4AI4A

Crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
MNECAFGTKDPVYLNYHDHVWGQPLYDSKALFKLLALQSQHAGLSWLTILKKKEAYEEAFYDFEPEKVAQMTAQDIDRLMTFPNIVHHRKKLEAIVNQAQGYLKIEQAYGSFSKFLWSYVNGKPKDLQYEHASDRITVDDTATQLSKDLKQYGFKFLGPVTVFSFLEAAGLYDAHLKDCPSKPKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-METHYLADENINE GLYCOSYLASE I
publication title A Model for 3-Methyladenine Recognition by 3-Methyladenine DNA Glycosylase I (Tag) from Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mssa476
molecule tags Hydrolase
total genus 75
structure length 186
sequence length 186
ec nomenclature ec 3.2.2.20: DNA-3-methyladenine glycosylase I.
pdb deposition date 2012-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ai4A00
1PU6A 1KO9A 4EJYA 1HU0A 4OFEA 3IH7A 1RRQA 2NOFA 3FHFA 4AI5A 3CVSA 4B21A 1P7MA 1NKUA 4E9GA 4AI4A 1KEAA 5KN9A 4YPRA 3CVTA 1PVSA 4B23A 3F0ZA 1KG6A 1XG7A 2JHJA 3CWAA 1YQRA 2NOBA 3KTUA 2NOHA 1MUNA 1YQMA 4YOQA 4EJZA 1LMZA 2XHIA 1XQPA 1PU7A 2OFIA 3F10A 1M3QA 1ORPA 4HSBA 4EA4A 4UNFA 1WEFA 3OH9A 4EW4A 4E9EA 1MUYA 1YQLA 3S6IA 4OFHA 1ORNA 3G0QA 1YQKA 2YG8A 3CWUA 4EW0A 1N39A 2JHNA 1EBMA 3N0UA 3IHOA 1KQJA 5KN8A 2NOLA 4EA5A 3I0XA 1KG3A 1NGNA 2YG9A 1KG5A 3FHGA 4AIAA 3OGDA 3OH6A 4E9HA 1P59A 1XQOA 4B22A 3CWTA 4DK9A 4B24A 1N3CA 2JG6A 3KNTA 1LWYA 1LWVA 2NOIA 5AN4A 2H56A 2NOZA 3D4VA 1KG4A 2NOEA 1FN7A 4OFAA 3I0WA 4UOBA 2I5WA 1WEIA 5DPKA 4E9FA 4EVVA 1N3AA 1DIZA 1RRSA 1KG7A 4PIIA 1MUDA 3CW7A 2OFKA 3CWSA 1PU8A 3FSPA 3N5NX 1M3HA 5CHZA 4YPHA 1LWWA 1KG2A 1WEGA 1VRLA 2ABKA 1MPGA
chains in the Genus database with same CATH superfamily
1PU6A 1KO9A 4EJYA 1HU0A 4OFEA 3IH7A 1RRQA 3OYMA 3S3OA 2NOFA 3FHFA 4AI5A 3OYHA 3CVSA 4B21A 3OYNA 1P7MA 1NKUA 3L2WA 3OY9A 4E9GA 4AI4A 1KEAA 3OYJA 3L2QA 5KN9A 4YPRA 3CVTA 1PVSA 4B23A 3F0ZA 1KG6A 1XG7A 3VW4A 5FROA 4BE1A 2JHJA 3L2UA 3OYBA 4BE2A 3CWAA 1YQRA 3S3MA 3OYGA 3OYDA 3L2RA 2NOBA 3R2XC 3KTUA 3S3NA 2V75A 4E7JA 1MUNA 2NOHA 1YQMA 4YOQA 4EJZA 1LMZA 4BDZA 2XHIA 1XQPA 4E7IA 1PU7A 2OFIA 3F10A 3OS1A 1M3QA 1ORPA 4HSBA 4EA4A 4UNFA 1WEFA 3OH9A 4EW4A 4E9EA 1MUYA 5FRNA 4NZGA 1YQLA 3S6IA 4OFHA 1ORNA 3G0QA 1YQKA 2YG8A 3CWUA 4EW0A 1N39A 2JHNA 1EBMA 3N0UA 3IHOA 5FRMA 1KQJA 5KN8A 3OYAA 2NOLA 4BDYA 4EA5A 3OS0A 3OYKA 3I0XA 1KG3A 1NGNA 2YG9A 3OYLA 3L2VA 1KG5A 4E7LA 3FHGA 4AIAA 3OGDA 3OH6A 4E9HA 1P59A 4ZTJA 4E7KA 1XQOA 4B22A 2W03A 3CWTA 4DK9A 4B24A 2W04A 3NNQA 1N3CA 2JG6A 3LCNA 3KNTA 1LWYA 1LWVA 2NOIA 5AN4A 2H56A 1U84A 2NOZA 3D4VA 1KG4A 2NOEA 1FN7A 4OFAA 3I0WA 4ZTFA 3OS2A 3OYCA 4UOBA 2I5WA 1WEIA 5DPKA 4E7HA 4E9FA 4EVVA 3OYEA 1N3AA 1DIZA 1RRSA 3OYIA 1KG7A 4PIIA 1MUDA 3CW7A 2OFKA 3CWSA 1PU8A 3FSPA 4IKFA 3N5NX 1M3HA 4BE0A 5CHZA 4YPHA 2JPSA 1LWWA 1KG2A 1WEGA 3OYFA 4BACA 1VRLA 2ABKA 1MPGA
chains in the Genus database with same CATH topology
1PU6A 1KO9A 4EJYA 1HU0A 4OFEA 3IH7A 1RRQA 2NOFA 3FHFA 4AI5A 3CVSA 4B21A 1P7MA 1NKUA 4E9GA 4AI4A 1KEAA 5KN9A 4YPRA 3CVTA 1PVSA 4B23A 3F0ZA 1KG6A 1XG7A 2JHJA 3CWAA 1YQRA 2NOBA 3KTUA 2NOHA 1MUNA 1YQMA 4YOQA 4EJZA 1LMZA 2XHIA 1XQPA 1PU7A 2OFIA 3F10A 1M3QA 1ORPA 4HSBA 4EA4A 4UNFA 1WEFA 3OH9A 4EW4A 4E9EA 1MUYA 1YQLA 3S6IA 4OFHA 1ORNA 3G0QA 1YQKA 2YG8A 3CWUA 4EW0A 1N39A 2JHNA 1EBMA 3N0UA 3IHOA 1KQJA 5KN8A 2NOLA 4EA5A 3I0XA 1KG3A 1NGNA 2YG9A 1KG5A 3FHGA 4AIAA 3OGDA 3OH6A 4E9HA 1P59A 1XQOA 4B22A 3CWTA 4DK9A 4B24A 1N3CA 2JG6A 3KNTA 1LWYA 1LWVA 2NOIA 5AN4A 2H56A 2NOZA 3D4VA 1KG4A 2NOEA 1FN7A 4OFAA 3I0WA 4UOBA 2I5WA 1WEIA 5DPKA 4E9FA 4EVVA 1N3AA 1DIZA 1RRSA 1KG7A 4PIIA 1MUDA 3CW7A 2OFKA 3CWSA 1PU8A 3FSPA 3N5NX 1M3HA 5CHZA 4YPHA 1LWWA 1KG2A 1WEGA 1VRLA 2ABKA 1MPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PU6 A;  1KO9 A;  4EJY A;  1HU0 A;  4OFE A;  3IH7 A;  1RRQ A;  2NOF A;  3FHF A;  4AI5 A;  3CVS A;  4B21 A;  1P7M A;  1NKU A;  4E9G A;  4AI4 A;  1KEA A;  5KN9 A;  4YPR A;  3CVT A;  1PVS A;  4B23 A;  3F0Z A;  1KG6 A;  1XG7 A;  2JHJ A;  3CWA A;  1YQR A;  2NOB A;  3KTU A;  2NOH A;  1MUN A;  1YQM A;  4YOQ A;  4EJZ A;  1LMZ A;  2XHI A;  1XQP A;  1PU7 A;  2OFI A;  3F10 A;  1M3Q A;  1ORP A;  4HSB A;  4EA4 A;  4UNF A;  1WEF A;  3OH9 A;  4EW4 A;  4E9E A;  1MUY A;  1YQL A;  3S6I A;  4OFH A;  1ORN A;  3G0Q A;  1YQK A;  2YG8 A;  3CWU A;  4EW0 A;  1N39 A;  2JHN A;  1EBM A;  3N0U A;  3IHO A;  1KQJ A;  5KN8 A;  2NOL A;  4EA5 A;  3I0X A;  1KG3 A;  1NGN A;  2YG9 A;  1KG5 A;  3FHG A;  4AIA A;  3OGD A;  3OH6 A;  4E9H A;  1P59 A;  1XQO A;  4B22 A;  3CWT A;  4DK9 A;  4B24 A;  1N3C A;  2JG6 A;  3KNT A;  1LWY A;  1LWV A;  2NOI A;  5AN4 A;  2H56 A;  2NOZ A;  3D4V A;  1KG4 A;  2NOE A;  1FN7 A;  4OFA A;  3I0W A;  4UOB A;  2I5W A;  1WEI A;  5DPK A;  4E9F A;  4EVV A;  1N3A A;  1DIZ A;  1RRS A;  1KG7 A;  4PII A;  1MUD A;  3CW7 A;  2OFK A;  3CWS A;  1PU8 A;  3FSP A;  3N5N X;  1M3H A;  5CHZ A;  4YPH A;  1LWW A;  1KG2 A;  1WEG A;  1VRL A;  2ABK A;  1MPG A; 
#chains in the Genus database with same CATH topology
 1PU6 A;  1KO9 A;  4EJY A;  1HU0 A;  4OFE A;  3IH7 A;  1RRQ A;  3OYM A;  3S3O A;  2NOF A;  3FHF A;  4AI5 A;  3OYH A;  3CVS A;  4B21 A;  3OYN A;  1P7M A;  1NKU A;  3L2W A;  3OY9 A;  4E9G A;  4AI4 A;  1KEA A;  3OYJ A;  3L2Q A;  5KN9 A;  4YPR A;  3CVT A;  1PVS A;  4B23 A;  3F0Z A;  1KG6 A;  1XG7 A;  3VW4 A;  5FRO A;  4BE1 A;  2JHJ A;  3L2U A;  3OYB A;  4BE2 A;  3CWA A;  1YQR A;  3S3M A;  3OYG A;  3OYD A;  3L2R A;  2NOB A;  3R2X C;  3KTU A;  3S3N A;  2V75 A;  4E7J A;  1MUN A;  2NOH A;  1YQM A;  4YOQ A;  4EJZ A;  1LMZ A;  4BDZ A;  2XHI A;  1XQP A;  4E7I A;  1PU7 A;  2OFI A;  3F10 A;  3OS1 A;  1M3Q A;  1ORP A;  4HSB A;  4EA4 A;  4UNF A;  1WEF A;  3OH9 A;  4EW4 A;  4E9E A;  1MUY A;  5FRN A;  4NZG A;  1YQL A;  3S6I A;  4OFH A;  1ORN A;  3G0Q A;  1YQK A;  2YG8 A;  3CWU A;  4EW0 A;  1N39 A;  2JHN A;  1EBM A;  3N0U A;  3IHO A;  5FRM A;  1KQJ A;  5KN8 A;  3OYA A;  2NOL A;  4BDY A;  4EA5 A;  3OS0 A;  3OYK A;  3I0X A;  1KG3 A;  1NGN A;  2YG9 A;  3OYL A;  3L2V A;  1KG5 A;  4E7L A;  3FHG A;  4AIA A;  3OGD A;  3OH6 A;  4E9H A;  1P59 A;  4ZTJ A;  4E7K A;  1XQO A;  4B22 A;  2W03 A;  3CWT A;  4DK9 A;  4B24 A;  2W04 A;  3NNQ A;  1N3C A;  2JG6 A;  3LCN A;  3KNT A;  1LWY A;  1LWV A;  2NOI A;  5AN4 A;  2H56 A;  1U84 A;  2NOZ A;  3D4V A;  1KG4 A;  2NOE A;  1FN7 A;  4OFA A;  3I0W A;  4ZTF A;  3OS2 A;  3OYC A;  4UOB A;  2I5W A;  1WEI A;  5DPK A;  4E7H A;  4E9F A;  4EVV A;  3OYE A;  1N3A A;  1DIZ A;  1RRS A;  3OYI A;  1KG7 A;  4PII A;  1MUD A;  3CW7 A;  2OFK A;  3CWS A;  1PU8 A;  3FSP A;  4IKF A;  3N5N X;  1M3H A;  4BE0 A;  5CHZ A;  4YPH A;  2JPS A;  1LWW A;  1KG2 A;  1WEG A;  3OYF A;  4BAC A;  1VRL A;  2ABK A;  1MPG A; 
#chains in the Genus database with same CATH homology
 1PU6 A;  1KO9 A;  4EJY A;  1HU0 A;  4OFE A;  3IH7 A;  1RRQ A;  2NOF A;  3FHF A;  4AI5 A;  3CVS A;  4B21 A;  1P7M A;  1NKU A;  4E9G A;  4AI4 A;  1KEA A;  5KN9 A;  4YPR A;  3CVT A;  1PVS A;  4B23 A;  3F0Z A;  1KG6 A;  1XG7 A;  2JHJ A;  3CWA A;  1YQR A;  2NOB A;  3KTU A;  2NOH A;  1MUN A;  1YQM A;  4YOQ A;  4EJZ A;  1LMZ A;  2XHI A;  1XQP A;  1PU7 A;  2OFI A;  3F10 A;  1M3Q A;  1ORP A;  4HSB A;  4EA4 A;  4UNF A;  1WEF A;  3OH9 A;  4EW4 A;  4E9E A;  1MUY A;  1YQL A;  3S6I A;  4OFH A;  1ORN A;  3G0Q A;  1YQK A;  2YG8 A;  3CWU A;  4EW0 A;  1N39 A;  2JHN A;  1EBM A;  3N0U A;  3IHO A;  1KQJ A;  5KN8 A;  2NOL A;  4EA5 A;  3I0X A;  1KG3 A;  1NGN A;  2YG9 A;  1KG5 A;  3FHG A;  4AIA A;  3OGD A;  3OH6 A;  4E9H A;  1P59 A;  1XQO A;  4B22 A;  3CWT A;  4DK9 A;  4B24 A;  1N3C A;  2JG6 A;  3KNT A;  1LWY A;  1LWV A;  2NOI A;  5AN4 A;  2H56 A;  2NOZ A;  3D4V A;  1KG4 A;  2NOE A;  1FN7 A;  4OFA A;  3I0W A;  4UOB A;  2I5W A;  1WEI A;  5DPK A;  4E9F A;  4EVV A;  1N3A A;  1DIZ A;  1RRS A;  1KG7 A;  4PII A;  1MUD A;  3CW7 A;  2OFK A;  3CWS A;  1PU8 A;  3FSP A;  3N5N X;  1M3H A;  5CHZ A;  4YPH A;  1LWW A;  1KG2 A;  1WEG A;  1VRL A;  2ABK A;  1MPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...