MFZA 3A7QA 2ENRA 1QQP1 3LPEB 1SLTA 4JAAA 1DCSA 3M2MA 3LPGA 4XJUA 1RJ7A 2R7ZL 2XKOA 2YBPA 2JDAA 3NJXA 3E6BA 1AR91 4LOSA 5JR2A 4CCOA 2YV8A 3NNFA 1BEV1 1XC6A 2WNUC 3VDDC 2Y6GA 2XQRA 3MPPG 5E16A 1BQ9A 1ZBE1 2W5FA 4FP3A 1VPHA 1W6OA 2B9UA 4K8FA 1AR83 2YPJA 4PBOA 3D8CA 2Z2SB 3RZHA 1VRH2 4K6BA 5FBJA 1EAH1 2DCJA 3NKTA 4RGAA 4CU6A 5CZKA 1TWHL 3KT7A 2RJ2A 2DTWA 4JAFA 5F2SA 4FSJA 1UU4A 1DQ0A 2BEOA 3B01A 4M00A 1N3OA 1LKMA 2XVKA 5F6KA 5JOYA 2DCYA 3PUSA 3B00A 2F4LA 5FZLA 2V0FA 1AR73 5D2AA 1YQ5A 2AGSA 2YBKA 2GMPA 1WBFA 1L7RA 3LD8A 2C4XA 1EYBA 4H7LA 1SEFA 3N9MA 4W6WA 5KHHA 3ZSMA 2XJRA 5FPAA 1KDMA 4UI9L 1Z78A 1R0JA 3S0MA 4GWMA 2RMU2 4M3CB 2NP0A 3K4ZA 4QX2A 1YI9A 1PFUA 4AYUA 2PFWA 4AZZA 3UETA 4A3LL 2PQSA 4QX7A 2NVTL 4B3NA 3BN6A 3O1UA 4OZOA 1J3PA 5AFBA 4QXCA 1GQHA 1GV9A 3SH3A 3AZZA 2RDRA 4L99A 1W99A 4FTEA 5CFCB 1AYM2 5DDJ3 5JIAA 2R072 4HK8A 2VCBA 1RUE1 4YG3A 3T2PA 1YQ8A 4COUA 4HXCA 1NKGA 5FAXA 1G9DA 1QCVA 4NVPA 5FMOS 3VBSB 3HT1A 4M3CA 1REFA 4FOQA 4E27A 1WMXA 3TN91 1AXYA 3VBHA 1S24A 2AUSB 4EWDA 5KHJA 4J1XA 4PDWA 1AL0G 1F4AA 2TEPA 2ZHMA 1JZ6A 4IE6A 3CQZL 1DVBA 3E6DA 4XBQA 2V5YA 2DTYA 2WNVB 3HT2A 5B2GB 5CFCA 1EUTA 1CAVB 1R091 4XUPA 4AAPA 1UO9A 1T2XA 3MICA 3OBRA 1X36A 1R0IA 1MZEA 2R6QA 5LY2A 3S7EA 3TRSB 3S5AA 1W9TA 3VBSA 4XAEA 1IPKA 2P3JA 1R082 3GTQL 2QDRA 4YLZA 2LROA 3ZYBA 1TWCL 1G9AA 4Q4X2 2OX0A 4S2GA 1QXPA 3JZVA 4QMAA 1QIQA 3LWVB 5FLML 4JVAA 5DUUA 2XXZA 2LRPA 4YGEA 1IW7D 3S6PA 2ZGMA 3JB8A 2IVIB 2VC9A 3CEWA 2D98A 4I0BA 2D93A 2E31A 3M7AA 3OY8B 2DWRA 1JUIA 5GALA 3FHAA 4DY3A 1VBC2 2NN8A 4Y26A 1HRI3 4EQVA 1W90A 3AZYA 2EA7A 3GHMA 3VBHC 4ZU5A 2Q5TA 4PDWC 3ZN4A 2VQUA 1Q5OA 1UKGA 2JKXA 4Z1VA 1XB9A 5DXDA 1CZSA 2C9AA 4QX0A 1RUOA 2P3YA 2PA7A 2ZHLA 1AX2A 3NKGA 3QLQA 5FP8A 4B29A 3TNQA 5CFCC 3PMSA 5HBAA 1OURA 4KMQA 3PUAA 3MIEA 4XEZA 2YC2A 1QWRA 3WY6A 5HV0A 3VBSC 5DUXA 2E51A 2YHJA 3HEIA 4FTSA 2E2JL 1RL3A 3IU3I 1LOAA 5GJ6A 5A6QA 5SV8A 5HCAA 2NZ9A 5FZIA 1CAAA 2JI2A 3OPZA 1W8UA 1PX4A 4TYSA 1HN1A 3WX5A 5FZ7A 1D2QA 3ZSJA 4ATFA 5GAEc 5GLTA 2YYOA 3LA3A 5FPVA 8RXNA 3KCYA 1YCIA 2W95A 2VQAA 3AK0A 2FHRA 4Y1UA 4O7XA 1PK6A 1HQWA 1E5IA 1SLCA 4OYUA 2QQJA 3L2HA 2K2DA 4DEQA 2O5JD 5C8WA 1AXKA 2VW2A 4NHKA 1LU2A 5IYYA 1RUI2 2J1AA 5FYSA 5HCHA 1I6HL 4MXWB 4XFCA 2CKAA 4KQ7A 3ZPYA 3M8LA 5E89A 1DGRN 1PGSA 4E2GA 2PYTA 1AX1A 1RGSA 5EIOC 1X8MA 1YFXA 1OVSA 4XCBA 4AVAA 2ZZJA 2ZEXA 4UYBA 3TB0A 2YFZA 4BE3A 2VBDA 1XU2A 2ERFA 3AVSA 4HETA 1UY3A 1W9WA 2D40A 2XLFA 2R16A 4S2HA 5FMBA 2JENA 4TSVA 3WNPA 1S30A 3MIHA 4YG0A 3B02A 3HJYB 3DYOA 3ACIA 3WP3A 4Q0QA 4QXBA 1MZFA 3TOJA 1C8M1 1PK6C 1V6OA 3FN9A 3FLTA 2XWBB 1DQ4A 4OZXA 1SG3A 3HOBA 4YW3A 2HKXA 2B45X 3H50A 3H99A 5FK7A 1B13A 1DYOA 5JMCA 3A4UA 3LOBA 2R92L 1C5IA 1YQ2A 3UKNA 4IEVA 5JUVA 1S2EA 3LFMA 1IZ3A 1PO23 1RXGA 1XSQA 2QDNA 5IP9L 3GTPL 2V5DA 3AP7A 1PVC1 4JTOA 5LB6A 1R0FA 1K3IA 3HPNA 2FDFA 2BW8A 3MZHA 4E2SA 2X8KA 1AR63 4PI0A 4OHYA 2I45A 5JSRA 1HXS1 1PO13 4P9JA 1IQAA 3H7JA 1ZRFA 2WZR2 3PO3L 5E8AA 1PGL2 4IQPA 4XTPA 5I8TA 2XONA 5F5IA 1LOFA 4DB5A 2XUEA 1N1VA 2ZGTA 3KGLA 3QOPA 2B4KA 4BCUA 1W8FA 3AZVA 2JWPA 3KSCA 3DKQA 3PL0A 3VB9A 5CBLA 1K12A 4A3CL 4HANA 1XRUA 4MADA 7RXNA 3WV6A 3HQXA 3ZSKA 1ZBA2 3QD6A 1MR5A 4LK6A 1G8WA 2CL2A 4L11A 4NAMA 1KRIA 5FYUA 1W9SA 1G6NA 5T5JA 3MFCA 4AVCA 2XBO1 2PLV2 3BTXA 1LB2A 4LNVA 1OUSA 4ZS2A 1NCRB 4B1MA 5IK5A 4XFGA 2APOB 3RS6A 2VTFA 5DAQA 2JD4A 3MLJA 3IAQA 3O1OA 5J36A 2WKKA 4JADA 1QU0A 2GC2A 4Y5SA 1OHFA 1VBA3 2Q30A 3RZTA 1SACA 5T50A 4N9HA 5CAZA 5F3GA 1WCUA 4LTAA 1CAUB 2VZOA 2VMIA 1CJPA 2ZBJA 1D0GA 3DKWA 1JZ2A 2A6ED 5KHKA 3LQCA 2MEV3 1AYN2 1LODA 2C6SA 4QKDA 1TMF1 1T9QA 5BNOB 3I49A 3OD4A 3CHXA 2ERJA 3GF6A 4LKSA 1W3XA 2XL9A 4IW3A 5M3FL 1Q8PA 1RXFA 3C7OA 1GQPA 5M5YL 3D4KA 4HN1A 4MSVA 4WZFA 1OSGA 3VZLA 2JI1A 2XL7A 3MBWA 2Z3RB 4AOCA 3J7Y1 1N3QA 4ZPIA 2CWSA 4BQWA 3T0DA 2ZZQA 4WVMA 1KD7A 2WAAA 2XJUA 2J1VA 1LKPA 4GWJA 4BIOA 5ABJA 1SLIA 4XXBB 1XBFA 3R4DB 4BQ3A 4LBNA 3THPA 1Y7BA 1WJVA 3NNGA 1ND3B 3ECQA 4XIOA 4OQ9A 1LEMA 3N9QA 3OJBA 3IMMA 3P1IA 4QWNA 1W03A 4DPNA 2RFKB 1FNYA 1RUJ2 4URAA 4LBQB 3ZXDA 3O0WA 4GXLA 5DZEA 4W8JA 1NXEA 1SFNA 5FZOB 1UPSA 2C1FA 1H2NA 3C3VA 1H2KA 1V9U3 2KR2A 2R041 4NHYA 5DAVA 4FAHA 2KD7A 3MIBA 3PJQA 1LHNA 5BV6A 4HT1T 4C1WA 2B8MA 2JIJA 3EQEA 4WVWA 5FYTA 4NAOA 4PQQA 2YMZA 3AKRA 4CU9A 1S2KA 1OBNA 3DN7A 4QKNA 2FDJA 2KXLA 3OPWA 4LE3A 1V6NA 2MNGA 1P8JA 2Y0OA 1TG7A 3EJKA 4MLOA 1HW5A 4Q0UA 5FO7B 1Z7S3 2IZWA 1QJY3 5F1RA 1CX1A 4Y5Z0 1HJGA 1LENA 1DGWX 2RE9A 3AX4A 3Q8AA 4DQAA 3MPSA 1GR3A 3AJZA 3NJYA 3T0AA 1FYUA 1SBFA 1BQ8A 1JTZX 2WFF3 3J8F1 5ABJC 1Y43B 3E1F1 2WT2A 5DAWA 5LBEA 2D6MA 4RHV1 2NYDA 2E9QA 5FMCA 1QHDA 3B3QE 1APNA 3PJYA 2PHUA 4AHZA 4AR5A 1OVPA 4JDMA 5F6LB 3HQUA 3W20A 5AC93 3KQRA 2W47A 1MZ6A 2XLGA 4H2AA 3VUOA 4R9AA 4X8PA 1VR3A 1KS4A 3O1VA 3AP9A 1RUD3 1POQA 2X05A 1GU3A 3ON7A 3S16L 1HQNA 1JYWA 1JYBA 3PKJA 1RUH1 4O9EA 2B5ID 4NN0A 3H9BA 5IY0A 2DCTA 2V0EA 3PIJA 2M4VA 4I30A 3WHUA 4EN6B 1UPIA 1WLWA 3ZMNA 1G9BA 2WN3A 4KH9A 3UKVA 2JDYA 3MLKA 3VBRB 4OHXA 2H6BA 4HLTA 4FQ4A 5ANNA 2PTMA 2R0FA 2ZX1A 4UW4A 2P5BA 2GC3A 3VZNA 4HZFA 4RXNA 4XBNA 2ZIXA 3WZ1A 1V6KA 1SHWB 3CO2A 3DUIA 1UW8A 4PCRA 1JYNA 2RM22 4XETA 4BLIA 2TNFA 4WVVA 1MEC1 1PMIA 2ZGSA 3B93A 4A3XA 4CP1A 5FXWA 1O4ZA 1KFXL 1NA1A 2DCKA 2CTVA 1F5JA 3MFAA 2D3RA 1FOD2 4YW4A 4BLJA 4C0BA 5I8YA 5LA9A 1X33A 1RHI2 4BQ5A 2VM9A 2KKDA 3PTYA 3WUCA 3ZFFB 2WLQA 4WM7B 5BNPB 1R1A1 2IWGB 3H3ZA 1A8MA 3PDQA 3HVDA 5FUIA 2E2IL 1XE8A 3VZOA 2JA8L 5JCTA 1J3QA 5CKQA 3KHCA 4COYA 2RS31 1TWAL 4EE2A 4GJZA 2ZGRA 4ET7A 1VRH3 1BJQA 4GULA 3U78A 2WT0A 3WF2A 5FYZA 3NV3A 3N7MA 2ZHKA 4KU7A 5FPLA 4ZY9A 5I0UA 4WM7A 5BNPA 3H9AA 1W05A 4CEYA 1RVF3 4JV4A 3EBRA 1OQ1A 2HWB3 5IK4A 2HEWF 1LR5A 5AI2A 2Q4SA 1GFF2 4UFJA 4Y22A 1Y9QA 4XDPA 2BWAA 3T2QA 1NA1C 3HOYL 3R4UA 1E5RA 5IWFA 2E33A 5T3NA 3T2OA 1K5JA 4W6XA 3ZIWA 4A3JL 4AWDA 5IYDL 4ITCA 5FZHA 3KYXA 1VMJA 1S0IA 1RUG2 2R061 3O5SA 3T30A 3ZN6B 4NROA 5T5LA 4XGHA 2MS3A 5H9PA 4D6SA 4LKFA 5DAXA 3VKFC 2R7EB 2XMLA 2D3PA 3T1LA 1YIFA 2VCCA 3LEGA 4J6GA 4A6OA 2FQPA 4U36A 1XOYA 5ANQA 5GKAC 1VAKA 2VQ0A 2DVFA 3CQOA 4QQLA 1AYM3 4GH4B 3UJQA 3VGIA 1F8VA 2PHXA 1ASJ2 5FLIA 1W8OA 5EIYB 3I8TA 3V64A 5JPMB 4YW1A 1EP0A 4YGDA 2EIDA 4RR3A 3D6EA 4E6YA 4Y22B 2VOTA 2ZA9A 5F5CA 1O8PA 3J26N 4TXWA 5FYMA 5JXIA 3VDCA 2XKPA 3VZMA 4WM7C 3RWKX 1XNBA 5BNPC 4CEYC 2Y6HA 3UJOA 1VZIA 1GP5A 1FHMA 2D97A 2OZJA 1W8TA 4JHZA 4P9YA 1SDWA 5FK8A 3V0BB 2J7MA 3ENRA 1HKDA 5LBCA 3MEPA 2QFEA 3CZUA 1QJZA 4FOWA 4ZN1B 1NUKA 1XE7A 1XYNA 4GH4A 4QDSA 3RYGA 5FYYA 4H3WA 1QQP2 3KLSA 4FPHA 4NUBA 2ZEYA 3VN4A 3LWQB 4NOTA 2HBUA 3U07A 1PM4A 2WC2A 4EJRA 2HWD1 1QGLA 4H14A 4JGZB 3BIWE 1AR92 1Y1VL 2DDUA 5GLWA 1R083 2Y8KA 5AFEA 4LLFA 2ZCWA 4Q4X3 1BEV2 1LGNA 5FYCA 5JIUA 3N4MA 2D5HA 2DVAA 1F9KA 1ZBE2 5IVEA 4V2VA 3V0BA 4AHYA 2RDQA 3BIEA 2C9KA 3S17L 2XB6C 3LEKA 3POJA 4IE5A 5EV7A 2JG8B 1Y3TA 2GSYA 4RR3C 1EAH2 4CUBA 3KYVA 1GICA 3WNKA 4HVQA 2VVFA 1HV0A 3I59B 5EPAA 1FX5A 4P9IA 5AVAA 2Q0AA 3O12A 3F2ZA 1X7NA 1CPMA 4JGZA 3LSDA 1OD5A 1O4YA 4EWAA 2RS11 3B69A 4ASKA 3PUIA 3O14A 4LR4A 1GBGA 5FKCA 3ZKYA 5D8AA 1YFYA 4IEWA 4Y20A 4KG0A 3W9AA 5EJ3A 4OQ8A 4GH4C 4Q27A 4QHBA 3T3YA 1DQ1A 5FZ9A 1UF2C 1LOEA 4MH0E 2VH9A 1J1TA 4MYEA 1YI7A 4JDNA 4B1LA 5BY5A 5IT6A 5HCBA 3PO2L 4IESA 3U4SA 3AKQA 2W1QA 4PLNA 1IU6A 4P9WA 2ZGPA 2RJLA 2WR9A 1OUXA 4Z92B 1J1LA 4XW3A 4XZPA 1LRHA 1WWYA 1ZZ9A 1RUE2 3DECA 3O0VA 4PF5A 5LK5A 3BTYA 2JA7L 2VUCA 2RVAA 3KV6A 5HPOA 1WW7A 1O4TA 5F5QA 3WW4A 1QDOA 4JGZC 3TN92 3RSJA 1DF0A 5FPBA 3ILNA 4BOWA 4QHOA 2JB8A 2FZ2A 1W2TA 1W8WA 4WVZA 5D8AC 2VMCA 3HOUL 3N35A 4ES9A 1OLRA 1STMA 1UD1A 4IV1A 4GIQA 1XU1A 3I2DA 4IEQA 4AI2A 3VBOA 1R092 1Y4WA 5FZGA 4IGQA 2PELA 4MUVA 4OHVA 4DINB 5JXGA 4I0AA 3T2TA 2Z79A 5EFUA 4Z2WA 4YM1A 1TVGA 2UY9A 4GS7D 1BVP1 3DEMA 3OTFA 4AEJA 2R32A 2Y33A 4E4HA 3I7DA 4OI4A 4CDXA 5IVYA 4CEWB 2WSUA 3IPVA 5FXZA 2PHWA 1H2LA 4RQPB 3S1QL 2WB1P 5T54A 3ZIXA 1J59A 5IVJA 1JOPA 1BBT1 2WL1A 1PX3A 4CCMA 1OOPB 1ULPA 2E26A 3OGGA 5CEHA 1AL21 1W6PB 3SKVA 2YU2A 1RDVA 1AR71 3GBGA 4A6SA 1SMVA 1L3JA 3A0KA 1RYTA 5F8PA 1OLME 4MX3A 2D6LX 3RZMA 2V72A 2BGCA 4BZ4A 4LHKA 2Q8CA 1BMV1 3KV4A 1PIV1 4IV1C 4PF1A 1PMJX 4QU2A 1XPWA 1BRFA 5DZFA 1HV1A 3ES1A 4S2DA 4CXYA 2A75A 3VBOC 1N3PA 1ODHA 2Z4FA 1IRNA 3LCPA 1OXCA 5DMYA 1ACCA 1PVXA 1U5XA 5LY1A 3CF6E 3RNSA 4FXGB 2FD8A 4R9BA 4NRMA 3BPSA 1O3QA 4BXXL 1VIWB 1WUVA 4R4ZA 5DDJ1 4CDXC 4XDOA 2WZR3 2BPA2 3ZYIB 4Y4YA 1RUF1 1YRZA 4I01A 5EHDA 1C8NA 1UZVA 3IDEA 3RYRA 2VE1A 5K4LA 3VV1A 4JGYB 1BLZA 1CIWA 1I50L 5FLJA 1OF4A 2ZEWA 2D6KA 1LTLA 4D8MA 3AP4A 1W9FA 3MW2A 3JB4C 4R4XA 4OMCA 3R6SA 1YQCA 4Y1VA 4XQDA 2PLV3 3JBG1 3LA2A 3RDIA 2VG9A 5H1Sc 1YJKA 3CL1A 3S2HL 4G9SB 5IAVA 1UY2A 3MYXA 4XTMA 5K9YA 4LKEA 2BERA 2UWCA 1I9RA 3KYYA 5DABA 4TPUA 1ZZ6A 3BU7A 2DFCA 2VUJA 4Z82A 3T1MA 3MDPA 4KBZA 1D4M3 3DV8A 2EIGA 4Q4V3 3WDUA 1I1EA 3HOWL 3D0SA 1GNHA 5GLZA 2ZPXA 4K9FA 2B63L 2Y6JA 2OPKA 4UFIA 2R93L 2VJXA 4JKMA 2AACA 1XNAA 3DYPA 4GZ9A 4CDQA 5FREA 4MO3M 5FZEA 4ZZ5A 4Q4W1 5FTTC 3Q8CA 4R9CA 4FPCA 2B42B 5CFDB 1AYN3 1VJ2A 1S0FA 2R1BA 4LQRA 3I3BA 2ARXA 3I54A 1W8ZA 4IV3A 2EY4E 4K3UA 4QKBA 4LBOA 4AEKA 4EYUA 2Z42A 2OKXA 5C4XL 1UY4A 1F31A 1C8M2 2ZMNA 3FKIL 2YGLA 2ZEZA 1R9TL 1W0NA 4X6AL 1RUC3 4A42A 1SLLA 2YROA 4LJHA 4TWTA 4AYBP 5E1RA 4AGVA 4XF3A 3VPBE 1TE1B 3W5NA 2XJPA 1XNDA 1JYIA 3ZR6A 4CSWA 4PHZA 4OFGA 1UOGA 2W91A 2WS91 1YLLA 3AFKA 5C4WB 3WWNB 3NNJA 4DXTA 2E7QA 5FY0A 2XDVA 1QJX3 4B7EA 3PZAA 1PVC2 1YUDA 1RUJ3 4LKDA 4Y1XA 3GNEA 4LOTA 3O1RA 3WNOA 3H0GL 1K5MB 1NQDA 4RN5A 1HXS2 2XJVA 1KS5A 2WO7A 4CDQC 4KGQA 4NMIA 1RMU1 1MS0A 5DM61 3RI9A 1Y1WL 2WDBA 4JC1A 3MLLA 1TQ5A 1CONA 1QOSA 1WW6A 1W04A 2VCMA 4LEJA 3ASIA 1S2ZA 4NHLA 4XUOA 4N7UA 3ZXLA 4IV3C 3G6JB 1NQJA 6RXNA 1YO8A 1FNZA 2JDHA 2LUWA 4MGSA 5FCCA 4PJYA 5FY1A 2ZKNA 3ZXEA 4PT6A 4JAEA 1K5MA 3DXUA 4OMDA 1PNGA 2XBO2 3R4SA 3T08A 3H1WA 2JXAA 4LBMA 4RSUA 5IHRA 3VKOA 1T6GC 5JI7A 2D6PA 4Q2FA 2VUDA 1KXGA 2GAUA 1RTVA 2JB4A 2TBVA 1X9TA 3C7GA 1OWBA 4N43B 4LORA 1OFSA 4CUGA 2VMHA 4AR4A 1PFVA 2XHKA 5ACA3 5J3UA 2QL0A 4YPJA 4NIHA 4NHXA 1DP0A 1C57A 4B8CD 1CX4A 1JW6A 2XVGA 5BNNB 3PUQA 3PWFA 5JVH1 1S1AA 4NIDA 4V196 1W2AX 3UYJA 3GDBA 2UWBA 5FYBA 4MOAA 1XSRA 2EAAA 3GBFA 2QQOA 4LPLA 1WD3A 1TMF2 2BUKA 3LPFA 1HJFA 4FQZA 2W9XA 4ZN3B 1CIYA 1DGLA 1W6NB 4A3DL 2AZ5A 2IFRA 2VVDA 4AFCA 4GMP0 4BQ2A 3O1MA 4AEMA 1K5MC 4OULA 3DGTA 2B7YA 5FOBB 3WINE 5FPZA 5AVPA 2RM23 4YNIA 3HNYM 3QQCE 2Y34A 1SFOL 4LIUA 2O8QA 3ST7A 1VRBA 2Y6KA 1UOBA 4INDA 3RZJA 1B09A 1C3HA 1W2NA 2Q1FA 4A41A 2ET7A 1GMMA 3CMGA 3MHZA 4NPRA 4CCKA 4CRQA 1RHI3 5FZ3A 3ZXJA 4P5HA 2V09A 1LNSA 1XNKA 3MIGA 3N9LA 1PZ8A 2GMMA 4CP0A 5A33B 2R042 4QIWP 1YK5A 2L0ZA 1V6LA 2ZX3A 4NPMA 3RGBA 4CUAA 3FE5A 4M4PA 4DXSA 3LFIA 1DU3D 1NCQB 5DQ0A 1QYBA 1H8TB 2WQ8A 3AJYA 5FP9A 4BMBA 1OPOA 3WG2A 5FY7A 3S15L 3RZKA 5FY4A 2WIIB 4AFAA 2HH9A 5IVBA 3LKJA 3HAGA 5FLHA 4DXRA 3GCXA 2WNVA 5C3SA 2D43A 1FPN3 1CAVA 3VD9A 4NR1A 5FUNA 3SH5A 3LF7A 3B9IA 1OC1A 5F37A 2UYAA 4JRLA 3S1ML 1QKQA 2OW4A 3FLRA 3J8F2 1LHVA 3WG3A 5F32A 4M3CF 4CDWB 2NPIA 1LOCA 4K40A 4RHV2 3V56A 1VBA1 4EZHA 2OT7A 2X10A 1IG0A 4IERA 4ZKTB 5FMDA 4POGA 4W50A 2VZ3A 4NO4A 4PLOA 3HKZP 3QH7A 5JOXA 1RUG3 3BPZA 2VAUA 3PIGA 4XF0A 1NE4A 5DPNA 3VHOA 1CGPA 3OY8A 2E63A 3G7DA 4WFN1 4XJAA 4AW7A 1VMFA 2Y26A 2ZGOA 1V6JA 3MW4A 4NE9A 1RUH2 3LNLA 5JOZA 2EXHA 2PAEA 3I2IA 2J9UB 1OMIA 3KWVA 3OBTA 3O1PA 3VBUB 1VP6A 2BVBA 2CAUA 1ASJ3 2R49A 3K2OA 2C6BA 1MQTB 4W6YA 4D7YA 3MV11 3PLQA 3P6BA 2WNVC 3P5BA 1EY2A 5FZCA 3EO6A 1E5SA 4UT5A 4XDQA 3JR7A 3D0JA 1C4RA 1O3TA 3J7LA 2XQXA 5IUQA 3O0XA 4C90A 4COWA 3MPBA 1VLNA 1TME3 3H9CA 1ODMA 1U5IA 2IXHA 4Q4Y3 3MI8A 1MEC2 4CP9B 4MZUA 4N90A 3ZYJB 1QH7A 4W4ZA 2JE9A 2PMWB 3BCWA 2ATFA 4Z07A 1LECA 1MQTA 1QQP3 2WAOA 3ATGA 3WQ0A 4YM3A 2VGDA 5C8CB 4FXKB 4BM8A 4OI2A 4ASMB 1WA6X 2XGXA 3AXEA 4COVA 3E6CC 2WYFA 1R1A2 1AR93 1WCKA 3AYDA 1V6IA 3KCXA 1F4HA 3V0AB 1PZ9A 3SITA 2HWF3 2P4EA 2YFUA 3WNXA 1UYZA 5F7UA 5FZ4A 1QEXA 4C2M1 1X50A 2IXKA 2GN3A 4F8AA 3HN1A 2RS32 1AHSA 1FMD3 2GN7A 5C3OA 4YVWB 2HWE1 3PVBB 2WO2A 3N9OA 1K45A 1EAH3 2FMDA 2WA4A 2G9GA 3I3DA 3IBMA 4N8MA 3BI3A 1RB9A 5A3OA 4MXWA 1MS1A 5C8CA 2DU1A 2PHTA 5KC6A 4BHPA 2P3KA 3RMYA 2RDSA 2VZTA 3LE0A 4TTGA 3GBWA 5JOWA 2BP6A 4E8DA 1HIXA 2BGOA 2E32A 5JI9A 1FI2A 5I0TA 3GTJL 2VW1A 1QJU3 4C3IL 5GADc 3HNBM 4BA6A 3WQBA 4BQ4A 1MQTC 1AXZA 1D7PM 1RUD1 1S0JA 4ZZ8A 1KQRA 3Q8BA 2R062 1O7FA 4CE8A 5GAGc 4JX0A 1FV2A 4XUTA 4QT6A 1AUYA 5K2ME 4I3PA 3OSDA 3DYMA 4V2WA 3Q8FA 4ES8A 5KXEA 1VBD3 5J7MA 4GB31 5K0UB 1AJOA 1AX0A 2PMZP 1UYXA 1H30A 1RUE3 4LO4B 4QPGB 4RL7A 5FP4A 4ISQA 4B4PA 2QNKA 5IFTA 2VL4A 5LRRA 4AVTA 5C8CC 1A34A 4XF9A 3M3OA 3TN93 4YRDA 4IEXA 1DHKB 3ZKUA 3ZSLA 2H12A 4TZDA 2Y0SP 3TEWA 1U12A 3LB9A 4QPWA 2KN9A 3WF1A 5FO9B 3AMMA 3I2KA 4WZCA 3JUUA 4GAZA 1R093 4L8QA 2JE8A 3WLUA 4P00B 2ERSA 3THDA 2DBIA 2VNRA 4KL1A 1CAXB 2WNEA 4HFSA 3ACHA 2B9VA 2HWD2 3ME2A 3RQ0A 2VUAA 1BE7A 3H97A 2X53S 5FP7A 1YYNA 2D7FA 1V6MA 4ONUA 1VRH1 5M5WL 3S5QA 2ZXQA 4LUMA 5L73A 5KR7A 2NVXL 3WDYA 1SQ4A 3R05A 1TEIA 1GANA 1NCRA 3GZEA 1DX8A 1YQ6A 3LWRB 2QZ3A 3HN3A 4C1XA 3K35A 1JI6A 1SLAA 3FL7A 5D1IA 3POGA 1O8SA 5A3TA 1RVF1 2WNOA 5EQUA 1LOBA 2HWB1 2CAVA 1EV12 5J09A 1QOTA 3HAXC 1FATA 4U2AA 4MGIE 1CD3G 3GZTB 3ZMOA 4AI8A 2VR4A 4YWAA 4BMEA 2GNTA 2RS12 4QGNA 1COV3 1O5UA 1UX6A 3HWJA 3NMBA 5DG2A 2AQCA 1VBB1 5A7NA 3VKMA 3WDTA 5KHIA 3I2OA 3RWNA 3NRUA 4C91A 1CAUA 4Y5TA 2VZSA 4J1WA 4AE2A 4XF1A 3VZJA 5GZCA 4YWMA 5A7PA 4A44A 2L9LA 1REEA 1ZVFA 1LKNA 1S2BA 2E53A 3SKJE 4CYDA 2N7GA 2ARBA 5BNOA 2LTNA 2VO5A 4PIXA 3B5LB 3AM2A 5M0TA 2PSMC 5L7OB 2JE7A 2ZHNA 2CKCA 2WQ4A 4AQ2A 2P6CA 1PZXA 3INAA 4TLGA 3WT3A 5CKNA 1PFYA 3RZDL 2BNOA 2P3IA 2YC0A 3BALA 1ENQA 1RWDA 1NCRC 1UU5A 3OD0A 2DUQA 1AJKA 5IYCL 5GAHc 1ZYBA 2Z69A 4P14A 4BK4A 3M3CA 3GTGL 3OGVA 3VD5A 5JLVA 2W92A 1ND3A 1LHWA 1S0GA 5GM0A 3U11A 2G9ZA 3A22A 4QXHA 5T5PA 2PHLA 2RS53 2WT1A 3I2FA 3IT8A 2BWCA 5HXVA 5BPXA 4LBQA 4OUMA 5FZOA 3VD3A 4FCAA 1X82A 1J58A 4XURA 4AR2A 1LKOA 1DGWA 1SBDA 2FCTA 2OIIA 3JU9A 4CDUB 5A7SA 3PTRB 1A3KA 2XVLA 3KYWA 2RR13 3IIIA 1QNYA 2WLPA 3KT4A 2W08A 4GWNA 5BNOC 2BDRA 4FFFA 5ISLA 1SMUA 2M6OA 4R52A 4UBGA 4I3GA 5DUWA 3DL3A 3DCQA 4GJYA 4XE9A 1SCRA 4BBRL 3BVCA 3IMNA 1DGRA 2VECA 4GA9A 4XHXA 1ULOA 1U5YA 1K83L 3T4HB 1BBT2 3TBDA 3PIP1 4XJWA 5IP7L 2Q8DA 3PUHA 5EP9A 1AL22 1I5PA 1GOHA 5EWSA 1AR72 1X8EA 4FFHA 2XJQA 2F6BA 4FTBA 2QVSB 1C8M3 1ND3C 4AEDB 2FDIA 5L9BA 4AR6A 4UF0B 4TN7A 5FXXA 3APBA 1LJ7A 1ZZBA 4OLLA 1KITA 4HMZA 2HLEA 1W3VA 4DRVA 2EIBA 5FPUA 1BMV2 3RZLA 1PIV2 3TYJA 1Q8VA 5EZWA 1IPSA 2WWUA 5FBZA 3SNMA 1IU5A 2LW8A 4YGBA 2OA2A 5CG8A 3A23A 2P17A 4AHWA 3T0BA 4GKYA 1J3RA 1LGBA 3ZX7A 1TWFL 2VBBA 1JH5A 4QQ2A 5A32B 3VBRA 4MVTA 2YU9L 5DDJ2 4LBKA 2IXCA 1Q8QA 1RUF2 1W9YA 1ZZ7A 2AENA 1UMIA 5DG1A 2NVQL 1VBE1 1UCXA 4YZ5A 1F4LA 5G04L 1OWCA 1D0HA 1NNQA 2OUJA 3HBZA 4LO8A 1BKZA 4A45A 4AGRA 4COZA 5JXJA 1DQ6A 5DAPA 1KDKA 3ILRA 5HI0A 1ZRDA 4JDOA 1VMHA 4UOJA 3OYWB 4JCKA 1HB1A 4BB3A 3VKLA 1I6XA 4A3KL 3ACLA 2PVXA 3ZFFA 2XBO3 1OLQA 3VHPA 4BBSL 1XNCA 2ETEA 3JBG2 4LHNA 4A3ML 2WINB 5A7OA 2WWJA 1N1YA 4W65A 2A3XA 1JZ3A 3VD4A 4M3CE 1JZ4A 1QQTA 1B2OA 3C7HA 2DVDA 3VDBA 5CG9A 1WKYA 1AVBA 4XFFA 2VMGA 3IZOA 2E2HL 3OUHA 3JQXA 2XG3A 1BCXA 4X6QB 3AMPA 3GGLA 4BQ1A 4MGZE 4YYOA 5H9QA 4UWDA 3KCCA 4QXKA 3VBRC 4GMP3 2RMU3 4YFZA 2F17A 1EUUA 1E5HA 2W39A 5L9RA 2EF6A 1HRV1 3ZYPA 4ME3A 4Q4W2 2YG0A 5A3UA 2A5ZA 4Y24A 2NMNA 2JG9B 2VW0A 2D5FA 2A6WA 3FDJA 1UX7A 3DPRB 2PXJA 5A80A 4K21A 1XYOA 1W6MB 1VB2A 2R073 5FV3A 2ORXA 4YZ4A 1CWPA 4LXLA 1PZ7A 4QX8A 4XAAA 3H1YA 3TAYA 3UGGA 2JD9A 3ZFFC 3ZN6A
chains in the Genus database with same CATH topology
3AMNA 3NAPB 3NWKA 3LOIA 4XYXA 3BOWA 2WS92 1R0HA 1ZREA 4FPFA 2A3YA 4D7TA 5HCFA 1DIWA 4I09A 3VHNA 2BVVA 2QUOA 2VPVA 4LHLA 3B94A 3CJXA 4Q0PA 1ZRRA 2Z5WA 2PVEA 3QCWA 4ASLA 1AZDA 1ZM1A 5EYYA 2JI3A 3JD71 3RZ6A 2AYHA 4IETA 1RMU2 2TUNA 3HIFA 5FQ0B 4RD7A 4QPIB 3NAPA 2OVUA 5KHGA 4YZ3A 1CQ9A 2HWC1 3NSTA 2AUYA 1WMDA 5GZGA 4BPZA 1IS5A 1WW5A 3WUDA 5AI3A 1C5HA 3WW1A 4P9GA 1B2JA 1RITA 2HJIA 3FHIB 1VBC3 1H9PA 1YJLA 3WOGA 5SV5A 1W0PA 1NLRA 3WWLA 1POV1 4UW3A 1OPMA 4AVSA 1D4M1 4Q4V1 4HSLA 3RPQA 4RGGA 3MW3A 1XQNA 4XFBA 2CY6A 3J7Z1 3AKTA 3TWIA 2XUMA 4DXZA 2JG8A 1ZX5A 4AQ6A 3KM5A 3M4FA 3I59A 4RA0A 1MS3A 1RUH3 1NLSA 3BB6A 5I0SA 1LCLA 1T9OA 3NAPC 4XOGA 2GALA 2B5HA 1JHNA 4PQ9A 1PM7A 3RMXA 4DRRA 1RUC1 1RINA 2I2SA 3HD8B 5L36A 5JSPA 4AI1A 3BOPA 3HR9A 2AYJA 2CNAA 4CP2A 4DY5A 4FAGA 4XIKA 3VLBB 3QACA 1QF3A 5A3LA 3EXUA 1MEC3 2PAMA 4QPIC 5I91A 1QJX1 1RUI3 4I0WB 3PVNA 2QKDA 3VBFB 2ZAAA 1BVVA 2G4IA 3PNAA 1TNRA 4AGGA 2UY8A 3KD4A 1A8DA 2D3SA 2JG8C 1GZWB 1C1LA 1W0OA 3ZYGA 5BYNA 1NXMA 1DFQA 3SHRA 1OKQA 1M06G 3H8UA 1LULA 1Q8OA 4OHWA 1AR81 3NW4A 4YM2A 3B7MA 3H7YA 3WCSA 4YZ1A 2JECA 5RXNA 2ZGNA 3C2UA 1ENRA 5J96B 4JAGA 1V00A 4E4ZA 4E4SA 3AB0A 5LEJA 1DQ2A 2LM3A 1H0BA 3WCRA 4F83A 1D4VB 5EYXA 3RYPA 2ZABA 3AXDA 5CU1A 1VBA2 4K7JA 5ACA1 2AH2A 4CEWA 4O9GA 4XF4A 2EXKA 3IDBB 4RQPA 3U4XA 1SMWA 1IPJA 4JRAA 3NFPI 2R063 4X8NA 3NVCA 1OOPA 3E5QA 2IXLA 1W6PA 4AFMA 4N53B 4YWLA 3KS7A 2E6VA 4LBJA 1ZNPA 1DDLA 3GYDA 2A6ZA 1RYQA 3IKWA 3SCHA 3ZXAC 1DZQA 2DF7A 3H1MA 3NO8A 4KU8A 3AMQA 2YXSA 2NM1A 5KBFA 1MS4A 1Q43A 4FOYA 3U10A 2XJTA 1CAWB 1ZBA3 2EVXA 5EXOA 5I8SA 1ALYA 5TSWA 4N7IA 5JZGB 4WBBA 4CEWC 3ZSEA 5MLC3 3WXPA 4BIFA 3NV2A 4RQPC 3ZFGB 1GZ9A 4AR3A 1OI6A 2RJKA 4IEZA 2ZACA 1ULCA 4M0NA 4JGYA 1ND2B 3GALA 4QQHA 1OOPC 2HWD3 1FHHA 5MF6A 4HPKB 2A69D 1UIKA 4HVRA 3ZXFA 2K9ZA 1CAWA 1E8JA 1I3HA 3E97A 4DOUA 3AYCA 4AFBA 2R1DA 3ETQA 4UW5A 2H6CA 1FPN1 2HWE2 1UZZA 3LA7A 4FBFA 5BUVA 3AP6A 1HRI1 2AR6A 2VY0A 2WNUB 3LAGA 4L92A 3VDDB 5K7PA 2JJ6A 1EV13 1ND2A 2ZOEB 3AKPA 4SLIA 2P2KA 1HX6A 4XQ4A 1CR7A 1H8VA 1UIJA 3UK9A 2CR8A 5J48A 5LRSA 3P2AA 2RS13 3ES4A 4HPKA 2QQPA 2OZ6A 3FZ3A 3O7OA 1YV1A 3ALQA 2JDZA 4LO7A 4ZXKA 3UKTA 1RUD2 4EWEA 1UZYA 5CFDA 4JGYC 2ZGUA 1W6QB 3ZG6A 3FBYA 5H9RA 1MACA 4QQPA 1C09A 1A78A 4D7SA 2BBVA 3UV9A 2LCQA 3PVOA 3ZFEB 3KZ4C 4DMIA 2W0XA 1T9PA 1ULGA 4GB32 3CJIB 1UMZA 2WQZC 2OUHA 2E7TA 2GC0A 2WJSA 5C9AB 1R0GA 2AREA 5T52A 1O3SA 5C4WA 1BYHA 1LESA 1ND2C 1TME1 4Q4Y1 1W6OB 4XXPA 1XXNA 1QXRA 1LTEA 2DVGA 2PHDA 2Y38A 3W58A 3KT1A 3ZFEA 1H4HA 2CYFA 3P3PA 4TVMA 5KXBA 3CJIA 4R8HA 3N7KA 1PNFA 4CZSA 5CFDC 3FWEA 5C9AA 2HWF1 1NY71 1DZRA 3WDXA 4A7YA 1KFUL 1FMD1 3NV1A 3L9JT 4IEOA 5C33A 3KMHA 4AF9A 1BBT3 2ES3A 2YUEA 5DUVA 4UW6A 1AL23 2EALA 5CVRA 2ZGLA 4IEYA 2VL6A 1RVF2 3UL2A 5T5OA 5C4WC 2HWB2 4IEUA 4N43A 3SCGA 3J9SA 2Q1MA 1C28A 2ZS6B 2WWSA 1QJU1 3M3EA 1CN1A 2BTVC 3M3QA 1LGCA 5BNNA 5I8TA 2BFUL 1VBB2 3ZFEC 1PIV3 1BK1A 1IKQA 4AG4A 1VAMA 1PO21 3CJIC 3SISA 1M4WA 3VBHB 2VVEA 4PDWB 5C9AC 1FOD3 1AR61 1PO11 4XJ9A 1VBD1 3RRDA 4LBQD 4AVBA 1W6NA 1W39A 3CLPA 4P9XA 1F5FA 1RUF3 1YHFA 5JDBA 3HMYA 5GLUA 4YFWA 1FT9A 3FC0A 4LE4A 5JAXA 4YVSB 3DF0A 3K48A 3LGRA 4UXAA 1OA3A 1XYPA 2VNOA 4N43C 1SLBA 1SBEA 2ZTNA 4F3JA 4YZ2A 3JBG3 3WQ7A 5BNNC 3WDWA 5A33A 4DNYA 1HDKA 1IGOA 1NE6A 5JVVA 1FV3A 1H1IA 1UAIA 1QY4A 2JEMA 5DM71 2BYVE 1NCQA 4A2UA 1H8TA 1JUHA 5F9TA 4QM8A 1S55A 4YVSA 3M1HA 3PIO1 1WGPA 3R0RA 1N1TA 1LU1A 1ENXA 3IDCB 4NWWA 2ZAHA 4LLOA 3D5OA 2I07B 4Q4W3 2MEV1 4EN8B 1IS6A 2VOVA 4FVVA 1BQPA 1ULEA 2IXJA 1MVQA 4CDWA 4BYYA 1H1MA 3WW3A 1MVEA 4FPOB 1NZCA 4XJ8A 3WW2A 1F2NA 1REDA 4QX5A 1COV1 5KXDA 3H0OA 4POFA 3FUQA 4XHBA 2RHPA 2A70A 3H3UA 4ISRA 2WS93 1PK6B 2A68D 4Y1YA 2H0VA 1NCQC 1PGW1 3BTAA 2O8OA 2CWMA 1H8TC 4AXOA 3FBMA 4KGGA 3VBUA 4YVSC 2HR5A 4BH9A 5DZGA 2BNMA 4ZU4A 1V9U1 1MZ5A 4LA3A 3JCIA 4K1YA 5FO8B 3ZO0B 1RMU3 1BEV3 5KXCA 3ILFA 1VBE2 1WW4A 1YUZA 4E9KA 1ZBE3 4CDWC 1Z7S1 1QJY1 2PQQA 4PIYA 4OVEA 4RS5B 2P37A 2RS51 4KWJA 3WP5A 1YWKA 3ZXKA 1G86A 1GKBA 4OI1A 4Q26A 2WFF1 4Q0VA 2CGNA 3CNAA 5GZEA 4EROA 5BNQA 1BZWA 2RR11 5CB7A 3V0AA 2KM2A 2MPFA 5CA6A 2CV6A 5AC91 3WR0A 3RJ2X 2NMOA 2BE5D 3VBUC 4RS5A 2GNDA 4YVWA 2ZX0A 1GLHA 5A3MA 3OGJA 3BODA 5JR7B 3SMHA 1ONAA 4JTNA 3WG4A 3U0ZA 1HRV2 1SCSA 1LEDA 2PYAA 5FPXA 2UWAA 4A7ZA 2PAKA 1ZRCA 5MFPA 3RYKA 2C0ZA 3NJZA 1FAYA 1WA4A 1ZA4A 4K9SA 2EXIA 4LULA 4EN7B 1WBLA 4I02A 2PHRA 4D69A 3IN9A 1YUXA 4OHZA 4C0HA 4NHMA 2BQPA 4FPEA 1EPWA 2X29A 1H9WA 4URTA 4AQSA 1WMEA 1RJ8A 4LT5A 3B0AB 4XMIA 1TNFA 5K0UA 4RS5C 4YVWC 3TNPB 2UURA 2DV9A 2PHFA 4QPGA 2YDEA 1I5ZA 2GU9A 3NV4A 2QE3A 3JD72 4PLMA 4FT8A 4V1PA 3WP4A 5K8SA 2UU8A 4Q1PA 2ZJCA 1YNAA 1RDGA 2HWC2 1WLCA 2MHFA 4LA2A 5JSOA 4XQWA 2DSXA 3GZAA 1ZZCA 3ZYRA 3P8BA 1CAXA 2K2SA 4D94A 3FFQA 4N9IA 2GNMA 1SMMA 2XJSA 2DVBA 4KNCA 2KA3A 2V73A 2SLIA 1D4M2 4Q4V2 1VAVA 1H4GA 1QH6A 2RMU1 5AN9H 4GMP1 5FMOL 1YFWA 5K0UC 5KC5A 4WVMB 4YSFA 5L19A 5ABJB 4QPGC 2PPTA 1ULDA 3AP5A 1LOFC 3A0NA 5CNAA 2ZGKA 2GH8A 2V3BB 3VZKA 4H55A 4XJZA 1QMJA 1POV0 3RI8A 1AYM1 3Q9OA 1MS8A 2D6NA 4XMAA 2R071 3MIFA 4AVVA 1WLTA 2DU0A 2WZPP 4HKWA 2Q1ZB 3M3IA 1RUC2 1GZCA 3X29B 4CTEA 1JBCA 1DYKA 4AK3A 1G9FA 1NYWA 4YW5A 4GALA 3KGZA 1DG6A 4I2OA 1C1FA 4B4QA 1DLLA 4D3WA 1W2UA 3QVDA 2RDVA 4WV8A 5JPNB 1N47A 1QJX2 2A73B 5L7OA 2ZX4A 5JVG1 2JICA 4GQ7A 2ZGQA 4NWVA 1IHMA 1KJRA 4A7KA 3POWA 1RUNA 2YZ4A 1CESA 1R081 4HKOA 1HLCA 1LOGA 4Q4X1 1H2MA 4FPJA 3ZXGA 2VOXA 2O0OA 2XPJA 2K0GA 5E88A 1UKRA 3AMHA 3IM0A 1AR82 3K51A 4HSJA 2F4PA 4IL7A 4AHXA 4IEPA 2HWE3 2C5DA 2YGMA 2W52A 4AFDA 3WDVA 4CDUA 1VBC1 2GNBA 3AZXA 4HVOA 3PMEA 5T55A 3FX3A 2Y0IA 2GH2A 4S2FA 1DBNA 2XH6A 4K20A 1HQLA 5L7OC 4FPGA 2A71A 2BNNA 5ACA2 1IKPA 1CVNA 3SCFA 3MGUA 3W59A 5FOJB 1B71A 3M70A 3FJSA 1PVC3 2W68A 4HBNA 3WVJA 1NA1B 3RZZA 2NYYA 2HEVF 4AEDA 1Q56A 3FLPA 4M01A 1HXS3 1EPZA 4GB33 1WCDJ 3USSA 1O5LA 4B8EA 4AI3A 1WMFA 3EHKA 5GZDA 4CDUC 1CADA 1CJDA 4MGYE 4QPYA 2HEYF 5LEKA 1URXA 1RUI1 5A32A 1E57A 2WA3A 3P3NA 1D2SA 1MS9A 1VALA 2P34A 2NQYA 3I4IA 4Y1ZA 1O3QA 2OYZA 4QGMA 3POYA 3PHMA 4CEYB 4DFSA 1JOJA 2NLRA 2R30A 3D82A 3CU7A 1S0CA 1S0DA 2QCSB 4Y22B 3FUOA 4M0HA 4HL0A 3KB5A 2M6PA 3VHRA 2A7AA 4AEDC 3OYWA 1H7VA 4UBHA 2G9FA 4FPKA 4QD2A 2IFWA 4L9BA 1FXZA 3ROUA 1R1ZA 2B39A 1FPN2 1IROA 2WFPA 2CGPA 5I93A 2GMGA 4R9DA 1HRI2 1TMF3 4FOVA 4ORFA 2DYCA 1LHUA 1QOOA 2Q8OA 4JQRA 1JN2P 4RR3B 1WCSA 4E2QA 1VBB3 1KJLA 3WP6A 3S7IA 1RC6A 1WLDA 4FP2A 2D44A 4LO6B 3S30A 1JXNA 2JG9A 3DPRA 4XXAA 1DZTA 4KWKA 5J37A 1W6MA 1GQGA 1Z0HA 2WZR1 1PGL1 3PKIA 1BFYA 2DURA 2R043 2YY1A 4G4FA 2VULA 2UYBA 4L97A 4MGKE 1ZBA1 5GLVA 2IC1A 1DQ5A 1JYCA 1TME2 4YM0A 4HK9A 4Q4Y2 4IXLA 2PLV1 1OQEA 1A6CA 3SH4A 1RIRA 4Q0SA 2QJVA 1UU6A 3USUB 4LO5B 3J8F3 3URFA 3LZZA 2WSVA 1IS4A 4FPYA 3FMGA 2QZ2A 4RHV3 4QPIA 4XFAA 5FQ0A 1IOAA 2JG9C 2X5IB 3DPRC 2JKBA 3KYUA 2HWF2 5D8AB 5IK7A 1NY72 2LALA 2DCZA 1BXHA 4Y20B 2ZMKA 1FMD2 1VCXA 3N7LA 5FDBA 1GNZA 5FRAA 1H1AA 1AYN1 2VOKA 4XFIA 3AFGA 3USUA 2A6VA 4Q29A 1EV11 1OA2A 1Q3EA 4OUSA 1RB8G 2X5IA 4F7ZA 3ELNA 1B35B 2DUPA 2M4YA 2FZ1A 2C6AA 4MV2A 4QM9A 3AKSA 1QJU2 1VZHA 2A6HD 1AF9A 1YIPA 4BWOA 4WM8B 3VL8A 1O91A 2HYKA 5BXXA 1PO22 2E7AA 1RUJ1 3QH6A 2O1QA 4KWLA 1AR62 3IWZA 1PO12 1S0EA 1Q8SA 3MIDA 3B08B 4LBLA 1VBD2 3JQWA 4U671 5MGNA 4IV1B 4B29A 3PVEA 1B35A 1R1A3 3VBOB 4ATEA 4AQTA 2BFUS 5LK7B 1VBE3 4WM8A 5I0RA 2RS33 3FFZA 1OA4A 5FFOC 3E5UA 4XPVA 3SXWA 4CDXB 3AYAA 2X5IC 3IPVB 3VBFA 2A6XA 4XILA 1YXWA 2R0HA 3AZWA 3L2YA 4ZU7A 1OQDA 3RJRA 1GZWA 5GZFA 3J4UH 1N1SA 1NXD1 4Q8LA 4XBLA 3ZVXA 3AYEA 4EN0A 5H9SA 3WHTA 4DS0A 2PN5A 1DYPA 3ZDSA 5J98B 2ILMA 4OI0A 3MSUA 2D6OX 1B35C 3V65A 1G7YA 4YW2A 4YARA 1HRV3 4EV0A 1U0AA 1QXJA 1WD4A 2DFBA 2ET1A 5CIRA 4Q1RA 4DZGA 2MEV2 3WQ1A 4WM8C 5CADA 2EAKA 3N7JA 4AI0A 4XFHA 2H0BA 5IK8A 1QNWA 4X6RB 3VBFC 3WG1A 4B4RA 1COV2 3MF9A 4EN9B 2RM21 2FBEA 2GZWA 2Z3QB 2ZKLA 1V70A 4FO9A 4Q8KA 1VB4A 2CGOA 3QBQA 3RG0A 4N53A 3SLIA 4QQOA 1LHOA 1FOD1 3OCPA 1CPNA 1PGW2 2VXRA 1NG0A 1RHI1 3IIAA 4GKXA 4META 2IXIA 1UL9A 1GYKA 1QDCA 3LSEA 1V9U2 4SBVA 2ZX2A 3A44A 2VU9A 4G6BA 1OFNA 4HN0A 3JD73 4QGLA 5JWPA 3B9CA 5C6CA 3E5XA 4YGCA 4PIZA 2HWC3 3N3HA 3MF6A 1Z7S2 1QJY2 2JX9A 1MS5A 5JZGA 2RS52 4CDQB 3VL9A 2GDFA 3ZFGA 4E4DX 1YK4A 3SS2A 2WFF2 1ENSA 2GC1A 2XLAA 4IV3B 4Z8BA 3N36A 2RR12 1POV3 4N53C 5EINC 2A6YA 1S0BA 4KBBA 5AC92 1UN1A 3POSA 1RUG1 4H7MA 2FMYA 4LUKA 2B46X 1NXGA 4FPLA 1O3RA 2ZMLA 2DUOA 1ULFA 2WNUA 2XWJB 3VDDA 3VKNA 2SBAA 1Z92B 3OF1A 1SFYA 4TLFA 1PHMA 1ZRPA 3GHNA 4RFT0 4YG6A 1ASJ1 2I74A 1ZZ8A 3WD5A 3THTA 1NOVA 3ZN5A 4HKLA 4P9LA 5JZGC 4B7KA 3LWCA 4PBPA 1U5ZA 5KWRA 3ZFGC 2A3WA 1IS3A 4MXVA 4G3YC 4KG8A 1GSLA 2VNGA 4K1ZA 4L2NA 1W6QA 1YFUA 1VZGA 2EXJA 2GMEA 2VOWA 3NL1A 3GZUC 4UY81 5MFZA 2ENRA 1QQP1 3LPEB 1SLTA 4JAAA 3M2MA 4XJUA 1RJ7A 2XKOA 3E6BA 1AR91 2YV8A 1BEV1 2WNUC 3VDDC 3MPPG 5E16A 1BQ9A 1ZBE1 4FP3A 1W6OA 2B9UA 4K8FA 1AR83 2YPJA 4PBOA 3D8CA 2Z2SB 1VRH2 4K6BA 1EAH1 2DCJA 3NKTA 4RGAA 3KT7A 2DTWA 4JAFA 4FSJA 1UU4A 1DQ0A 2BEOA 3B01A 4M00A 1N3OA 1LKMA 2XVKA 5F6KA 5JOYA 2DCYA 3B00A 2V0FA 1AR73 2AGSA 2GMPA 1WBFA 1EYBA 4H7LA 1SEFA 5KHHA 4W6WA 3ZSMA 2XJRA 1KDMA 1Z78A 1R0JA 3S0MA 4GWMA 2RMU2 4M3CB 2NP0A 1YI9A 4AYUA 2PFWA 4B3NA 1J3PA 5AFBA 1GQHA 1GV9A 3SH3A 3AZZA 4L99A 4FTEA 5CFCB 1AYM2 5DDJ3 5JIAA 2R072 4HK8A 1RUE1 4YG3A 4COUA 5FAXA 1G9DA 1QCVA 4NVPA 5FMOS 3VBSB 3HT1A 4M3CA 1REFA 4FOQA 4E27A 3TN91 1AXYA 3VBHA 1S24A 4EWDA 5KHJA 4J1XA 4PDWA 1AL0G 2TEPA 2ZHMA 4XBQA 1DVBA 3E6DA 2V5YA 2DTYA 2WNVB 3HT2A 5B2GB 5CFCA 1CAVB 1R091 3MICA 3OBRA 1X36A 1R0IA 1MZEA 2R6QA 3S7EA 3TRSB 3VBSA 1IPKA 2P3JA 1R082 2QDRA 4YLZA 1G9BA 1G9AA 4Q4X2 4S2GA 1QXPA 3JZVA 4QMAA 4JVAA 5DUUA 4YGEA 1IW7D 3S6PA 2ZGMA 3JB8A 3CEWA 2D98A 4I0BA 2D93A 3OY8B 3M7AA 2DWRA 1JUIA 5GALA 4DY3A 1VBC2 2NN8A 4Y26A 1HRI3 3AZYA 2EA7A 3GHMA 3VBHC 4ZU5A 2Q5TA 4PDWC 3ZN4A 1Q5OA 1UKGA 4Z1VA 5DXDA 2C9AA 1RUOA 2PA7A 2ZHLA 1AX2A 3NKGA 3QLQA 5CFCC 3TNQA 3PMSA 5HBAA 3MIEA 4XEZA 1QWRA 3WY6A 3VBSC 5DUXA 2E51A 2YHJA 4FTSA 1RL3A 3IU3I 1LOAA 5GJ6A 5SV8A 2NZ9A 1CAAA 2JI2A 3OPZA 4TYSA 3ZSJA 3WX5A 4ATFA 1D2QA 5GAEc 5GLTA 2YYOA 3LA3A 8RXNA 3KCYA 1YCIA 2VQAA 3AK0A 2FHRA 4Y1UA 1PK6A 1HQWA 1SLCA 3L2HA 2K2DA 5C8WA 2O5JD 1AXKA 2VW2A 4NHKA 1LU2A 1RUI2 4MXWB 4XFCA 2CKAA 4KQ7A 3ZPYA 3M8LA 5E89A 1DGRN 1PGSA 4E2GA 2PYTA 1AX1A 1RGSA 5EIOC 1X8MA 1YFXA 4AVAA 2ZZJA 3TB0A 4BE3A 1XU2A 2ERFA 4HETA 2D40A 2XLFA 2R16A 4S2HA 2JENA 4TSVA 1S30A 3MIHA 4YG0A 3B02A 3WP3A 4Q0QA 1MZFA 3TOJA 1C8M1 1PK6C 1V6OA 3FLTA 2XWBB 1DQ4A 4OZXA 4YW3A 2HKXA 2B45X 3H50A 1B13A 5JMCA 3A4UA 3LOBA 1C5IA 3UKNA 4IEVA 1IZ3A 1PO23 2QDNA 3AP7A 4JTOA 1PVC1 1R0FA 2BW8A 3MZHA 4E2SA 2X8KA 1AR63 4OHYA 2I45A 5JSRA 1HXS1 1PO13 4P9JA 1IQAA 3H7JA 1ZRFA 2WZR2 5E8AA 1PGL2 4IQPA 4XTPA 4DB5A 1LOFA 1N1VA 2ZGTA 3KGLA 3QOPA 4BCUA 3AZVA 3KSCA 5CBLA 4HANA 1XRUA 7RXNA 3WV6A 3HQXA 3ZSKA 1ZBA2 3QD6A 1MR5A 1G8WA 2CL2A 4L11A 1KRIA 5T5JA 1LB2A 1G6NA 4AVCA 3MFCA 2XBO1 2PLV2 4LNVA 1NCRB 5IK5A 4XFGA 3RS6A 2JD4A 3MLJA 5J36A 2WKKA 4JADA 1QU0A 2GC2A 1OHFA 1VBA3 2Q30A 3RZTA 1SACA 5T50A 4N9HA 5CAZA 4LTAA 1CAUB 2VMIA 1CJPA 2ZBJA 1D0GA 3DKWA 2A6ED 5KHKA 2MEV3 1AYN2 1LODA 1TMF1 1T9QA 5BNOB 3OD4A 3GF6A 2ERJA 2XL9A 1Q8PA 3D4KA 4MSVA 4HN1A 3VZLA 4WZFA 1OSGA 2JI1A 2XL7A 2Z3RB 3J7Y1 1N3QA 2CWSA 2ZZQA 4WVMA 1KD7A 4BIOA 2XJUA 5ABJA 1LKPA 1SLIA 4XXBB 3R4DB 4LBNA 3THPA 1Y7BA 1WJVA 1ND3B 3ECQA 4XIOA 1LEMA 3OJBA 4DPNA 1FNYA 1RUJ2 4LBQB 3ZXDA 3O0WA 4GXLA 5DZEA 1NXEA 1SFNA 1UPSA 2C1FA 1H2NA 3C3VA 1H2KA 1V9U3