4AI5A

Crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
188
structure length
188
Chain Sequence
GAMNECAFGTKDPVYLNFHDHVWGQPLYDSKALFKLLALESQHAGLSWLTILKKKEAYEEAFYDFEPEKVAQMTAQDIDRLMTFPNIVHHRKKLEAIVNQAQGYLKIEQAYGSFSKFLWSYVNGKPKDLQYEHASDRITVDDTATQLSKDLKQYGFKFLGPVTVFSFLEAAGLYDAHLKDCPSKPKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-METHYLADENINE GLYCOSYLASE I
publication title A Model for 3-Methyladenine Recognition by 3-Methyladenine DNA Glycosylase I (Tag) from Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mssa476
molecule tags Hydrolase
total genus 76
structure length 188
sequence length 188
chains with identical sequence B, C, D, E
ec nomenclature ec 3.2.2.20: DNA-3-methyladenine glycosylase I.
pdb deposition date 2012-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ai5A00
4UOBA 2XHIA 1KG6A 1KG7A 1P59A 1XQPA 4OFAA 3FSPA 1DIZA 3I0XA 3FHGA 3I0WA 3OH9A 1RRQA 1KG5A 2JG6A 1KG3A 3IHOA 1ORNA 3N5NX 3CVTA 1KG2A 1YQMA 4AI5A 4OFEA 4EVVA 4AIAA 4AI4A 2ABKA 5CHZA 3CWSA 2JHNA 3IH7A 4EA5A 2NOEA 4EJYA 3CVSA 3D4VA 1WEGA 3OH6A 1EBMA 4YOQA 1P7MA 1KO9A 4UNFA 3CW7A 1LWWA 1WEFA 3KNTA 2NOBA 3F10A 4B21A 4YPHA 1NKUA 2H56A 4PIIA 4E9EA 3F0ZA 1XG7A 4B24A 1YQKA 1FN7A 1MUNA 4E9GA 5KN9A 1WEIA 2YG8A 4YPRA 4B23A 1KG4A 3CWTA 3S6IA 3CWUA 3N0UA 5AN4A 1M3QA 1NGNA 2NOHA 1N3AA 4E9HA 3FHFA 1N3CA 1XQOA 2NOLA 1YQLA 3OGDA 1MUYA 4E9FA 1MPGA 1PU6A 1HU0A 1VRLA 3KTUA 2I5WA 3CWAA 1RRSA 1M3HA 2NOFA 4EW0A 1LMZA 5DPKA 2NOZA 1ORPA 4OFHA 1LWYA 1PU7A 2NOIA 1KEAA 4EW4A 1KQJA 2OFKA 1PU8A 4DK9A 4EJZA 1N39A 4B22A 3G0QA 1LWVA 4HSBA 2OFIA 1YQRA 1PVSA 1MUDA 2JHJA 4EA4A 5KN8A 2YG9A
chains in the Genus database with same CATH superfamily
3OYMA 4UOBA 5FRNA 4BDZA 3R2XC 2XHIA 5FROA 1KG6A 1KG7A 4E7IA 1P59A 3LCNA 1XQPA 3NNQA 4OFAA 3FSPA 1DIZA 3I0XA 4BE2A 3FHGA 3I0WA 3OH9A 1RRQA 5FRMA 3L2QA 3OYCA 1KG5A 2JG6A 1KG3A 3IHOA 3S3MA 3N5NX 1ORNA 3CVTA 1KG2A 2W04A 1YQMA 4AI5A 4OFEA 4EVVA 4AIAA 4AI4A 2ABKA 5CHZA 3CWSA 3OY9A 2JHNA 2W03A 3IH7A 4EA5A 3OYAA 2NOEA 4EJYA 3CVSA 3D4VA 3OYLA 3OYJA 4E7HA 1WEGA 4E7LA 3OH6A 1EBMA 4YOQA 3L2RA 1P7MA 1KO9A 3VW4A 4UNFA 3CW7A 1LWWA 1WEFA 3KNTA 2NOBA 3F10A 4ZTJA 4B21A 4YPHA 1NKUA 3OYNA 2H56A 4PIIA 4E9EA 3F0ZA 3S3NA 3S3OA 4E7JA 1XG7A 4B24A 1YQKA 3OYKA 1FN7A 1MUNA 4E9GA 5KN9A 1WEIA 2YG8A 4YPRA 4B23A 1KG4A 3OYBA 3CWTA 3S6IA 3CWUA 3N0UA 5AN4A 3OS2A 1M3QA 4BDYA 1NGNA 2NOHA 1N3AA 2V75A 4BE1A 4E9HA 3FHFA 3OYGA 1N3CA 1XQOA 4BACA 2NOLA 1YQLA 3OGDA 1MUYA 4E9FA 1MPGA 1PU6A 1HU0A 3OS0A 3KTUA 1VRLA 2I5WA 3L2UA 3CWAA 1RRSA 4IKFA 1M3HA 2NOFA 4EW0A 1LMZA 4BE0A 3OYIA 5DPKA 2NOZA 4ZTFA 4OFHA 1U84A 1ORPA 3L2WA 1LWYA 1PU7A 3L2VA 2NOIA 3OYDA 1KEAA 4EW4A 2JPSA 4NZGA 1KQJA 2OFKA 1PU8A 4DK9A 4EJZA 3OYEA 3OYFA 4E7KA 1N39A 4B22A 3G0QA 1LWVA 4HSBA 3OYHA 2OFIA 1YQRA 1PVSA 1MUDA 2JHJA 4EA4A 3OS1A 5KN8A 2YG9A
chains in the Genus database with same CATH topology
4UOBA 2XHIA 1KG6A 1KG7A 1P59A 1XQPA 4OFAA 3FSPA 1DIZA 3I0XA 3FHGA 3I0WA 3OH9A 1RRQA 1KG5A 2JG6A 1KG3A 3IHOA 1ORNA 3N5NX 3CVTA 1KG2A 1YQMA 4AI5A 4OFEA 4EVVA 4AIAA 4AI4A 2ABKA 5CHZA 3CWSA 2JHNA 3IH7A 4EA5A 2NOEA 4EJYA 3CVSA 3D4VA 1WEGA 3OH6A 1EBMA 4YOQA 1P7MA 1KO9A 4UNFA 3CW7A 1LWWA 1WEFA 3KNTA 2NOBA 3F10A 4B21A 4YPHA 1NKUA 2H56A 4PIIA 4E9EA 3F0ZA 1XG7A 4B24A 1YQKA 1FN7A 1MUNA 4E9GA 5KN9A 1WEIA 2YG8A 4YPRA 4B23A 1KG4A 3CWTA 3S6IA 3CWUA 3N0UA 5AN4A 1M3QA 1NGNA 2NOHA 1N3AA 4E9HA 3FHFA 1N3CA 1XQOA 2NOLA 1YQLA 3OGDA 1MUYA 4E9FA 1MPGA 1PU6A 1HU0A 1VRLA 3KTUA 2I5WA 3CWAA 1RRSA 1M3HA 2NOFA 4EW0A 1LMZA 5DPKA 2NOZA 1ORPA 4OFHA 1LWYA 1PU7A 2NOIA 1KEAA 4EW4A 1KQJA 2OFKA 1PU8A 4DK9A 4EJZA 1N39A 4B22A 3G0QA 1LWVA 4HSBA 2OFIA 1YQRA 1PVSA 1MUDA 2JHJA 4EA4A 5KN8A 2YG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UOB A;  2XHI A;  1KG6 A;  1KG7 A;  1P59 A;  1XQP A;  4OFA A;  3FSP A;  1DIZ A;  3I0X A;  3FHG A;  3I0W A;  3OH9 A;  1RRQ A;  1KG5 A;  2JG6 A;  1KG3 A;  3IHO A;  1ORN A;  3N5N X;  3CVT A;  1KG2 A;  1YQM A;  4AI5 A;  4OFE A;  4EVV A;  4AIA A;  4AI4 A;  2ABK A;  5CHZ A;  3CWS A;  2JHN A;  3IH7 A;  4EA5 A;  2NOE A;  4EJY A;  3CVS A;  3D4V A;  1WEG A;  3OH6 A;  1EBM A;  4YOQ A;  1P7M A;  1KO9 A;  4UNF A;  3CW7 A;  1LWW A;  1WEF A;  3KNT A;  2NOB A;  3F10 A;  4B21 A;  4YPH A;  1NKU A;  2H56 A;  4PII A;  4E9E A;  3F0Z A;  1XG7 A;  4B24 A;  1YQK A;  1FN7 A;  1MUN A;  4E9G A;  5KN9 A;  1WEI A;  2YG8 A;  4YPR A;  4B23 A;  1KG4 A;  3CWT A;  3S6I A;  3CWU A;  3N0U A;  5AN4 A;  1M3Q A;  1NGN A;  2NOH A;  1N3A A;  4E9H A;  3FHF A;  1N3C A;  1XQO A;  2NOL A;  1YQL A;  3OGD A;  1MUY A;  4E9F A;  1MPG A;  1PU6 A;  1HU0 A;  1VRL A;  3KTU A;  2I5W A;  3CWA A;  1RRS A;  1M3H A;  2NOF A;  4EW0 A;  1LMZ A;  5DPK A;  2NOZ A;  1ORP A;  4OFH A;  1LWY A;  1PU7 A;  2NOI A;  1KEA A;  4EW4 A;  1KQJ A;  2OFK A;  1PU8 A;  4DK9 A;  4EJZ A;  1N39 A;  4B22 A;  3G0Q A;  1LWV A;  4HSB A;  2OFI A;  1YQR A;  1PVS A;  1MUD A;  2JHJ A;  4EA4 A;  5KN8 A;  2YG9 A; 
#chains in the Genus database with same CATH topology
 3OYM A;  4UOB A;  5FRN A;  4BDZ A;  3R2X C;  2XHI A;  5FRO A;  1KG6 A;  1KG7 A;  4E7I A;  1P59 A;  3LCN A;  1XQP A;  3NNQ A;  4OFA A;  3FSP A;  1DIZ A;  3I0X A;  4BE2 A;  3FHG A;  3I0W A;  3OH9 A;  1RRQ A;  5FRM A;  3L2Q A;  3OYC A;  1KG5 A;  2JG6 A;  1KG3 A;  3IHO A;  3S3M A;  3N5N X;  1ORN A;  3CVT A;  1KG2 A;  2W04 A;  1YQM A;  4AI5 A;  4OFE A;  4EVV A;  4AIA A;  4AI4 A;  2ABK A;  5CHZ A;  3CWS A;  3OY9 A;  2JHN A;  2W03 A;  3IH7 A;  4EA5 A;  3OYA A;  2NOE A;  4EJY A;  3CVS A;  3D4V A;  3OYL A;  3OYJ A;  4E7H A;  1WEG A;  4E7L A;  3OH6 A;  1EBM A;  4YOQ A;  3L2R A;  1P7M A;  1KO9 A;  3VW4 A;  4UNF A;  3CW7 A;  1LWW A;  1WEF A;  3KNT A;  2NOB A;  3F10 A;  4ZTJ A;  4B21 A;  4YPH A;  1NKU A;  3OYN A;  2H56 A;  4PII A;  4E9E A;  3F0Z A;  3S3N A;  3S3O A;  4E7J A;  1XG7 A;  4B24 A;  1YQK A;  3OYK A;  1FN7 A;  1MUN A;  4E9G A;  5KN9 A;  1WEI A;  2YG8 A;  4YPR A;  4B23 A;  1KG4 A;  3OYB A;  3CWT A;  3S6I A;  3CWU A;  3N0U A;  5AN4 A;  3OS2 A;  1M3Q A;  4BDY A;  1NGN A;  2NOH A;  1N3A A;  2V75 A;  4BE1 A;  4E9H A;  3FHF A;  3OYG A;  1N3C A;  1XQO A;  4BAC A;  2NOL A;  1YQL A;  3OGD A;  1MUY A;  4E9F A;  1MPG A;  1PU6 A;  1HU0 A;  3OS0 A;  3KTU A;  1VRL A;  2I5W A;  3L2U A;  3CWA A;  1RRS A;  4IKF A;  1M3H A;  2NOF A;  4EW0 A;  1LMZ A;  4BE0 A;  3OYI A;  5DPK A;  2NOZ A;  4ZTF A;  4OFH A;  1U84 A;  1ORP A;  3L2W A;  1LWY A;  1PU7 A;  3L2V A;  2NOI A;  3OYD A;  1KEA A;  4EW4 A;  2JPS A;  4NZG A;  1KQJ A;  2OFK A;  1PU8 A;  4DK9 A;  4EJZ A;  3OYE A;  3OYF A;  4E7K A;  1N39 A;  4B22 A;  3G0Q A;  1LWV A;  4HSB A;  3OYH A;  2OFI A;  1YQR A;  1PVS A;  1MUD A;  2JHJ A;  4EA4 A;  3OS1 A;  5KN8 A;  2YG9 A; 
#chains in the Genus database with same CATH homology
 4UOB A;  2XHI A;  1KG6 A;  1KG7 A;  1P59 A;  1XQP A;  4OFA A;  3FSP A;  1DIZ A;  3I0X A;  3FHG A;  3I0W A;  3OH9 A;  1RRQ A;  1KG5 A;  2JG6 A;  1KG3 A;  3IHO A;  1ORN A;  3N5N X;  3CVT A;  1KG2 A;  1YQM A;  4AI5 A;  4OFE A;  4EVV A;  4AIA A;  4AI4 A;  2ABK A;  5CHZ A;  3CWS A;  2JHN A;  3IH7 A;  4EA5 A;  2NOE A;  4EJY A;  3CVS A;  3D4V A;  1WEG A;  3OH6 A;  1EBM A;  4YOQ A;  1P7M A;  1KO9 A;  4UNF A;  3CW7 A;  1LWW A;  1WEF A;  3KNT A;  2NOB A;  3F10 A;  4B21 A;  4YPH A;  1NKU A;  2H56 A;  4PII A;  4E9E A;  3F0Z A;  1XG7 A;  4B24 A;  1YQK A;  1FN7 A;  1MUN A;  4E9G A;  5KN9 A;  1WEI A;  2YG8 A;  4YPR A;  4B23 A;  1KG4 A;  3CWT A;  3S6I A;  3CWU A;  3N0U A;  5AN4 A;  1M3Q A;  1NGN A;  2NOH A;  1N3A A;  4E9H A;  3FHF A;  1N3C A;  1XQO A;  2NOL A;  1YQL A;  3OGD A;  1MUY A;  4E9F A;  1MPG A;  1PU6 A;  1HU0 A;  1VRL A;  3KTU A;  2I5W A;  3CWA A;  1RRS A;  1M3H A;  2NOF A;  4EW0 A;  1LMZ A;  5DPK A;  2NOZ A;  1ORP A;  4OFH A;  1LWY A;  1PU7 A;  2NOI A;  1KEA A;  4EW4 A;  1KQJ A;  2OFK A;  1PU8 A;  4DK9 A;  4EJZ A;  1N39 A;  4B22 A;  3G0Q A;  1LWV A;  4HSB A;  2OFI A;  1YQR A;  1PVS A;  1MUD A;  2JHJ A;  4EA4 A;  5KN8 A;  2YG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...