4AI8A

Factor inhibiting hif-1 alpha in complex with daminozide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
339
structure length
339
Chain Sequence
b'SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Plant growth regulator daminozide is a selective inhibitor of human KDM2/7 histone demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4ai8A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ai8A01
4Z2WA 3D8CA 2ILMA 2WA3A 2YDEA 1H2MA 3P3PA 2W0XA 2CGNA 5JWPA 2CGOA 4BIOA 1H2LA 2WA4A 4B7EA 1YCIA 4NR1A 1IZ3A 1MZEA 4AI8A 2YC0A 3OD4A 3KCYA 4JAAA 3KCXA 1H2NA 3P3NA 2XUMA 4Z1VA 1MZFA 4QU2A 4B7KA 1H2KA 2Y0IA
chains in the Genus database with same CATH superfamily
5FYZA 2HR3A 2WBKA 3B2EE 1NCQC 3Q9OA 4FOWA 4BK4A 4Q4X1 2WLIA 3GVMA 3RYRA 4WFGA 3AL5A 1LKNA 3G6JB 1EBOA 4JAAA 1V55B 1Z7S1 1DYPA 2LM3A 3R4SA 2Y38A 3BVCA 1QU7A 2RMU3 2A5ZA 1Y6XA 4XDJA 1SA0B 4OI1A 3POEA 3L9JT 4LF8B 4E2GA 1FOD1 4A3ZA 1U5XA 2ORZA 3BRCA 1PP9H 4QKBA 4XYXA 2ZAHA 4I3GA 1JFFA 4DW1A 1QJZA 3KVBA 1F5JA 3OUIA 1HLCA 4R9AA 2WSSG 4FO9A 3W7WA 4XFAA 2JDNA 4QX5A 2ZOEB 3NJZA 1OUXA 2JDZA 2EJRA 3QH7A 3HKDB 3VBFB 5FRAA 3ABLC 1TEIA 5LOVB 1D4M1 1XI1A 4OHXA 4QQOA 5GZCA 4OZOA 1QF3A 2VBPA 1MS8A 3RMYA 2J1SA 2J1TA 5EFUA 5GM0A 4YGDA 2YXSA 3NWKA 4YZ1A 4IL6Z 2IW5A 2W1SA 1DHKB 5F9TA 1TVGA 1XYPA 2HH9A 4URAA 5C9AB 1HQLA 4DXZA 3O0VA 4L8QA 4O4HB 4DXWA 4DR2O 4JASA 3GHNA 4N7IA 4JDMA 5BNNA 1YJ9V 3SJBC 1OCOB 1BK0A 3WFVA 2ID4A 3JB4C 5B1AB 3U11A 4XMIA 2CAUA 1RIRA 1H1AA 2Y0IA 4RQPB 2GMEA 3RYIA 1NQJA 1ND2C 4DV1B 4YVSA 2XUEA 3O1MA 3V0BA 4HXCA 1S2EA 2WZ8A 3W7SA 5HV0A 1QNWA 1MPXA 2A1XA 4NRPA 4L11A 3RYPA 4BQ1A 4DR6O 5KUKA 2PHTA 3IWZA 2D6OX 1LGNA 5CEHA 4B8EA 4B4QA 3KLSA 3F95A 3MEPA 5IT9N 4DV3B 3AVSA 3C3VA 4IEWA 3AYAA 4HT1T 3HNYM 4UW4A 4QE7A 4JTOA 1QHDA 3GCWA 1VAKA 3DPRB 2OTJV 3KGZA 2W87A 3WOGA 4WFFA 1U0AA 2JKBA 1UU4A 5IYCO 4RN5A 3SPIA 3ZN0A 4QPWA 1DZQA 4R4ZA 1EAH1 1CQ9A 3AG4B 3WXPA 2X29A 2C9KA 4JI7O 1JI6A 3M8AA 4AEDB 4AFBA 2VWKA 3S7IA 3VBFA 3HPLC 2HWC1 4BU2A 5FPRA 2W95A 4CCEA 1V6JA 3WF3A 4YW1A 1TA8A 3GZUC 2JDHA 2ITDC 2JE8A 3VDAA 1H2LA 5D8AA 3N9PA 4BWAA 4BQ4A 3LDEA 5FMOS 2OQ7A 2WC2A 5CAZA 5IWFA 4LBEC 3NR7A 1OBNA 2ZE8A 3KD4A 4QWNA 3C90A 1JZ3A 5L9RA 2VQTA 2CUGA 5CFDA 2E7QA 3ZMOA 5FY9A 2DYRC 5GLUA 1W6NA 2YBPA 5E79Z 1W2BU 2YB7A 4G9SB 4O4HA 3ZVXA 2XVLA 4YW5A 3FLTA 2Y6LA 3LB9A 2D97A 5BNOA 4XURA 4ZI7A 1AYN3 1D4VB 4FAHA 5CB4B 2Y69C 1JYXA 1XPWA 5F2SA 4R9DA 3C7HA 4Y5TA 1XC6A 3RWRD 4A41A 1S77D 2D3SA 5L3BA 2PLV3 4RO2A 3KV5A 5A9GA 1W6MB 4YZ5A 2UWCA 2ZX4A 3W5MA 3WCRA 4DR7O 4QGMA 4XTPA 4G28B 2Z42A 3I56V 5J2TA 2ZIMA 4JX0A 1PM7A 5CNAA 3N3HA 1ULEA 1PZ7A 2JECA 5SV5A 1QWRA 1NI8A 1PM4A 1U96A 4RSUA 5H9QA 1O9HA 1PGL1 1O3TA 1VBB3 2AEZA 5FYIA 4I09A 4LWSB 1YVWA 4JGZC 1ZX3A 1KQRA 5HCFA 5C5UA 1HRI1 3CRCA 4I4TB 5H6RA 3OFNG 4JV5B 4WFAV 1AZDA 5FPOA 1HNXB 2JGUA 3JALB 1RUC2 5H5NA 5E8AA 2RHPA 5JOYA 3KV9A 4FCAA 4U3FH 5GONB 1G9DA 2GDFA 2WINB 2B8MA 1BZWA 2M7WA 5A3NA 4XFCA 5CA1B 1H6XA 2X53S 1WGPA 2PQSA 4GKKB 4XAAA 3RZJA 1DQ6A 1V6KA 4JC1A 4CDWC 5I0RA 1IBKB 4CUCA 3OGJA 5H6QA 2ZAAA 1RXFA 2C4XA 3TEWA 4FFFA 1KMIZ 3I59A 1UZZA 1TVKB 4R7CA 1N32B 1RMU2 2R043 4R4XA 1Y3TA 4TUYB 2D6KA 3HT2A 2Q8VA 4XOGA 5JSRA 4X1YB 2QE7G 1S5HC 2ETEA 1KQSU 1BQ0A 2HBUA 4KHPO 1GUIA 1TMF2 5CKMA 5DECA 1QVFU 3NKGA 4LKEA 5KAFZ 5JVVA 4RS5A 2CE4A 1V6OA 2QQVA 5JQGB 3FYIB 3A8TA 1NG0A 2GP3A 4COVA 4C90A 1T6GC 3AMPA 1S0JA 2OZJA 1ND2B 2DDUA 3NW4A 1AYM2 1Q6UA 1SC5B 2DUPA 4PJYA 3RI9A 3VHNA 2VCMA 5JCTA 4PDWA 3VKMA 1WA8B 1IXMA 2RM23 3VD9A 5JXHA 3OY8B 5LXTA 1Y74A 1DLCA 1XNAA 3AP7A 1TME1 4H0LB 3RRDA 4NKGB 1BBT3 3LIHA 5DMYA 1M56C 2WT2A 4UYBA 1GM7A 2BPA2 2NM1A 5A2QN 2VBBA 4GB33 1W2TA 5HFMA 1K12A 4DPNA 2R062 3CCJV 4RHV1 4XHXA 2VZRA 4NIAA 2JGDB 1GSLA 3D0SA 1GQHA 1ZRRA 5ANQA 1NAEA 4FLXA 5ISLA 2AR6A 4TXWA 1C4RA 2WJSA 3MIFA 1ODMA 2OX0A 4FPEA 5FKBA 3WUDA 3TOJA 3PLQA 4DUYO 4MVTA 1DF5A 1VQPV 3ALQA 1YI2V 2QEXV 3W7XA 4N21A 1F15A 1NA1C 3T1YB 5F7UA 5JXIA 4NR1A 4FFHA 5K0UA 1LOBA 4MSWC 4GYCB 1JXNA 1C1LA 2DBNA 5T55A 1GMGA 2GC3A 2WWWA 1NXD1 1NT2B 2DYRB 3K08A 3A0RA 1N3OA 1PO13 4JI4B 1VR3A 2BWAA 3AX4A 1BVVA 1IKPA 2GC1A 2O1QA 2A6WA 2RNBA 4A45A 5C3PA 4MGKE 1OJHA 1JQ0A 1E5RA 1EYBA 1KS4A 3TGUH 2WNVC 3LSDA 3G80A 3H1LH 3ACHA 1SLLA 2HWD1 4RQFA 5CA0A 5EZYA 2GAUA 5T5OA 4UW6A 2WAOA 4JYBA 3CCRV 4NHXA 2QZ2A 3ECQA 3MLLA 3OBTA 3HR9A 3MW2A 5BXZA 1X82A 1RUF1 2MEV3 2E5LB 4WVZA 1ZZBA 1BQZA 2ATKC 2YI9A 1R6TA 3ZHRA 3W7UA 1W8WA 4C7UA 4UT5A 1AJPA 5IVFA 4P9GA 5A3WA 4PELA 3RT3C 1EV11 1DQ4A 2JG9C 4QB6A 2VMEA 1VB2A 5I0SA 3K0DA 2OPKA 4Y5Z0 3MUY1 2G38A 3PIGA 5DDJ2 1N1TA 2SLIA 4JGZB 3WLUA 3ZHTA 2YXYA 4QDRA 3D5OA 4FPLA 4IEXA 3POJA 3CD6V 4FVMA 3K57A 2QM7A 5D1IA 1QMJA 4Y1YA 4JGSA 4Q4Y1 1Y4MA 3MV01 2P3KA 2VMDA 5IE9A 1LCLA 4CYDA 3MLKA 4KGGA 2ZX1A 4D6QA 1IZ3A 3AXEA 4YZ3A 1PO23 3CBNA 1FJGB 4JI0O 4YJ2A 1VIWB 3N7JA 1VBE1 4CXYA 2WN3A 3M3OA 2J1VA 2X09A 3H9VA 1OQDA 4QDQA 2RS33 4I0XA 1IPSA 1OUSA 4Q4V1 1XILA 4Y4YA 4QD2A 4KU7A 2YSUB 2X5IC 3T1HB 2WAAA 3ETEA 2VR4A 5DUXA 3WG7C 1AF9A 2GC2A 2BNOA 4UBHA 4YHHB 1QQCA 1SKVA 3B9IA 2Q0AA 3ZCCA 2XWJB 4OFGA 5T5PA 2YYOA 1RUJ1 1QOSA 2A3WA 4GH4A 4G27B 2YMZA 4YLZA 1LOFC 4ZU4A 3ZJZA 3QO8A 1SBEA 4H14A 3DF0A 4CRQA 2ZR2A 1W04A 2Y6HA 3SISA 3CE2A 3MIBA 4FLTA 2ERFA 4J1XA 3AMHA 1YIJV 3VBOA 3BOWA 4E8DA 5EC1C 4AEMA 3JD73 1SPPA 3CJIC 4JGYC 3LE0A 5FLJA 4O4IA 1W8TA 2JS5A 3OTOO 1JUIA 2E74B 1Q81W 1FPN1 1LHOA 3KZIZ 4M3CB 5GTIZ 3KKYA 3I2DA 4LF9B 1JH5A 4NHKA 4PI0A 3SJQC 4RR3C 4K8RB 1RITA 1VAVA 2ZX3A 4KI5M 4P08A 2VQAA 3WY6A 4EB6B 4GUNA 2C5DA 1XEQA 1BEV2 4BPZA 5J2UB 1QJY1 1US6A 5CYYA 1CPNA 2XPJA 1GR3A 4ES9A 3B02A 2ADEA 3N9NA 2R072 1N33B 2VQUA 1V9U3 5EYXA 2E76B 1WMDA 4CC5A 3BN6A 2WS92 4NN0A 3OUHA 5J36A 1WW7A 5E16A 2NN4A 3B8MA 4BAYA 1AL23 1ZZ6A 1V00A 1OPOA 4X1KA 5BUVA 4X62B 4QPIA 5LYJB 4XTMA 3H42B 5D8AC 3TEXA 1UFIA 3GB7C 1TUBB 3S6PA 4DR1B 1DQ1A 5BY5A 2WFF2 2VVDA 2QWRB 3B8NA 1BT8A 4Q5OA 2PA7A 4XHBA 2ZPXA 3IAQA 4TT3G 3JU9A 3S0MA 2OTLV 2BOCC 3U75A 2LO1A 1H1IA 2EZPA 4ZHQB 1OD3A 1F7YA 3L72H 3SMHA 4QAWA 3PVBB 2EINB 4N9HA 5BNOC 1CVNA 2VOTA 4FAGA 2Z69A 2HJFC 4KP4A 4YNIA 3BTYA 1WCKA 1JPXA 4I0WB 4LNUB 5AVPA 1UN1A 2UXDB 1N34B 3CCQV 3QO5A 1XREA 2A7AA 2L6LA 4BE3A 2NZ9A 3JAMN 4OMCA 4X65B 5J37A 5C3SA 2UUBB 3CJXA 4RWUA 2XAJA 2JG9B 1S72V 2WABA 1GP6A 2ARCA 1Q8QA 2UUAO 1POV1 1JHNA 1US3A 2K0GA 1HR0B 3HQRA 5EYYA 4M3CA 1GM8A 5K1PA 3M3QA 4Y4RA 5LCWL 3STLC 5C3OA 2RG4A 4JQRA 5FZOA 2ARAA 1K5MC 4XFFA 4IE5A 2B7YA 4WBBA 1ASJ3 4UAPA 4O4LB 2VNOA 2ZD9A 2A3XA 2JDAA 2Q6AA 4FM2A 3PTYA 4RYDA 4BW5A 3ZHVA 4NROA 3KCCA 2H8PC 1Z0HA 2AHYA 4BW9A 3LDRA 2WUHA 3MPPG 1QDCA 4Q0SA 4IDZA 3TNQA 1XU1A 2C24A 4Y5SA 3UYJA 4MXWB 4EN7B 4A6SA 3JB8A 5FZFA 3T2MA 3POWA 4ZHNA 2FD8A 3J8F3 2AW9A 4K8FA 2X5IB 4F83A 1LOAA 4R9CA 1R1A1 2LS6A 1P7GA 4LFAB 3VHOA 4Z2WA 1RUD1 5G04L 4YGCA 2HKOA 3RBZA 2XAGA 4BLIA 2PN5A 1GOGA 1O6UA 4OUSA 2BZDA 4YJ3A 2XJRA 2H6CA 4FOYA 2ZGQA 2YI8A 4DRRA 4XXAA 3I3BA 1IHMA 1QJX2 3I2KA 4FLZA 3NV2A 1OLME 4XJAA 3M2MA 1OURA 3AFKA 3K51A 2BNNA 4DEVA 4XJWA 3HQUA 5FWJA 3CJIB 1W03A 3BPZA 3LCPA 4JGYB 2PI4A 4PDWC 1GLHA 1HJFA 3H8UA 1WD4A 4CU9A 2W47A 2HEPA 5AC92 5EYPB 3LEKA 2HVJC 1ALYA 3KT4A 4U7NA 2WLNA 2DWEC 5IFTA 2XOKG 2VW0A 3AG2C 3LWCA 2QQWA 4M0NA 4AHCA 3HNMA 3ZSLA 1NY72 2WT0A 1QVGU 3EMRA 2EJ7A 1REDA 5IVVA 4DR5O 4GMP3 5LA2A 1X36A 3F2ZA 4PA3A 1UZVA 3T0DA 5B66Z 4DV6B 1KP2A 4P5YA 5F3IA 1NCRA 5KHIA 3N9OA 4PLMA 3TNPB 5GLVA 5KXCA 3O5SA 4MO3M 4CA9A 1PPJH 2W68A 4LIUA 4N53B 4XUPA 3BY6A 3N9MA 3VKNA 1IBMB 3SH5A 3RVYA 1FATA 4UBGA 1QQP3 2WFPA 4OI0A 1OCRC 4EWAA 2Q1ZB 5IWAB 1IKQA 5FFOC 1GRJA 2BYVE 3PJQA 2QQUA 4ASMB 3TCUA 3HQXA 4E4ZA 4MX3A 5EIBC 4NXNB 2ZR3A 1PK6A 4ZPIA 2QKCA 3AXDA 1YQ2A 4TLGA 3GWKC 5JSOA 2HWE2 5GALA 3L9DA 4HSJA 3OUFA 2IH3C 5A7WA 3MLJA 4Z2AA 3OTFA 2HWB2 3GBFA 1E1RG 1S5LZ 3MHHC 4BQXA 3T4DA 1JODA 3P3NA 2BTOA 3N4MA 1XXNA 3CCLV 1DQ5A 2KQXA 1YJNV 1ZRIA 4YM0A 1ST8A 3UV9A 4LKFA 2EZOA 2QKSA 1GZ9A 3L2YA 3ZLIA 4J7JA 1CJDA 1WW4A 1PD3A 1JMKC 3OBAA 1PIV3 2JS3A 5BMVA 5L73A 4IL7A 1BCCH 2FZ1A 1NH2D 1G86A 4COWA 5L36A 3B93A 1BZKA 4Q20A 3AKQA 4AQTA 1CZSA 1ZYBA 1AB3A 2N7GA 1VBC3 1G6UA 2ZE5A 2L35A 2R70A 2WKKA 1LHWA 1I3HA 1UXXX 1REEA 4LHNA 1JW6A 4WBNB 2Z79A 1S0IA 1K5MB 1VE0A 1RM1B 3SR2C 4MSVA 4AEJA 1FXVA 1LESA 4Q4X3 3L75H 4NRMA 1LR5A 1O4TA 2AUYA 4RUFA 4XDOA 4LTAA 2YS8A 4FVVA 4O9EA 2A6YA 4YVWC 1NKDA 2BOJA 1PMIA 3IDAA 4BWOA 5LB6A 1FFXA 1HQWA 2IXKA 1HIXA 1NUKA 2E31A 2F4VB 3WB1A 1ZZ7A 1GN4A 1MS3A 4UFKA 3KCYA 1ZA4A 5A6ZA 3BFRA 3C3TA 2DU0A 5B1OA 5DAVA 4MVSA 5FZ4A 5F3CA 1E79G 1H30A 1TNRA 2DUOA 3CB2A 2W2IA 2JXAA 4NWWA 3EHBB 3ABKC 5FZMA 3ZM8A 3H9AA 2P5OA 4ZOLA 2J1RA 3ZYRA 1OKOA 2BJSA 3HBZA 2C26A 4PV1B 3ZN5A 2NNUA 4BM8A 2RR13 1JUHA 3NV1A 1AX2A 2A6XA 5FDBA 4A5UB 4FK5C 4FQZA 3EFFK 1C5IA 4H37A 2I74A 5A7QA 4GH4C 4HNAA 1K34A 1D4M3 2B9UA 2QDRA 4CP9B 2YPDA 5HXMA 2GTAA 1RVF2 3VBOC 1QJU1 5BNPA 3GALA 3J26N 1AJNA 1RFYA 3T4HB 3OOXA 2WQZC 3AP5A 5KWRA 3ACIA 2P1BA 3GXUA 4CDUB 1OH3A 2DW4A 5ANNA 1AI4A 3OW2U 4LPLA 2OXBA 3F5WC 3ZMUA 2OCCC 1DGSA 4JVAA 2J1AA 2D5HA 3I3EA 1W90A 4HZFA 5L3DA 4IT5A 3JATB 2LW8A 3AG2B 4CE8A 1NOVA 3B00A 2YXHA 4I30A 2V5DA 1MZFA 1PX3A 2W08A 4EN6B 4MTGA 1F9KA 3AMNA 2CH7A 4X8AA 3M4FA 1WP7A 1O3RA 1D2SA 4N9IA 4LQRA 4WV8A 3IM0A 4Q0VA 1SETA 4JI2O 4GZ9A 4DXTA 4CU6A 1CAVB 4Q26A 3HN1A 1OVSA 5FYVA 2B9VA 5ACA1 1KRIA 5A3UA 4WVWA 4O2AB 2Y6FA 3RNSA 5FR3A 5A7NA 4CDXA 1O8PA 3WNOA 2UXCB 1RUH1 3AK2A 4QPIC 4J41A 1ENQA 3K75B 1AROP 3OUJA 3M8LA 1BK1A 3Q8AA 1CAWB 1PL4A 1CGPA 4MTFA 1W28A 2VTXJ 3BGAA 3OGIB 2PZSA 3LFMA 1AVBA 1IBLO 3AMQA 2Y33A 3BIEA 4CCNA 4JYCA 2WAMA 4X9QA 3SGIA 4FFIA 4D7TA 5DZFA 4D8MA 4BQ3A 2KR2A 1QGLA 5FIXA 2QR4A 2D6MA 4AI2A 3VDBA 3WNMA 3UK9A 4ET7A 4QPGC 1DQ0A 3OPWA 3LDKA 5GLTA 2VTFA 3QACA 1VAMA 1EAH3 1YF2A 1UYPA 2Y0OA 3FUOA 4X20A 5FJKA 1XYNA 1R1BA 3OYWB 2WQ8A 1T6BX 4DV7O 4OUEA 3AK3A 2BBAA 1FNZA 5JXJA 1Z78A 3RZZA 4OULA 4F6RA 2DTYA 4WM7A 1VLNA 3ABTA 1L1FA 1AYM1 2ZMLA 3EXAA 2XJPA 4CP9A 4WFBV 2FDIA 1O5LA 5A32A 2YIBA 1UX7A 1KITA 4DR2B 3VDDA 1YI9A 1LRHA 5F2VO 5T52A 3ZYHA 3E6CC 2YUAA 4JI1B 3DXRA 2ODMA 3TWIA 5KX5A 3H50A 5F5AA 1HV0A 4ISQA 5A3LA 1U5YA 1XE7A 3H0OA 3N2GB 2VUAA 3RZKA 3E22B 5C8YA 1FNYA 2XWBB 5F5IA 1PVC1 4FM1A 3KS7A 2RN9A 1IQAA 1LNQA 4OQ8A 4YVWB 3ILNA 3U4XA 5EQUA 4DR6B 1W8ZA 2D6PA 2O57A 1I0HA 4IGGA 1WZXA 1YTFB 1R73A 2K9ZA 2DF7A 3N2KA 1AXZA 1W6OA 2ZGLA 2AEYA 4AI0A 1N1YA 5F2WA 2ZGSA 3MAQA 1C1FA 1F4NA 4Q6GA 5LMUB 1UO9A 3UO2A 2ORXA 5JOXA 1BHGA 4J25A 4LT5A 2CDPA 3SEEA 4CZZA 5KHGA 1K33A 1Q86W 1B35A 1LUWA 3WW4A 1X59A 4YG0A 2Q5TA 3CP1A 1RL3A 2D6LX 1HRI3 4PIXA 5HV4A 1OLMA 1MZ5A 4LEJA 2GDSA 5AVAA 1A6CA 3VZOA 3G6EV 1O7FA 1PKXA 4YM2A 3OMAB 3HEIA 3K2OA 2XLFA 4JHZA 4PF5A 4EEQA 4CCMA 3AK1A 4LK6A 1CIYA 2UWBA 4GJYA 1QCEA 4CEWB 1KDMA 5JAXA 3MHSC 5FZLA 4XC9A 1JZ2A 4YGBA 2VMGA 2QA4V 1R64A 1GOHA 5FWEA 4NJ4A 2OCCB 1ZUQA 4JYYA 3RYHB 2HEYF 3VHPA 1C28A 3LEGA 1S0CA 2VZ3A 1PZ9A 5FZ1A 1EY2A 3NMBA 2ZTNA 1BL8A 1R083 3KGLA 5E1AC 5DDJ1 2JKXA 3THOA 1HNWO 4GX5A 3JAKB 1ULOA 5A7PA 3H8OA 5CZKA 2R6QA 4QDSA 4UXNA 4WZFA 1NKGA 3T09A 5I8TA 1V6IA 4CH3A 3VHRA 1NCRC 1GYKA 4DR7B 2QQLA 4HFSA 3AFGA 3ZSMA 1AYN2 3NV4A 3FKSG 4JPRA 5J3UA 2OCHA 2BTVC 1XNQB 2IZWA 2VD7A 4TWTA 2VRZA 4IGPA 5FNVB 1YTFD 2DTWA 1TME3 5FZ8A 3HMYA 4L87A 2JRIA 2PLV2 5I0UA 4LBQB 3FFQA 4GIQA 1ZVFA 2EXJA 5LBFA 3GDBA 5F39A 3JASB 1PK6C 3ACGA 1NVPB 2CDYA 3FZ3A 1F4AA 3I2GA 5LRSA 3CEWA 1DZTA 1JYTA 5B1BC 1PVXA 4RHV3 1ZZ9A 4QPGB 4F7ZA 3D0JA 1K73W 1MQTA 4Q4W2 3O1TA 1Q5OA 3Q8EA 4KQ7A 4UW3A 1GN3A 5C7GA 2IJHA 1NLSA 2WLKA 4DYLA 4HK9A 3DGEA 4JAVA 3W5NA 3IAPA 4LBKA 4B3RO 4O4JB 2W1UA 1OOPC 2YBSA 5DUVA 2NLRA 3AK0A 3IPVA 4R9BA 3Q8FA 2HWF3 1S3JA 1YJLA 4TOIA 1N36O 4HKWA 2EAAA 2XLAA 3GCXA 5EZWA 5KBFA 4JYAO 4L9BA 4KHPB 5J09A 4YY3O 3I2OA 2CYFA 3CMEV 1PNKA 1YZBA 5LA6B 2NN8A 3CJHB 4TV9B 3OAAG 3RYHA 4N8MA 1MEC1 1HN1A 5I0DA 2R042 1I1EA 2EALA 5D5PA 3EQEA 1BEV1 1JZ7A 2EA7A 2ZJCA 3APQA 1X8EA 4I5SA 1VEWA 3UCSC 4S2HA 1JR9A 5EHDA 4XUOA 1OKQA 4RUEA 4QHOA 4P00B 3K3WA 1DDLA 2WS91 3KQRA 2B1GA 4JKKA 4B3SB 2JDUA 2E63A 3H1KH 2JB8A 5CKQA 4AHYA 1ZLZA 3BALA 2XAQA 1D5AA 2WR9A 2R9RB 4U3JB 3ILRA 1FKAO 3IBMA 3A21A 3RN4A 4NHMA 4OHZA 2ZGRA 2ZXQA 1OXCA 2UU8A 2XKPA 2YEVA 5IJ0A 5FPXA 4XBLA 3TEZA 1MZ6A 4D69A 3ST7A 2WFF1 1F31A 2YXLA 2JIGA 5FZ7A 5LRRA 5DZGA 4NRQA 4P2ZA 4LBQD 4IHJA 4UB8Z 2VCCA 2JWPA 4FSJA 3ICXA 3K5NA 3WNLA 1BBT2 3BUCA 2QTSA 2R30A 1HWYA 3THDA 1PGW2 4DK1A 2CSGA 4Q4Y3 4DRXB 4LK7A 2WPDG 4GB32 4I02A 4L92A 3ZSJA 3MHZA 1A3KA 4RL7A 1SEFA 4IXLA 4PCRA 5J98B 1W6QA 3NSTA 1OH4A 4ZKIA 5BNPC 1VBE3 4QB1A 3VBHB 3ZRXA 3G4SV 3CCUV 4DR3B 4E8CA 1THZA 3NKTA 4YG6A 4IGOA 3ZFEB 3MW3A 3ES1A 4FFKA 2AZ0A 4PHZA 1UIJA 4JI8O 3CO2A 1PMJX 3ES4A 4FTBA 2D93A 3WX5A 5DAQA 1C57A 1DFQA 1UMZA 1UZYA 3J7LA 4NIDA 5C4WA 3I2JA 5EV7A 3QVNA 4COZA 1UOBA 4CXXA 3LAGA 4K3UA 1BMFG 1RUJ3 4BQ5A 3GZAA 4IV1B 3K5OA 1YIFA 1KS5A 2HHHB 2EULA 1PO12 2YGLA 2JD4A 3PVNA 4R6ZA 1JX9A 3E86A 1XNRO 3TN93 1W39A 4P9OA 5GKAC 1Q82W 5K8SA 3INAA 2JIJA 2P4VA 2C6SA 3ZN6B 1FS0G 3QO7A 4IEUA 4CPBA 4CPBD 1M1KW 3WT3A 4IE7A 3D82A 1ZL8B 2IU3A 4LA3A 3OPZA 2A73B 1M06G 2GUZA 5L9BA 2MEV2 1HB1A 3JCZA 4Y22B 1V6MA 4XQDA 3VBSA 4GKXA 2Z4FA 3VDCA 4DZGA 4XF9A 1N1VA 3UGFA 1WN7A 4LBLA 3LQCA 3NNMA 1OZ0A 4QGLA 2UXBO 4FXGB 3AEIA 2QUOA 5B1BB 1GP4A 1WMXA 2BTQB 2AREA 2R9IA 4QQLA 3HOBA 3APBA 1N0JA 3JAWA 1Y7BA 5JOWA 2DOSA 1ENVA 5IY5C 2YPJA 2FDKA 1QJX1 2ZA9A 1F23A 1HB2A 1VQ8V 4KH9A 1V6NA 1OOPB 4CH6A 2Q69A 5JVDB 1S0VA 1VF7A 3TETA 2WSUA 4OQ9A 4LFBO 4AFMA 1AR61 5LY1A 1J84A 3WZ1A 1UMIA 4DW0A 4H7MA 4ARYA 4Q1PA 1XQ8A 4K40A 3HJRA 1UY4A 4B1MA 1CR7A 3SQOA 1WA6X 1VF6A 1RYYA 3MFAA 3G7DA 5JZGA 2WLLB 1UL9A 5FZ0A 5B4XA 3VDDC 3T2TA 1PO22 4KL1A 2VOWA 4MVOA 1S0GA 4X88A 2IC1A 1W59A 2X05A 5L7OC 3KV6A 2RS32 3KB5A 1WPBA 4LF4O 4CEYA 4QNHB 3W21A 4RGAA 1S1AA 1NY71 4YXWG 2WNUA 1G9CA 2AXTZ 2RJKA 1ZNPA 1I9RA 3EJKA 1NXMA 2RE9A 1YXBA 2I07B 1KP3A 3IIIA 1XNKA 3AZZA 4HG6B 3A7QA 4KG0A 2VW2A 3OTOB 1RJ8A 5CFCA 3PUIA 4QQPA 3PL0A 1F4HA 2WRAA 4TTGA 3D6EA 4BQ2A 1AR92 2ATFA 4X6RB 1SQGA 1AX1A 1RSOA 3RI8A 4AGGA 2DV9A 2XHNA 3UM7A 4HVRA 2FDGA 2BV4A 3JD72 2RVAA 1POV3 2BSKB 4HN1A 1WWYA 2JDMA 2ZGNA 2ZEWA 2XMLA 3TBDA 3WF4A 3ZOIA 3OEEG 4LUMA 5GZEA 2HP8A 3DL3A 5FZHA 4JTNA 2HWE1 1JZ5A 3UESA 2KA3A 1UQXA 2FB5A 2HWB1 2D5FA 2H6BA 4D0QA 4BIFA 1POQA 1V54C 4L2NA 4IE4A 4QX1A 4FFBB 4ZU7A 1Z5WA 1O59A 3RYKA 5F37A 2PYJA 1NZIA 1V9U2 3QF7A 1SQXH 2HKXA 5L3EA 2V72A 3EYPA 5IVEA 3ZFGA 4GKJO 4K0KO 3VBBA 1YEWA 1MS0A 1AL22 1Q8SA 3H01A 3PUSA 2ZX2A 3RGBA 2Y48A 1Q8PA 3L74H 2RS52 3JARB 5CG9A 2XLGA 4ASKA 2YIAA 1RUD3 2XG3A 3LFIA 3SPGA 4B3TO 4LF5O 2ZBJA 3I2IA 4CCKA 3F7YC 3GBWA 5GJ6A 4UF0B 1W9TA 2RV9A 4CCCA 2YZ4A 2UU9O 4DV0O 3HD8B 5LP6B 2XH6A 4RFRB 4XJ9A 3WW1A 1AR4A 3K06A 3WP4A 1DZRA 4XFBA 5GLZA 5LHIA 1ULDA 2V09A 3H1MA 4V2VA 4I9WA 4OGQB 4NMIA 5ABJC 2UUAB 2QWQB 4K20A 2UXXA 5LGUA 3FLPA 3MIEA 4Z92B 3WP6A 1VQ4V 4UVCA 3P5BA 3S30A 4IEPA 3FAVA 4EQVA 3AZVA 4QQ2A 5HFLA 2VZ1A 1WLDA 4ICGA 3SJAC 1RUE1 2UURA 2WN2A 4E4EA 1VQLV 4X64B 3ETGA 4AI8A 1BXHA 5JIAA 3VBRA 1Y43B 2VOKA 3HBKA 1MACA 1MQTC 4A44A 3UKMA 4LF8O 3IDEA 1AR72 2XOMA 2R0FA 5IY5B 4A4AA 2IXHA 3FC0A 1IVSA 1NLQA 3MDPA 2Y6JA 1I5XA 2ARHA 5JH7A 2Y4TA 2BGOA 2H0BA 4X66O 4LCUC 1ASJ2 1RVF1 1DU3D 3S57A 3CHXA 2PF4E 5I8YA 2EIKC 5LA0A 1RUI1 1W0OA 3CPWU 4Q1RA 3BPSA 4BH9A 4QKDA 4X1IB 2CGOA 1XHZA 5KMGB 4FP3A 5G05L 1JA8A 2ZGOA 2VQFO 5KC6A 4UI9L 4IV3C 5FZ6A 5ITZA 4JTAB 2V73A 1Y76A 1QKQA 4XDQA 5L7OB 1GQGA 3FBYA 1VQ6V 4DXSA 5TISZ 1UY3A 3QBQA 4XIOA 1SFNA 3VKOA 3RFRA 3J8F2 2GNTA 3DUIA 1VQ9V 2OIGA 5FOBB 4KFMA 1SQFA 5JI7A 2VPVA 3ML0A 1AP6A 5GTHZ 2BP6A 4RA0A 2BE3A 4JF3A 2V4VA 4FPGA 1NYWA 4IYHA 1OF4A 1EN5A 5CBGA 4XABA 5IJ9A 1WLEA 4QPYA 3HPNA 3KHBA 4QMAA 3AKPA 2YICA 3IN9A 1J1LA 2F6BA 1C8NA 2Q8OA 4XXPA 3SC7X 1BHAA 3VD7A 4PF1A 4DV1O 2OYQA 1XRUA 3POIA 2DCKA 4I0AA 1FXKB 3AKSA 1H8TB 1KYOF 5EP9A 3SHRA 1UY2A 4XCBA 3LA3A 1BYHA 5C8CC 2IBZH 2YV8A 4LBOA 1Q8IA 3ENRA 1D5NA 1D0HA 2YY1A 1JYIA 2X10A 1VRBA 4IETA 3CIHA 1FYUA 3APOA 3HAGA 5J1XA 1W0NA 4R8HA 4DV3O 1G8WA 2R32A 1QNYA 4HETA 3TJTA 1ZBE3 5FZGA 4H13B 1APNA 1EN4A 1RPRA 1O4ZA 5I0TA 1LHVA 3MFCA 4BR6A 1L8DA 5H9PA 3K77A 4LR4A 4BXSV 2GHYA 4CZSA 4XPVA 2D43A 5A33A 1HB4A 1FD9A 1D0GA 2VH9A 2XL9A 4RAIA 4HSLA 1QQP2 3NNGA 4XDLA 3FL7A 4PIYA 4LITA 1COV3 4LJHA 2XJVA 5EC2C 3TXSA 4N90A 2CDOA 4YW7A 1WW6A 2QQNA 3Q4HA 3K04A 5DABA 3BTZA 1ACCA 1BVP1 2J7MA 4BJ0A 2E26A 3J80N 2OQ6A 3UT5A 1FXZA 3WNKA 4GWJA 5JJNB 1K92A 4AVBA 1QJU3 4Y3OA 2W0FC 4MG2A 5E6HA 5A80A 4IE6A 4AG4A 5ABJB 3H3ZA 2Q8EA 4AI1A 2PHXA 2HEWF 1W06A 4W65A 1DF0A 5JR2A 1OSGA 4FBFA 4JV4A 1IURA 3GF6A 1UMHA 2Y8KA 1DK1A 1AXKA 3AYEA 3BKZA 1PIV2 1S0EA 4A7KA 4X8PA 4UWDA 4EROA 1GKFA 3RZGA 2QFEA 5LGNA 4QGNA 3VQXA 3MIDA 3THCA 3SDLA 4L8JA 5JOZA 2ZZJA 4TV8B 1VBC2 4EJRA 4QU2A 4U2AA 2VOXA 4DUWA 4UW5A 4ZZ5A 4HN0A 4OHWA 2JDIG 4QKNA 4PA7A 5ACA3 3GHMA 4JZGA 3USUB 4I50B 2VQ0A 3B5LB 1QY4A 2DBIA 4Q4X2 1JOPA 2ZACA 2A9HA 4LC1A 3UO3A 2EIKB 1Q6IA 1RUH3 2BFUS 3FX3A 1JYWA 3JZVA 3V0AB 4IGQA 4JV5O 2R9AA 3SYAA 3G67A 4IIJA 3SH4A 3OGGA 1HNXO 2J1EA 2RS13 2QQMA 2F4PA 2ZGKA 4UFZA 2VZVA 4PD4F 4FOVA 5A3TA 4IV3B 3SKVA 3ZIXA 2A6VA 3ZSEA 5FPAA 4WCEV 4GKKO 3GYDA 1H9WA 1DP0A 1MOFA 4LHLA 3ZFFA 1P8JA 1RUOA 1NZ6A 4MW8A 2YU2A 5A7SA 4BHPA 4CEYC 4CDQC 1H4GA 5DM6V 5CBFA 1AVMA 2LRPA 2I2SA 1XMQO 5BR8O 4JRLA 3SPHA 2YFUA 3ZDVA 2QDOA 2BVVA 2DN9A 3T2QA 2RR12 2KG7B 1C5HA 5LW9A 2PHWA 2DVFA 5B1NA 1OA4A 1O8SA 3ASNC 3CMAV 1GZWB 1JOYA 1TQ5A 4MGTA 5CFCC 3HB3B 4UVAA 1SQBH 2OW4A 4JZ2A 4OHVA 4XF1A 1UYZA 4UVBA 3JD2A 1ZRFA 5FQ0B 3JBG1 4AGVA 4PI2A 1SDWA 4QHZA 4HZ3A 4FMTA 1B06A 3VBUA 3WV6A 4J1WA 2H3OA 1JU3A 4HLTA 4EN9B 3CU7A 2VZTA 4TSFG 3H1HH 2BNMA 1GO3F 5FO8B 4JI2B 1RB8G 4UCVA 3M3EA 3KT1A 3DC5A 1CZTA 4TWKA 5FMOL 2VZOA 5C8CB 3EHKA 4FLWA 1PVC3 1KKCA 4Q4W1 4WVMB 2WLMA 2ZKLA 4NHYA 3BA8A 4N43B 2RDCA 1XU2A 2IWGB 4LBMA 4LLFA 4YGEA 4X8NA 4F8AA 1IOAA 2ITCC 4CCDA 1GWKA 3C7EA 2IXCA 2B45X 1CX1A 3QLQA 4Q2FA 2DFCA 2X8KA 1V9PA 4BCUA 2EIJC 2P6JA 1GFF2 3FMGA 4HKOA 3ZBHA 4QPJA 1SLCA 2V4DA 3ABMB 3W58A 2R49A 1RHI3 1NBMG 3RJ2X 5DUWA 4AWDA 4CS2A 2DWRA 2ZHNA 4GWMA 1OLRA 3EVKA 1SA0A 2GSYA 3NAPC 2P3YA 1I08A 2VCBA 3ACFA 1L0LH 2Z0AA 3PDQA 1IS3A 1J3QA 5J96B 2R041 3F5TA 3D3AA 2D3RA 4CC6A 3AP4A 5LBEA 2K1EA 1CESA 3T1YO 1ODNA 3FFZA 1MSWD 1XMOB 2YDEA 4CVUA 4HVOA 1KUQA 3B4SA 1ND3B 1GKBA 1EAH2 3OD4A 5EK0A 1T5EA 3HKDA 2X7RB 2ZMKA 3ZKUA 1OHHG 1H4HA 5LOVA 3D36A 2F4LA 4M0HA 1RC6A 1BJQA 2AACA 3CXHF 1H2SB 1NLRA 2E75B 3AM2A 3CC4V 2P37A 3RYFB 2E5LO 5DDJ3 3BA9A 1H6YA 1LB2A 5IYBO 3K4AA 2PUSA 5C9AA 5FK7A 4E4HA 1BBT1 4UV8A 1M57C 3VBRC 1WMEA 1PGW1 1LHNA 4LLOA 1CAUB 1NCQB 5FPLA 2PHLA 4GB31 1OQEA 4QXBA 5BV6A 1WCDJ 1S55A 4J11A 4RQPA 2ENRA 2E53A 2EIDA 5FREA 4Z07A 3WG1A 5IK4A 4CBCA 4LF7O 2JG8C 4M4PA 3KVAA 3MF9A 1CONA 1Q8OA 1JZ6A 5FXZA 4A7ZA 4TN7A 4IEQA 3CC2V 3IGAC 4URTA 1N3QA 3T08A 4V2WA 3ETDA 1CAXB 2A7WA 4P9PA 2PELA 3SNMA 3WNPA 2D3PA 1FJGO 2VU9A 4FPHA 3K59A 4LHSA 1WP8A 4LFCB 1V0AA 1UD1A 1PGL2 4CDQB 4QQHA 4WM8C 5F3GA 1X8MA 3KG2A 3WG4A 4ZZ8A 3IC7A 3ZRWB 4AHWA 3WDVA 1H8HG 2IH1C 4M3CE 2VUDA 3DPRA 4X6QB 1HRI2 2PI5A 2E7AA 3LZZA 3ABLB 3ASNB 1DIWA 3T1HO 2Z5UA 2ZEYA 4UXAA 1W3VA 2KB1A 4AQSA 3K9SA 3IDCB 1SZXA 3KCXA 1BSMA 4YHHO 1W0JG 5B3SC 1HRV1 2W3JA 4BB3A 4AEDA 2MEV1 3ASIA 1P84F 4OVEA 2XJSA 2GNMA 3BI3A 4FLYA 1OCCC 1NE6A 1MEC3 2DYSC 4BK5A 5LEJA 2EIMC 3A2FA 5D5QA 1QR9A 4F4LA 2ARXA 5BXXA 3H1YA 2CGPA 4CP1A 5JSPA 4CP0A 2EIBA 2NYYA 1QLNA 1W8FA 3K48A 4JI3O 3O0WA 4GX0A 3C7GA 2FZ2A 2OIIA 2B46X 2AZ5A 3WUCA 4CUAA 1R082 4YARA 2WZR3 3HKEB 3EBRA 4LF9O 3OEAA 3UQ8A 5FYTA 2JJ2G 5FY1A 2LGQA 3IMNA 2DUQA 5CB4A 1C8M1 1K42A 2D98A 2Y60A 1ENRA 3MZHA 5GZFA 3ZRSA 4LO8A 4AQYB 3NVCA 3T4VA 3B01A 2ADDA 1I94B 5FZIA 1GNZA 3GWOA 5JWPA 3ATGA 3LDDA 1U5ZA 4B1LA 5AFBA 1TGOA 1W6MA 1VBD1 3LGRA 3SCGA 1N47A 1SCSA 1GNYA 1TME2 2TEPA 3CMGA 1LEDA 2XBO1 1XNTA 5LK5A 3TXQA 3BODA 4NAMA 2RS31 2LTNA 3OE7G 3LSUA 4X62O 4B3RB 2Y4UA 3ZYPA 4LWSA 1Q90D 4JQTA 1S0FA 3N35A 5E89A 3S3XA 3JUUA 4RHV2 3ELNA 1RUG1 1TE1B 1P7BA 3U1XA 4I4TA 1N36B 4M00A 4B4RA 3DSQA 2UUCO 3DC6A 3JALA 4E4SA 4WZCA 2YC0A 1GANA 2BWCA 3LEMA 2XAFA 1IS5A 3WD5A 5GONA 2CHHA 3ZYIB 2H0VA 3K5LA 1PNMA 1AR91 5CA1A 5JPNB 2G9FA 4Q8KA 1QNMA 1LEMA 5JXGA 3OGSA 4Y1ZA 2NQYA 2HWF2 1K8AW 4B7EA 2XVKA 3FB5C 5CBLA 5JDBA 2UXDO 3FJSA 1EUTA 4GLXA 1N34O 3WF1A 1M9NA 1TVKA 2EXHA 2XKOA 5FBZA 3VD3A 3OMNB 3AP9A 4TUYA 4L97A 3P3PA 3A0HZ 4X65O 4X1YA 3ZMSA 4C1XA 2PHRA 4MW3A 4KXRA 4DB5A 1R091 4FLVA 1REFA 2Y69B 1S5JA 3ASOC 4B29A 3LIGA 4O65A 1HR0O 3A22A 2KXLA 5JQGA 2FQPA 4MLOA 2JG8B 3BU7A 2DFBA 2HEVF 2CWSA 1ND2A 5JI9A 5DAPA 2MHFA 3MI8A 3USSA 4E2LA 1NTZH 4G4FA 4HAMA 4XIKA 4CCLA 3T1MA 4A3XA 4LP8A 3POGA 1POV0 1WA8A 2ET1A 3B69A 4META 3URFA 3HT1A 2WZPP 2E6VA 3OY8A 1FFTB 1PNLA 3CRRA 2IJKA 1W6PB 5JJEB 2RS51 3WHUA 4P9JA 2W94A 3L71H 3WB2A 4GKYA 2H94A 4CUGA 4NVPA 4WM8B 2JJ1G 3OSDA 4K21A 1BE3H 2WL1A 3B77A 2GMPA 3I55V 5FPBA 2Q68A 2ET7A 1WBLA 2R1BA 2LQTA 1ROPA 2SBAA 3D3IA 4WFHA 1FV3A 4Y20B 1E5IA 2JGDA 2ZNIA 3PURA 1AR63 4TQFA 4Q4Y2 5KA5A 4FOQA 3CLPA 1UZ0A 4CDWB 2RJZA 4KBZA 1QLEC 1SQQH 1MG1A 2LP7A 1SF9A 3VUOA 1N8RW 5T5LA 3FD9A 1X50A 4MTOA 1CJPA 2KKWA 4YIOA 3AP6A 4EYUA 4O2BB 5LASA 2DYSB 2EIMB 3KWVA 2PYLA 2O8QA 3OG2A 1XNRB 4PBOA 5IJRA 5BNNC 3N27A 4YW2A 2E33A 2E9QA 1AR5A 4GCZA 3OBRA 3DEMA 1O9GA 1AR71 3GJBA 2N05A 5JMOA 4IEYA 4Q0QA 1HJGA 1GBGA 4OXSA 4NUBA 1AR1B 1RUJ2 3UT0A 2W0XA 4YVSC 5KXDA 3U14A 3UJQA 2QQIA 5FZ9A 5K7PA 4GZRB 3GGLA 3L73H 2XHKA 3TN92 3MO4A 1OA3A 3RZMA 2PTMA 2HVKC 1P4RA 4QX2A 2V1DA 2XQXA 1M56B 4G3YC 5LMNB 3OBZA 1MVEA 3LDBA 3OEHG 1NTMH 1XL6A 1IDSA 1UYYA 5FY5A 3JCIA 3ZIWA 1QU0A 4HYOA 3DYMA 4FTSA 2JJ6A 4HPKB 2HWB3 2VMIA 5FMCA 3SYQA 3J8F1 3OUSA 5KA6A 2I45A 1BKZA 4JGZA 3TAYA 2WYFA 2QKAA 5BPXA 4C0BA 3G71V 3QNEA 1YQ8A 4NXNO 3VZKA 3I3MA 3J7NA 4NPMA 2GC0A 3VBFC 2LJ2A 2A3YA 1VMHA 4QX7A 4QIWF 1J5EB 4PA6A 1HNZB 3D36C 3U10A 1LJ7A 2YIDA 2ZM6O 1ZX5A 5FO7B 5EWSA 5JJJB 2JENA 4GD4A 1NA1B 3ZMNA 4LF4B 3NJXA 2EF6A 4XFGA 3ABUA 1OHFA 2DE0X 4LHKA 5FJHA 5CFDC 2XJUA 3ZN1A 4HL0A 5ERLA 1WCQA 1VBA2 2D44A 3RS6A 3LF7A 5LBQA 2GALA 4UFHA 4I0BA 1KKDA 1CXZB 5FMBA 2WNVB 2WO1A 1OCOC 2K2SA 2LALA 2CTWA 3R05A 5B1AC 2QJVA 4KGQA 2VMFA 3KQ4B 2GP5A 4RQPC 4GMP1 1QH6A 2XVGA 3WR0A 1KXGA 1KFUL 3TRSB 1R3LC 4JI5O 2B4KA 2UYBA 2CY6A 1SLIA 1FYJA 3RG0A 3POYA 3H1IH 4DV2B 1J58A 1R3IC 2VVFA 5T50A 4GX1A 5IATA 2ZGTA 4P14A 1KD1W 4GWIA 2P4EA 5APAA 1ZWIC 1RUE3 3M7AA 5BZBA 1AR83 3AZYA 3I4IA 1JFFB 3PTRB 2F4VO 1UWWA 3X2QC 4GA9A 1UU5A 5I8SA 3PHMA 3JD3A 2UXNA 4UCOA 3ZKYA 4BXFA 1JN2P 5IW0A 2C1FA 5M0TA 4EB6A 2BW8A 4QX8A 1TG7A 2HYXA 1N1SA 5L3GA 2G19A 5J2UA 3I54A 1O5UA 4MZUA 4JI6O 1SLAA 5CG8A 4IE0A 2QJ1A 4UB6Z 4ZBMA 2MPFA 1UZWA 5A6QA 2BERA 2ZABA 1RUI3 4Q29A 5T3NA 3PN1A 3AG4C 4I7ZB 5KAIZ 2F17A 3I3DA 4AEDC 1YHQV 4RGKA 1K4CC 2AGSA 1OA2A 4B3TB 5IAXA 3U0ZA 5I91A 4LF5B 5LYJA 3I2FA 1ZRCA 1LHUA 4B08A 4XUNA 1I7FA 3T1LA 4CH5A 4YYOA 4YW4A 1TUBA 5CADA 1ENXA 3ZXKA 4MVZA 3WG7B 4KG8A 5D21A 5BNNB 3SPJA 4DV0B 1LOEA 1XSRA 1ZAUA 2XGXA 4PA4A 4H7LA 3O9OA 2WLQA 4WF9V 3LKJA 2X6AA 1RUD2 1YCIA 3RZHA 2ZX0A 4RS5C 2KM2A 2J22A 1VBC1 2NR5A 1LECA 4ZHQA 2JDPA 2BU9A 3RYIB 3EB7A 1OLQA 4NPLA 3HN3A 1F5FA 1SQPH 1GZCA 1QOOA 4YVSB 4AFAA 3CZJA 2JDKA 3V0BB 1L0NH 3E89A 4EFBA 4B3MB 5HBAA 4LNUA 3OEBA 1YQ5A 4COUA 2VE1A 3MUZ1 4IESA 2HJIA 3H7JA 3OT7A 4GQ7A 2QQKA 4ITCA 4AEKA 4IEVA 1KJRA 3SITA 5FLIA 2EBOA 5JMCA 3E1F1 5A6XA 4XF3A 1H0BA 4RR3B 4HKLA 1E5HA 2JG9A 3BCCH 3ZR6A 3LA7A 5B4NA 3O1VA 1NQDA 2ADQB 2QTOA 3AMMA 2UXCO 4HMZA 4LH7A 5LGTA 5LL6Y 4NOTA 3VZNA 4X66B 3FWEA 2VNGA 3NQHA 4FZ0A 2VQEB 4D7SA 3FHAA 5F6LB 2RR11 3AKRA 4PDMA 4MGZE 1ZM1A 1J95A 2V7QG 1UIKA 3CF6E 1STMA 4O4LA 1RPOA 1HXS3 2VQFB 3SXWA 4FLUA 1OC1A 5L3CA 3CCSV 1WNSA 4P9XA 4DO0A 5D8AB 2E7TA 5K0UC 1UKRA 4PIZA 1I5PA 3PMEA 4MXWA 5CFDB 4W50A 3LPGA 4Z1VA 1W6NB 2W91A 4MGIE 1QEXA 3WF2A 4BISA 5A1FA 3NJYA 2P17A 2ILMA 2X5IA 4NO4A 3KF5A 5BNOB 4ZI7B 4EZHA 1UW8A 3BHPA 1SZTA 4JI1O 1RJ7A 2VECA 1J3PA 3S3WA 2CNAA 1LOFA 3ZYFA 1FXHA 2FDHA 2RDRA 5EPAA 3BVOA 2Q73A 3WCSA 3IFXA 4DV5O 2P6CA 4DO2A 2B39A 4BOWA 4DY5A 3W9AA 5J2TB 3MD0A 2OA2A 2CL2A 2B1IA 1UF2C 3CJIA 1VRH2 4JGYA 2QQOA 3NNLA 2FMLA 4XCAA 3OJBA 4QM9A 3BEHA 4HBNA 1S76D 1PHMA 2HBTA 3X2QB 5EYPA 2LFSA 2WT1A 4MOAA 3WNNA 1FMD3 5C6CA 3A0NA 4XUTA 2P3JA 4YFZA 4DUXA 4RR3A 1W0KG 2XJQA 1BCXA 5LMUO 4PJ0Z 1CPMA 1G4YB 3I3QA 1PNGA 2PMWB 1JJ2U 1XOUA 2F66C 2UWAA 3OGRA 1Z7S3 1ZBA2 1AI7A 1SLTA 2NMNA 1GN2A 4FPCA 4V1PA 2VWJA 1SHWB 2ZHLA 3PIJA 1IS4A 1F8VA 3ZRVA 4OUMA 4WVVA 2GN7A 5KXBA 3H8RA 3S5QA 1ZBE2 1FOD3 3VL9A 1B3QA 4Z82A 1HV1A 3K5MA 3I59B 4AFCA 5DXDA 4N53A 3O1UA 2RMKB 4E9KA 1XNBA 5CKNA 4HANA 1EN6A 3DTUB 3AZXA 2A6ZA 4DV4O 1W8NA 1HDJA 1YDXA 1VP6A 2QZ3A 2PAMA 4NTXA 1ULPA 4BMEA 2IUWA 3ITQA 4QPKA 4QM8A 2ZT9B 5IT6A 3R4DB 5A70A 5FP7A 2DCJA 4AVTA 4RS5B 1WUVA 4UCTA 1NU1H 4CS4A 3VV1A 4GWNA 1COV2 1QIQA 2VS0A 3I49A 3HR0A 2YU1A 1AILA 3TEYA 1NTKH 3CC7V 1BMV2 5C93A 4D94A 2IJJA 4BQWA 4QHBA 3JBG3 4Y1XA 4O61A 1SESA 4PDWB 2ZNJA 1QJU2 2P90A 1R1ZA 3ZPYA 2CAZC 2VZSA 3K0GA 3NO8A 3LA2A 5LXTB 1Y74B 3JSLA 1G9AA 1WCUA 4CS3A 1WJZA 1US2A 4B3NA 2E51A 5C3QA 1W99A 4LF6O 1V70A 4JHTA 2K46A 2XB6C 1XNQO 1HW7A 4Q4W3 2AYHA 4FM0A 5FYMA 1VARA 1YO8A 3RW0A 4AZZA 2WZEA 3ZSKA 4J42A 2W6JG 3AG3C 4WBNA 1VQKV 1RUC1 2WWUA 2VZPA 2NLJC 1K5MA 3ZXGA 1VJ2A 5L19A 1UKGA 2UY9A 3O1RA 2P5BA 2ZINA 5IVCA 2IJIA 3ZXAC 3PNAA 2AGAA 4YW3A 2Z5WA 5ACA2 5C5TA 3E8FA 1LENA 1Q43A 4AQ2A 2RQ6A 2FCUA 2XTAA 1OCRB 2A3QA 1XE8A 3ORJA 1YIPA 5K0UB 1RUH2 2W52A 1R3JC 1RMU1 1Y9QA 3NNFA 2GNDA 3N7LA 1G1XB 1XMQB 2RMU2 5BR8B 2RS12 2WIIB 1PM9A 4EFEA 1O4YA 1W9SA 2LFRA 1YYNA 2DWDC 4EN0A 4ZY9A 1I5YA 5IYDO 1TMF1 3ZXJA 4SBVA 2RDNA 2FYUH 2FHRA 1R081 3N36A 5T54A 2P2KA 5CA0B 5EZYB 2OT5A 2D2CB 4LE4A 3WQBA 2GNBA 1H1MA 2D6NA 2GU9A 3KSCA 5FZEA 1CD3G 3J81N 4AHZA 4IEOA 3JD0A 2HWC3 4TZDA 2VL4A 2VGDA 1D2DA 5A3PA 4JTCB 3I97A 3ZIAG 2QWPB 2E32A 5IVYA 3HKBB 5L3FA 3WDTA 3LEIA 1K3IA 3N9QA 1UCXA 1WB7A 5CIRA 5FYSA 2JE7A 3DECA 1Z5VA 1U97A 3CL1A 5A7OA 4CDUA 4E2SA 2A79B 4B3SO 3IZOA 5HCAA 4ONUA 3BB6A 1ORQC 4XFIA 1ZRDA 4LR3A 3JATA 3WP3A 2R061 1L7RA 5FYHA 4FPPA 1NE4A 1WCSA 3ZN4A 4DMIA 5DZEA 2MK3A 4FXKB 1E5SA 1DLLA 1PVC2 5FZCA 3LD8A 1NZCA 2A70A 3POBA 1WBFA 4CP2A 2DCZA 4IQPA 1CAVA 4YJ2B 3D4KA 3MDSA 3CS5A 2ZXWC 1YC61 4PT6A 1W2AX 2Q7EA 4O2AA 2TUNA 4ZXKA 3ABKB 2HWF1 4B7KA 4I0XB 5AG2A 4LBNA 1OV9A 2QCSB 1CAWA 3CSXA 1RHI2 4QXCA 2WLJA 4QT6A 2W39A 4LUKA 2D3OW 4UFJA 3ZO0B 2JVDA 3I2HA 2ZEXA 5EIBD 1S4CA 4DR3O 4N23A 4P9IA 4E27A 3AZWA 3ZYBA 3AL6A 4JI7B 5T5JA 3K46A 4AOCA 3V56A 5DN2A 5DQ0A 4GH4B 4F6EA 2PHDA 5C8WA 3ZR5A 4YW6A 1WMFA 1MS9A 2EINC 1LODA 4LO6B 5FAXA 4S2GA 3CRAA 2IVJA 3VBOB 1AL0G 5EBMC 2VNVA 1HRV3 3OYWA 3AJZA 1SPPB 4EN8B 1QJFA 2W46A 2BOIA 4O4IB 2HHHO 3L2HA 4ASLA 2R16A 1UPIA 4AF9A 1Q3EA 5FO9B 4DRVA 3ZHQA 2ZGPA 4XQWA 3HKBA 3ACLA 5FPZA 5GZGA 1OQ1A 4MGSA 3K03A 2WO3A 3THPA 5KC5A 4XBFA 1SERA 2C9AA 1A78A 3NJVA 1YFUA 3RVHA 1NQTA 1ULGA 2R72A 1XYOA 2P67A 3J9SA 2BBVA 5JPMB 3KF3A 1E57A 3S7EA 4AW7A 3WSOA 4LF7B 3N2GA 3AG3B 1M4WA 2X6CA 1Q7YW 2Y6KA 3E22A 4P02B 1C8M3 1SACA 4ZS2A 2IXLA 1AX0A 3CNAA 3LPFA 2L9LA 3VGIA 2Q7GA 5FZBA 4YVWA 1LULA 4XW3A 1Q8VA 2QBXA 1PX4A 3GZEA 3E35A 3EXUA 4X1KB 4QPIB 4XUQA 1SLBA 1VBD3 3PUQA 4LOSA 4M4RA 5FV3A 2XBO3 3O7OA 1QHTA 1B09A 3R65A 3B94A 5FY7A 4DUVA 4JCKA 5IVJA 1GNHA 2LROA 5KHJA 5FKCA 4AYUA 3KM5A 4N7UA 1VBB2 2RDQA 4UV9A 1RUG3 1DTOA 3RSJA 1JMUB 1NX9A 3ME2A 2Q4SA 3PJYA 4ZKTB 1JYCA 3FB7C 5IUQA 4YZ4A 1AR93 4LH6A 3M7MX 1LTEA 4LBJA 4AVCA 4PDVA 4O9GA 3TN91 4Y33A 5FUPA 1UU6A 2XHBA 4CEWA 1VIBA 2EILC 5IYZB 3ILFA 1W2UA 2WLPA 3RQ0A 1SQVH 4JI3B 3ZMZA 1R6KA 3UL2A 2BDRA 4FPYA 1KD7A 1TAEA 2IXIA 2YUEA 4GJZA 3M3CA 4AQ6A 3WP5A 3WF0A 4FTEA 1R093 3OD0A 5FZOB 4BIZA 1L7LA 3ZXDA 2GZWA 4UUJC 1MEC2 2HWD3 3E97A 3GNEA 2JEMA 5CN0A 2R071 3JAKA 1W3XA 3E5QA 2DCTA 2UYAA 4QXHA 4YPJA 1RUF3 1CP9A 1DYOA 4KWUA 1VALA 1PV0A 4U7OA 1W8UA 2WZR2 5C33A 4LOTA 1H2MA 4DK0A 4NXMO 1YFWA 3ZX7A 3B40A 3AYDA 3HKCB 2ZXWB 1WW5A 3ZMTA 3BYWA 2R7EB 3J7MA 1LAJA 1WA4A 3BOPA 4Y24A 5A1AA 1EV13 4KWJA 2RDSA 2OWOA 2XUMA 4XMAA 3N7KA 4N53C 5JCOA 4OI4A 5CA6A 1QXJA 5FTTC 3WG2A 1X4TA 5FNVA 2RS53 4LO5B 2RM22 1FI2A 1YI7A 2QM8A 2AH2A 3NXSA 2AENA 1DCSA 4COYA 4LBQA 4XETA 5HXVA 1UY0A 3QH6A 4XF0A 4XACA 4MYEA 2K9PA 3ZMVA 1VBA1 3JASA 3MF6A 4C1WA 1JYVA 2W5FA 1NVPD 1NT0A 3OF1A 2JICA 4DINB 3ZXLA 2UUCB 4YJ3B 1F2NA 3RMXA 5DG2A 5B5EZ 5FYYA 1XSQA 4A7YA 4QPGA 2MNGA 4DUYB 1EFRG 2VAUA 4EE2A 2LGWA 3AB0A 3N7MA 3X29B 3BTAA 2GH2A 1OD5A 4O4JA 2OVUA 1UAIA 1UPSA 4TQDA 1YXWA 3SCFA 1R3KC 2BUKA 2DQ3A 1IS6A 1COWG 4Q4V3 3WDUA 1UX6A 3B3QE 4OPAA 3K58A 1HB3A 4YFWA 1PZ8A 4LULA 2V4AA 3TK1A 2XNDG 4S2DA 2WLHA 5IYZA 2QQPA 4GULA 2A0LA 1YHFA 5LA6A 3CJHA 4TV9A 1WAZA 1AR73 3JXSA 5J48A 2J42A 1KDKA 3PMSA 3SJCC 1YUDA 4JTDB 2DU1A 1MS5A 3BABA 4DR4O 4OPHA 2GH8A 2QGNA 1NCRB 4Z8BA 4MGQA 3ZYGA 5A3MA 1RM1C 2ZIOA 3T2OA 4MVMA 4X64O 2FBEA 4CDXC 1GM9A 4OHYA 2XDVA 5FXXA 3LSEA 2B9ZA 3H3UA 1FPN3 2JX9A 4QB2A 5HPOA 1YRZA 3ZXEA 4GALA 3HKCA 5FZKA 3WEZA 4EKWA 4K35A 1M5IA 4U3JA 1GWLA 5JLVA 1Y9MA 3VLBB 1OFSA 5BNQA 1AI6A 2WQ4A 4W4KA 2VMCA 4W4ZA 4NTWA 1PK6B 4X89A 5DPNA 2EICA 4BQYA 1GK9A 3O1PA 3DKWA 3CDZB 1QJY3 2Q5ZA 5A7WB 1KU9A 3IC9A 2JDYA 5E1RA 4KUMA 2VOVA 3VZLA 1AUYA 4HONA 2ZCEA 2ARBA 4JKMA 4ARXA 4DUZO 3BIWE 5FXWA 4JI0B 1I6XA 4HVQA 3E6DA 4DRXA 2VZUA 2P7TC 2G4IA 4WM7C 5IHRA 2CAVA 3IMMA 3T2PA 1OI6A 2NMOA 1YLLA 4P30A 1UJWB 4F3JA 4PA9A 4J10A 4BDVB 1AR62 3VBHA 5DUUA 5LK7B 2EILB 2YGMA 5BMVB 3MPBA 3T0BA 1NH2B 5AC91 4CDUC 2FCTA 3CRQA 4OI2A 3ZFEA 2CK3G 1SG3A 2Q9LA 3A23A 1UY1A 1JU4A 4IERA 4CH4A 1AJKA 3E2EA 3ZYJB 4W6WA 3LNMB 1DG6A 1IXBA 5F8PA 3STZC 2G9ZA 1DYKA 1YJWV 5KR7A 2YG0A 5H9CA 2HLDG 2FDJA 4OX9O 2PAEA 4A2UA 5GZDA 2W92A 2X0LA 1FAFA 4IV1A 3FYEB 1Q56A 4DOUA 1FFXB 4D6RA 4AVVA 2RJ2A 5FBJA 4NB5A 3J4UH 2OT7A 5CISA 2VTXA 3ZN6A 1VPHA 4MHRA 3LSSA 1VF5B 1K5JA 4HOOA 3JSNA 5LHGA 1ZZCA 4DQAA 3LOIA 1ZL8A 5FY4A 4ZOLB 3L70H 2HLEA 4AXOA 5IAVA 2EXIA 1SRYA 4Y22A 1B35C 2VW1A 5F3EA 3IIAA 1XHXA 3A0KA 4LE3A 3SLIA 1ZTEA 4XBQA 1N4CA 1J3RA 3CZUA 2GBOA 1NJIW 3KMHA 4XZPA 4HNAB 5LBCA 1H38A 2BTQA 4SLIA 2OUJA 5KUMA 2WSVA 5BYNA 4AAPA 2ZM6B 4AFDA 2HYKA 3OPTA 5BNPB 4Q0UA 5IVBA 4JRAA 4L0PA 2WNOA 4H44B 3AJYA 1JJOA 3RPQA 1OOPA 3H7YA 3UJOA 5JVDA 1EZVH 3JQXA 1KECA 3HNBM 3VZMA 3VB9A 3ETQA 5LA1A 5F32A 3M3IA 1VRH1 5FP3A 2FMYA 3CWBH 4PDLA 3PUHA 1SS3A 3FBMA 3RYCB 1R1A3 1DGRN 2WLLA 2Y26A 1AJQA 2ZQMA 3T3YA 2CGNA 1EM1A 1T2XA 3AG1C 4ZIBA 4FZ1A 2CH7B 5C70A 1A8MA 4INDA 3RWKX 3C3SA 4JDOA 1ZSPA 2UY8A 1YWKA 3IKWA 2C0ZA 4JI5B 4ABMA 2P6HA 4ATFA 4UCRA 3WG3A 4LO7A 4UFIA 1ZBA1 4EZ4A 1OVPA 1PGSA 2FDFA 2ZE6A 3U78A 3U07A 4CDXB 4I2OA 3D8CA 3UKVA 1S2KA 2DQ0A 1ZBE1 1QXPA 5E88A 5K1XA 5F5CA 4CCJA 1QDOA 1XNDA 5CVRA 2BSKA 4W4LA 1VQ5V 3O14A 1GMMA 4I01A 1RUE2 5J7MA 4JI6B 1TUEB 3QOPA 3ZHSA 1AR82 4P9YA 1JVMA 3C7OA 1JZ8A 4X20B 3K4ZA 3SH3A 3CEIA 4K3AA 1DLBA 1COV1 1H9PA 3DXTA 3O1SA 3SCHA 2YBKA 4YWAA 4FT8A 4F6RB 4WM7B 1NR7A 1BMV1 1FX5A 1K9MW 4PQQA 3OMIB 4R52A 4FFBA 1J1TA 1NS1A 4NTYA 4BA6A 1H8VA 1D2QA 1RXGA 4QXKA 5A32B 4DIQA 4CEWC 5IK5A 3CKHA 4PBPA 1BS3A 3VDDB 1RUI2 3LOBA 2F1MA 4L99A 1JHJA 1UOGA 2GSMB 3DXRB 5KX5B 4XDKA 5FZ3A 5FLXN 1UPGA 2CWMA 3DGTA 2F23A 1AHSA 1VMGA 1ZA7A 4MHUA 1J59A 2NPIA 1FT9A 3RYCA 3J7HA 3JARA 3FUQA 1GICA 1AP5A 3H1WA 1CZVA 1Z2GA 5C8YB 5KHHA 3CRMA 4OCTA 4XQ4A 4P9WA 4D7YA 1IX9A 2XL7A 5EXOA 2JEXA 1BGYH 4LXLA 1Q6HA 4UF0A 2CTPA 3N2KB 4W6YA 4NHLA 5LP6A 1W6OB 4FPOB 1W2NA 5DEDA 1JYNA 4ZXEA 5KLVH 5JCOC 1K5QA 4LIVA 4XBNA 5IK8A 5FP8A 4CU8A 2ZEZA 1B6QA 3AG7A 3T0AA 1B35B 4DR5B 4DFSA 2RMU1 5LEKA 2RS11 4R8CA 4Q27A 4NYKA 3BTXA 1RUNA 1X33A 4DY3A 2IFRA 3CCVV 4ZONA 2OZ6A 3POSA 5KHKA 1YITV 2FCVA 2XQRA 4IEZA 2Q30A 2TBVA 1KC8W 2QTWB 3CX5F 3OR7C 4QX0A 2JIZG 2PFWA 1V54B 1K3EA 1HX6A 1K4DC 2CU5A 2DCYA 1NR1A 3M1HA 2Y0PA 1I5ZA 2VJXA 5KXEA 3AC0A 3B09A 4ATEA 2AC1A 1XMOO 3E8HA 1HXS2 2RJLA 1MS4A 1HKDA 3AYCA 1C3HA 3R6SA 3CCEV 5IFPA 2DVBA 4X1IA 3PJSK 3FB8C 5KMGA 1W8OA 2YIBD 2Y64A 5D2AA 5FP9A 3DV8A 3WW3A 2BFUL 3AG1B 1M4UA 1YFYA 2IM9A 2GV9A 5FUNA 2YHJA 3SEPA 1F4MA 5C4WC 3MYXA 2BCCH 3NV3A 4MADA 2Q7HA 1ZREA 5L7OA 1MABG 4AVAA 1G9FA 2F43G 3QTCA 2ZGMA 2VO5A 2F95B 1JOBA 4DV5B 3WDXA 2G1MA 2A71A 4BZ4A 3I5DA 1PL0A 1TNFA 1E1QG 4BMBA 3DYOA 2QVSB 4WFEA 1LU1A 2KSDA 5EBLC 4K8XA 4AILC 3VBSC 3IDBB 1H2NA 2ZCWA 1R6NA 3RZLA 5C3RA 4LKSA 4EWDA 4W6XA 2ADPA 4NWVA 3K3OA 4JZRA 2GMMA 4MS2A 1RHI1 4TSVA 4XILA 1GP5A 3KV4A 3ZEDA 2WNEA 1RP3B 4OMDA 1MQTB 1FXKA 4AL9A 1AI5A 4DNYA 4EV0A 1AJOA 1H8TA 2PXJA 1RUC3 3SKJE 4KU8A 5FY0A 2VUCA 1SCRA 3DCQA 1FMD2 2ZZQA 3JCUZ 4UOJA 5H9RA 1XQNA 4LFCO 3IPVB 5DAWA 1W8HA 3KT7A 2VY0A 4MGYE 2YC2A 1TZOA 1Z7S2 3T30A 2ES3A 1EPZA 2X6BA 1XB9A 1KBHA 4GX2A 4CCOA 2Z2SB 1VF6C 3UNPA 4DV4B 3V65A 5JZGC 3VBHC 1HW5A 1KFXL 1RMU3 2AHZA 1FPOA 3T4ZA 4ZS3A 4XZUG 4IUGA 3DN7A 2DJVA 3E5UA 5CMUA 1L7QA 1FOD2 3FHIB 2KD7A 3ZFEC 5EJZB 1IBKO 2FMDA 4HK8A 1RGSA 1TMF3 4AAXA 5EBWC 2E3CA 5HI0A 3OGCC 4CSWA 2WNUC 4W8JA 1K97A 2WWSA 3WVJA 1Y9GA 3UGHA 1QR8A 1N32O 4YSFA 3VQWA 3GM8A 1W9YA 5LA9A 1Y67A 4H2AA 4IV1C 5K9YA 1S0DA 1AYM3 5FPUA 2DYCA 1AYN1 3JQWA 4MV2A 3CYOA 1IQDC 1X7NA 1D4M2 2W9XA 2VUJA 1AXYA 1OF3A 2PGGA 2DURA 4LF6B 3VZJA 3JBG2 3BU0A 4Y26A 5ABJA 2EXKA 4YZ2A 2PLV1 2YEVB 3E83A 5IJ0B 1IG0A 2R1DA 2C2AA 3K4DA 2RCVA 2BQPA 4FJCC 3ZXFA 5FCCA 4K7JA 4IHJB 3ZPOA 2YROA 1DGWA 4E4DX 4AQYO 1EUUA 3SPCA 4LO4B 1VQNV 2R063 2OS2A 3D3QA 1I94O 1YFXA 2N04A 1OPMA 1Y66A 1KGYA 2VZQA 1YQCA 2EX3A 1VBB1 3KHCA 4RGGA 5I93A 2W6IG 1RTVA 2GTSA 4TV8A 2DMXA 1DGWX 3VQVA 1W6QB 4OYUA 2EAKA 1D7PM 3C2UA 3W59A 4XAEA 3USUA 4I50A 1IBLB 2HJDA 5AFEA 2PYTA 3ZFGC 2JB4A 3HIFA 1KB9F 1UOJA 5FXVA 3V0AA 1SMVA 2R0HA 3O0XA 5DN6G 3SYOA 2ZHKA 5HCBA 2FKXA 1MSDA 1ULCA 5EJ1B 4IV3A 1XJAA 5DG1A 3ETPA 1VMJA 4IW3A 5C4WB 3RVZA 2Y34A 3HWJA 1L3JA 4DV7B 4K1ZA 5JUVA 1Y4WA 5LATA 2IFWA 3AVRA 5EIYB 5H2FZ 3PU8A 3P1IA 1ENSA 4JI4O 1GZTA 2XR4A 2KG7A 3RJRA 1LUVA 1CEZA 2WZR1 2BGPA 2V5YA 4LMFA 1GZWA 2GUZB 4MVUA 1O91A 2HWC2 3H3LA 1P49A 2O14A 4BIOA 1M90W 3UGGA 3VBSB 5FQ0A 4Y1VA 1K5SA 5CU1A 5FOJB 4QU1A 4KWKA 4BYYA 1XBLA 3K3NA 4YM3A 2RM21 4FFGA 1B04A 2QWOB 3I7DA 2P4KA 3EO6A 2CTQA 2WA3A 1WD3A 3WDWA 1VQMV 4ISRA 4AK3A 1HP8A 3VKFC 3HVDA 1FAYA 5CB7A 4J9YB 2WWJA 2WO2A 4QE9A 3JAWB 2QNKA 2BEOA 3QCWA 1QJEA 2F93B 5C8CA 3W7TA 5DAXA 1LU2A 1GWMA 4WVMA 4JKLA 3POFA 1LGCA 4N43A 1LGBA 5GLWA 2VNRA 3T1CA 3R0RA 3WDYA 1K7DA 3ZHUA 3MGUA 4D3WA 3DXUA 3VOUA 3UETA 5JZGB 1W05A 4FIPC 5A3OA 4J80A 3TYJA 2XJTA 3GZTB 4ZU5A 1JBCA 5TSWA 4K8ZA 4CXWA 2Q8DA 5A1LA 3FB6C 2Q8CA 4LA2A 2VC9A 4OLLA 3SYPA 3OGVA 4DEQA 1H2GA 4CEYB 4FQ4A 1QOTA 1MVQA 2WNUB 2ZMNA 5BY1A 4O7XA 4CUBA 1CX4A 1PO11 4XDPA 3FHQA 1CPYA 4AI9A 1WB8A 1UOFA 4K6BA 1SFYA 3NL1A 1PNFA 5CFCB 1LNSA 2CTRA 5CBHA 5GW7A 2QWNB 5LP6C 4LKDA 2WYSA 1ND3A 4RD7A 4TLFA 3WU2Z 3NRUA 5F1RA 1RSOB 1GQPA 1SBFA 1GH6A 3OCPA 2Q1MA 3JYCA 1HRV2 5J9PC 4PLOA 1N3PA 1HNWB 4QKFA 1VQOV 2CV6A 3A0BZ 4MH0E 4ORFA 4MT8A 1HDKA 4NAOA 3F7VC 3RYFA 2YFZA 2B5HA 1BEV3 3O12A 1HN0A 3JD4A 5IYYA 1G9BA 1MA1A 3W20A 3QG5A 2ZDIA 4QX3A 2P06A 2OPWA 5IDJA 2R073 2Q67A 2LUWA 1GN6A 1YQ6A 5FYUA 3P6BA 4C8DA 4ASUG 2ZHMA 2O0OA 3B7MA 5FYCA 1JTZX 2WS93 5LMNO 2QSAA 2D40A 1CAUA 2ZKOA 4M3CF 1NCQA 1SFPA 3WQ0A 4PDRA 4ES8A 1C8M2 2EIJB 2QQJA 3I8TA 4CU7A 2XAHA 3FN9A 3ZFGB 2VXRA 1N33O 3FE5A 1UXZA 1KJLA 2LW1A 1X9PA 3C7FA 3RWNA 1PO21 2WFF3 1UNBA 4AGRA 3KZ4C 1F51A 2FL4A 3LNNA 4D6TH 3NAPB 4IYIA 1VBD2 2FTKA 1J5EO 1VBA3 3E8GA 1CAXA 4YG3A 1HNZO 5LHHA 2XBO2 4H3WA 3ZDSA 3MIHA 5FY8A 4AI3A 1ULFA 3E5XA 4CDQA 4YIPA 4FP2A 4DR1O 1OMIA 1YSCA 2DVDA 2VM9A 1U5IA 4E2QA 3ZRWA 5EJ3A 2VXJA 1LR1A 2AZ2A 2PAKA 1RUG2 1EZJA 1A8DA 4JYAB 2QDNA 1JCHA 1GV9A 4YY3B 4PLNA 4Y1UA 2OKXA 4S2FA 2OIEA 3PUAA 5FZDA 1PMHX 5FUIA 1WKYA 4KWLA 3JD71 3FAVB 1W9FA 2A06H 3VKLA 2PY5A 1YNAA 3B9CA 3CQOA 2XXZA 4KNCA 3VD5A 4D6SA 5L9VA 2P3IA 2ETNA 4DV2O 2EIEA 3M70A 1UYXA 1M57B 3VBRB 1FXKC 1QBZA 2UUBO 5CA3A 1H8TC 3GJAA 4Q0PA 1LOGA 4NXMB 5B2GB 1IPJA 3N9LA 1R092 3A4UA 2B5UA 5JH7B 4GMP0 4XJ8A 3AKTA 4P5HA 3HKEA 1G7YA 2HWD2 1VP7A 4K9SA 3TB0A 2ZS6B 3ABZA 2PHFA 4XJUA 3WNXA 5A6YA 4DXRA 4RFT0 1CN1A 1J83A 3BCWA 1V9U1 1RUF2 4I9QA 3THTA 4J7KA 1DGLA 5JR7B 3ROUA 4QJFB 1G6NA 2QE3A 1QH7A 5FMDA 4XFHA 4NIGA 1AL21 4XEZA 4J7ZA 1ZZ8A 3V64A 5ITZB 4RQEA 4A42A 1IG3A 1Y76B 1EV12 1OCZC 1GU3A 4FPJA 3ZFFC 3Q8CA 2O8OA 1MR5A 1FV2A 3NAPA 1IGOA 1SDDB 4KMQA 4H33A 3IAYA 5FZAA 5LWBA 4FPKA 3RDIA 1QJX3 1S2BA 1RINA 4XJZA 3M99B 4NPRA 2P34A 3P32A 2BGCA 1SZBA 3O1OA 3UKTA 1DBNA 2PQQA 1XDCA 4OZXA 3MW4A 4LFAO 4MTXA 4FI9A 1S0BA 4P9LA 5C71A 5B3SB 5IJ9B 2VULA 4K1YA 3MIGA 5SV8A 5LZ6A 4JI8B 1VB4A 3WINE 1M93A 2OUHA 5F6KA 1VBE2 5AC93 3ZS8C 2J1UA 4NIHA 3VBUC 2JD9A 1OCCB 3LSQA 1V6LA 4EWEA 1XUQA 2GN3A 1KEXA 4XF4A 3GBGA 4J9ZB 1W0PA 4B3MO 5FLHA 3E6BA 4Q4V2 4C91A 2XASA 4UCSA 4Q8LA 4DR4B 2XT9A 5F5QA 1WLTA 2W1QA 4GAZA 1AR81 1DGRA 2ZKNA 1CIWA 2JEUA 5FYBA 2VMHA 3FX7A 2ZE7A 3U4SA 4A6OA 2HFEC 2BVBA 3CCMV 3MV11 3ZX6A 2XONA 1ASJ1 1A32A 2VG9A 4M01A 1F35A 2EVXA 4AR2A 1BHBA 1DQ2A 2QKDA 5LBBA 5FP4A 1V55C 2VQEO 2JG8A 2UXBB 4DV6O 3OM3B 2Q1FA 2Y6GA 5A33B 4YRDA 4CTEA 4H55A 4I55B 1FPN2 5H9SA 2HWE3 1H8EG 4AVSA 5IK7A 1W9WA 2DVGA 1H2KA 3WB0A 3IB3A 4DUZB 3U37A 5K4LA 3VQYA 1IBMO 3WQ7A 1W6PA 3K9AA 1XOYA 2VVEA 3PVEA 1WLCA 3QD6A 3Q4HB 3J7AU 5IWAO 3H8XA 4AHXA 3ON7A 1GOFA 2WDBA 4WM8A 1U12A 4LFBB 1QJY2 3WW2A 3UT5B 5FL7G 1CWPA 3P30A 2WO7A 2A75A 1MMMA 1XBFA 4R50A 1K45A 1VQ7V 3LUTB 4FPFA 4Y20A 1N0NA 2Z3YA 3FLRA 3VL8A 1MS1A 1XNCA 4JDNA 2VBDA 1VRH3 3IJ4A 2D7FA 4CDWA 3Q8BA 1W2OA 1IPKA 3PU3A 3MBWA 4XE9A 4GT1A 1GTOA 4OX9B 2VCAA 1HQNA 4O2BA 2IXJA 2TNFA 3LDCA 5C9AC 1X9TA 2YC4A 1MNGA 1A34A 4MUVA 2P22C 2NP0A 5LY2A 2PHUA 1O3QA 3PVOA 2BRTA 4XVHA 2W1WA 2B42B 3ASOB 3R4UA 1XE0A 3MICA 5FK8A 4JAUA 4GXLA 2WLIB 1ZBA3 1EP0A 2M6YA 4UFLA 4N43C 3JD1A 1O3SA 4UFMA 3UKNA 1G8MA 3H1JH 1JZ4A 4QGPA 4UCUA 4IIJB 3IT8A 3O65A 1SBDA 2LW7A 1YJKA 4TYSA 1HXS1 1ONAA 4C0HA 4U36A 2MW2B 3K79A 3WQ1A 3CXCU 4J6GA 1DF4A 3R66A 1JS9A 1SQ4A 1VMFA 3ABMC 5HCHA 1OCZB 2JK5C 4MVRA 3ZFFB 1QQP1 3OR6C 3E8BA 2IVIB 2IU0A 4I55A 3WHTA 4LORA 1BQPA 1WPXA 1XL4A 4MVQA 1BLZA 2Q0OC 1WLWA 3DPRC 4Z1MG 4HPKA 5FPVA 1JOJA 4B4PA 2BOBC 1RVF3 3VD4A 4GKJB 2DVAA 4K0KB 3SYCA 3NNJA 2WA4A 2EIGA 3VN4A 1QLEB 1ND3C 1OFNA 3BAAA 4DS0A 1URXA 3DKQA 2G9GA 1GAXA 4BIUA 2HG5C 2CTVA 1OT5A 3VBUB 2N74A 1NA1A 4KBBA 1PIV1 4YM1A 2QM4A 3C8XA 4AE2A 2Q4PA 2UU9B 3G6BA 2JE9A 1R1A2 2OYZA 2ZGUA 2ZDIC 1URFA 5JIUA 4G2KA 4LNVA 3OB8A 1LOCA 4PQ9A 3S5AA 1QXRA 1MZEA 4BLJA 4NE9A 1FMD1 1EPWA 4NIIA 4I3PA 3DYPA 4MXVA 2WNVA
chains in the Genus database with same CATH topology
3ELNA 5JOXA 1RUG1 1TE1B 4LT5A 1NCQC 3Q9OA 4FOWA 4OI2A 3ZFEA 5KHGA 4M00A 4Q4X1 3RYRA 4B4RA 1B35A 1LKNA 3G6JB 4IERA 3WW4A 1AJKA 4E4SA 4YG0A 2Q5TA 3ZYJB 4W6WA 4WZCA 2YC0A 1DG6A 1VZ4A 1GANA 2BWCA 4JAAA 1IS5A 3WD5A 1Z7S1 1DYKA 1RL3A 3EATX 2D6LX 3ZYIB 1DYPA 1HRI3 2H0VA 2LM3A 4PIXA 3R4SA 1AR91 1MZ5A 4LEJA 2Y38A 5JPNB 2G9FA 4Q8KA 5AVAA 1LEMA 2PAEA 1A6CA 4A2UA 3VZOA 4Y1ZA 2NQYA 2HWF2 1O7FA 2RMU3 2A5ZA 4YM2A 4B7EA 2XVKA 4OI1A 5CBLA 5GZDA 3L9JT 5JDBA 4E2GA 2XLFA 1FOD1 4IV1A 4PF5A 3FJSA 1U5XA 1Q56A 4DOUA 2EXHA 2XKOA 5FBZA 4AVVA 3AP9A 3J4UH 4L97A 4XYXA 3P3PA 2ZAHA 2UWBA 4I3GA 4CEWB 1KDMA 3ZN6A 5JAXA 1QJZA 1F5JA 1HLCA 4R9AA 2PHRA 4YGBA 4C1XA 2VMGA 4FO9A 4DB5A 1ZZCA 1R091 4XFAA 4DQAA 4QX5A 1REFA 3LOIA 2ZOEB 4B29A 4AXOA 2HEYF 2EXIA 3NJZA 3VHPA 1C28A 4Y22A 1B35C 2JDZA 2VW1A 3IIAA 3QH7A 1S0CA 3VBFB 2KXLA 3A0KA 5FRAA 4LE3A 2FQPA 1PZ9A 3SLIA 1EY2A 2ZTNA 1TEIA 1R083 1D4M1 3KGLA 4MLOA 2JG8B 5DDJ1 4XBQA 3BU7A 4OHXA 2DFBA 4QQOA 2HEVF 2CWSA 1ND2A 5JI9A 1J3RA 2MHFA 5GZCA 3MI8A 1QF3A 3USSA 4G4FA 1MS8A 3RMYA 3KMHA 4XZPA 5EFUA 5GM0A 4XIKA 4YGDA 2YXSA 3NWKA 3T1MA 4A3XA 4SLIA 4YZ1A 2OUJA 1POV0 2R6QA 4WZFA 2ET1A 3B69A 4META 1DHKB 3URFA 3HT1A 2WSVA 2WZPP 5I8TA 2E6VA 3OY8A 5BYNA 5F9TA 1V6IA 3VHRA 4AFDA 1W6PB 1NCRC 1GYKA 1XYPA 2HYKA 2RS51 3WHUA 5BNPB 5C9AB 4HFSA 4Q0UA 1HQLA 4DXZA 3AFGA 4JRAA 4P9JA 3ZSMA 4GKYA 3O0VA 4L8QA 1AYN2 3AJYA 3NV4A 4NVPA 3RPQA 4WM8B 1OOPA 3H7YA 3UJOA 3GHNA 5J3UA 2BTVC 4N7IA 4K21A 3JQXA 2IZWA 4TWTA 3VZMA 4JDMA 5BNNA 2WL1A 3ETQA 2GMPA 2DTWA 1TME3 3M3IA 1VRH1 2FMYA 3JB4C 2ET7A 3U11A 3HMYA 1WBLA 2R1BA 4XMIA 2OG6A 2CAUA 1RIRA 2SBAA 3FBMA 1H1AA 2PLV2 5I0UA 2Y0IA 4LBQB 1R1A3 3FFQA 1DGRN 1FV3A 4GIQA 4RQPB 1ZVFA 2EXJA 2GMEA 2Y26A 4Y20B 2CGNA 4Y0EA 1NX8A 1AR63 4Q4Y2 1NQJA 4FOQA 1PK6C 1ND2C 4YVSA 3CLPA 3FZ3A 4CDWB 1OIIA 5LRSA 3CEWA 1DZTA 3V0BA 1A8MA 4INDA 1PVXA 4RHV3 1QNWA 1ZZ9A 4QPGB 3SWTA 4F7ZA 3D0JA 4JDOA 1MQTA 4Q4W2 3VUOA 2UY8A 1YWKA 1Q5OA 3IKWA 4L11A 5T5LA 3RYPA 1X50A 2C0ZA 4BQ1A 1CJPA 4KQ7A 4UW3A 4ATFA 2PHTA 3WG3A 3IWZA 4LO7A 1NLSA 4HK9A 3AP6A 2D6OX 1LGNA 4B8EA 4B4QA 1ZBA1 4LBKA 3KLSA 1PGSA 3MEPA 2O8QA 1OOPC 3C3VA 3U07A 5DUVA 4CDXB 4I2OA 3D8CA 2NLRA 3AK0A 3AYAA 3IPVA 4IEWA 3UKVA 4R9BA 2HWF3 4HT1T 4PBOA 4UW4A 5BNNC 1YJLA 4YW2A 2E9QA 4JTOA 1QHDA 1S2KA 1ZBE1 3OBRA 1VAKA 3DPRB 4HKWA 3KGZA 1QXPA 2EAAA 3WOGA 1AR71 2XLAA 5E88A 1U