4AI5A

Crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
188
structure length
188
Chain Sequence
GAMNECAFGTKDPVYLNFHDHVWGQPLYDSKALFKLLALESQHAGLSWLTILKKKEAYEEAFYDFEPEKVAQMTAQDIDRLMTFPNIVHHRKKLEAIVNQAQGYLKIEQAYGSFSKFLWSYVNGKPKDLQYEHASDRITVDDTATQLSKDLKQYGFKFLGPVTVFSFLEAAGLYDAHLKDCPSKPKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-METHYLADENINE GLYCOSYLASE I
publication title A Model for 3-Methyladenine Recognition by 3-Methyladenine DNA Glycosylase I (Tag) from Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mssa476
molecule tags Hydrolase
total genus 76
structure length 188
sequence length 188
chains with identical sequence B, C, D, E
ec nomenclature ec 3.2.2.20: DNA-3-methyladenine glycosylase I.
pdb deposition date 2012-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ai5A00
2NOBA 3CW7A 4E9GA 4EW0A 4HSBA 1XG7A 1KG4A 3N0UA 2YG9A 3CWTA 3G0QA 3OH6A 1YQRA 1N39A 5AN4A 1YQMA 2NOZA 3KTUA 4B21A 5DPKA 1VRLA 4E9FA 3CVTA 1P59A 4PIIA 2JHJA 4EW4A 3I0XA 3F10A 1YQLA 4EA5A 1PVSA 2OFIA 3N5NX 2I5WA 1NKUA 1P7MA 3I0WA 3F0ZA 4EJZA 3OH9A 5KN8A 4UNFA 1RRQA 4DK9A 3S6IA 1KG5A 1N3CA 1LMZA 1YQKA 3CWSA 3FSPA 4YOQA 4EVVA 4EA4A 2YG8A 1KG6A 1KG7A 1KEAA 1WEIA 3IHOA 2NOHA 1RRSA 4AI5A 2NOEA 3CVSA 4YPHA 1KO9A 4UOBA 1ORPA 1PU8A 1HU0A 1PU6A 1MUNA 1MUDA 3CWUA 4B22A 1LWVA 1DIZA 3D4VA 2OFKA 5CHZA 3CWAA 1M3HA 4YPRA 1NGNA 2H56A 4OFAA 2JG6A 3OGDA 1LWWA 1MUYA 2ABKA 4AI4A 2XHIA 2NOFA 1KQJA 1ORNA 4EJYA 1KG2A 1XQOA 4B23A 5KN9A 1PU7A 1XQPA 1N3AA 2NOIA 1LWYA 4E9HA 2NOLA 1KG3A 1WEFA 1MPGA 1M3QA 4OFHA 4OFEA 1WEGA 1EBMA 2JHNA 1FN7A 3IH7A 3FHFA 3FHGA 4AIAA 4E9EA 4B24A 3KNTA
chains in the Genus database with same CATH superfamily
2NOBA 3CW7A 4E9GA 3OYJA 4EW0A 3L2VA 4HSBA 3L2WA 1XG7A 1KG4A 3N0UA 2YG9A 3CWTA 3G0QA 3OH6A 1YQRA 1N39A 3L2RA 5AN4A 3OS2A 1YQMA 2NOZA 3KTUA 4B21A 5DPKA 1VRLA 3S3MA 4E9FA 3OYEA 3L2QA 4BE2A 3OS0A 3CVTA 1P59A 3LCNA 4PIIA 2JHJA 4EW4A 3I0XA 3F10A 1YQLA 4EA5A 1PVSA 5FROA 2OFIA 3N5NX 3OYCA 2I5WA 1NKUA 1P7MA 3OYNA 3OYLA 4BDZA 3I0WA 3F0ZA 4EJZA 5FRMA 3OH9A 5KN8A 4UNFA 4E7KA 1RRQA 4DK9A 3S6IA 1KG5A 1N3CA 1LMZA 1YQKA 3CWSA 3FSPA 3S3OA 4YOQA 4EVVA 4EA4A 2YG8A 3L2UA 1KG6A 1KG7A 1KEAA 3NNQA 1WEIA 3IHOA 2NOHA 1RRSA 4IKFA 4AI5A 2NOEA 3OYBA 3CVSA 4BE0A 4YPHA 4E7LA 1KO9A 1U84A 4UOBA 1ORPA 1PU8A 1HU0A 1PU6A 4BE1A 1MUNA 1MUDA 3CWUA 4B22A 1LWVA 3OS1A 1DIZA 3OYDA 3D4VA 2OFKA 5CHZA 3CWAA 1M3HA 2W04A 4YPRA 3OYFA 4ZTFA 3R2XC 1NGNA 2H56A 3OYKA 4ZTJA 3OY9A 3VW4A 2JPSA 4OFAA 2JG6A 3OYIA 3OGDA 4E7HA 2V75A 1LWWA 1MUYA 2ABKA 4AI4A 2XHIA 2NOFA 4E7IA 1KQJA 4NZGA 1ORNA 1KG2A 4EJYA 1XQOA 4B23A 3OYGA 5KN9A 2W03A 1PU7A 1XQPA 3OYAA 3OYMA 1N3AA 2NOIA 4BDYA 1LWYA 4E9HA 2NOLA 1KG3A 1WEFA 1MPGA 4E7JA 4OFHA 4BACA 1M3QA 5FRNA 4OFEA 3OYHA 1WEGA 1EBMA 2JHNA 1FN7A 3IH7A 3FHFA 3FHGA 4AIAA 4E9EA 4B24A 3KNTA 3S3NA
chains in the Genus database with same CATH topology
2NOBA 3CW7A 4E9GA 4EW0A 4HSBA 1XG7A 1KG4A 3N0UA 2YG9A 3CWTA 3G0QA 3OH6A 1YQRA 1N39A 5AN4A 1YQMA 2NOZA 3KTUA 4B21A 5DPKA 1VRLA 4E9FA 3CVTA 1P59A 4PIIA 2JHJA 4EW4A 3I0XA 3F10A 1YQLA 4EA5A 1PVSA 2OFIA 3N5NX 2I5WA 1NKUA 1P7MA 3I0WA 3F0ZA 4EJZA 3OH9A 5KN8A 4UNFA 1RRQA 4DK9A 3S6IA 1KG5A 1N3CA 1LMZA 1YQKA 3CWSA 3FSPA 4YOQA 4EVVA 4EA4A 2YG8A 1KG6A 1KG7A 1KEAA 1WEIA 3IHOA 2NOHA 1RRSA 4AI5A 2NOEA 3CVSA 4YPHA 1KO9A 4UOBA 1ORPA 1PU8A 1HU0A 1PU6A 1MUNA 1MUDA 3CWUA 4B22A 1LWVA 1DIZA 3D4VA 2OFKA 5CHZA 3CWAA 1M3HA 4YPRA 1NGNA 2H56A 4OFAA 2JG6A 3OGDA 1LWWA 1MUYA 2ABKA 4AI4A 2XHIA 2NOFA 1KQJA 1ORNA 4EJYA 1KG2A 1XQOA 4B23A 5KN9A 1PU7A 1XQPA 1N3AA 2NOIA 1LWYA 4E9HA 2NOLA 1KG3A 1WEFA 1MPGA 1M3QA 4OFHA 4OFEA 1WEGA 1EBMA 2JHNA 1FN7A 3IH7A 3FHFA 3FHGA 4AIAA 4E9EA 4B24A 3KNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOB A;  3CW7 A;  4E9G A;  4EW0 A;  4HSB A;  1XG7 A;  1KG4 A;  3N0U A;  2YG9 A;  3CWT A;  3G0Q A;  3OH6 A;  1YQR A;  1N39 A;  5AN4 A;  1YQM A;  2NOZ A;  3KTU A;  4B21 A;  5DPK A;  1VRL A;  4E9F A;  3CVT A;  1P59 A;  4PII A;  2JHJ A;  4EW4 A;  3I0X A;  3F10 A;  1YQL A;  4EA5 A;  1PVS A;  2OFI A;  3N5N X;  2I5W A;  1NKU A;  1P7M A;  3I0W A;  3F0Z A;  4EJZ A;  3OH9 A;  5KN8 A;  4UNF A;  1RRQ A;  4DK9 A;  3S6I A;  1KG5 A;  1N3C A;  1LMZ A;  1YQK A;  3CWS A;  3FSP A;  4YOQ A;  4EVV A;  4EA4 A;  2YG8 A;  1KG6 A;  1KG7 A;  1KEA A;  1WEI A;  3IHO A;  2NOH A;  1RRS A;  4AI5 A;  2NOE A;  3CVS A;  4YPH A;  1KO9 A;  4UOB A;  1ORP A;  1PU8 A;  1HU0 A;  1PU6 A;  1MUN A;  1MUD A;  3CWU A;  4B22 A;  1LWV A;  1DIZ A;  3D4V A;  2OFK A;  5CHZ A;  3CWA A;  1M3H A;  4YPR A;  1NGN A;  2H56 A;  4OFA A;  2JG6 A;  3OGD A;  1LWW A;  1MUY A;  2ABK A;  4AI4 A;  2XHI A;  2NOF A;  1KQJ A;  1ORN A;  4EJY A;  1KG2 A;  1XQO A;  4B23 A;  5KN9 A;  1PU7 A;  1XQP A;  1N3A A;  2NOI A;  1LWY A;  4E9H A;  2NOL A;  1KG3 A;  1WEF A;  1MPG A;  1M3Q A;  4OFH A;  4OFE A;  1WEG A;  1EBM A;  2JHN A;  1FN7 A;  3IH7 A;  3FHF A;  3FHG A;  4AIA A;  4E9E A;  4B24 A;  3KNT A; 
#chains in the Genus database with same CATH topology
 2NOB A;  3CW7 A;  4E9G A;  3OYJ A;  4EW0 A;  3L2V A;  4HSB A;  3L2W A;  1XG7 A;  1KG4 A;  3N0U A;  2YG9 A;  3CWT A;  3G0Q A;  3OH6 A;  1YQR A;  1N39 A;  3L2R A;  5AN4 A;  3OS2 A;  1YQM A;  2NOZ A;  3KTU A;  4B21 A;  5DPK A;  1VRL A;  3S3M A;  4E9F A;  3OYE A;  3L2Q A;  4BE2 A;  3OS0 A;  3CVT A;  1P59 A;  3LCN A;  4PII A;  2JHJ A;  4EW4 A;  3I0X A;  3F10 A;  1YQL A;  4EA5 A;  1PVS A;  5FRO A;  2OFI A;  3N5N X;  3OYC A;  2I5W A;  1NKU A;  1P7M A;  3OYN A;  3OYL A;  4BDZ A;  3I0W A;  3F0Z A;  4EJZ A;  5FRM A;  3OH9 A;  5KN8 A;  4UNF A;  4E7K A;  1RRQ A;  4DK9 A;  3S6I A;  1KG5 A;  1N3C A;  1LMZ A;  1YQK A;  3CWS A;  3FSP A;  3S3O A;  4YOQ A;  4EVV A;  4EA4 A;  2YG8 A;  3L2U A;  1KG6 A;  1KG7 A;  1KEA A;  3NNQ A;  1WEI A;  3IHO A;  2NOH A;  1RRS A;  4IKF A;  4AI5 A;  2NOE A;  3OYB A;  3CVS A;  4BE0 A;  4YPH A;  4E7L A;  1KO9 A;  1U84 A;  4UOB A;  1ORP A;  1PU8 A;  1HU0 A;  1PU6 A;  4BE1 A;  1MUN A;  1MUD A;  3CWU A;  4B22 A;  1LWV A;  3OS1 A;  1DIZ A;  3OYD A;  3D4V A;  2OFK A;  5CHZ A;  3CWA A;  1M3H A;  2W04 A;  4YPR A;  3OYF A;  4ZTF A;  3R2X C;  1NGN A;  2H56 A;  3OYK A;  4ZTJ A;  3OY9 A;  3VW4 A;  2JPS A;  4OFA A;  2JG6 A;  3OYI A;  3OGD A;  4E7H A;  2V75 A;  1LWW A;  1MUY A;  2ABK A;  4AI4 A;  2XHI A;  2NOF A;  4E7I A;  1KQJ A;  4NZG A;  1ORN A;  1KG2 A;  4EJY A;  1XQO A;  4B23 A;  3OYG A;  5KN9 A;  2W03 A;  1PU7 A;  1XQP A;  3OYA A;  3OYM A;  1N3A A;  2NOI A;  4BDY A;  1LWY A;  4E9H A;  2NOL A;  1KG3 A;  1WEF A;  1MPG A;  4E7J A;  4OFH A;  4BAC A;  1M3Q A;  5FRN A;  4OFE A;  3OYH A;  1WEG A;  1EBM A;  2JHN A;  1FN7 A;  3IH7 A;  3FHF A;  3FHG A;  4AIA A;  4E9E A;  4B24 A;  3KNT A;  3S3N A; 
#chains in the Genus database with same CATH homology
 2NOB A;  3CW7 A;  4E9G A;  4EW0 A;  4HSB A;  1XG7 A;  1KG4 A;  3N0U A;  2YG9 A;  3CWT A;  3G0Q A;  3OH6 A;  1YQR A;  1N39 A;  5AN4 A;  1YQM A;  2NOZ A;  3KTU A;  4B21 A;  5DPK A;  1VRL A;  4E9F A;  3CVT A;  1P59 A;  4PII A;  2JHJ A;  4EW4 A;  3I0X A;  3F10 A;  1YQL A;  4EA5 A;  1PVS A;  2OFI A;  3N5N X;  2I5W A;  1NKU A;  1P7M A;  3I0W A;  3F0Z A;  4EJZ A;  3OH9 A;  5KN8 A;  4UNF A;  1RRQ A;  4DK9 A;  3S6I A;  1KG5 A;  1N3C A;  1LMZ A;  1YQK A;  3CWS A;  3FSP A;  4YOQ A;  4EVV A;  4EA4 A;  2YG8 A;  1KG6 A;  1KG7 A;  1KEA A;  1WEI A;  3IHO A;  2NOH A;  1RRS A;  4AI5 A;  2NOE A;  3CVS A;  4YPH A;  1KO9 A;  4UOB A;  1ORP A;  1PU8 A;  1HU0 A;  1PU6 A;  1MUN A;  1MUD A;  3CWU A;  4B22 A;  1LWV A;  1DIZ A;  3D4V A;  2OFK A;  5CHZ A;  3CWA A;  1M3H A;  4YPR A;  1NGN A;  2H56 A;  4OFA A;  2JG6 A;  3OGD A;  1LWW A;  1MUY A;  2ABK A;  4AI4 A;  2XHI A;  2NOF A;  1KQJ A;  1ORN A;  4EJY A;  1KG2 A;  1XQO A;  4B23 A;  5KN9 A;  1PU7 A;  1XQP A;  1N3A A;  2NOI A;  1LWY A;  4E9H A;  2NOL A;  1KG3 A;  1WEF A;  1MPG A;  1M3Q A;  4OFH A;  4OFE A;  1WEG A;  1EBM A;  2JHN A;  1FN7 A;  3IH7 A;  3FHF A;  3FHG A;  4AIA A;  4E9E A;  4B24 A;  3KNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...