4AI8A

Factor inhibiting hif-1 alpha in complex with daminozide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
339
structure length
339
Chain Sequence
SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plant growth regulator daminozide is a selective inhibitor of human KDM2/7 histone demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 103
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4ai8A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ai8A01
3P3NA 1MZFA 1YCIA 2CGNA 1H2NA 4NR1A 2XUMA 3D8CA 2YC0A 4B7EA 3KCYA 2WA4A 2YDEA 3KCXA 4AI8A 4BIOA 2W0XA 4JAAA 5JWPA 2CGOA 4QU2A 3P3PA 2Y0IA 1IZ3A 1H2LA 2WA3A 4B7KA 1H2KA 3OD4A 4Z2WA 1H2MA 1MZEA 2ILMA 4Z1VA
chains in the Genus database with same CATH superfamily
2XAHA 4TWTA 2YEVA 1SQBH 4JRLA 3RYFA 2JGDB 3WF3A 2R1BA 4BW9A 5IK7A 4HKOA 5CG8A 2JDNA 4DXSA 4YGDA 2ZDIC 2JECA 2JENA 1CX4A 2W87A 3ZMNA 3GCXA 1AP6A 5FXVA 3JSNA 1RM1C 1B3QA 2FDFA 4MVTA 4XDLA 3CBNA 5I0RA 2WO7A 3DCQA 4ET7A 4DMIA 4WFEA 3AZWA 2FMDA 1OA3A 1OF3A 2HVKC 4QE7A 1COV2 4EN7B 4IEZA 4NRMA 2AZ0A 5A80A 4OUSA 2W92A 2DBNA 4JZRA 3THCA 1VE0A 1UOFA 1VP7A 2UXDB 3DV8A 1CAUA 2A6VA 4I3GA 5FJKA 5CISA 1VQOV 4TUYA 1H1IA 3RI9A 1DQ5A 1VBE2 1N3PA 3DUIA 2NP0A 3OSDA 3JD0A 4FOYA 4BQ1A 5F5QA 4NIIA 5JOYA 1SLCA 2VTFA 4CCLA 3DKQA 4Z2WA 3FFQA 4IV3C 4E2LA 4CYDA 2OVUA 4CZZA 1ZBE1 3KF3A 2Y33A 1CJPA 5C93A 1POV0 2CTQA 3KCYA 1UFIA 1VP6A 1E5RA 3R05A 4GJYA 1GZCA 4JF3A 1HRI1 4BQ4A 3PMEA 1AR62 4FPYA 1MSWD 2NM1A 3P32A 3K5NA 1DF0A 3OUHA 1JOYA 1PK6B 2GV9A 4L2NA 2IC1A 2PZSA 1CVNA 2XJTA 2ZGTA 1VMGA 4K0KO 1UIKA 1RUNA 5EBMC 2DYSC 4AOCA 4RA0A 2IVJA 2RS13 2RM21 5IYYA 4CRQA 2RDSA 1ZRFA 5C3OA 4WBBA 1VMHA 2QQJA 4J42A 1GM7A 4E4DX 1X59A 4ZZ5A 4QDQA 2B1GA 4YIOA 2CHHA 1OD5A 3SJBC 2WZR2 4LFBO 1BQPA 3AVSA 2RJLA 2VRZA 3T4DA 2JEUA 1BKZA 3D3QA 5FPZA 1R083 4N90A 2CDPA 1AYM3 3K5OA 3CRMA 2P3IA 1L7LA 5F2WA 1U97A 2DBIA 4ZXKA 3LEIA 3ZYGA 3URFA 3MLLA 1YZBA 1ENRA 4O2AB 2G9ZA 4DUVA 2QQLA 3RZKA 3CHXA 4LLFA 1AR71 3JYCA 2RR12 1U12A 3KT7A 3LFIA 4A7KA 1AI4A 2A6ZA 4AZZA 1JN2P 2Q7GA 3WW1A 4JKMA 4XETA 5L3GA 3TYJA 4AQTA 2KD7A 4CP9B 4KL1A 1K42A 3VQYA 3VBSA 3H1YA 4A7ZA 2Q4PA 1NOVA 1S2KA 3MHZA 1C1LA 2OIIA 5C70A 4A5UB 3J7NA 3MIDA 1EN6A 3OE7G 2FCVA 1FYUA 2R0HA 4UFKA 3VQWA 3ZJZA 3WFVA 1PZ9A 1KBHA 1WBLA 4Z8BA 4EQVA 1H8TA 1WKYA 2Q9LA 4A7YA 1HRV1 3ZLIA 4CE8A 2QKCA 4E2SA 4HPKA 1VPHA 3DF0A 1OHHG 2IFRA 5JCTA 2X09A 1RHI1 1F4AA 3VBFC 2Q4SA 4RL7A 5FY4A 1SFPA 2VZ1A 4FAGA 4MGKE 5KHKA 4XHBA 3T30A 2A9HA 4JASA 2E7QA 3G7DA 2XMLA 4QQ2A 4BLIA 1T2XA 1WA8A 2BVBA 1JA8A 1XJAA 3K46A 3LPGA 4GB32 2DF7A 1UY2A 2GTSA 2XJSA 2HWE1 5JR7B 2HKXA 4LF4B 1DFQA 5JQGA 2LFRA 2UUAB 2XAQA 3J26N 3N9PA 2P4VA 5CN0A 1KDMA 2V4AA 1HKDA 2ZGRA 4O4HA 1MVQA 2QUOA 2WT2A 3A0KA 5JXGA 2QQPA 3Q8EA 1CAVA 1J58A 5L3BA 5A6ZA 4DR3O 4CEYC 2Q0AA 4WF9V 3L71H 5FYYA 3E2EA 4I3PA 2EX3A 3WF4A 1Y3TA 2WRAA 1QH7A 2KSDA 2OX0A 1K4DC 1XNRO 1B35C 1Y43B 3APBA 4DR5O 3TN92 4CH6A 3DXUA 4FK5C 3WU2Z 1WP7A 3GWKC 5C4WC 4AFBA 4WFHA 3ZOIA 4YHHB 2R063 4P9IA 2XR4A 1KITA 4MOAA 3NJVA 1P7BA 4E2GA 2RQ6A 2IU0A 1MPXA 4OQ8A 1ZL8B 5CBHA 1F5FA 1KQRA 2HWB3 2TBVA 1PNKA 4JV4A 1OZ0A 5D8AA 2D3SA 1Q86W 4G27B 4PDMA 2VNGA 3ZDVA 3GHMA 4O4LA 1OUXA 3HNBM 1MS8A 3AL6A 1VQ4V 1GQGA 2ARHA 4WFGA 2XL9A 4FM0A 4UFJA 2KXLA 4JI4O 1EP0A 1MS1A 4N43B 4RHV2 1H38A 1N8RW 4JI0B 5JJEB 4AE2A 5LRSA 2XGXA 4I09A 4I9WA 4JYAB 1NVPD 3KWVA 4FFKA 4BHPA 3EVKA 4NXNB 2Q8CA 4IEWA 3OD0A 3S6PA 3FE5A 1DGRA 4FOVA 1ZBA1 2J1AA 4PF5A 1JYXA 3WX5A 5GLWA 2KKWA 1DP0A 1OFSA 1VQ7V 1EN5A 4JGYC 5IK5A 3R6SA 4FZ0A 1FD9A 3Q8FA 5K0UC 1S5HC 2OW4A 3OR7C 5FZ3A 4UCVA 1SDWA 2UXNA 2C6SA 2VCMA 3LDBA 3HKCA 1J84A 1K33A 5LBBA 4RFT0 4XZPA 2JE8A 2ZX0A 2KB1A 3ACFA 3ZFGA 5KXEA 2PHDA 1S1AA 2ZGUA 2Y6HA 3RN4A 2Y0OA 5FZBA 1XYPA 2VOKA 1NG0A 4FI9A 2PHRA 1YQ2A 4XF3A 3MFAA 3RYHA 4MLOA 4U36A 3NKTA 1EAH3 2BU9A 4P9WA 5IJRA 2P6CA 4QGPA 5BNNA 1OQDA 2EIJC 2QM7A 4YJ2B 4D6QA 2XAFA 3AG4B 3J8F3 1SZXA 3HNMA 5EXOA 3H3ZA 3ON7A 3RJ2X 4TXWA 4J1WA 3LB9A 4HVQA 5DM6V 3PHMA 1DQ4A 2YV8A 4B7EA 3ZMSA 3DGTA 2DTYA 5FO9B 3SHRA 1SA0B 2VBBA 4LBQB 3BFRA 2H6CA 5FKBA 1BS3A 1W6PB 3OGRA 3ZO0B 1L7QA 3CCLV 4HN1A 2WN2A 1VB2A 1IS5A 1S77D 1Z5WA 3WW2A 3TGUH 2QKDA 2UURA 1US3A 4CP9A 1D4M1 2XJVA 4LF6B 4ZKIA 4A44A 3I2KA 1OKOA 3Q4HB 2G1MA 3IC7A 3AX4A 4FFBA 3LKJA 3A7QA 4P9OA 1ULFA 3GHNA 3WW4A 3OBZA 3MAQA 3ZHQA 5JMOA 1RMU2 4C90A 4MVQA 3I54A 1VBA1 3F95A 3JD1A 1GICA 5EIBD 1RUD3 3K57A 3HKDA 1NR1A 3RZMA 3C7FA 4FM1A 3JBG2 2BTVC 2R9AA 4U3FH 1HNXO 1FYJA 1LESA 3ZYBA 5A7SA 4DY5A 1N34O 2XWJB 5FZ7A 4B8EA 5KC5A 1ENVA 5HXMA 2CNAA 3ZHSA 1YRZA 1H6XA 1MQTC 1LHOA 4OI1A 2EULA 4WVMB 1PGW1 2VBPA 4EEQA 3T4HB 3ALQA 3O1RA 3POYA 5CB4A 3O12A 2VC9A 2ZEYA 4YYOA 4NWWA 1HXS2 2EIBA 4AAPA 4HANA 3NV2A 2QVSB 4KH9A 4NHMA 5L7OA 4IE0A 4AFAA 1DQ1A 1GZWA 5E8AA 4JI6B 3PVBB 4KHPO 4QXKA 1HDJA 3D0JA 3I2FA 4QM8A 1J59A 3NJYA 5T50A 5A3LA 1R6KA 5FRAA 4YM0A 2WFPA 2JG8A 2CGPA 3B02A 1K3EA 2BUKA 4BPZA 4OI4A 1ZRIA 1RPRA 2VZRA 4UYBA 4QDSA 2HBUA 3BPZA 3ZRXA 4GZRB 1TNRA 1QGLA 4CDUA 2ODMA 1FOD2 2FZ1A 2VO5A 3CPWU 2ZX3A 2HEPA 2WR9A 4PDLA 5FJHA 1GNHA 1JZ4A 2UY9A 1ZWIC 4Q4W1 2VW1A 5EC1C 5LWBA 2FD8A 4Y3OA 1G9DA 3VBUA 2X7RB 3J7MA 5JOZA 1IX9A 4PQ9A 1MEC2 1XPWA 4UBGA 3ASNB 3SH4A 2Y4TA 2UUAO 2LW1A 4CA9A 1YFXA 1QXJA 1KQSU 4AEKA 2H94A 5A1AA 3C3VA 4IEVA 2SLIA 3WF0A 2ADPA 5FY1A 1HR0O 2GSYA 1ZX3A 5A2QN 1Z7S3 2WNOA 4AEMA 3JASB 3ORJA 3ENRA 3K5LA 2B4KA 4IE6A 1IBMO 3A0RA 1HXS3 3JXSA 3RVYA 3FWEA 1T6GC 4JKKA 5DUVA 2XHNA 4NYKA 3BI3A 1SRYA 3IDCB 1CPYA 1AL21 3O0XA 1PM7A 4HKLA 2D5HA 1PO11 2Y26A 4IETA 1ZL8A 1AJQA 1Y9MA 3VBHA 4BU2A 3DYPA 1AF9A 5JPMB 3WCSA 3CCQV 1VB4A 5A9GA 3I2HA 4WV8A 4GX0A 2MPFA 5GLTA 4DPNA 2QGNA 1O4TA 3SPHA 3ASIA 3UK9A 1GN2A 1K5JA 5KC6A 2RM22 1AYM1 1GKBA 4DW0A 4Y5SA 3THPA 3WVJA 1W28A 3H42B 2HKOA 4MG2A 4BJ0A 3ZSMA 2XVLA 3HJRA 5D8AC 2BDRA 4S2DA 2B5UA 2XWBB 3H1WA 1ULEA 3V0AB 4ZONA 2W0XA 4LBEC 1Q8OA 3ZFFC 1AL0G 1Q8SA 3OF1A 2D6OX 4IHJA 2PELA 4P9XA 3AG3C 3FZ3A 3TCUA 1QQP2 3WG3A 1XB9A 2YIBD 2W0FC 2DU0A 5FYZA 1KGYA 2ADDA 4XF0A 2GC2A 5H9CA 1BEV3 2V4DA 2Q0OC 3MIGA 4ES8A 1XNTA 2PF4E 1QJY3 3Q4HA 3KV5A 3M3OA 2ZCWA 2ZMNA 4DV1B 3D36C 5IYZB 2VWJA 2JS3A 2LW7A 3T1CA 3B8MA 1RP3B 2BNMA 3ZPOA 1KS5A 1AX2A 1IPKA 3AYAA 1W03A 2UXBO 2EIMB 2DTWA 4TV9A 5CAZA 2QSAA 3OB8A 4O61A 2QEXV 4L11A 1WWYA 5C3QA 4BXFA 3V0BB 4PA4A 1OJHA 2Y69B 4L8JA 4J7ZA 2WKKA 4Q20A 3CRCA 1Q5OA 1TMF2 4MW8A 3MDPA 1OUSA 4Q6GA 4AGVA 2AEZA 2K9PA 2Q7EA 1RHI3 2BZDA 1PGW2 4FCAA 1EV12 1PIV1 4R52A 2EAKA 3MD0A 2G4IA 2XKPA 5FFOC 2MK3A 3DXRA 2PLV2 5BMVB 4LBNA 4LKSA 4IEQA 4XFCA 1QJU1 3H1KH 2PUSA 1U5ZA 2VOXA 1DQ0A 1QNYA 1F15A 2VWKA 1RUC2 2VD7A 4M3CA 2LW8A 1NCQA 3JARA 4MGZE 4J7JA 1TME2 3IWZA 2W1QA 1COWG 1T5EA 3ZN5A 3UJOA 1UU4A 2OUHA 3M3CA 5A7QA 1QXRA 5JXJA 2EJ7A 5LYJB 3K5MA 4LHLA 1JZ6A 4GA9A 1UZZA 2QBXA 1NCRC 1WD3A 1GBGA 5T5JA 2ARBA 2GP5A 2OZ6A 5DZFA 2QQKA 2GU9A 2Z2SB 3CCJV 5BR8B 2VZQA 4CXWA 1XILA 4GT1A 4UCTA 4Y20A 1M5IA 2IJIA 1X33A 3QTCA 3LZZA 4GMP3 2P4EA 2EZOA 4QD2A 5FUIA 3MHSC 5LATA 1EZJA 4CDQB 4E27A 2NYYA 3ILNA 2RHPA 2PLV1 2W46A 1CZSA 4CDWC 1TMF1 2XHBA 3S3XA 1CZTA 1WAZA 3W5MA 2R1DA 3AK0A 4PIZA 3OT7A 3ZYHA 4JI5O 1Q8VA 1KDKA 1OD3A 3OUJA 1SLAA 1KKCA 5JUVA 1US6A 4BK4A 4JDOA 1UIJA 4X1IB 2WLNA 2ZHLA 2JG8B 1VF7A 1REFA 1O4ZA 5KHJA 1HRV2 1SERA 3ZYJB 3IFXA 1BCXA 1XYNA 4PA3A 3EXAA 3GBFA 5D8AB 2OTLV 5A3PA 3P1IA 4GQ7A 1KP3A 1EY2A 1DZQA 1WUVA 2V09A 1NUKA 4DEQA 4A6OA 2UXXA 3ABMB 1FMD2 3AP5A 3HN1A 3SPCA 1AXZA 3CCMV 4IL7A 3QF7A 1R3IC 2WWWA 2DCJA 1VBB2 3H8XA 2F17A 3AYDA 1VQKV 1UYYA 3M8AA 1W90A 4XQ4A 2KQXA 4P00B 4BQXA 1CEZA 2YFZA 4UCOA 3JD4A 3FX3A 4UCSA 3WHTA 1G9FA 4GKXA 5CZKA 1JMUB 2N04A 1OCOC 1V54C 1W6MA 3PU3A 4OGQB 4LF5O 5J3UA 3J8F2 1R092 3HVDA 2GTAA 1YJKA 2AUYA 3NNJA 2RG4A 4RGKA 5A3NA 3CP1A 3CU7A 2ERFA 1IS6A 2ILMA 4NAMA 4I7ZB 4AF9A 1H6YA 3MIEA 5DXDA 4ARYA 2WZR1 2W2IA 2WINB 3QD6A 4MTGA 4B3NA 4K8ZA 5LYJA 2IH1C 4XE9A 3EYPA 2D7FA 2DUQA 2PAEA 2F93B 2YS8A 4ATEA 1QLEC 2ZOEB 4DB5A 1PPJH 3CEWA 4RGGA 3QO8A 3N7KA 4R9CA 4KI5M 3ZHUA 2CGNA 4ZS3A 3POSA 1RUH1 4LBQA 1W2NA 2Q5ZA 5JSOA 1R3JC 1S55A 1V00A 3H9VA 2PHFA 4JI7O 4QX0A 3FLPA 2P4KA 3I3MA 3LF7A 1GM8A 2P1BA 2DVBA 5DAQA 1GR3A 4YJ3B 3T0DA 5JVDB 1RM1B 5APAA 3KQ4B 1GKFA 2RDNA 5K0UA 4I4TB 4O9GA 3V0BA 2JDUA 1YQCA 2VE1A 4EROA 2BTQB 2RE9A 2WLJA 4AYUA 3R0RA 4AI2A 2ZXWC 3T1HB 2W08A 3ZN0A 5ERLA 1VQ8V 4TN7A 3WINE 1BK1A 5IVJA 1VQ9V 1JJOA 3J7AU 1KFXL 4DQAA 1GNYA 4UV8A 5HI0A 3VBSB 2R6QA 5AC93 5LHGA 2GNBA 4AK3A 4E8CA 4OUEA 4KGGA 5E1RA 1PVC3 1XMOO 4IGPA 1KMIZ 3QG5A 2WNVB 4L87A 5JR2A 5BNOA 1FT9A 3RZLA 1GYKA 4TQFA 3ZXJA 4GB31 4QKDA 2B1IA 2NQYA 4LR4A 1OI6A 5JOXA 3VBOA 1VBC3 1Q81W 3NNFA 4QKFA 4MGSA 4H14A 5BNQA 1YVWA 3ELNA 3D6EA 2B9ZA 5LEJA 4C7UA 3LUTB 1KXGA 2BJSA 1O9GA 2VQ0A 1TAEA 2W1UA 2EINC 4FVMA 3U14A 1KS4A 4BOWA 2XBO3 4XACA 1K12A 1FV3A 2AC1A 3MO4A 1S0VA 2XVKA 4OPHA 3TNPB 2F4VO 1DLLA 1PX4A 1SHWB 4DV2B 1NKGA 1V55B 3C2UA 1ZRDA 1H30A 2QWRB 1NY72 5I8TA 5ACA2 4CDWB 1DTOA 3JATA 1YWKA 3QOPA 3JQXA 3X2QB 3WLUA 4NTXA 3U0ZA 1SACA 1UD1A 5LRRA 1FOD3 1CXZB 1OCOB 1V54B 5J9PC 4Y5TA 4UFLA 3T1YO 2Q67A 5IYDO 3PUQA 3MW3A 1QIQA 3EMRA 4BIZA 3LFMA 3I5DA 5FYVA 4TWKA 3ACGA 1ND3C 1S5LZ 3USUA 1Y6XA 1ENSA 1O3TA 1WLCA 2JDMA 2WN3A 4X9QA 3KS7A 3IM0A 2ZR3A 1UU6A 4DV1O 4CDXB 1DCSA 4MO3M 1PM9A 1IVSA 4FPEA 3KLSA 3UT5B 2QCSB 1E57A 1D5NA 3BRCA 2QQMA 1POQA 1I5XA 5DG1A 4J9YB 5DAXA 1WB8A 3TEWA 1W8ZA 1WLDA 1F4MA 1L1FA 5FLHA 1AVBA 2QJVA 3CWBH 4A45A 4ASUG 2JE7A 3OJBA 4R8CA 1TZOA 1LR1A 4K3AA 5LOVA 4CEWA 2CDYA 1JU4A 4AXOA 3OEAA 2YG0A 4GULA 4I4TA 1AL23 5JH7B 4HYOA 4AGGA 4ISRA 1JMKC 3AZYA 4AG4A 1O3RA 1RUI2 2ZX4A 4P9LA 5KMGA 2ARXA 3RZGA 3IPVB 4JDMA 5L7OB 4FLZA 4K20A 1R1ZA 1W6NA 5C8CC 4KP4A 2PQQA 2OTJV 1AJPA 4IESA 5I0DA 3POFA 4OFGA 1Q3EA 4AHZA 1PMIA 2KG7B 1XOUA 3CIHA 4OQ9A 4JGYB 4A6SA 4J7KA 5K1PA 4DV6B 1GQHA 2MNGA 5A33A 3LDCA 1JYCA 2YFUA 3ABTA 3AZXA 4XPVA 3PTYA 1VLNA 3AC0A 5A33B 4UFHA 5C6CA 1C4RA 5D5PA 2L9LA 4HG6B 4E4SA 2PA7A 4IERA 4XAAA 5EZYA 1I08A 4IE7A 1S0GA 5CADA 4YVSB 2JDYA 3WG1A 1S4CA 3FUOA 2O1QA 1K9MW 1PP9H 1RUE1 2HWB1 4EJRA 3T1YB 3AG1B 3PNAA 4U3JA 1WLWA 1D2DA 4LKEA 4XBFA 3OYWA 3A23A 1J3PA 4MVRA 4IIJB 1EAH2 3K58A 1V9U3 3WG7B 5A3TA 2WYFA 4L8QA 3ZIWA 3MPBA 3U10A 2ORXA 1ZNPA 3K3WA 4HT1T 4YSFA 1ZRCA 3I59B 2XQXA 1E1QG 3K3OA 4Y4YA 2WA3A 3DXTA 4B3MO 4I0XA 5CBGA 2E33A 4J11A 1A34A 3OR6C 5DDJ3 5B4XA 4QPIA 1GWKA 3FFZA 2LUWA 1RIRA 3HIFA 1ROPA 5FZCA 1RPOA 1FX5A 3T08A 1RXGA 4LKDA 4AEDA 4QPKA 1K34A 2J42A 3DTUB 3PURA 1KKDA 2Z69A 1NA1C 3O1TA 3KHBA 2FCUA 1RUJ2 2RJ2A 4GLXA 1W04A 1XU1A 2AZ2A 5CA0B 4NHKA 3UCSC 1Y7BA 2NN4A 4LA3A 5HCAA 2E76B 1D7PM 4OUMA 4JGYA 3TEZA 1PO22 1VBE3 4DR7O 3C8XA 1RUI3 5HFMA 3I8TA 5CMUA 5C33A 1YJLA 5IDJA 3H3UA 3CMAV 1K5MA 1ZZBA 2DCTA 1UL9A 2OXBA 4K6BA 5C5TA 1N0JA 1M4UA 1N47A 4G28B 3CXCU 4WZCA 3IJ4A 4G2KA 1SPPA 4LF9O 1JHNA 1O5LA 4CS4A 2E32A 1DF5A 1PIV2 1NZCA 1TUEB 4CS2A 2B9UA 2E53A 1VF5B 1GSLA 4LBQD 2HLDG 3ZIXA 2OCHA 1V9U1 3R65A 2V72A 4Q4Y2 4HSLA 1N3QA 3PLQA 4OMCA 1DLBA 5IAVA 5GZEA 1BHAA 3RYFB 1REEA 2D6MA 1UAIA 2Q7HA 4CCOA 4CCJA 2YB7A 1XQNA 1CIYA 5ABJB 3VBRC 5GLUA 3VHPA 1AR61 1XREA 2ZZQA 1NA1A 3HAGA 3WQ7A 4UB8Z 4N53C 3SJCC 1LOEA 1OA4A 4QGNA 4CDQA 1SF9A 4Y5Z0 5DEDA 4Q4W2 2GUZA 3KF5A 3BA8A 2BSKB 4DK1A 2VMHA 2ZEWA 4MSVA 1W3XA 1KJRA 4O2AA 1UZVA 3LEKA 4LEJA 3RW0A 3THDA 3CQOA 1HX6A 2ZACA 3FLRA 1SBEA 5FZMA 1VBE1 5EC2C 4AQ6A 2ETNA 4GMP1 5FMOL 1TUBB 4KBBA 5JZGC 4TLGA 5A3WA 2ZGNA 3N2KA 3U4XA 1EPZA 2HFEC 2C26A 4Y1YA 3OPTA 1OCCC 5CB4B 4B3SO 1W0PA 3MFCA 1BXHA 1QF3A 3FL7A 4W4ZA 2R041 2Z42A 1GWLA 4KWUA 1XNAA 1V9U2 3AZZA 2MHFA 2B39A 5EYXA 1YI2V 3C7OA 3NJZA 3T4ZA 2JG9B 4BMBA 2JG9A 1JHJA 4QQOA 5FZ6A 4FOWA 1AZDA 1SCSA 3J8F1 5B66Z 1WCKA 1PVC2 3VD3A 1E79G 1XMQO 1W8OA 3FHAA 4D6RA 1IBLO 3E86A 4X66O 1AX0A 4LWSB 1OXCA 4QQPA 3D8CA 2XTAA 2WA4A 4CP1A 1CAVB 3L72H 4I5SA 3HBZA 4Q4V3 4LF7B 3WXPA 3LIGA 1F5JA 1V70A 4R9BA 1FS0G 1MSDA 4EKWA 1BQ0A 3RQ0A 4ATFA 1D4M3 1FPN2 4YRDA 3QO5A 2PHWA 2R9IA 3K51A 2ZE8A 4QU1A 2CAUA 2YBKA 5A32B 1QEXA 4LQRA 1ZBE2 2HHHB 3LGRA 2J7MA 3ZHVA 3UM7A 4AHCA 3T09A 5JCOC 4YGCA 4M3CF 4IE4A 3CJHB 1XU2A 2A7AA 3VBHC 1HQLA 3OCPA 2DQ3A 1ND2C 2WZR3 1N33O 4TV8A 3DGEA 1NTZH 3LDRA 4BA6A 1ULCA 3WV6A 3PIGA 4OHWA 2VNVA 1W39A 1RVF1 3ZSLA 1WP8A 4K0KB 2QZ3A 2JD4A 2H0VA 2AGSA 2HYKA 1GTOA 4I02A 2Q1MA 1OA2A 3PUIA 1CPNA 2XONA 3FLTA 3T2QA 1EPWA 2LP7A 3H3LA 2A71A 1HB3A 2RDQA 1PM4A 4GWNA 2EILB 2Z4FA 2CH7A 3C3TA 4BISA 3CEIA 3O0VA 1UNBA 1BK0A 1SQVH 4UVCA 2VS0A 3ACIA 3E22A 5F37A 1FMD3 3VHRA 3ZFEC 4BB3A 2X6AA 1IG3A 1VQNV 4QXHA 2JE9A 4DXWA 2OKXA 1XE0A 5CA0A 1GK9A 3GGLA 1FATA 1CAWA 4S2HA 3WQBA 4D6TH 3WDVA 4JTCB 1PKXA 4NIAA 3FAVB 3OOXA 1ONAA 3DPRA 2W95A 3QNEA 1QXPA 3NV1A 3OGGA 3AFKA 3B7MA 4TLFA 2EBOA 2P22C 1RUG3 1F4NA 4JI1O 4XAEA 3SCGA 3T2OA 5FUNA 4GAZA 5J1XA 2X6BA 1LHWA 5LA9A 4BMEA 5L7OC 2WAAA 1VIBA 4IL6Z 1OBNA 2JEXA 1RUF3 4ZPIA 3VOUA 4JTDB 3M99B 4EE2A 2RS33 4ZIBA 2H8PC 2M6YA 1JQ0A 4COUA 4LF7O 3EHKA 2IJHA 1OPMA 1DYOA 4QQLA 4DUZO 1RUE3 4B1MA 1NCRB 4NXNO 4YJ3A 1XYOA 5F7UA 4JYAO 2ZHKA 5KBFA 3EB7A 1DIWA 4FBFA 4IEPA 3IKWA 2XKOA 4YIPA 2K2SA 1K5MB 3CZUA 2W68A 5EBWC 1QDCA 4IV1C 4JI7B 4Y1ZA 3OMNB 4AL9A 4AW7A 1R6NA 3FX7A 1PO23 4OHXA 4PI2A 3D5OA 4JTOA 4ZS2A 2F1MA 4X20A 1YIPA 3KV6A 5ACA1 4YG6A 4R8HA 3EBRA 5EWSA 3ZM8A 2WLIA 4ZHQB 4HNAA 4DK0A 2GH2A 4RN5A 1IBMB 1AVMA 2EIMC 4QPIC 4XJAA 3OFNG 5L3DA 3G6EV 3ZFFB 1DU3D 4XABA 2GMPA 4KWLA 1SBDA 5FYIA 2NNUA 4QPGA 4FFHA 4FMTA 3DSQA 1LECA 1S0IA 1M1KW 3JB8A 5JVVA 1AYM2 5B1AC 3F2ZA 5FNVB 4KU8A 5IJ9B 4CZSA 3U37A 4H33A 3WT3A 5JI9A 2ZPXA 5CA1A 3HKCB 4M4RA 2G9FA 4X6RB 1HWYA 4YW3A 2XH6A 1E1RG 4IYHA 1VEWA 2Q8EA 1VBD3 2VVDA 4DO0A 1WD4A 3LPFA 4YZ2A 1XSRA 3OEEG 5FZ8A 2RS12 3KKYA 2DCKA 4EWDA 1XBLA 1JJ2U 5I93A 3T0AA 4FFIA 4YVSA 5LCWL 5EZYB 4RQPA 2ZCEA 3QCWA 2ZAAA 2JRIA 2A3YA 5H2FZ 2ITCC 4JYYA 4PLMA 3WP5A 2IFWA 2Z0AA 2DWRA 2NPIA 1K97A 1YFWA 2XAGA 5IVCA 2AYHA 3USUB 4UXNA 5C3RA 3UETA 3IT8A 1MEC1 3FHQA 1OLQA 4IV1A 3CO2A 3E5UA 4K7JA 4MTOA 3JATB 5CYYA 3D4KA 3ABZA 5GZFA 4Q26A 4DRVA 2DU1A 3RWNA 3KVBA 2YMZA 2DW4A 1U0AA 3ABKB 1SESA 2VOVA 2DVGA 2QKSA 2WABA 3SDLA 5LA1A 2WWJA 5CFCC 1GO3F 5EPAA 3IBMA 2GC3A 3FJSA 5FMDA 3IDEA 3ABLC 5FPVA 1AL22 1A8DA 1SLTA 3OGVA 4GX2A 1CGPA 2IVIB 2P5OA 3W20A 1XDCA 3JARB 4LNUA 4PA9A 1W3VA 4RGAA 2ZGKA 5DAVA 1R091 1STMA 2GAUA 1DQ2A 2BYVE 1BMFG 1JPXA 1UKGA 3VUOA 4YGBA 1M4WA 4XQDA 3RFRA 1AR81 1QR9A 2Y38A 3RVZA 1KB9F 5IVFA 5A7WA 3ZMZA 1NAEA 4QPWA 3JALA 4KFMA 4X20B 1QU0A 3M7AA 2PYLA 2ZEXA 3KD4A 3LSEA 4H13B 1E5HA 3PL0A 1M57C 4IEOA 3NWKA 4U2AA 5DECA 4W8JA 5FK8A 1ZLZA 2DUOA 5C4WA 5GZDA 2IJKA 1YQ8A 1CAXA 4N9IA 1D2QA 4NUBA 3H1LH 1W0NA 3O1MA 1OMIA 2D2CB 4YW2A 5A6QA 1FNYA 4M01A 4UCRA 3K9SA 4O2BB 2WL1A 3BA9A 2CWMA 2P06A 5H9RA 2WUHA 4LBKA 4BWAA 4JI8B 2NLJC 3U78A 1RUC3 1XEQA 4B3RO 2JIGA 2YYOA 4X65O 3BCCH 4Q5OA 4MHUA 1N32B 1GLHA 2AACA 3CCVV 1COV1 1LR5A 1MS4A 3MUY1 3U75A 2EF6A 1ASJ2 4X62B 1RTVA 4B4QA 1S0DA 2QNKA 5CKMA 5E6HA 5AC91 4XXPA 4CH5A 4FPFA 2WAOA 4DR3B 2WNUB 1TG7A 1V6OA 2EXKA 3HNYM 3O14A 2BBVA 4Q0PA 2CTWA 1OQEA 4XBLA 2HWC3 2R043 4MXWA 4Q0UA 2W5FA 2DVFA 2P17A 4O4HB 2WQZC 4NO4A 4YG0A 1N36O 4K35A 3UT0A 4Z1MG 3AP9A 5JIUA 2YEVB 2HR3A 1SQGA 1F2NA 3I3BA 3U4SA 1VQ5V 5KLVH 3WQ1A 1B04A 3G6BA 3MBWA 3CJIB 3ES1A 5EJZB 1OVSA 2HVJC 1F35A 3IPVA 1UYPA 4LCUC 5IW0A 5C9AB 1SCRA 2Q5TA 3VKLA 1G4YB 2CDOA 4MVMA 1VBB1 4XDJA 4LO8A 2WLMA 1JVMA 2IH3C 5IFPA 4H0LB 1QQCA 2HHHO 3GBWA 4BCUA 1KUQA 4LUKA 2IXLA 4DV5B 5K0UB 1LB2A 4LPLA 2AREA 3N2KB 1SBFA 3I7DA 4AEDB 4FLUA 2E6VA 1BL8A 2GALA 3N7MA 4B08A 1VQLV 4DR4O 3ZR6A 5I0UA 1RXFA 3AP6A 1H8TB 1JYNA 3RG0A 2F4PA 4Q1RA 1WW5A 5LK7B 1AR4A 2A79B 5LBCA 1YIJV 2QR4A 2GUZB 2YHJA 2ZHMA 4RQFA 3G67A 3WP6A 3W7WA 4UW5A 3B8NA 4QX7A 4A3XA 3HT1A 4DUWA 2F95B 1RUD1 3MIBA 2Y64A 4XJUA 4ZI7B 1IDSA 2WNUA 1H4GA 5ABJA 3AG3B 2IM9A 1XMQB 4Q8KA 2Z3YA 3MF9A 3K3NA 2CAVA 3MF6A 1S0FA 1ZX5A 4LFBB 1W2OA 5FPLA 1AR93 4WM8B 2PQSA 2VMGA 5IAXA 3IIIA 4I0WB 4E9KA 3DL3A 1LU2A 2QQWA 1M57B 2A6YA 3WHUA 4HK9A 4QX1A 1K73W 4AWDA 2YY1A 3CCEV 1HLCA 3HMYA 2LQTA 2DOSA 3O1UA 3BHPA 2XOKG 3SKJE 4FJCC 1VBB3 1VF6C 4UFZA 3ACHA 3I3QA 4KHPB 1CJDA 3H01A 4P9PA 1N4CA 1T6BX 5FO8B 1P84F 2D6KA 1VAKA 5K9YA 3FYIB 4MSWC 2JG8C 2RR11 2WNEA 3J4UH 4LMFA 1QOOA 5E88A 1UKRA 3TJTA 4XVHA 1PVC1 3S5QA 1S72V 4M3CB 1RUH2 3BODA 1VR3A 1YO8A 3HR0A 2HJIA 3EHBB 1P4RA 5EV7A 5C3PA 1NI8A 4QGLA 3WSOA 2EXIA 2AZ5A 4XCAA 2GBOA 2YUEA 4QQHA 2X53S 2OT5A 3ZSEA 3E8HA 2JB8A 2XT9A 3I2JA 1YC61 4XTMA 1X82A 4URTA 2YXYA 2YUAA 1H8HG 4NB5A 2P3KA 4TT3G 4JHTA 1PX3A 2WYSA 3VKNA 3CJHA 2M7WA 3B01A 2CL2A 1SDDB 3ACLA 2ZDIA 5FPXA 2C0ZA 1UZWA 3W58A 2VCCA 4DS0A 4QGMA 4CBCA 2R32A 1XOYA 5IWAB 5JSPA 2PAMA 3VV1A 1YLLA 2RJKA 1VRBA 3JZVA 1YFUA 4Q4X1 3CB2A 1SKVA 1W9TA 2QM4A 4RWUA 1XSQA 4JI1B 5IK4A 5HPOA 1FMD1 2ORZA 2HEWF 2PI5A 3LE0A 5SV5A 3RYHB 3POWA 4GMP0 5LMNB 1S0EA 4IGQA 3LEMA 4X8PA 1CP9A 3AKSA 3CRAA 2NMOA 1Q6HA 1R3KC 5LBEA 3EXUA 4LF8B 3H8UA 2WLHA 2F6BA 5FYHA 3PVEA 3ZKUA 4CVUA 5A70A 3K4DA 4C1XA 3BB6A 4CDXA 1GOGA 4XQWA 3CX5F 3B77A 3ASNC 4AI0A 5H9QA 4XIOA 4YM3A 1MZEA 3RYIA 3MI8A 4DR2O 2GMMA 1B06A 2AW9A 2YROA 2DQ0A 4JI8O 4WM8C 2K1EA 1O59A 2ZXWB 1EV13 5B1OA 5JLVA 4NKGB 5DQ0A 4K1YA 1POV1 4NHXA 5KX5B 1VBD2 1KD1W 3UYJA 3FN9A 4LOTA 2LGQA 2UU9B 3GF6A 4MX3A 4OI0A 3TEYA 1QJX1 4Z82A 3KVAA 1R093 3MYXA 1MS9A 5FY8A 4O4JB 5FY5A 4UF0B 2V5DA 3UKVA 5FZ0A 2JIJA 1BGYH 4X8NA 3RGBA 3C7GA 1H8VA 5CA3A 2RS52 4LLOA 2OQ7A 2W39A 3L2HA 5LW9A 5EFUA 1OOPA 4HK8A 1APNA 2BW8A 5EK0A 4MXVA 1HRI2 4NTWA 4C1WA 5HV4A 2XDVA 3L73H 1D4M2 3OG2A 1QQP3 3TNQA 3CXHF 1SQQH 1DGRN 4PDWA 1URXA 4J1XA 3T1LA 4CPBD 5ANNA 5C3SA 3BCWA 4W6YA 3IB3A 2YGLA 1ULGA 1QJU2 2PHTA 4G4FA 4FLVA 3ICXA 2XJQA 1R1A1 1ZSPA 3C3SA 2XLFA 3B69A 4BW5A 2CU5A 1GN3A 4MZUA 2B45X 2BCCH 2J1RA 3JCZA 3BIEA 1JH5A 1BZKA 3T2PA 1UOJA 1B09A 2OCCB 1F31A 1OLMA 5IFTA 1QLEB 2BTQA 1UU5A 1CAUB 1VARA 2ATFA 1FFXA 2YXHA 3E89A 1OHFA 4PDWC 2HWC2 4CCNA 1GAXA 2RS32 1UY1A 1XE8A 1C1FA 4HN0A 3NO8A 2DWEC 4WVMA 5IWFA 2CTPA 1AB3A 1C8M1 2XHKA 4U7OA 4LE3A 2KM2A 5C5UA 2LM3A 3GZEA 2WNVA 1GMMA 2VJXA 4QPGB 2J1EA 1K3IA 3MPPG 4HXCA 2ATKC 1UWWA 4XIKA 3AMNA 4XFFA 2W6IG 1NR7A 1Q90D 2ITDC 1VAVA 2DYRB 2VMIA 3ZYPA 4B3TO 3M3IA 3ZYRA 3D3IA 4ZOLB 1GV9A 3B09A 2JG9C 2BGPA 2E5LB 1JZ8A 1NXD1 5LOVB 4I50A 5IVBA 4XUOA 1KU9A 1JXNA 5JVDA 5LBQA 1Y74B 1QJY1 1BVP1 1XNRB 1PNLA 1TME1 3CCSV 5IK8A 3MV11 2BNOA 1X8MA 5BYNA 4QPGC 5FQ0A 1MS3A 5FZIA 4BIFA 3N35A 3H7JA 1Y76B 2YXSA 2YPDA 3VD4A 1PO12 1YTFD 1EM1A 1GANA 2QQNA 4YY3B 1MG1A 3JAKA 4IEUA 1IQDC 4TUYB 4XILA 5IYZA 3DYOA 3ABKC 2Q30A 5IJ9A 2EXJA 4DR1O 3A8TA 3SPJA 2VZOA 5FNVA 4CU9A 2HP8A 1GRJA 1AI5A 3ZYFA 3S7IA 1PIV3 1SQFA 4LH6A 1Y9GA 3BOWA 2ZNJA 1ZZ6A 4JI2B 4J6GA 5CIRA 3ZMTA 2VGDA 1BHBA 3ZPYA 2L35A 2ZM6O 5FYTA 4CDQC 1F51A 5FAXA 2VM9A 1JTZX 1ND3B 4XC9A 2WFF3 1QVGU 5JAXA 5EZWA 3TEXA 4UW4A 1J3RA 3GXUA 3N9QA 3KM5A 1K5SA 2B9VA 4UF0A 2FKXA 3WG7C 3SJQC 1KP2A 1RMU3 2BGOA 3FD9A 5A7WB 5CG9A 4ZZ8A 4KUMA 1Q7YW 1WW7A 4MADA 3POIA 3AG1C 1B6QA 4N21A 5AVPA 2Q6AA 4LULA 1MZFA 3ECQA 3VDBA 3Q8CA 1RUC1 1YI7A 2XLAA 1YTFB 4WFAV 1JZ3A 2A73B 2EIJB 3WG4A 1PZ8A 3B93A 3R66A 1ULDA 4LT5A 3SQOA 5E1AC 2G19A 1PZ7A 3VDAA 3T1HO 1ULPA 2ZM6B 2R72A 3DC6A 4M0HA 2PGGA 2D3OW 4XURA 3WB2A 1FXHA 1YYNA 5BZBA 4JPRA 3SYAA 2VZPA 5FPRA 3J9SA 4LNUB 3TWIA 1VBA3 1UYXA 1W9FA 1HB2A 5F1RA 1VIWB 1R73A 3OTOO 3LNNA 4OX9O 4WM7A 3FB7C 5I0SA 2DUPA 3RNSA 4JV5O 5T3NA 3GB7C 5A1FA 2JS5A 4XDQA 1FXKB 3BY6A 2JDIG 4DW1A 5BNNB 4N43A 3ETPA 5F5AA 4W4LA 5A3OA 1UMHA 1ZREA 5LA2A 4D7SA 3AZVA 2VZUA 1S76D 3AK3A 3A22A 4I0BA 3SMHA 1N32O 4YM1A 4LR3A 4QWNA 2V1DA 5KR7A 2ADQB 1RITA 3K79A 5JJJB 3VDDA 1I3HA 1H2LA 5IY5C 4CDUB 2YBSA 1XRUA 1M56B 3KT1A 2WZPP 5ABJC 2FBEA 4HKWA 3ILFA 2FB5A 3ZXLA 3AXEA 2X0LA 4JYCA 4XOGA 5LY2A 5KHHA 1VRH2 1ZTEA 3F7VC 2IJJA 1DK1A 3HPNA 3SR2C 3NNLA 3EJKA 4W65A 4J41A 1PHMA 3NQHA 3N9NA 3NSTA 4RS5C 1PGL2 1GZWB 1FXVA 1EBOA 4IEYA 1NY71 4AQYO 1CZVA 1YEWA 4KBZA 4JGZB 2VQAA 2VOWA 2EIDA 4PDVA 2VBDA 4NXMB 1UF2C 4R9DA 3OBTA 1A8MA 4QT6A 2WFF2 1RGSA 2JGDA 1UXZA 4NPMA 4LFCB 2ZT9B 3K0DA 5AFEA 5KXBA 4CUCA 3CCUV 2ENRA 3WDXA 2R0FA 1PV0A 4AHYA 3K04A 1NT2B 2X5IC 4MGIE 1Z7S1 2ADEA 4BZ4A 1DBNA 2BTOA 5L9BA 3UKNA 4LTAA 1ZA7A 3VDCA 5EJ1B 2ET7A 1VBC1 4D6SA 2AENA 4O4IA 4FFBB 1XC6A 3JD72 3ZN4A 3TK1A 1UY3A 4GUNA 3IMMA 3DXRB 4TV9B 3IMNA 4PA6A 5A32A 2XPJA 3N7JA 3BU0A 2GN7A 1PO13 3OPWA 1EFRG 1J95A 2D6LX 4W4KA 1GFF2 4XUPA 1DLCA 1XNDA 3QH7A 3MV01 3JBG1 2Y0PA 1AXKA 3K59A 5CNAA 2R9RB 4KQ7A 5A1LA 5F3GA 4OULA 3KV9A 1J3QA 3O1SA 2ES3A 5FK7A 5A6YA 2HEYF 1K7DA 2ZGLA 2KR2A 1HJGA 2UYBA 4EB6A 4PI0A 3L9DA 4X62O 4FTSA 3I2IA 1O3SA 5ACA3 1JZ2A 4C91A 1DYPA 3VQXA 2V5YA 3USSA 4QNHB 1BVVA 1WLEA 3W5NA 1N3OA 3WD5A 4DR5B 4YZ5A 5D1IA 5FZKA 2RMU1 4NN0A 4W6WA 4RD7A 3VLBB 1XNQB 1S0CA 4L0PA 1QY4A 4AVTA 2WAMA 1AJKA 1HXS1 3CC7V 1NH2B 1HJFA 2QE7G 4YW7A 1TE1B 1QR8A 4PBPA 3CC2V 1RYYA 5FOJB 5DUUA 4PV1B 1GH6A 5BNOC 2DCZA 3FUQA 1NVPB 5LK5A 3U07A 3S7EA 1WMEA 5FPOA 2HBTA 3E5XA 3QH6A 4UOJA 5K8SA 2ZS6B 3BN6A 1O4YA 2WT0A 3VBHB 3BOPA 2P90A 2HLEA 5IYCO 1FXKC 3O1PA 1UW8A 3RRDA 4XDPA 1QHDA 2VMCA 1PGSA 1HW7A 5FY0A 1L8DA 2YC4A 2FDIA 5HCFA 2ZIOA 3WCRA 1CONA 5IVYA 1Y4WA 4UFIA 1QJU3 1W9SA 3ZMVA 4FOQA 2P67A 1OCCB 3HD8B 4QPJA 2RMU2 5LA6A 4XBQA 4DV0O 1NE6A 3E83A 2BVVA 2QM8A 5JDBA 2JJ6A 1W6NB 4UVAA 2Q8DA 3IAPA 1HRI3 3RS6A 4AQ2A 2UUBB 5DABA 2VZSA 2JX9A 1NT0A 4IE5A 4GYCB 2R061 2QJ1A 4QX3A 5LXTB 4DV7O 4XF1A 1MQTA 1QNWA 4U7NA 4LP8A 2HWE2 1SQPH 3N9OA 2YIAA 3I59A 1SLLA 1POV3 2HWD1 4RR3B 3S3WA 1EV11 1QJEA 3PJQA 2PMWB 3KZ4C 4QXBA 2A70A 3G71V 2E3CA 3RYCB 4DUZB 2A1XA 2V73A 2DVDA 2EALA 5HXVA 3GVMA 5HBAA 3ZHRA 1AJNA 1EN4A 3ZN6A 5HCHA 2D5FA 1V6KA 4NTYA 3ZSKA 3GCWA 1VMJA 3AMQA 3ZSJA 5C4WB 4OVEA 1AR83 1Y66A 4FPGA 5TISZ 3ATGA 4XJZA 4OZOA 3WDYA 3DPRB 4EN0A 2UXCB 5IJ0B 2OWOA 3ASOB 2I2SA 2VUCA 2DE0X 1NZIA 1WPBA 4YW4A 1W06A 5F9TA 5GALA 3K06A 1LEMA 2H0BA 1NQDA 1U5IA 5T54A 1HIXA 1X7NA 4LJHA 4META 4YWAA 4Q0QA 4LNVA 1FV2A 4H55A 1UZYA 1K4CC 4HBNA 3N3HA 4UAPA 3GNEA 1H2KA 4WM7C 5M0TA 1YSCA 4NR1A 1HNWO 3GALA 4FQ4A 2C24A 2YC0A 4PBOA 5FR3A 1XNBA 4P02B 2F4VB 1N1VA 2WNUC 3CRQA 2XAJA 5C8YA 5ITZA 3E8BA 2YU1A 3OGCC 4S2FA 5FP7A 4X1KA 2EIEA 3BAAA 4ZY9A 4AVAA 5FO7B 1BMV2 2WDBA 2VCAA 2EIKB 1H8EG 4IXLA 3JCIA 4LO4B 2X29A 3KG2A 4QX5A 2RMKB 2YGMA 4XMAA 1YI9A 3JD73 2GH8A 2ZGSA 2B42B 2I45A 4DO2A 2UYAA 1IKPA 1W2TA 2A3QA 3ZN1A 1JUIA 3O1OA 1QDOA 3V0AA 4R7CA 1GZTA 2O8OA 4QKNA 2XB6C 3S5AA 1BE3H 1AI6A 1UQXA 2JB4A 1FXKA 1IHMA 4DRRA 2YU2A 2QTSA 1QNMA 1HQWA 4N7IA 4JTAB 4D7YA 3JAKB 1TGOA 5FYMA 4DR1B 4AI9A 4LIUA 1RUH3 1KECA 3MZHA 3FHIB 3TXQA 5LMUB 1KC8W 4DXZA 2BWCA 4KXRA 2CY6A 4F6RB 5J37A 1D0HA 3WDWA 2GDFA 1O8SA 1RUJ3 1UMIA 3AEIA 1K8AW 5B4NA 1GM9A 4QXCA 1A78A 5CFCB 3H1HH 3ABUA 1TME3 4LOSA 4CEWC 4UVBA 5FZLA 5LP6A 3NR7A 3HEIA 3AJYA 4P08A 2Y6LA 2RR13 1MOFA 4COVA 1OC1A 1S0JA 4N9HA 4M0NA 1Z5VA 2GNTA 3BABA 3HR9A 5DMYA 4YM2A 1X36A 5DAPA 2WC2A 5IY5B 2PLV3 4XTPA 2YPJA 1G6UA 5C9AA 3ROUA 1AR92 4V1PA 4Q4Y1 5A3MA 1LHUA 5GJ6A 4FQZA 4AFCA 1XE7A 5GW7A 4XMIA 5IJ0A 4AILC 1RHI2 3OMIB 2VNOA 2ZKNA 1YHFA 2V4VA 4QDRA 1XNQO 4BAYA 4GXLA 1RJ7A 1OFNA 4H44B 2VCBA 1AJOA 1HNWB 4KGQA 3MGUA 1SLIA 2GC0A 5F3IA 1WBFA 1XBFA 5D5QA 3SC7X 2ZZJA 2RN9A 1VBA2 1OH4A 5JQGB 3KMHA 3C90A 1RMU1 4CXYA 3MIFA 1W2AX 4BM8A 4ZU4A 1VQ6V 1BMV1 2JEMA 3N36A 5J2UA 2LROA 4CU7A 5I0TA 5KUKA 1I1EA 4PIXA 2BE3A 2A75A 5LA0A 3AYCA 4XJ8A 1DZRA 1DDLA 1C57A 3V56A 2ZGMA 4J25A 4AHXA 5E89A 5CA6A 5IVEA 3SYOA 1RFYA 4Q4W3 3RYCA 4Q1PA 4AI8A 4H2AA 3ETDA 5FP3A 3AG7A 3ZX7A 2GMEA 4FPHA 1XI1A 1C3HA 2BBAA 1U96A 3RZJA 1V6JA 4WZFA 2ZX2A 1H2NA 4AI3A 4QM9A 5JIAA 3E35A 3AL5A 5FV3A 5L9RA 2QDNA 4LFCO 4MT8A 4JYBA 5JOWA 4F83A 2YICA 3OMAB 2ZAHA 3VD5A 3LWCA 3ZXEA 5CBFA 3VHNA 5J98B 4LK6A 3N27A 4HONA 1AR1B 4G9SB 5JMCA 1I0HA 2F23A 1Q56A 2R071 1O9HA 1OQ1A 4K8XA 4NROA 4JHZA 1MR5A 1W0JG 4INDA 3D82A 3W7UA 3RYRA 1LTEA 5BNPA 3OBAA 1ST8A 4B29A 4PT6A 4FFFA 1AYN2 1P8JA 1W8WA 3CJIC 1A6CA 3L74H 2DV9A 3HPLC 1LCLA 3K48A 2GZWA 1PK6A 3ETQA 4GKKO 3FB8C 1P49A 1F23A 5HCBA 1EUTA 3RZHA 5LL6Y 5JI7A 2VUAA 1AXYA 1GP4A 4DR2B 5FDBA 2W94A 3N2GB 3WP3A 2XL7A 1LKNA 1ZAUA 3GZAA 3AKQA 2LS6A 3IAQA 4RR3A 1UOBA 1M93A 2HH9A 1Z0HA 1M56C 5L73A 2IW5A 5T5LA 4JQTA 4ARXA 2I07B 1C28A 2VMEA 3WEZA 4NPRA 5IE9A 2E31A 1A32A 1BHGA 4YZ1A 1DGSA 4LA2A 2SBAA 1AYN3 3J80N 2XBO2 2AH2A 4D3WA 2PN5A 5EYPB 3LDDA 3ZFEB 2P5BA 5FY7A 4DY3A 5JWPA 2OZJA 1S3JA 4GH4C 2VNRA 2YXLA 2WS92 4MV2A 1UO9A 1QWRA 2FCTA 4FO9A 2RDCA 1H1MA 1UCXA 3UO2A 2L6LA 5CFCA 5GZGA 2K0GA 1TVKA 2RDRA 2WBKA 2R073 2YC2A 1LUVA 5LGTA 4JDNA 4RO2A 3BTZA 4F6RA 4IUGA 2MEV1 4N53A 1XNKA 5FOBB 2C1FA 3T4VA 4WVZA 3OY8A 2EICA 4QB6A 3KCXA 1GWMA 2A3WA 5LEKA 4PIYA 1GZ9A 2MW2B 5JJNB 4H7MA 1NJIW 2LGWA 1TVGA 4AFMA 1I7FA 4NHYA 2FMYA 1JI6A 4YZ4A 2XG3A 4XW3A 3UNPA 3H1JH 4BLJA 1R6TA 2ZA9A 5FYSA 4BXSV 4IHJB 3VZKA 3PIJA 4UW6A 4TSFG 2D6NA 3VN4A 4OXSA 1NBMG 1Q6UA 4DXRA 1NCQB 3M7MX 2GSMB 3H7YA 4CCMA 4DYLA 2VTXA 4HNAB 3MICA 2HYXA 1UN1A 3BGAA 5JH7A 1S5JA 1L7RA 1WMFA 1WW4A 3VKOA 5CKNA 4ABMA 4UCUA 4QPYA 1WMDA 3WF1A 5KHIA 1IBLB 3AFGA 4R9AA 3O1VA 4DV4B 4LHNA 2QQIA 2PHXA 2QE3A 3AG2B 1N1SA 3LSDA 1X8EA 3NAPC 4GIQA 2ZINA 2P6JA 4RQPB 5D21A 2EAAA 2DDUA 5AFBA 2HWD3 1QOTA 4DEVA 5LXTA 4PJ0Z 2W1WA 3FBYA 3BPSA 2PY5A 2JJ2G 1W8FA 1NCQC 1R081 2Q73A 1SA0A 1Q8PA 2HWF2 3E6CC 3A21A 1HR0B 4XDKA 3SYPA 3KZIZ 2WLQA 2JDHA 3B9IA 1H9WA 1QH6A 3L70H 3NXSA 2FQPA 4DR6O 4KWJA 1QQP1 5KXCA 1DGLA 1L0LH 1PVXA 3VL9A 1BLZA 4FLXA 5DN6G 3RZZA 5C8WA 5KHGA 4MGTA 2OYZA 1IS4A 4OPAA 3RDIA 2LRPA 4QJFB 1OCZB 1IXBA 4HETA 3ZS8C 5C8CA 4RR3C 3LA3A 4FLYA 5BMVA 1W05A 1KFUL 3TXSA 1NH2D 3CE2A 4HPKB 2VQTA 2CE4A 4N53B 5F6KA 5B1NA 2V7QG 1VRH1 3QBQA 3VQVA 5KA5A 5LP6B 4O9EA 2XJRA 4E8DA 3L75H 1R64A 2OYQA 1CN1A 1OSGA 2JK5C 1NE4A 3KB5A 3PJSK 4R50A 4CXXA 3J7LA 1FPOA 1F7YA 4Y24A 3AJZA 3IDBB 1H2MA 1K5QA 2YSUB 5FP8A 4YW6A 4CEYB 2QWQB 1YUDA 4NXMO 1OLRA 1QMJA 3CL1A 5FZGA 3UQ8A 1PMHX 3ZKYA 3NNMA 4QKBA 2E75B 3IC9A 3M2MA 3LNMB 2JDKA 4QPIB 3RSJA 3K08A 5I8YA 3TAYA 3VBOC 1R1BA 5J09A 3GBGA 4IDZA 1VMFA 3QACA 3LOBA 2EIGA 1W6OB 3MDSA 4LBLA 3ASOC 3UESA 3KCCA 3PUHA 4DXTA 5T52A 3RT3C 1B35A 4I0XB 5FIXA 4I50B 3TN93 3N2GA 3T1MA 2FZ2A 1PL4A 3K75B 1HDKA 5FCCA 4YGEA 3OM3B 3H9AA 1UPSA 3QO7A 1W2BU 4X66B 4RS5A 2PI4A 3WG2A 3POEA 3J7HA 3H8RA 2RVAA 4R4XA 1CD3G 3GZUC 5FWEA 2AR6A 1W8NA 4U3JB 1MNGA 1MABG 1IOAA 1FJGB 2WQ8A 4Y33A 2QTWB 4DV2O 4P2ZA 3ITQA 1K92A 4YVWC 3DEMA 3VZNA 3JSLA 2HJDA 3I56V 1KEXA 5HFLA 1I6XA 5J2TB 1M90W 3E5QA 1AP5A 1V9PA 2WT1A 3JB4C 3WNMA 2HWC1 1WLTA 5FZ4A 1AUYA 2KA3A 1TMF3 1JODA 2QDOA 4ZI7A 1I5ZA 5FZFA 4JGSA 2X10A 2E5LO 1RB8G 3ZR5A 3B40A 1A3KA 1GP6A 4LBOA 5FWJA 2GDSA 4N43C 1IBKO 2VZ3A 1PNMA 4DR4B 2Y69C 4DNYA 4CDUC 5LMUO 4IGOA 5GKAC 2R7EB 1IXMA 5GM0A 4ITCA 4ZU5A 4NWVA 4MTXA 2RV9A 1H4HA 4AVVA 2D93A 1QOSA 4NJ4A 4GWMA 3A2FA 1MZ5A 4KWKA 1XUQA 1FPN3 4O65A 5FBJA 2XUMA 3H8OA 3AMHA 1R3LC 2JKBA 2DFCA 2EVXA 5GONA 2D3RA 1I94O 3ZRSA 4OHVA 3THOA 2A6XA 1U5YA 1CPMA 4QX8A 3BKZA 4PLOA 2J1TA 4L99A 3OEBA 2BSKA 4X64B 2VULA 2NN8A 2PTMA 3I2GA 2FYUH 3UL2A 5LY1A 5EYYA 1GP5A 2RS51 3JU9A 5FMCA 3VKMA 4YNIA 3WNPA 4Z1VA 4QHZA 1BJQA 1CIWA 4NHLA 2OIGA 3WDTA 1RUE2 4LF6O 2PYTA 1RVF3 4DRXB 1X50A 2VQUA 3M4FA 5GTIZ 3I2OA 5D2AA 5FP9A 1YFYA 1AROP 1ZZCA 4YPJA 2VTXJ 5FZOA 5FZAA 3OPZA 5FMOS 3QVNA 3FYEB 4D94A 3SEEA 1RUF2 4YVSC 4HAMA 2H3OA 1ZA4A 3OBRA 3MUZ1 2WPDG 1G7YA 5F5IA 3CDZB 5BPXA 4LORA 4ICGA 1GOHA 4JI3B 3E1F1 3JAWA 1PMJX 2RJZA 3VBBA 4Q4V1 1EYBA 3JALB 1JFFA 4GH4A 4LC1A 2MEV3 5LGNA 4CSWA 1FFXB 1W59A 2UUCB 1YQ6A 5DG2A 4FP2A 3SCFA 1AR73 1YJWV 4DR6B 4Q29A 4GX1A 4FLWA 2E26A 3OY8B 2UXCO 3VZMA 4I01A 4RQEA 4XF4A 2IXKA 3MHHC 4KNCA 2CWSA 3SYQA 4LF8O 1FNZA 1JU3A 4E4HA 3WUDA 1RUG1 4NIDA 4MGQA 4UUJC 3EFFK 4E4ZA 4A42A 1URFA 4LF5B 4MHRA 1KRIA 3WZ1A 3K77A 1O3QA 1AI7A 2QWNB 1LNQA 1W8HA 1DGWA 2ZJCA 3PUSA 1IKQA 1IG0A 4Y26A 2W52A 2E63A 4I55B 3VBRB 4K9SA 5BY5A 5K1XA 1N1YA 5FYCA 1H2SB 4EYUA 2WSUA 3CCRV 1RJ8A 1JOPA 2W3JA 1QJX2 3OEHG 2A7WA 2UUBO 2HWF1 4JI3O 2A3XA 3AKRA 2WQ4A 2OA2A 5LB6A 2YBPA 3KQRA 4A41A 4IIJA 4BQ3A 2ZABA 3NV4A 4Q27A 4DIQA 2Y34A 5JXIA 1MQTB 3I4IA 2HWE3 4DV5O 5EIYB 4HFSA 1ND2A 4P14A 1ZBE3 3MEPA 3H0OA 3ZMOA 4MH0E 1BEV2 1AHSA 4KU7A 1SQ4A 4F8AA 1Q82W 4XFGA 3E97A 4GWJA 4LHKA 4DRXA 5FPBA 3BTXA 4M3CE 4ZHQA 1OURA 2AHYA 4GCZA 3FAVA 1YJ9V 2RMU3 4UV9A 3GWOA 4J10A 4JI0O 1NKDA 1Y67A 4X64O 1NYWA 2DWDC 1Y9QA 3I49A 2QQOA 1AILA 5B2GB 3T0BA 3C7EA 5B5EZ 3OAAG 5JZGB 3R4UA 3NL1A 4XJWA 2TUNA 3VB9A 4BH9A 4YY3O 1QHTA 3B94A 4QIWF 5F39A 3LD8A 3LSQA 4XBNA 1G8WA 2G9GA 3DPRC 2WWUA 1TUBA 5KMGB 2JJ1G 2CUGA 3DN7A 3LA2A 3WNOA 4LBMA 4J9ZB 4CCDA 1NCRA 3S0MA 5DZGA 2WLPA 4KG8A 3FB5C 4X8AA 2Q68A 4TQDA 1LRHA 2VUDA 1MS5A 3U1XA 3JD71 3ZFEA 3CYOA 4CH4A 1SFNA 5J2UB 3UV9A 2J1SA 2QZ2A 2A5ZA 3WB0A 3AG4C 1J5EO 2D6PA 4I0AA 1ZUQA 4FPLA 3UJQA 5H9SA 3VD7A 1LAJA 1L0NH 2IXJA 1X9TA 1HV0A 1HW5A 1PNGA 2OS2A 1JUHA 2OIEA 3TRSB 2X05A 4GKKB 2Q1FA 1MA1A 2PXJA 3CZJA 4EZ4A 3HKBA 5CB7A 3PVNA 3RBZA 1D5AA 1W6QB 5E79Z 3AMPA 2QQVA 4K21A 3BALA 3HOBA 1SETA 4D7TA 1XHXA 1UZ0A 3IDAA 5FREA 3X29B 4YW5A 1WPXA 5JZGA 4YXWG 2P3JA 1BEV1 3A0HZ 5B1AB 4DUYB 3HB3B 4XEZA 4HL0A 2CTVA 2ZIMA 3AG2C 4ONUA 4BYYA 5K7PA 3ZCCA 4MTFA 4GWIA 4D0QA 3EQEA 4GALA 3FMGA 4Y1UA 2FTKA 1THZA 2JXAA 4X6QB 2VW0A 3PDQA 3ABMC 3D36A 1N33B 3W59A 3POBA 2ZTNA 1NX9A 2VUJA 1GOFA 4OLLA 1S2EA 3VD9A 2WIIB 3AM2A 1HB1A 4F4LA 1UX6A 1NQTA 1JFFB 2YIBA 2VL4A 5J96B 4AAXA 4TOIA 1OOPC 4SLIA 1FAFA 4K3UA 5CBLA 1QJX3 3G80A 4B7KA 1QU7A 1ODMA 1EAH1 4NAOA 2Y6JA 4DV0B 1ORQC 2XUEA 4AR2A 5B1BB 4YG3A 2VQFO 5F2VO 4HLTA 4AI1A 4P5YA 3M70A 3E8FA 4FAHA 4UI9L 1BT8A 1I5YA 2VXRA 4OCTA 2QWOB 5L3FA 5BNOB 1RUD2 4IGGA 5DDJ1 2RNBA 2JICA 4CPBA 3K2OA 3NMBA 3WNNA 3OYWB 1W8UA 4JTNA 4X1IA 2P3YA 2R062 3NV3A 2LFSA 1YF2A 1WN7A 4UFMA 1JR9A 4B4RA 4ISQA 3CF6E 3I3EA 4YHHO 4CS3A 2W1SA 1OH3A 1CX1A 5F3EA 1SZTA 3GM8A 3ZYIB 4MUVA 4SBVA 4L9BA 1ZBA2 2FL4A 4XXAA 4QU2A 3LSUA 1BSMA 5C71A 3POGA 4M00A 1KYOF 5EBLC 4Y1XA 5DDJ2 3CSXA 3N9LA 1O5UA 3ZMUA 2GNDA 3NVCA 1YHQV 5CFDC 2EILC 4CC5A 2BNNA 4B3SB 2LJ2A 2VQEB 1FJGO 1JBCA 4PJYA 3S57A 3GZTB 1ENQA 1DG6A 5KA6A 2JDAA 3HWJA 1DHKB 4O2BA 1AR82 3A4UA 3RWKX 4JZGA 1VBC2 1OLME 3NNGA 5DPNA 1M9NA 1SQXH 3CMEV 4W6XA 4DV4O 5KX5A 4MXWB 1W9WA 4B3TB 2IXHA 4XJ9A 4WCEV 2BFUL 3OUSA 4TV8B 2VXJA 3P30A 5I91A 4P9GA 5FZOB 4EV0A 4JKLA 5AC92 2DMXA 1S0BA 2K9ZA 1ZYBA 1CR7A 4Z92B 1SPPB 2OQ6A 4OYUA 1ACCA 3VBFB 1M06G 1AR91 1WCQA 3HQRA 4LK7A 4MVUA 5F2SA 1VJ2A 2BOJA 5FKCA 2XQRA 5G04L 1V6IA 1L3JA 1G9AA 5A6XA 4RUEA 3WQ0A 1ASJ1 2B7YA 4JI6O 1XXNA 1SG3A 1GMGA 1DGWX 1IS3A 3UGHA 1UY0A 4IV1B 5GZCA 1P7GA 4LHSA 3SPIA 2Y48A 3AK1A 3UKTA 4PD4F 1TEIA 3KV4A 2ZMKA 4XFBA 4IT5A 1W9YA 3UO3A 2CAZC 3ZXKA 3BIWE 2BGCA 5ISLA 2Y8KA 3THTA 4JI2O 4Q2FA 4WBNA 5T55A 1YCIA 1HN1A 2DFBA 4EZHA 4NRPA 4YVWB 4UB6Z 2LTNA 1UPIA 1HNZO 3D0SA 3INAA 2JDZA 4NOTA 3SXWA 1WGPA 1AYN1 3LA7A 3WW3A 1F4HA 2Y6GA 3HKBB 4MGYE 1X4TA 4XUQA 4CCKA 2XJPA 2ETEA 1AX1A 2WLKA 1ALYA 2PHUA 1H9PA 5FLJA 3OUFA 2ZMLA 4CDWA 5EQUA 4YZ3A 4AEDC 4CC6A 1H0BA 1VAMA 1LHVA 4X1KB 5LHIA 2ZEZA 3IIAA 4OMDA 3HKEB 4JAAA 4N23A 4EN6B 5J7MA 5CFDA 5EHDA 3GJBA 4HVOA 1BCCH 5FBZA 3WOGA 1NQJA 2N7GA 3KGZA 5B1BC 4RSUA 1UPGA 1Y74A 4QE9A 4X1YB 2P34A 2DYRC 5F6LB 3G6JB 4J80A 2VQEO 3OTFA 5L36A 4FXGB 4FTEA 4ZOLA 5CFDB 4UT5A 3FKSG 3AP4A 4B3MB 1N0NA 2G38A 4I30A 3T2TA 4Z07A 1AR72 1V0AA 2BP6A 2VR4A 4ORFA 2PAKA 1LGNA 5IVVA 2JWPA 3BUCA 4LE4A 4ZBMA 4CP2A 1QVFU 1JW6A 1JOBA 5BXXA 5IT9N 3R4DB 4AQSA 2X6CA 3N4MA 3AXDA 4CUBA 2VVFA 4OX9B 1GUIA 4ZU7A 5L3EA 2A0LA 2W9XA 4EFBA 4YARA 2ZXQA 3L2YA 5EYPA 4R4ZA 1LGCA 2BWAA 2CSGA 5FQ0B 3DC5A 1NTMH 3ZN6B 2Q1ZB 2WNVC 4TSVA 3VKFC 2IBZH 2C9AA 4GB33 4AVBA 4YVWA 4B1LA 4NPLA 2UXBB 2Y60A 5FLIA 5CEHA 1LHNA 1ODNA 4RYDA 3RMYA 4K1ZA 1RSOB 5KWRA 5CA1B 1QCEA 2RS11 2C9KA 5FTTC 1F9KA 1CWPA 3OGIB 3ZXGA 2E7AA 2ZE6A 1QLNA 2EXHA 4JI4B 4LO7A 2XBO1 5IWAO 2AXTZ 4KMQA 5GTHZ 3NW4A 2D3PA 3X2QC 4O7XA 5CVRA 3E6BA 2IU3A 3POJA 1G1XB 1ENXA 2WSVA 1LGBA 4YW1A 1NLRA 3JQWA 3B4SA 4FFGA 4L92A 3ZDSA 4XHXA 2QFEA 4HMZA 1TNFA 2HJFC 2BPA2 1JCHA 5BV6A 3SCHA 3HT2A 4GX5A 4LXLA 1SFYA 4XUTA 1LODA 2WO2A 3NJXA 2WLLB 1BBT2 4MS2A 1LOBA 2P6HA 2C4XA 2YI9A 1K45A 2W6JG 1ND3A 1LU1A 3ZFFA 2B5HA 2IXIA 1W6QA 3JCUZ 2DCYA 5J48A 4JRAA 4PA7A 1UY4A 1OPOA 4TYSA 3BVOA 1JYIA 3W7TA 3R4SA 3V64A 2XXZA 1MACA 1XNCA 3ZXDA 1O91A 5KUMA 3SEPA 2BRTA 2A06H 3PVOA 2O57A 3AKPA 1ZVFA 3IAYA 5L9VA 2CV6A 1Y4MA 2HWF3 2JIZG 5EJ3A 3CLPA 4GKYA 1IBKB 2RS31 2DYSB 4FVVA 4PDWB 4C0HA 2CYFA 3OW2U 1VALA 2ZX1A 3PMSA 2HWD2 3RI8A 4PF1A 2BOCC 4BQ2A 3UKMA 1FFTB 2ID4A 4S2GA 3NAPB 2XVGA 3JD3A 3M3QA 5C9AC 4WM8A 3IGAC 3SH5A 5LMNO 1US2A 4HOOA 2NZ9A 1S2BA 2DJVA 3VDDB 4GD4A 2K46A 2VOTA 1R1A2 1MMMA 4OZXA 2P37A 1YNAA 1FAYA 3ABLB 2WJSA 4I55A 4LKFA 1HP8A 4WBNB 1RINA 2X5IA 4LIVA 1YXWA 5LP6C 4JV5B 4NRQA 5A7OA 5H9PA 4QHBA 1V6LA 1LENA 5BXZA 3L9JT 1LULA 4BDVB 1DF4A 1H8TC 2O14A 2ARCA 5FYUA 1J1LA 1WZXA 2BERA 4JX0A 1WA4A 5K4LA 3CMGA 4DOUA 4BR6A 3F7YC 4LF9B 4QMAA 4V2WA 2AEYA 3SISA 2GNMA 4IV3A 1WNSA 5LZ6A 3VBSC 5ITZB 4P9JA 1LUWA 3WDUA 3NAPA 3E22B 2QKAA 3CNAA 1WCDJ 3WY6A 4PCRA 5IHRA 1C8M3 4R6ZA 2OPWA 3CRRA 3MW2A 4JC1A 4DV3B 2HEVF 1LOCA 4X1YA 3B00A 1VBD1 4JAUA 4QHOA 3AYEA 2UY8A 4AHWA 4AQYB 3VGIA 3APOA 3ETGA 1UX7A 3OUIA 2VECA 1ZZ9A 4UBHA 3HKEA 4K40A 2D97A 3M3EA 1BBT1 1OF4A 3ZRWB 2JKXA 3D3AA 3U11A 2D43A 1QJZA 2Q8OA 3P5BA 3VZOA 3VHOA 1XL6A 1YJNV 2E74B 1GNZA 2WFF1 3KT4A 4FM2A 3VBOB 5DUWA 3HQUA 3ST7A 1ZM1A 1EUUA 5IYBO 3Q8AA 1YDXA 1CQ9A 1FPN1 3W7XA 4BWOA 1IQAA 4OHYA 4O4LB 3RPQA 1W2UA 3BVCA 4XCBA 1GQPA 2DURA 2OT7A 4TTGA 1REDA 1HB4A 5BUVA 1OT5A 3O7OA 1QBZA 3OTOB 5GONB 2UWBA 5L3CA 2FDHA 3F5WC 3CC4V 1ZRRA 5AVAA 1GN4A 2TEPA 1WB7A 1LNSA 3BTAA 3G4SV 4OI2A 3T3YA 2Y4UA 1UOGA 1J5EB 2BOIA 5FXXA 4YFZA 5H6RA 1RL3A 3RVHA 4MW3A 4H7LA 3LAGA 2UUCO 4UWDA 2ZE7A 2JGUA 3KSCA 1C5IA 4K8RB 3ZRWA 5BNNC 2PFWA 3LIHA 4ASLA 4BQWA 4PDRA 1O8PA 5E16A 2ZKLA 5EIBC 5JSRA 1XMOB 2F4LA 2FDGA 5FL7G 4EFEA 1G8MA 3TN91 5FZEA 4DV6O 1TVKB 2EIKC 4IW3A 3LDEA 2D98A 3B2EE 2FDJA 2QA4V 1HNXB 4DV3O 1ULOA 1WJZA 3VZJA 5KAIZ 3ML0A 3O5SA 4GKJB 4RUFA 2E7TA 4ZKTB 2WLLA 2GP3A 2BFUS 1RUJ1 1IZ3A 4DZGA 2GHYA 3DECA 2B8MA 3WNKA 1DYKA 3ZX6A 1FOD1 1JYTA 2ZE5A 3B5LB 1I94B 2Y6FA 4EWEA 5GLVA 3PU8A 1OCZC 1W6OA 2ZNIA 1SMVA 2RS53 4ASKA 4DFSA 2JD9A 3CS5A 1G9BA 1G6NA 3ZBHA 4LO6B 3HBKA 2LALA 3SITA 3VL8A 3STZC 3O9OA 1IPSA 2UU9O 1Q43A 1D0GA 4WFBV 1LOFA 1EZVH 1Q6IA 1FI2A 5FZHA 2DN9A 2X5IB 4X65B 2EINB 4GZ9A 5FZ9A 5L19A 1LEDA 2IXCA 5HV0A 2WS93 4X89A 2NLRA 4P30A 1D4VB 1Z7S2 3BU7A 4CH3A 4CEYA 1Q8IA 3PJYA 2PHLA 3ETEA 4ZHNA 5J2TA 5FYBA 1JOJA 2R16A 4LBJA 2DYCA 5A3UA 5B3SB 2YDEA 3N7LA 3LDKA 1OVPA 1VQPV 4AVCA 2WSSG 1PNFA 5IATA 3K0GA 4A3ZA 1FXZA 2O0OA 4BIUA 4XFIA 4Q4X3 5TSWA 2VPVA 1CAWB 1C8NA 5FP4A 1MZ6A 3T2MA 2EA7A 3K4AA 4EWAA 2XOMA 1LOGA 3M1HA 4BK5A 5JCOA 1RC6A 4CDXC 1DQ6A 2GC1A 4LUMA 4QB1A 3SYCA 1PO21 4HZ3A 4GJZA 4N7UA 3CJIA 1QJFA 3AK2A 3VBUC 2Z79A 3OGSA 1V55C 1HNZB 3A0NA 4BQ5A 4CU8A 2ZHNA 2MEV2 3P6BA 3MLKA 3OGJA 4JVAA 3VBFA 3LQCA 2YIDA 2WLIB 5LHHA 2N05A 2F66C 1OV9A 4RHV3 4PLNA 4FP3A 4CCEA 3LCPA 2NR5A 5FXZA 2VVEA 3GYDA 2VZVA 3K9AA 3J81N 4LFAB 3H1MA 1KJLA 5F3CA 4AEJA 5F8PA 5T5PA 3I3DA 4TZDA 1V6MA 4B4PA 1C8M2 3B9CA 1Z78A 3PUAA 4Q0SA 3SLIA 1WMXA 4A4AA 1RVF2 3ZXFA 4RQPC 3SH3A 4BQYA 2HWB2 3WF2A 2OCCC 3JBG3 2VH9A 3RMXA 5CKQA 3I55V 5LBFA 2WZ8A 4PELA 4COWA 1RUG2 2JVDA 1MS0A 3VZLA 4DR7B 4YJ2A 1W8TA 3E6DA 4COZA 2ZBJA 3LOIA 1XHZA 1J83A 4O4IB 3Q8BA 3RYPA 2Q8VA 4GKJO 4DINB 1WW6A 2H6BA 3ZHTA 1GU3A 5T5OA 3WNLA 2E9QA 2ZGQA 4A2UA 3AB0A 1CAXB 3RJRA 3PN1A 3TOJA 2C2AA 3C7HA 4C0BA 4RFRB 4XUNA 4P5HA 3HN3A 3CKHA 3ZFGB 4FPKA 2ZGOA 4D69A 3ZIAG 3ZVXA 1YITV 3RWRD 5IUQA 1J1TA 2P2KA 2NMNA 3SKVA 3TETA 5LA6B 2OPKA 2Z5WA 5FUPA 2QWPB 2FDKA 2R30A 3VDDC 1R1A3 3A0BZ 1HN0A 1RUF1 2AGAA 1RUI1 5FY9A 4K8FA 2XJUA 2CTRA 2UWCA 3TB0A 3JD2A 4CUAA 1RUOA 3I2DA 4JGZA 1SLBA 2XNDG 3MLJA 3O0WA 5DUXA 1F8VA 3F5TA 5B3SC 4COYA 4Y1VA 5F32A 1NXMA 2ZR2A 4Y22B 3M8LA 4RAIA 2D44A 2J1VA 4L97A 4X88A 5G05L 2E51A 4N8MA 4LH7A 3I97A 1WA8B 4UXAA 3W21A 5F5CA 5AG2A 4CU6A 4GH4B 3FBMA 5JPNB 1CESA 4FXKB 1I5PA 2VG9A 1LJ7A 1NA1B 4YLZA 3KHCA 1WA6X 4DUXA 1FKAO 1B35B 2VQFB 1YQ5A 4LO5B 1O6UA 5DZEA 1I9RA 4FPCA 3H50A 3WNXA 2Q69A 3AVRA 1U5XA 4WFFA 3ZXAC 3WB1A 1PGL1 2Z5UA 1G9CA 4NVPA 2GN3A 1BBT3 1UMZA 5EP9A 4XF9A 5FPUA 4G3YC 2HG5C 2UXDO 1IPJA 2ARAA 2EZPA 1D2SA 1K5MC 2BEOA 3AP7A 1NTKH 1X9PA 1VQMV 2VW2A 1V6NA 5DN2A 4JI5B 4PHZA 3BTYA 3Q9OA 3UGFA 3GDBA 4FPOB 4AFDA 5FZDA 2P7TC 2WWSA 2WO1A 2BQPA 4WM7B 1BYHA 1HRV3 4EB6B 1O7FA 2RM23 4NE9A 4QB2A 2A6WA 4FPJA 1H1AA 3IZOA 3PTRB 1OCRB 1IURA 2B46X 1ZZ8A 4Y22A 1IGOA 1N36B 2J1UA 1JS9A 1R082 1VF6A 5LASA 3VBUB 5BNPB 1Y76A 4JZ2A 4BIOA 4F7ZA 1JZ5A 2FMLA 3P3PA 5BR8O 4I9QA 2R072 2UWAA 2R042 2N74A 4UW3A 3P3NA 3RYIB 3E8GA 2LO1A 2JDPA 3O65A 3STLC 3AKTA 3DKWA 5C8CB 3JASA 2TNFA 4HSJA 1JX9A 4NMIA 4XDOA 1W0OA 4B3RB 2QQUA 3TBDA 5IT6A 2ZGPA 4DUYO 4HZFA 1SS3A 5I8SA 1YXBA 3V65A 4Y4RA 5GLZA 1AR63 3QLQA 1XQ8A 4XFAA 1MEC3 1NLSA 3S30A 4XFHA 2R49A 2BOBC 2W91A 3LEGA 1ZBA3 4CTEA 4H37A 1H2GA 4JGZC 4XYXA 2CK3G 4KG0A 3BEHA 4ES9A 4FZ1A 2WO3A 2Y0IA 2X8KA 4URAA 4WVWA 1W6MB 4JCKA 4LF4O 1NLQA 2CH7B 3B3QE 2OUJA 3FC0A 4Q4X2 3HKDB 3IN9A 4F6EA 4FTBA 3ZFGC 4OHZA 4D8MA 2YI8A 4I2OA 4ZXEA 2I74A 4JQRA 2YZ4A 5J36A 3JAMN 1E5IA 4RS5B 1HQNA 4P9YA 4MVSA 2WZEA 2XLGA 3BYWA 4AVSA 4CEWB 4C8DA 1LOAA 4FSJA 3ME2A 2ZD9A 1COV3 1JZ7A 4Q4Y3 3ZEDA 4MVOA 1C5HA 4DV7B 1PL0A 3FB6C 5CU1A 3SJAC 2AHZA 5A7PA 4ASMB 3NKGA 1NU1H 4YFWA 4Q8LA 4CUGA 2KG7A 5SV8A 3W9AA 1BZWA 1E5SA 1W6PA 4M4PA 1TA8A 4FIPC 3K4ZA 1ZZ7A 4W50A 4JAVA 1N34B 3MW4A 5A7NA 3SPGA 1KD7A 2ET1A 3ZRVA 5DAWA 1MVEA 1NZ6A 4LITA 3JUUA 2D40A 4Y20B 1HV1A 1PK6C 4IEXA 4AGRA 2UU8A 1QJY2 1OKQA 5FMBA 1AR5A 4IYIA 4FT8A 5KAFZ 1JYWA 1WCUA 4LFAO 2F43G 5BNPC 1N1TA 4FLTA 5ANQA 1Q8QA 3JAWB 1SC5B 3K03A 2QTOA 4NIGA 5C7GA 4Q4V2 3SGIA 4O4JA 1WCSA 4EN8B 3WR0A 1SEFA 4H3WA 1NS1A 1UXXX 4IQPA 1VRH3 2VZTA 4LWSA 3UGGA 2O8QA 1SZBA 1PD3A 2QDRA 1ND2B 3CD6V 1UJWB 5FXWA 1JYVA 2VU9A 2EJRA 3UT5A 1UYZA 4PQQA 2VY0A 3RYKA 3ILRA 1OCRC 2FHRA 1RSOA 2XASA 3OD4A 1YIFA 1BQZA 3DYMA 4XZUG 2Y6KA 4WVVA 1DZTA 3LSSA 4BE3A 4IV3B 4EN9B 2CGOA 3KGLA 2VMFA 3W7SA 3EO6A 1QKQA 4CCCA 4RHV1 2J22A 3GJAA 2BV4A 3AMMA 1GN6A 3VBRA 5LGUA 3HQXA 1Z2GA 1G86A 1W99A 3APQA 5BY1A 4F3JA 3ES4A 1OOPB 3WP4A 3SNMA 4E4EA 2IZWA 2WS91 1ASJ3 5FZ1A 1W0KG 3N9MA 3NRUA 5JXHA 2R70A 4V2VA 4MYEA 4MVZA 4QAWA 4Z2AA 4NIHA 5H6QA 2RCVA 2PYJA 5C8YB 5H5NA 3H1IH 1LOFC 2ZQMA 5KXDA 5FLXN 4CP0A 2C5DA 4QX2A 4FPPA 2IUWA 2VMDA 2W47A 5FPAA 4Q0VA 2ZKOA 4HVRA 3WUCA 3CJXA 2VAUA 2DVAA 1XL4A 3MIHA 2IWGB 1TQ5A 4E2QA
chains in the Genus database with same CATH topology
1VBE3 4BYYA 4JGZB 4TWTA 5K7PA 2VQAA 2VOWA 1RUI3 4JRLA 3EQEA 4GALA 3FMGA 1UF2C 4Y1UA 4R9DA 3I8TA 5C33A 2R1BA 2JXAA 3OBTA 2VW0A 4X6QB 1A8MA 1YJLA 3H3UA 4QT6A 2WFF2 1K5MA 4HKOA 5IK7A 5CG8A 1ZZBA 2DCTA 1RGSA 3W59A 1UL9A 4YGDA 2ZTNA 2VUJA 4K6BA 2JECA 2JENA 4OLLA 1CX4A 5AFEA 2WIIB 5KXBA 2ENRA 3WDXA 1N47A 3ZMNA 3AM2A 4WZCA 1UX6A 2R0FA 4AHYA 4BG1A 4MVTA 2X5IC 1JHNA 1O5LA 5J96B 4MGIE 1OOPC 4SLIA 1PIV2 1Z7S1 4K3UA 5I0RA 1NZCA 4BZ4A 1DBNA 2B9UA 2E53A 3UKNA 4DMIA 5CBLA 1GSLA 4LBQD 3ZIXA 1QJX3 4LTAA 3AZWA 2FMDA 4B7KA 2ET7A 1OA3A 1VBC1 1V9U1 2AENA 1EAH1 3JD72 3ZN4A 4Q4Y2 4HSLA 1COV2 4EN7B 1N3QA 3PLQA 4IEZA 4YG3A 4HLTA 4AI1A 3IMNA 4OUSA 3M70A 5A32A 2XPJA 3N7JA 2GN7A 4FAHA 2VXRA 5GZEA 1PO13 1REEA 2D6MA 1UAIA 3DV8A 1CAUA 2A6VA 4I3GA 5BNOB 1RUD2 2D6LX 1GFF2 1XQNA 1XNDA 5DDJ1 5ABJB 1H1IA 3QH7A 2JICA 3RI9A 3JBG1 3VBRC 5GLUA 3VHPA 1DQ5A 1AR61 1N3PA 1VBE2 3DUIA 3OYWB 2NP0A 1AXKA 2ZZQA 4FOYA 4BQ1A 1NA1A 3HAGA 4JTNA 5F5QA 5CNAA 2R062 4KQ7A 3NV3A 5JOYA 3WQ7A 1SLCA 4OULA 4B4RA 4M2CA 1J3QA 3CF6E 4ISQA 2ES3A 4N53C 1LOEA 4QGNA 1OA4A 4CDQA 1NX8A 4Y5Z0 2HEYF 4Z2WA 3FFQA 2ZGLA 4IV3C 4Q4W2 4CYDA 2OVUA 2UYBA 1ZBE1 1CJPA 3ZYIB 2VMHA 4MUVA 4SBVA 1POV0 4L9BA 4MSVA 4FTSA 1O3SA 1KJRA 3KCYA 5ACA3 1ZBA2 1VP6A 4XXAA 4LEJA 4C91A 3R05A 4QU2A 1OIJA 1DYPA 1GZCA 2V5YA 3USSA 1BVVA 1HRI1 1HX6A 2ZACA 3FLRA 1SBEA 3PMEA 1VBE1 1AR62 1N3OA 4FPYA 3WD5A 4AQ6A 2NM1A 4GMP1 4M00A 5FMOL 4YZ5A 4Y1XA 4KBBA 5DDJ2 5JZGC 5D1IA 1DF0A 2RMU1 4NN0A 1O5UA 1PK6B 4W6WA 4RD7A 3VLBB 2ZGNA 2GNDA 1S0CA 1EPZA 3U4XA 3NVCA 4L2NA 1QY4A 5CFDC 2IC1A 4AVTA 4Y1YA 1AJKA 1HXS1 2BNNA 1CVNA 2XJTA 1W0PA 2ZGTA 1JBCA 3MFCA 4PJYA 3GZTB 1ENQA 1DG6A 1BXHA 1QF3A 1RUNA 1UIKA 2R041 2Z42A 1TE1B 4RA0A 3HWJA 2RS13 1DHKB 4PBPA 2RM21 5FOJB 5DUUA 4CRQA 1AR82 1ZRFA 3A4UA 1V9U2 3AZZA 4WBBA 2MHFA 1VBC2 2B39A 5EYXA 5BNOC 2DCZA 3FUQA 3NJZA 5LK5A 4W6XA 3U07A 2JG9B 3S7EA 4E4DX 1WMEA 4BMBA 4MXWB 2OG7A 4BGKA 2IXHA 2JG9A 4XJ9A 4QQOA 3E5XA 3QH6A 2BFUL 1OD5A 2WZR2 5K8SA 1BQPA 4FOWA 2ZS6B 1AZDA 1SCSA 2RJLA 3J8F1 5I91A 1BKZA 4P9GA 5FPZA 1WCKA 1R083 1PVC2 4N90A 4EV0A 1AYM3 1O4YA 2WT0A 3VBHB 3BOPA 5AC92 1S0BA 2K9ZA 2P3IA 1ZYBA 1CR7A 1UW8A 3RRDA 4ZXKA 1AX0A 4Z92B 3ZYGA 1QHDA 3URFA 1PGSA 3MLLA 3VBFB 1M06G 1ENRA 5HCFA 1AR91 3WCRA 1CONA 4QQPA 3D8CA 1VJ2A 4LLFA 1AR71 2WA4A 2RR12 1QJU3 1V6IA 1U12A 3KT7A 4A7KA 1L3JA 4CP1A 1CAVB 4FOQA