4AI8A

Factor inhibiting hif-1 alpha in complex with daminozide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
339
structure length
339
Chain Sequence
SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plant growth regulator daminozide is a selective inhibitor of human KDM2/7 histone demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 103
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4ai8A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ai8A01
3KCXA 1H2NA 3D8CA 1H2KA 3KCYA 2W0XA 1IZ3A 3P3PA 2XUMA 2CGOA 4Z2WA 4NR1A 4QU2A 4AI8A 1H2MA 5JWPA 4B7KA 1MZFA 2Y0IA 2CGNA 4Z1VA 1YCIA 4BIOA 1MZEA 2YDEA 2WA3A 4B7EA 1H2LA 3OD4A 3P3NA 2WA4A 4JAAA 2YC0A 2ILMA
chains in the Genus database with same CATH superfamily
1W05A 1W8OA 1O4YA 4N43C 5A3TA 1OVSA 5T5OA 5FYHA 2VCAA 3CBNA 1Q43A 1KBHA 2YIBD 3GZTB 4CCNA 3N7KA 3APQA 1Y3TA 2LROA 3KT1A 3KWVA 3V56A 1Z78A 3WCSA 5LBCA 3E89A 3HBKA 2O0OA 1FNYA 4DRXB 2FQPA 1BK0A 3M4FA 3TB0A 1JOPA 3R4SA 1VALA 4Q1PA 3N35A 3ZHTA 1VF6C 4DIQA 4RQPC 3HKBB 1OVPA 3NV1A 4QB2A 2VVEA 4WCEV 1XJAA 5A7WA 3ZMNA 2OIEA 1AILA 4BQ5A 4XABA 1W2NA 4IV3A 3HOBA 1UY3A 1E5SA 1S2EA 1KKDA 5GZGA 5C4WA 1YJNV 2FDGA 3W7SA 4JI0B 1TEIA 4A4AA 3BUCA 1B09A 4XZPA 3KM5A 1KU9A 2GUZA 1NT0A 4I02A 1ZA7A 3C7EA 4BQ1A 4Y1VA 3CEIA 4XACA 2WABA 5AC93 5C93A 4H3WA 5ERLA 3HKCA 1HN0A 4KBZA 3FC0A 3U10A 1VRH3 2QE7G 4DRVA 2ZBJA 3N27A 5AFBA 1PD3A 5FNVA 2J1EA 3X2QB 1REEA 1ZL8A 2R9IA 1KS5A 2V72A 4JX0A 3WDWA 1K7DA 3VGIA 2OCCC 1CP9A 1ZNPA 4H14A 5FYBA 2Y0PA 4XFBA 3LDEA 1L1FA 4CDXC 5F1RA 3VL8A 3CF6E 1TUBA 1C8M2 4Q20A 1CIYA 2HWD1 1JYXA 4XZUG 2R061 3E8HA 3HR9A 4XDOA 3GWKC 2P37A 5IHRA 4YW5A 2UXBB 1SRYA 4LH7A 5A6XA 3J7AU 1Z5VA 4DYLA 2XJUA 4E2GA 4JAVA 4OZOA 4XURA 2HEVF 3I2FA 4LBEC 1LESA 1A8DA 1NKGA 2EXIA 4UV8A 2Y6GA 1HIXA 4B3MB 2BGCA 4UAPA 1SDWA 5EPAA 3WNXA 3WG7C 4CCKA 1R6NA 4JI6O 1YXWA 1V6IA 2UWBA 4MVQA 3JXSA 3OW2U 1AR61 2DW4A 2LUWA 1CAVA 1U5YA 1P49A 3VBUC 5J7MA 4IV3B 4CUBA 3N36A 1O8PA 5BR8B 2VZVA 5J3UA 4OHXA 3MD0A 4LK7A 2PQSA 1WCQA 4XJ9A 1YHFA 5LBFA 1WB8A 3MHSC 1F23A 2IBZH 4TQDA 1O6UA 2AHYA 4ZI7B 4QPKA 3WD5A 4FLUA 1HRV1 1X8MA 4META 3U37A 4FSJA 3PURA 4AI8A 3FL7A 3CNAA 1PX4A 5BNPA 2P3KA 2WNUC 1FFTB 4JI4B 1RUF3 1W6QB 4RGKA 1SLCA 4J7ZA 5LMUO 1FYUA 5FZBA 5AC91 1BCXA 1X33A 4LBJA 1T5EA 3K4DA 1GKBA 4LK6A 4ZU5A 2C6SA 1WCDJ 3TEWA 1J1LA 4DS0A 2P4KA 1GP4A 3IFXA 4CDQA 3NR7A 2JXAA 3O12A 3JAKA 3L9JT 1REFA 3UETA 5IVFA 4IEVA 1POV3 4NWWA 4AILC 1IS3A 4B4RA 1LNSA 1PIV3 3GZAA 3JB8A 1M9NA 4X9QA 4D6QA 1NQDA 1DQ1A 1EV11 3ASNC 3AMMA 5L3EA 4ZXEA 2MEV3 3D4KA 4M3CA 2YYOA 4NHYA 2Z2SB 3ABLB 1H1MA 1DZTA 3DPRC 5FMDA 4LOTA 2GV9A 4XJZA 4Y22A 3DL3A 3OGJA 1Z2GA 1XNTA 5L7OC 1PNFA 4QDSA 4P2ZA 4XFFA 3I49A 4X1IB 4AGRA 3R4DB 4CP9B 1OQ1A 4W4KA 2BGOA 2VW0A 2EZOA 2YXYA 2D6MA 2OVUA 1RUH2 3ZYRA 5FZHA 4GX2A 2FCTA 1PO13 1KEXA 4MXVA 2XVGA 4P08A 3ML0A 2AREA 2JG9B 4EZ4A 4J80A 3HIFA 4P9YA 5JXGA 1RMU1 1XNCA 3CCLV 1I5ZA 3ACLA 3U4SA 2A6WA 4CUGA 1WW6A 1YFXA 2D3OW 4NAOA 3A22A 3KS7A 1DF0A 5FP7A 5KMGB 1O9GA 4GX1A 4JZGA 4I09A 4UW6A 5CFDA 1JU4A 3WB0A 1I94B 3GBGA 4KGGA 2QCSB 1MG1A 5FYCA 4CZZA 1NZ6A 3ZMUA 4BJ0A 2YIAA 4IE4A 1X50A 3J7MA 2D43A 1SA0A 2RV9A 4K0KB 1YI2V 3JD1A 1RPRA 3HQUA 3CXHF 5LBQA 5KXBA 1JCHA 3ZMSA 4GLXA 2WT1A 4L9BA 1FPN2 4GJZA 1OH4A 1JN2P 2JS3A 2HLDG 1XNRO 2VBDA 2WLQA 5LATA 5KLVH 4XBNA 3I5DA 4HPKA 3ZFEB 5DAPA 3ETEA 3WR0A 4LF8O 5D8AA 2R72A 1LHUA 5JJJB 2WQZC 1DYKA 1K92A 3WP5A 1AR72 1ZZ9A 4HKLA 1W3XA 4YFZA 4H13B 3ZEDA 2B5UA 4FFFA 5C8CB 4UCTA 4BCUA 3U1XA 3M7MX 1PVC1 3SPHA 5JCOC 4DV2B 1GWMA 1V6LA 1TQ5A 4UVCA 1PM9A 1S0JA 2QQIA 4AW7A 2WINB 2W6JG 2KD7A 1JODA 3VZNA 1IBKB 2FZ1A 2D6KA 3KV6A 2V4VA 3AP5A 3K5LA 3EBRA 2BYVE 1ALYA 5FZ7A 1ZRCA 1SBFA 2A6YA 4OULA 1LULA 4MHRA 2ZHKA 5A80A 3K3OA 1PKXA 1UXXX 1F5FA 5FPXA 1BHGA 2CWMA 2WZEA 3ZOIA 2A3QA 5LP6A 4UFZA 3RWRD 5KHHA 4LFAO 4YYOA 3WINE 1NBMG 1OA2A 5HBAA 4MGKE 1QEXA 3SH4A 3T1LA 4AEDB 2VOVA 4O9GA 5F2WA 1LOAA 3FN9A 4ISRA 4E4ZA 1NT2B 1E1RG 4EROA 3L9DA 1I08A 3VQYA 4DOUA 5B1OA 4DUYO 4W8JA 1AJNA 5M0TA 3E1F1 5J2UA 2Q6AA 3SHRA 4YW2A 2O1QA 1YNAA 1G9DA 4D69A 1RINA 5C8WA 1SC5B 4LKFA 3T0DA 1T2XA 2JG8C 4W6WA 4WZCA 4WVZA 4FPYA 2ZMKA 1BZKA 3I59A 1B35A 3WDXA 1HB4A 1R64A 4LBOA 4TSVA 4TYSA 2PA7A 3DXUA 5JOWA 1MOFA 1TNRA 1ZBE2 4CSWA 1MR5A 4IV1C 4G3YC 2A6VA 3POEA 1NE4A 1HR0O 2VMEA 1B6QA 3BKZA 2WAOA 2LQTA 4QNHB 3OJBA 4JGZC 1TMF1 2GP5A 1R093 1PIV1 4CU7A 2UUAB 2A06H 4QPWA 1VQ8V 1HJFA 2I2SA 1XILA 4AVCA 2VQFB 1Y7BA 1WB7A 3ZIWA 4NROA 4MADA 2WNVA 2QE3A 4Q4W1 2CDYA 2W1QA 5B1BB 3MLKA 3T1HB 3MAQA 1K42A 2FDJA 3ZHSA 2UY9A 2W94A 3K46A 1SLBA 1OMIA 1WMXA 4Q27A 1FPOA 2E3CA 3JBG1 3T3YA 2XOKG 1CZTA 3SMHA 3IM0A 1FXKA 3BCWA 1UMHA 2OTJV 2PLV1 3O0XA 2UUCO 2XJRA 1LUVA 1RUI1 5L3GA 4Q0PA 3UESA 1YWKA 3AZXA 2C1FA 4W6XA 1IXBA 1W8HA 1JOJA 1UZZA 5IYZA 5JI7A 2CK3G 4BDVB 2VBBA 4OHZA 5A6YA 4YJ2A 5KR7A 4PHZA 1R6TA 2VD7A 2V09A 1O9HA 2WIIB 5J2UB 2ZGRA 5IFPA 5FZ1A 2Z5UA 2YIDA 1BEV3 5E8AA 1WJZA 4J42A 2PYLA 3ZXGA 1ZRRA 4QGPA 2PY5A 1VF7A 1PMIA 3O65A 3SXWA 4NHLA 3THCA 1RVF3 1FAFA 1LOFC 2WA4A 1QY4A 4HVRA 4LBMA 4D94A 1DYPA 2MHFA 3OEAA 4G27B 1QDCA 4Y5TA 4CDWC 4QE9A 4QKBA 2E6VA 5CIRA 4UBHA 1HRV2 1EN6A 3VBSC 4FPEA 5TISZ 1NU1H 4LO6B 2BJSA 4DXTA 3H01A 4EB6B 2QR4A 4Y1UA 4DEVA 4Y4YA 4IERA 3WLUA 5IK8A 5FYMA 1UOJA 4GWJA 2JDUA 4YHHB 1YITV 1GQPA 4QE7A 3EO6A 1L0LH 4S2FA 2GALA 2Q73A 4ZU4A 3ACIA 3TXQA 1KS4A 4HZ3A 5LY1A 1S5HC 2Y48A 1GN3A 2AYHA 1XHZA 4OPHA 3S7IA 4V2VA 2DOSA 5H9RA 5LK7B 1ZZCA 3ABMB 1AJKA 1J3QA 2Y4TA 4MS2A 1PGW2 3T1MA 2F4VO 3O0VA 3WF1A 2UURA 3CRRA 3CP1A 1CEZA 2XDVA 1VBB2 1RSOB 1SF9A 4PI2A 3HWJA 4Z8BA 2Q7GA 1VQKV 2YGLA 3QO5A 5LP6B 1M1KW 2WNOA 2D7FA 2IFRA 4FIPC 4QB1A 1Y9GA 5IAVA 3CC4V 2BSKA 2DVAA 5A6QA 3KV4A 4MGSA 4FFIA 2DU1A 1WPXA 1FS0G 1IVSA 4R52A 3K5OA 5KHGA 5E89A 3CDZB 3ETGA 4NB5A 1H9PA 1ZA4A 2ZE8A 1CAXA 4XPVA 2A7AA 5BNPC 3PUAA 2VW1A 3HT2A 1FXVA 2WO3A 1OV9A 1VIBA 2FDFA 4CDWA 3CSXA 3LPFA 1R1A3 1CAWB 4XILA 5FPUA 1O3QA 2VVFA 2OCHA 3LD8A 4DFSA 4B7KA 2VNOA 4EN0A 4AHCA 2EIDA 3R65A 2GC1A 4KQ7A 4ZKIA 1N36B 1W6PB 1V6JA 4NUBA 2JIJA 4IV3C 2VAUA 2BTOA 5ITZB 4LR4A 4JZRA 2E53A 3IAQA 2W68A 2RS52 2XONA 5LHGA 1QH6A 1BE3H 4WBBA 1BL8A 1JXNA 5FQ0A 4CA9A 2VQUA 3GYDA 5JLVA 1IGOA 4K1ZA 2JEMA 3ASOB 5LMUB 2WLHA 2PHRA 3M7AA 4QPGC 2JRIA 1OCCC 5FZ3A 2YPJA 4JHTA 1AR71 3SNMA 4H37A 4O65A 2CTWA 4AGGA 1CZVA 5FZIA 1F51A 1PZ7A 1ZBA2 2AGSA 4Y1ZA 5C9AA 1US6A 3I3EA 2F17A 3K06A 3K48A 1HNZB 4EN8B 4FVMA 2J1VA 5A1AA 3B7MA 4FPLA 4BU2A 3VKMA 3WU2Z 1VQPV 1EM1A 1DTOA 1S5LZ 2EZPA 5FUIA 5CA0A 5AFEA 4DV1O 5FYZA 3A0NA 1NA1A 3LA2A 1GLHA 3WDUA 1YQ8A 3V0AB 2L9LA 5L3FA 3B93A 2WSVA 1THZA 3VBRC 3QO7A 1NZCA 2DMXA 4Y20B 1NTZH 4FFBB 2FHRA 1QJY3 3H8XA 4DK0A 1V70A 3RZJA 2E33A 2ZZJA 3TOJA 4AQYO 2Q1ZB 3PUIA 3BU7A 3CZUA 4UFHA 1O4TA 1M93A 4ZPIA 3HEIA 4YY3O 4AYUA 5K1XA 2VXJA 2G9GA 4MLOA 1CONA 4QPGA 3WF3A 1Z7S1 2RHPA 4K0KO 3M1HA 1JZ3A 1P7GA 2BEOA 1PO23 5JAXA 1JZ8A 3Q8FA 4I55A 2VTFA 4IYIA 5K1PA 1KQSU 2CGNA 3M3IA 4YVWA 3FE5A 4ASUG 4IE6A 4Y26A 5LWBA 4COYA 3PJQA 3PVNA 2A7WA 3K5MA 2JE7A 4LF9O 2QM8A 1UOGA 5A3LA 2VQAA 2VL4A 5ANQA 4GJYA 2P06A 3FHIB 2XJSA 1HQNA 2QWNB 1ZM1A 2Q1FA 1CPYA 4UCRA 4AAXA 3I56V 1LOEA 2Q7HA 2L35A 5B1AB 2JDHA 4QGMA 1NA1C 1GR3A 1IPJA 4LFBO 2XB6C 3SKJE 3ORJA 4O4JB 3AEIA 3AVRA 4XUOA 4B3TO 3LUTB 1PL0A 5CB4B 3E5XA 3UQ8A 2D6LX 2XUEA 5IWAB 1G86A 3OGVA 4QX1A 1IURA 4XTPA 2BNMA 4I50B 4O2AB 5T52A 4NIAA 1DIWA 4YZ4A 4NYKA 1TVKB 3ZX6A 1U96A 5CKMA 1OLRA 3ZIAG 2OWOA 4L8QA 4MSWC 1TVKA 1RMU3 5B4NA 1NCQC 2RJKA 4Y5SA 1N1VA 5C7GA 4NTXA 2FD8A 4M4PA 2I45A 1MEC3 2WFPA 4IW3A 2VMHA 2J1SA 4RS5B 5I91A 1EAH1 5KBFA 3B8MA 4J25A 3FD9A 3UKVA 4DNYA 2OTLV 3JSNA 3HJRA 2PHLA 3OMIB 4FPKA 4CXXA 5LBEA 2V5DA 4UCUA 1XEQA 5LK5A 4FK5C 1NUKA 4CH5A 3TEZA 4IV1A 3A21A 4EWAA 3MIFA 3LDKA 3BPSA 4QX0A 4X20B 1N1SA 1OOPC 3PUSA 2OPWA 3PIJA 1QH7A 5F32A 2VO5A 4GH4A 4R50A 2RJZA 2D5FA 5BV6A 3CCQV 4QU2A 2R073 5FP9A 1Q6HA 3GXUA 4KBBA 4XQWA 5H9QA 3PUQA 1N3PA 3ABLC 2CGPA 3WNMA 3VKFC 3RMXA 1UU4A 3B77A 4FFHA 5K0UB 1W0KG 5KHJA 1VBE1 5DUXA 2WR9A 4AWDA 1IPSA 2YU1A 1COV1 4P9XA 1FXKB 4J1XA 3Q4HB 3N3HA 5FUPA 4E27A 1R083 4HG6B 4OPAA 4CCLA 3ST7A 3HPNA 1N32O 4PA3A 1COWG 3RDIA 4M01A 2AZ5A 2UUCB 2EXHA 1XU1A 5JMCA 3OUJA 4HOOA 1IG0A 3LPGA 3CJHB 1MZEA 5FAXA 4B7EA 2YBPA 1CGPA 3APBA 2P4VA 2VNVA 1HV0A 1YQCA 2Q67A 1RC6A 4COUA 1G1XB 1YYNA 2EINC 3ILRA 1VARA 1UMIA 2WT2A 4C0BA 5H2FZ 2VUDA 1XYNA 4AVVA 1XXNA 3DYPA 4QPGB 4JI2O 5HXVA 3A0BZ 4LLFA 1AUYA 1X4TA 3V0BA 3ZR6A 2YBKA 4EJRA 4DV2O 1RUJ3 3HQXA 2HHHB 1IKQA 1NLSA 4KG0A 2QKSA 4CCJA 4X65B 1UN1A 3FFQA 1CQ9A 3V0BB 3WQBA 2Q8VA 3CYOA 2JE9A 2RNBA 1GNYA 3M99B 1ODNA 1TG7A 1K5MA 3C3SA 3O1VA 4A44A 4DZGA 4MZUA 1RHI1 5IJ0A 2N04A 3OY8B 4QQHA 1SLLA 3B02A 2K0GA 5FYUA 3EVKA 1H6XA 5FFOC 4IIJB 3SLIA 2EILB 4HT1T 3U75A 2BU9A 2KM2A 1UYZA 4L97A 1W8FA 2XKPA 3M70A 3TNQA 2NP0A 1VRBA 4GMP1 3JB4C 1N1YA 4W6YA 3RSJA 3K0DA 5H6QA 3THDA 4FZ1A 2JICA 3L72H 5IVJA 3HB3B 4YJ3A 2HG5C 1K73W 1SQBH 3CCSV 3AMHA 2VZSA 1W8NA 5F39A 1VQNV 2VZPA 5KAIZ 2PF4E 3N9MA 4W50A 4ZU7A 3MHHC 3T1YO 5F6KA 4GCZA 4A7YA 5CA1A 3B69A 1ULEA 2ZXWB 1PZ8A 5APAA 4JYYA 3A8TA 4KG8A 5FO7B 3VKLA 2WLLA 1RUI3 1W9FA 1LEMA 3ACHA 1M56B 1LB2A 3I7DA 4Q4W2 2LW8A 2RS13 5AG2A 2HWC2 2PYJA 3UGHA 4JYBA 2ZCWA 2ZGSA 1D5AA 4UCSA 4PA6A 3I3QA 1OA3A 1XNAA 1D5NA 2CAZC 1AROP 3GDBA 4GZ9A 2DYRC 2GUZB 3BALA 1H8TB 1K12A 1ZRIA 1H2GA 5E1AC 1CPMA 3RYIB 4Z2WA 5G05L 3JQXA 1F4HA 3HKCB 2QA4V 4BK5A 2GHYA 4OFGA 1AJPA 3CPWU 1XL6A 4IEQA 4I5SA 2XQRA 1ZZ8A 1GM7A 4WM7B 3BYWA 1YI7A 2JIGA 5K7PA 3GNEA 5BR8O 1VE0A 4P02B 4ZHNA 5FDBA 3IBMA 4CDQC 3E35A 3OYWA 1JHNA 2XJTA 1Y9MA 3CS5A 3PJYA 3GJAA 2X5IC 3PU8A 1WZXA 3GZUC 4BQ2A 5J36A 1JUIA 4HVOA 1RUD2 5K4LA 3RNSA 1AYN3 3SCHA 1G9AA 3K2OA 4HVQA 3AG2B 1PL4A 4M3CB 4Q29A 2EICA 2BERA 1XI1A 4PI0A 2KKWA 3HAGA 2YFZA 1VEWA 4K8ZA 1MQTB 1Q86W 3PDQA 3C7GA 4KWKA 5JZGC 2YEVA 3B09A 1UX7A 4GALA 3BVOA 1PK6A 2ZGKA 3MIGA 1U5XA 3CJHA 3GF6A 2AXTZ 4K8RB 2AACA 5JVDB 1YXBA 2XJVA 1WP8A 2PYTA 3W20A 5HI0A 2WC2A 1C8M1 3GCXA 3QVNA 4NHKA 3UKMA 4F6EA 3CCEV 2GN7A 1IS4A 4LF6B 5FZ6A 5IJRA 1G8MA 5IY5C 3AJZA 1HXS1 1FFXB 1GWKA 1AXYA 3NV2A 5BXXA 1RUOA 4D3WA 3KCXA 4LCUC 1CX4A 4RAIA 3MW2A 2B9UA 2WS92 3HQRA 1VB4A 2WSUA 5DM6V 1AF9A 1FV2A 2WWUA 1LHVA 2VG9A 3IMMA 2WUHA 1W28A 2WYFA 4QB6A 4QMAA 3H8RA 4LBQA 1HW7A 3QNEA 1OBNA 3R05A 3CJIB 3T4DA 4XC9A 4DR5B 3R4UA 1U97A 5CBLA 5B2GB 3CMEV 3MYXA 4KU7A 4F6RB 1OKOA 4DO2A 4DUZO 4C0HA 2IH3C 5CBFA 3NRUA 1KP2A 1LCLA 4RHV3 4YFWA 4NN0A 2WLKA 4FCAA 5F3EA 1WMEA 1YUDA 4JKLA 1VBE2 1N1TA 4YXWG 4ITCA 2PI5A 2HJFC 1RHI3 1RXGA 4GMP0 2WWSA 4UFKA 3VL9A 4YG3A 1FXZA 5DABA 3W7UA 1PK6B 4CTEA 4UOJA 1YJ9V 3ZXAC 3VBHB 1MQTA 5EJZB 1VBC3 2QQUA 2GN3A 1KC8W 3ABTA 2V1DA 4G9SB 1RM1B 2E7AA 4AHYA 4I4TB 1PIV2 2ZIOA 3KQRA 5FXWA 2P34A 1YTFB 2VTXJ 3KVBA 3IC7A 5DQ0A 1AVMA 3O1TA 5B1BC 4ES8A 1N33B 2IU0A 1QVGU 2W1UA 2Y6KA 4JDOA 1OA4A 4XQ4A 4UCOA 3C7FA 5B66Z 2BOCC 4XFIA 1SACA 1OKQA 1BT8A 2WZ8A 2W95A 3K51A 2PXJA 4YG0A 3NNGA 4GB33 1O8SA 2GH2A 2Y34A 1QJX1 4ZIBA 2VMDA 5CEHA 3B8NA 1H4HA 1WGPA 2P22C 5I93A 2ADEA 1XNQO 5FMBA 1S77D 4Y20A 2ARHA 2LM3A 4QXHA 1SQQH 1NXMA 3AP4A 5A3NA 4L92A 2WFF2 1LECA 1DLBA 2WNVB 1MS8A 4PDVA 3T0BA 5I8TA 1SZXA 3BTAA 4XFAA 2V7QG 3S5AA 1PHMA 3KCYA 1GTOA 3H1IH 2GNMA 1S2KA 2ADDA 3WVJA 5JOXA 2WWWA 2ITCC 4KHPB 1JTZX 2QWQB 2E31A 4GX0A 2UUBB 5IY5B 3SYOA 2QJ1A 5FV3A 2BOIA 4GKJB 2Y69C 5LYJB 3ABZA 4XJAA 5D8AC 1RITA 1NJIW 3ZXKA 1F15A 5FP3A 4DQAA 1CAVB 4ZKTB 4URAA 1HQLA 5FPAA 3R6SA 1D2QA 4BISA 4IEYA 2VQ0A 4IHJA 3AL5A 3NV3A 3IAPA 1AYN1 3T2MA 3IDEA 1N36O 1QQCA 1N34O 5FLHA 2J7MA 4U7NA 2XG3A 4G2KA 1AYM3 5CFCC 1SQVH 3B40A 3JD4A 5F2VO 1R3IC 2LFSA 4DUZB 2FTKA 4PIYA 4XDJA 2DTYA 3QOPA 4JDNA 3MIBA 4JTAB 1EY2A 1R092 1UF2C 3LDCA 5DAWA 1DGRN 1S0EA 3ZXLA 4D6SA 3LA7A 5KC6A 1EPZA 1HRI1 1C8M3 1Y74B 1K5QA 3ZXDA 1CIWA 2RS12 3AM2A 4FP2A 1S0IA 1D2DA 1UYPA 1F2NA 4GKJO 3M3OA 4UB8Z 1W3VA 2LO1A 1U0AA 4BAYA 1X8EA 5KWRA 5FMOS 4CXWA 1CXZB 2Y26A 1Y43B 2ZGTA 1MZFA 4A3XA 3AG3B 4MW8A 3E22B 4CC6A 4FM2A 4S2DA 3OUFA 2A6XA 4OUSA 5DUVA 1NZIA 5I0UA 2UU8A 3HN3A 4DR1O 2VCCA 2EA7A 3NKGA 2WJSA 3AK2A 4GWIA 5IATA 3NAPB 4CDUB 2E7QA 1L3JA 4DR5O 1RUC1 1EYBA 1UZ0A 1RUJ2 3VQVA 1PVC2 2OZ6A 3OAAG 2B4KA 4DR7O 4KP4A 5C3SA 1JFFB 4LHKA 4LHNA 1V9PA 3H9VA 1OD5A 5D5PA 3N9PA 2YICA 3FBMA 2D3RA 1QXRA 5AVPA 5EC2C 3WX5A 3K9AA 1XB9A 3ZIXA 3H7JA 4PV1B 4IUGA 4ZS2A 3E83A 3JAWA 4OXSA 3Q4HA 2A71A 1C3HA 4LF4B 3D36C 1H1AA 2ZEXA 1G6NA 3MFAA 4I30A 1EUUA 4BWOA 3OBZA 2YC2A 4J1WA 5EIYB 1NI8A 4I0AA 4JTDB 1PK6C 4QGLA 4YZ5A 3WQ1A 4QHBA 2ZABA 1WD3A 2X6CA 1KUQA 1PM7A 4I50A 1ZBA1 2ADQB 2DCKA 4Q4V1 2JDZA 4PDMA 1AYN2 4LXLA 2VCBA 3JSLA 5FK8A 1ULCA 1YCIA 4J9YB 1OSGA 4OI4A 5HFLA 2RS31 5GZCA 3I2KA 2WLPA 2B1IA 2DVDA 3AG3C 2BW8A 5JH7A 3EB7A 3ZXJA 1GZWB 2ADPA 4LEJA 3LNNA 4JGSA 4EN9B 2KXLA 5JPMB 2R70A 1PVXA 3VQWA 3HNMA 1UU5A 3MIHA 1HNXB 2LS6A 3VHPA 1LRHA 4BIOA 1FMD2 3J80N 4PT6A 3WNLA 3QO8A 5C6CA 2QQLA 4KWJA 4UT5A 5L9BA 4P9IA 4GA9A 1NE6A 3ZN6B 4YPJA 1PGL2 3ABKB 4NKGB 3OG2A 5D8AB 1DQ0A 1C28A 4WFGA 3IDAA 1IBMB 2VRZA 2DE0X 1XMOB 4FTBA 4A2UA 1PV0A 1RVF2 2HWB1 3H3ZA 2GDFA 4FLZA 5A1FA 4JTNA 3G67A 1AR1B 1U5ZA 2ZXQA 2OQ6A 2IVIB 2K9PA 2XAJA 3AG4C 4N23A 1FKAO 3D0JA 4O4HA 2BE3A 4DR3O 4LO7A 4N21A 4HAMA 2DWDC 1OCOB 5BMVB 2W0FC 2PHTA 3D8CA 4FP3A 1Q82W 2EALA 2ZACA 2HVJC 2R062 3CL1A 4FXKB 1G9FA 5LA0A 2Y0IA 3APOA 2XAHA 4KWUA 3INAA 1W8TA 1UYYA 3B5LB 4DXZA 4FAHA 3LA3A 2WPDG 3J7LA 1W0JG 2R6QA 4AAPA 3MI8A 4JGZA 1LR1A 2RMU3 3ALQA 2P7TC 5JQGB 2ZIMA 3FBYA 1FXHA 4UF0A 5LY2A 3T1CA 4I3PA 1GU3A 2QBXA 4BA6A 2JGDB 1YHQV 3ES1A 1BYHA 3AYAA 4NPLA 5DG2A 4O9EA 3JQWA 1F35A 3HT1A 4NHXA 4CP1A 5HCBA 3VKOA 2AEZA 2PZSA 4YM2A 5CA0B 2ZEYA 1ND3B 2QQKA 4XDKA 2DURA 2WQ4A 1NA1B 3Q8EA 3ASIA 2JG9C 4LJHA 3ZO0B 2NMNA 5B5EZ 1BMV1 4DR4O 4JGYC 5H9SA 4D6TH 4LH6A 2Q4PA 3NJZA 2OPKA 4Q4Y3 4L87A 4CS2A 1KYOF 1QOOA 3G7DA 4NXMO 2EIGA 4DV0O 1N3OA 1S55A 2GC0A 1FT9A 5BYNA 4LF6O 3W9AA 3SC7X 2HBTA 1E1QG 2XAFA 1K33A 2EIKB 4OI2A 1Q90D 3O14A 1QQP2 1U5IA 1QXJA 3JASA 1IS6A 5FMOL 1K4DC 5F7UA 1WKYA 1SFNA 2YZ4A 5FPRA 3ME2A 1YSCA 3C3TA 4GYCB 4Q2FA 2Y60A 1XUQA 3VD7A 1VBD3 1XE8A 1OF4A 4IGQA 5FXZA 4MGQA 2ZTNA 1SPPA 4FLVA 1DGRA 1UD1A 4X6QB 2VM9A 1QNMA 2A5ZA 4DV6B 2A1XA 3CE2A 4NOTA 1HX6A 3CRAA 3GGLA 3USUB 1TAEA 1WA4A 4PA4A 3F95A 3OGRA 2EIJB 4CRQA 5FLIA 1IQAA 4GZRB 2PAMA 4HANA 4KGQA 1BGYH 3V65A 4E9KA 4JI7O 2VMGA 3PMSA 1QJY1 4CU9A 1QOSA 3N7MA 1YJKA 1MVEA 1UFIA 3LSEA 3U4XA 4BW9A 2HKXA 4DV1B 3FLTA 3RYKA 3K0GA 3OPWA 4QXCA 5J1XA 4JPRA 1HQWA 1SETA 2R9RB 1YIPA 1AP5A 2XOMA 5KA6A 1QJFA 2YBSA 4NXNO 4FOYA 4F3JA 4UYBA 3VHNA 4B4QA 4NIGA 1MSDA 4TV9B 4AR2A 1WMDA 4YIPA 2OA2A 5JOZA 4GIQA 4DXWA 1W6MB 1W6PA 1VRH1 4YVWC 1KECA 5FPZA 4N7IA 1YFYA 3GALA 4Q8LA 4ZZ5A 2BPA2 3DC6A 4EZHA 1K5JA 2RN9A 3BGAA 2AC1A 1LENA 5CFCA 3VLBB 1AVBA 1K3EA 4JI8O 4UFIA 3P6BA 2QQVA 3E8FA 2A3YA 4Q4W3 2Q69A 1F7YA 1FX5A 3TN92 2E74B 5IDJA 5HCAA 2XHNA 5FTTC 2YGMA 3WY6A 3ZFGB 3ATGA 1QJU3 3CU7A 1GSLA 4AEKA 2H94A 1Q56A 2D2CB 2RJ2A 3WSOA 4MXWA 3OTFA 1ULFA 2VWJA 3BPZA 1MABG 2UUBO 4MVMA 3LEIA 4CDWB 3TEYA 2DBNA 1CAWA 4MGTA 1GN4A 1V55C 1FOD3 4E4DX 1ZBE3 3K75B 1Y76B 1GV9A 4XYXA 1FMD1 1KB9F 4FTSA 4UW3A 2W08A 1PZ9A 4F4LA 1QMJA 5LMNB 4JHZA 3B9CA 1RXFA 3AX4A 3S0MA 5HCFA 4NIDA 1OUSA 4A45A 1Y74A 5EZYA 4GXLA 1GOGA 3IGAC 4QGNA 4Q4V2 4XUTA 1G7YA 4LFCB 3ZS8C 1C1LA 4C7UA 5BNNB 5KXDA 1D0HA 5DAXA 2Y8KA 1EN4A 2ARAA 5FNVB 3B01A 5BUVA 1BS3A 3VDAA 4WF9V 1O4ZA 1WLEA 1NVPD 3QH7A 2QKCA 1Z7S2 3POJA 5IVBA 1CZSA 4TT3G 3D3AA 2JIZG 2HYXA 1GM9A 1GFF2 1JA8A 4I9QA 3W7XA 2ZXWC 1AI6A 5KHIA 4ABMA 2W5FA 5FZMA 3AFGA 5GONB 1IBLO 3ASOC 2JDPA 1OOPA 3M2MA 5LW9A 5B3SB 5A3UA 1ZTEA 2ZA9A 2ITDC 2R071 4Y1YA 2AH2A 1K3IA 5CZKA 3UT5B 3T4VA 2C9AA 5D1IA 1RYYA 2QTSA 2P5BA 2QQWA 1VQOV 5JIUA 1EBOA 1H8VA 1AJOA 2V73A 1B35B 1XREA 4RQFA 3MIEA 1YZBA 4BIUA 4MVZA 2HH9A 4E2LA 3VBOC 1SKVA 4R9DA 2Y69B 1WA6X 4X8PA 4RGAA 4CCEA 4YG6A 1YVWA 1UX6A 4UW4A 4AFDA 3ZSJA 1PNMA 4O4JA 1V00A 5KMGA 4J10A 3UK9A 3VBOA 3JD72 2JENA 4XDLA 4LF5O 3NW4A 4TUYA 4B3SB 2VQTA 1H9WA 1BVP1 4CCOA 2ZKNA 1GO3F 5FO9B 3D3QA 4TN7A 3A2FA 3P30A 2VQFO 5IUQA 1EN5A 2K46A 4QQLA 1IXMA 2B8MA 3VBFA 1H30A 1UY0A 5IJ9A 1ORQC 4BQ4A 4Y1XA 1US2A 5FXXA 1NH2B 1RUH1 1VBC2 4COZA 3ES4A 3D5OA 3E22A 2NN8A 1C4RA 4CH3A 2VMCA 1G9CA 2W52A 5I0RA 1OF3A 1GOFA 2R043 2EIBA 3I8TA 2ZKOA 5L73A 1AJQA 1OURA 3ZRSA 2VC9A 5EWSA 4AHZA 3IAYA 5FYVA 5T54A 4NE9A 1R6KA 1RUE2 4JQRA 3FMGA 2OUJA 2ZX1A 1QCEA 4JI5B 2D40A 4FO9A 5JR2A 3J81N 5C8CA 3OY8A 4I0XB 3RBZA 3KMHA 3MLJA 2R7EB 4ORFA 2BRTA 1C5HA 4GB32 2JE8A 3HPLC 3BU0A 2H8PC 4BOWA 1AL21 2C26A 4FPOB 2B45X 4GH4B 4OZXA 1A34A 1VBA2 1AR92 4K35A 2CTPA 3ZPYA 1V6KA 1I6XA 4I2OA 4O4IA 4WFEA 4QX7A 1RMU2 4BM8A 1K8AW 4DY5A 1PVC3 4OX9B 2QM4A 4UFJA 5JI9A 4TQFA 3CC2V 1URFA 4TV8A 3MUZ1 1V6MA 1KQRA 3RVHA 3AKPA 1BQZA 3WW2A 1QJU2 5A6ZA 2DCTA 1NKDA 4YRDA 2ZZQA 4IGGA 1K5MC 3T4ZA 1RPOA 4ATFA 1N33O 1OLQA 2WWJA 3SH5A 3VDCA 1MACA 4LO4B 2VE1A 3BI3A 1I7FA 1XMQO 2YDEA 4RS5A 3RN4A 5JR7B 5H6RA 3ZN5A 4R8HA 5SV8A 4C8DA 1D4M3 2RJLA 4MO3M 1DBNA 4ZS3A 2BBAA 1XYPA 1OI6A 4JV5B 5IWFA 1I5YA 2VNGA 5FRAA 5GTIZ 4CDXB 3B3QE 4X1YA 3P5BA 3ACFA 5FWEA 1MS5A 3CCJV 2JGUA 1NYWA 5EK0A 1ND3C 4P9JA 1RFYA 4IXLA 2WAMA 1FATA 3EMRA 3WDVA 4GAZA 4XHXA 4LF4O 2YXHA 3WB1A 5JVVA 5JOYA 2EAAA 4Q26A 4MH0E 5FY4A 4IDZA 2HKOA 1KP3A 3LOIA 1UPGA 3CMGA 3GHNA 3H1WA 5A7QA 5JDBA 1FYJA 1TE1B 1UY1A 5A1LA 2KA3A 2W39A 4WV8A 1W39A 2P3JA 4PLNA 3ZHVA 3RZKA 3IT8A 1W2OA 3NNMA 5JCTA 1J95A 3LWCA 1A6CA 4QXBA 1W59A 2QWPB 3JAWB 4FQZA 2EIKC 2QZ3A 2F6BA 3K57A 5LP6C 4DK1A 1ZX3A 4PIXA 2H6BA 3LQCA 1TMF3 2KR2A 1S76D 1NLRA 1TME2 5L9VA 1Q6IA 4LWSB 4YW1A 1JZ5A 4QJFB 3ZSEA 3U78A 2VZUA 1SERA 4J11A 1N34B 1DF4A 1HB1A 3CEWA 3AZWA 5F5CA 2VZOA 3TN91 3POFA 4OHWA 3LSDA 1Y67A 3TK1A 2WNUB 1H4GA 3DV8A 3S3XA 5HCHA 2GNTA 2AUYA 5IYCO 1RUG3 1BBT1 2P6CA 2UXBO 4N8MA 5G04L 2IM9A 3L70H 2ERFA 1RUD1 5A7PA 3LIGA 2Z42A 4Q4X1 4BW5A 1JYVA 3EXAA 3M3CA 3MLLA 3NV4A 1TNFA 1R091 3OPZA 1SFYA 4UVAA 3Q8BA 4QPYA 1TVGA 3WQ7A 1AR63 1DQ5A 1MA1A 4KH9A 3M8LA 1RUH3 5CG9A 1ASJ2 2IJJA 4IE0A 3S57A 3O1SA 3KV9A 4UCVA 2HP8A 5I0TA 1WLDA 3S30A 4ZHQB 4CCCA 2YUAA 3MDSA 1H1IA 3CJIA 3POBA 3U14A 5I8SA 3W59A 4FT8A 3LF7A 4RR3C 4MV2A 4NXNB 3GVMA 1BBT2 3KV5A 4E8CA 2JD9A 1MS3A 2YY1A 4P5YA 2Q68A 2VOKA 5CA3A 4NJ4A 4P14A 2BDRA 3DKQA 4CXYA 4PDLA 1SCRA 5GW7A 1L8DA 1JW6A 4XW3A 1AR82 1IX9A 1VQ9V 1DYOA 3WT3A 4RA0A 1AX2A 4X8NA 3POWA 2VMFA 2WLMA 3RVZA 1YO8A 1XOUA 2DYCA 2FMYA 4P5HA 2FCUA 1DQ6A 4LHSA 2G4IA 1JZ2A 2HEWF 1OHFA 4Y4RA 5ACA2 2G1MA 2IJIA 2P4EA 4FPHA 3VD3A 1EZVH 1ZREA 3OR6C 3CCRV 2UXCB 5JXHA 3RYFB 2GP3A 1S5JA 5F3IA 1UZVA 1EV13 3D36A 1YIJV 2YIBA 3TN93 3AK3A 1YQ6A 2MEV1 4CVUA 1FD9A 2ZT9B 1QJX3 4ISQA 1CWPA 1Q8OA 5BXZA 2NQYA 1HXS2 2JK5C 4N53C 2F66C 4BQWA 5FPVA 1RUG1 4FI9A 5FY9A 4XUNA 3ZM8A 3RYRA 4EE2A 4KMQA 1AXZA 4LBQD 4YLZA 4XCAA 5JJNB 4WVWA 4X6RB 3ZRXA 2RS32 1QVFU 2E76B 3ZHRA 4BLJA 2ZHLA 5BNOC 3VN4A 1I1EA 2IVJA 5DDJ3 3CWBH 4H0LB 2DFBA 4MT8A 1SG3A 2ZHMA 2UWAA 4CCMA 3UT0A 3KF3A 2EILC 3MV01 2VULA 2UU9O 2AGAA 3I2IA 3JD0A 1NLQA 4O4LB 2ZEZA 5GONA 3WW4A 1KXGA 3ZFEA 2HWF1 1WNSA 2Z3YA 4QPIB 3BTYA 2LW7A 3UT5A 1CD3G 4MTFA 5CFCB 2LRPA 4EFEA 1B35C 1IBLB 4DR4B 2ILMA 4YNIA 2HVKC 3DUIA 1AYM1 1OUXA 3DC5A 4BIFA 3QCWA 1Q7YW 1NCRB 3ETQA 3A0HZ 5JWPA 1LTEA 3LGRA 3WW3A 5GZFA 4NTWA 3B9IA 4DV3O 1UKGA 1ENSA 2H3OA 2GAUA 1SQGA 4D7TA 2E9QA 4MGYE 5KX5A 1AL22 4GWNA 3JARB 5IYYA 5C3OA 1QIQA 4DR6O 1UW8A 4M00A 4FOWA 1JPXA 4XDPA 2QTWB 4WBNB 2NPIA 2DVFA 2ARBA 1M4WA 4ZY9A 2CAUA 1UZWA 1E79G 5FOJB 3GM8A 2WZR2 1JQ0A 5ISLA 1GWLA 4COWA 3A0KA 4AI2A 4MTGA 3FX7A 2RDSA 1E5IA 2EBOA 4LC1A 2XJQA 1QJU1 4CEYA 2OQ7A 1BHAA 2LW1A 2ZGPA 1OJHA 1HP8A 4Y24A 2DQ0A 3VZJA 4KXRA 5FY1A 4URTA 2YC0A 1GH6A 3L75H 2GTAA 4FLXA 1FOD1 4IE5A 3T2QA 1NCQA 4PDWC 4DY3A 4Q4X3 1GRJA 3JU9A 5LASA 4N53B 3LIHA 3HNYM 1RUF2 1LOCA 4N9IA 3ABKC 4Q8KA 1P4RA 1LODA 4B3SO 3QD6A 2YI8A 3CMAV 2VPVA 2QQPA 4NXMB 3N9OA 4Q4V3 1KFUL 3HBZA 2DVBA 2Q8OA 4W4ZA 3ZMZA 5FKBA 1ENVA 2A9HA 5DEDA 4WFFA 1K45A 3NQHA 2OIIA 3BTZA 5CN0A 3N9QA 2EX3A 4LPLA 4I3GA 3BHPA 5JIAA 4KL1A 4AG4A 3JARA 5CMUA 1O5UA 4M3CF 3S3WA 1WCSA 3SCFA 2P17A 4OUEA 3OEBA 2B9VA 2YV8A 2BTQB 4HONA 4FTEA 1OFSA 2YI9A 5DG1A 5CB4A 3UKNA 1GP6A 3PIGA 4YGCA 3EXUA 2VY0A 2QWOB 2HWF2 5BNNC 1A32A 1QGLA 3EHKA 3ZMOA 2PAEA 2ZNJA 4GT1A 4CPBA 3O1PA 3QG5A 3ZBHA 4PDRA 4RR3A 1IBMO 3LEMA 4PA7A 2GNDA 4O7XA 2D3PA 1S0BA 1OPOA 1MQTC 2JB4A 3ZLIA 4GUNA 2E63A 2Z69A 5JQGA 3PTYA 2GSMB 2DF7A 3I54A 4JQTA 3MW3A 5DZFA 4LF7B 4B3MO 5L3DA 2ZAHA 3AYEA 3SISA 1HXS3 4J9ZB 3H1YA 4D6RA 2ARCA 3VBFC 1X36A 5KXEA 2QSAA 3ABUA 5IK7A 3OMAB 1AR62 2JDNA 2QTOA 5IT9N 3AG4B 4MVTA 4GX5A 4DV5B 2Y6JA 5C5UA 3LSQA 3IJ4A 3DCQA 4J6GA 1W2BU 1FAYA 1XHXA 5JSPA 2RS53 5L7OA 1J3RA 1DLCA 1B3QA 4QHZA 1LNQA 5KUMA 2RM22 4P9GA 2WO2A 4QDRA 4D7SA 3CHXA 4KNCA 1GYKA 2KB1A 3VBHC 3T2TA 3CLPA 4AF9A 4Q6GA 3RJRA 3DXTA 1GP5A 4KU8A 4K20A 3FUOA 4WZFA 5BNOB 2VZ1A 4NIHA 2ZM6O 5B4XA 4OYUA 1SESA 3VDDC 3K58A 3ZN0A 4IQPA 5A9GA 4HMZA 1I94O 3GJBA 3USSA 1VQLV 2A70A 1QHTA 1Q8IA 4QX3A 4N90A 5A33A 4MYEA 1NY72 2YHJA 3T1HO 2Y6HA 3FJSA 2NZ9A 1GMMA 1AR81 1WD4A 2GMPA 2FYUH 3I3DA 3P3NA 4DB5A 3WHTA 3KVAA 4EWDA 3SJAC 3OMNB 2PTMA 1NG0A 2VOWA 3R0RA 1RVF1 1L7LA 1Y6XA 1QWRA 1RJ8A 1H2MA 1RUE1 2QFEA 1VBE3 3WNKA 3ZYIB 2PGGA 3TEXA 4Y3OA 5L9RA 5LEJA 3G4SV 3BB6A 1POQA 3PUHA 5LXTB 2C5DA 1VF6A 4DMIA 2IU3A 5J98B 1QOTA 1HRV3 3ELNA 2J42A 2P1BA 2RMU2 2H0BA 2ZX0A 4WBNA 4FPPA 1Q8PA 1DCSA 4LBNA 3OD0A 5CFDC 5CVRA 2YB7A 4MW3A 4AQYB 1HNWO 1R3JC 5EYPB 2NN4A 4YARA 1QU0A 1YRZA 3J26N 1W0NA 2IWGB 3VDBA 5BNOA 3VDDA 2DFCA 1XL4A 1STMA 1UXZA 2BNNA 1TUEB 4RFRB 4EN6B 3A4UA 2Y6LA 1S72V 1QNWA 3DPRA 3VUOA 1JJ2U 4G4FA 2YG0A 3RS6A 5GLVA 2VTXA 3VD9A 4LBLA 3DXRA 3ZRWB 1ASJ3 1JH5A 1LHNA 2FBEA 4HSJA 3E86A 5IAXA 3WDTA 3JBG2 3O1RA 5I8YA 3ZRWA 3DKWA 4QKDA 5FYSA 5FPBA 2OX0A 3HR0A 3OEHG 3ZFGC 4Z07A 5BPXA 3L2YA 3UO3A 5FKCA 4E4HA 4ATEA 5LYJA 3BA8A 2FMDA 4K6BA 1TA8A 3T2OA 4RO2A 1QXPA 4RL7A 1YFUA 2ZCEA 3H3LA 2PELA 1SQFA 3URFA 1MS1A 4GKKB 3E97A 1VP7A 4NHMA 1BXHA 1LR5A 3OF1A 2RCVA 3ICXA 1NX9A 5FZEA 3A7QA 4HK8A 1VP6A 1OT5A 1R1A1 2VZ3A 1QQP1 4IEXA 2ETNA 3ZDVA 3IPVB 3BVCA 4E2SA 5CISA 4PA9A 1YQ5A 2ENRA 4YSFA 5FZOB 2CDPA 1NS1A 5FLXN 4LIUA 4NVPA 3MDPA 4AVAA 4B08A 3CX5F 1LOFA 4DR3B 4JGYA 5F3GA 3SQOA 1F31A 1D0GA 3C8XA 1DGWA 1DZRA 2ZEWA 4RR3B 4I0XA 4XUPA 4ASLA 4IEZA 1ZSPA 4CBCA 3UM7A 3KHCA 2G38A 4LE3A 5A32A 3RYIA 1UU6A 2QDNA 3AL6A 3NSTA 1CJDA 3CJIC 4YVSB 4L8JA 4ARYA 3I97A 2L6LA 1KFXL 1RL3A 3MUY1 4DR2B 3AK0A 3KD4A 2CE4A 2DWEC 3EJKA 4O4IB 2WFF1 1RUD3 3LEKA 1M57B 2D3SA 4XBQA 4TV8B 5J2TA 1AZDA 2OT7A 1QLEB 2EXKA 4H55A 3SYQA 2A73B 4SBVA 2YXLA 4BR6A 5E88A 4QPIA 3FYEB 3X2QC 4XBFA 4JDMA 2V5YA 3LFIA 2HWE1 1K34A 1V9U1 3KGZA 2F1MA 4DR7B 2GU9A 1WA8B 3AXEA 4N53A 1XNQB 4XOGA 1I0HA 1RM1C 4HFSA 4UF0B 4YJ2B 1W9YA 4BLIA 1MS0A 1K9MW 4G28B 1I5PA 2QEXV 5FY8A 2Y4UA 2Y33A 1NTKH 1JZ6A 3J4UH 3TWIA 5IJ9B 1JUHA 3O5SA 5AVAA 4YM3A 4DV6O 2JJ6A 1NQJA 2XAQA 4Q0SA 3O0WA 1GQHA 1VBA1 3MZHA 1UL9A 4AL9A 2YROA 3K59A 4JGYB 2F95B 1C5IA 1VQMV 5C33A 4UUJC 3AKRA 4LHLA 1LGNA 1SZBA 3TYJA 1V9U2 3K9SA 1GBGA 1J84A 5LHHA 4IT5A 3DN7A 3KKYA 3P32A 3WNOA 1NXD1 3OSDA 2PHXA 1DGSA 2XTAA 3ENRA 1HRI2 4LBQB 2ZE5A 3LDDA 4I9WA 1W90A 2VOXA 4HNAA 1O5LA 1QKQA 4NIIA 1UNBA 3SEEA 1GN6A 2WO7A 2ZS6B 4AEDA 3Q9OA 4QD2A 3WG2A 1PNKA 3BOWA 3POSA 4CEWA 1V6NA 4PF1A 5FBJA 4CC5A 2KQXA 1I5XA 1K4CC 4SLIA 3RYHA 2Q8EA 4B1LA 4Y5Z0 5LOVB 5GM0A 2Q5ZA 1R3KC 2GSYA 3CO2A 1US3A 4ZOLB 1FNZA 1W6MA 2VW2A 1ODMA 3ZPOA 3CKHA 2TBVA 2HJIA 1NY71 4DXRA 1UWWA 5KXCA 5K9YA 2C2AA 4DUWA 4IV1B 1S0VA 2RM21 5JZGB 3TGUH 1UO9A 3LSUA 4I4TA 4D8MA 3JCIA 3RMYA 2JJ2G 5CADA 2HWE3 2VNRA 3WNPA 2HWD3 4FPFA 2EIJC 1HLCA 3FB6C 2G9ZA 5CNAA 1KD7A 2DBIA 2XVKA 4PDWA 1A78A 4XMAA 3AYDA 4E4EA 1ONAA 1S0FA 2WLIA 2V4DA 1OQEA 2D93A 3ZYGA 1L0NH 3SPJA 3FZ3A 2ZX3A 1M57C 2E5LB 1IG3A 5FCCA 1POV0 4CDXA 4Z2AA 4XJ8A 2RDQA 1JX9A 2ZGOA 4HLTA 4F8AA 1VQ7V 3NMBA 2N7GA 2JKBA 5F3CA 4WVMA 1KRIA 5FY0A 4M4RA 2CH7B 4EFBA 3H3UA 5H5NA 1LAJA 3ZHUA 2IJKA 1MEC2 3D6EA 5JXJA 1AL23 2SBAA 5A3OA 4JAUA 5FZCA 3VD5A 4DO0A 3K3NA 4RHV1 5FP4A 1OLME 2XNDG 2ZMLA 2PHFA 4NRPA 2F4PA 2BV4A 4R8CA 1XPWA 1S2BA 3CB2A 1CX1A 4WM8C 4FFBA 1REDA 4R4ZA 4IGOA 1F8VA 4RUFA 2GZWA 2W6IG 1ZL8B 1MNGA 2EIEA 2JDAA 2XPJA 1W2TA 4GB31 1P7BA 2Q8DA 1ENXA 2TUNA 5KUKA 4R9BA 4LT5A 5L36A 5FY5A 5EC1C 1GM8A 3JASB 4CCDA 2ZE7A 4U36A 4DV0B 2EVXA 2FDIA 2PLV2 1AR91 1QU7A 2OZJA 1PP9H 4BE3A 4Y22B 4EYUA 4K9SA 3SH3A 4YWAA 3LDBA 1RB8G 3ACGA 5FZLA 1W6OB 2UWCA 2CGOA 1JVMA 2JEXA 3GHMA 2QQMA 2YXSA 5CA6A 4GKXA 3ZN6A 1I3HA 4IEWA 2FZ2A 1S3JA 3UL2A 1RTVA 3I3BA 3S6PA 4WFBV 3FB5C 1NCRC 5DAVA 1UIKA 1GICA 4X1KB 1G6UA 3ZSMA 2ZPXA 3ZXFA 3ECQA 5EBLC 4BH9A 1RUF1 3L73H 3T1YB 3PU3A 5GLZA 4LE4A 4A6OA 1AR4A 4K21A 4LKEA 5DMYA 2JS5A 4JF3A 1JMUB 3VZMA 1V55B 4BMBA 5D5QA 2E7TA 4FQ4A 4BXSV 5K8SA 3J7NA 4R6ZA 5T3NA 4B3NA 2UXDO 4LF7O 4KFMA 2XQXA 2P6JA 4MVSA 5GZDA 1MS4A 2W47A 1VQ5V 3ABMC 1YF2A 3AG1B 3NL1A 4WM8A 2Q1MA 4DV3B 3KT4A 3OUIA 1SA0B 3L74H 5EXOA 3UJQA 4FM1A 4OQ8A 1AP6A 5A7SA 4Q5OA 3MO4A 4TLFA 4JI3B 1HRI3 4YZ3A 3BIWE 4YGEA 4TWTA 2HWC1 4DPNA 3IB3A 3ZRVA 3IPVA 1SBEA 2XLFA 2VBPA 1X82A 4AFBA 1H8TA 4JKKA 1DP0A 2OIGA 4PELA 3J8F1 1JYWA 1Q8SA 5EV7A 1WCUA 4IESA 4H2AA 5A3WA 1EZJA 2AR6A 4FM0A 4AI0A 3VBUA 5F2SA 4XAEA 2UU9B 3OBRA 1XC6A 3IZOA 1SQPH 3TBDA 5CBHA 4EWEA 1GQGA 2Z4FA 1FXKC 5HV4A 4RSUA 4YGDA 5IJ0B 1AR73 3VBRA 4N9HA 4A42A 4PBPA 5T55A 1COV2 1XSQA 1DG6A 3IDBB 3BY6A 4YM1A 3MHZA 2BNOA 1W04A 3C90A 3QH6A 2XWBB 4N43A 4DXSA 1JS9A 1GNHA 1TGOA 1NCQB 4YJ3B 1XNKA 2GC2A 1Z5WA 2ZX4A 3WOGA 3SPGA 2JDKA 4H44B 4XXPA 5FXVA 1NOVA 1RUI2 2JGDA 1W03A 1BHBA 3T0AA 4QQOA 5IK5A 2ZGMA 2RS11 4JC1A 1GZWA 5C8YB 2EJRA 3I2GA 3TXSA 1OFNA 4A7KA 2F4VB 4AQTA 4CP0A 3BRCA 2IXKA 2ZD9A 5E16A 2W1WA 2WNUA 2QQNA 4JYAB 5HPOA 1W06A 2BSKB 1OCRB 4P9OA 4CH4A 4IEUA 3MF6A 1QJY2 4AFAA 3AMQA 1LEDA 2JG9A 2DUPA 3I59B 5ACA3 5IVYA 4XFHA 4B29A 5C3QA 3FLPA 4IEPA 1AHSA 4B4PA 2WN2A 3OBTA 1S0CA 3WDYA 1GZ9A 5CKNA 5ABJC 5GLTA 5A7NA 2ORXA 4RYDA 4RQPB 1L7QA 1PO21 5FJHA 2LGWA 1DU3D 5EJ3A 1HNZO 2CTQA 3AJYA 4PQQA 1DLLA 1ENQA 5LA1A 2CAVA 1YJLA 3L71H 3PLQA 4MVRA 4AQ2A 4LR3A 4PLMA 3CRQA 1FJGO 3K03A 4JTCB 2HFEC 3PMEA 2HWB3 3NJVA 4PBOA 2A0LA 1SEFA 4FLYA 3OM3B 3WF0A 3LKJA 3VBOB 2KG7A 4L99A 3KT7A 1HNXO 1D4VB 1VMJA 4N43B 1KMIZ 1XNBA 3DF0A 3HKDB 1WBFA 2JX9A 3KF5A 1F4NA 4CS3A 1DGWX 2B1GA 2X09A 2VCMA 4JAAA 5T5JA 2YEVB 2D5HA 3N9NA 2GMMA 1A8MA 4FMTA 2HEYF 1ND3A 2GDSA 5JSOA 4LO5B 3GZEA 1RGSA 1DDLA 1SZTA 3RI9A 3AC0A 4QPIC 3S5QA 1W9SA 4K8XA 2X29A 3ZCCA 2YSUB 5A32B 4MVUA 2ZINA 5DXDA 2LALA 3WG1A 5DN2A 1ASJ1 1VMHA 3NJXA 4XXAA 2DUOA 2DN9A 4TUYB 4M3CE 4RS5C 2AZ2A 5ACA1 3KQ4B 2B7YA 1JYCA 4UVBA 4JI1B 4NPMA 2R32A 1H2LA 1PPJH 3FAVA 2XASA 3RT3C 3B94A 3SGIA 5FK7A 1JOYA 4Q4Y1 3NO8A 4A5UB 3RZLA 2JDYA 1BMFG 3VZKA 3MICA 5BMVA 5KA5A 1ZRDA 3RQ0A 2NM1A 3LFMA 3U11A 3DECA 3HKDA 3ZFFB 2OT5A 3RGBA 2O8OA 3DSQA 4K40A 5FBZA 4TOIA 2R1BA 1PO22 2NNUA 1AXKA 1PX3A 4GH4C 5A3PA 3MPPG 4MHUA 5FZFA 4X1IA 4C91A 2OUHA 5FPOA 1QLNA 1OOPB 1LKNA 4DV7B 5EIBD 2AZ0A 3I2JA 2VZRA 3ZSKA 1N0JA 2EINB 3RW0A 2J1AA 3WP3A 1OPMA 1UY4A 3DGTA 2O8QA 4Q1RA 4FAGA 1Y76A 2GMEA 1ZUQA 1H8HG 1JBCA 4EEQA 5FZDA 2BOJA 3BOPA 5C3RA 4W65A 4HN0A 1N3QA 5L7OB 3WEZA 2WNVC 4WFAV 5LA2A 1UPSA 1EP0A 4KUMA 3NAPA 4CDUA 2ZJCA 1VLNA 4QWNA 2CY6A 4DUYB 1PO11 1IKPA 3THPA 1W9WA 4XAAA 3J8F2 1ULGA 2E5LO 1C8NA 3ASNB 3H1MA 3JALA 1OLMA 4LBKA 1K97A 1R73A 4BPZA 2P90A 2WZR3 1H8EG 3V64A 2WN3A 1W2AX 4FOQA 3GB7C 3AP6A 1HJGA 3NNFA 4ZXKA 3LDRA 4GKKO 4QX8A 5ITZA 2R1DA 2VZTA 1VBD2 3JAMN 2OS2A 3H1JH 5J96B 3TCUA 1G4YB 1AI7A 1NR7A 2QQJA 4JV4A 3PVBB 4HK9A 3B00A 1NH2D 1H2SB 2WSSG 1YC61 1H8TC 4JRAA 1ST8A 1N0NA 5EIBC 1SFPA 2WKKA 1S1AA 2Q4SA 4BHPA 2K2SA 2R9AA 5CA1B 2D6PA 3DEMA 3QLQA 3L2HA 5C9AB 3HKEB 2E75B 1ULDA 4P9WA 4S2GA 4AGVA 1VQ6V 2HBUA 2V4AA 2WLLB 3CRCA 1FPN1 2H6CA 1T6GC 2G19A 2IH1C 1ROPA 3STLC 3RG0A 3NWKA 2WRAA 5J9PC 2HYKA 4LTAA 1VIWB 5LMNO 3C3VA 4PJYA 1CVNA 2LTNA 1ZRFA 3CRMA 2EXJA 1OZ0A 1IQDC 4R4XA 4AK3A 4XFCA 1IS5A 3VDDB 4A6SA 2XL9A 3BIEA 1PGSA 2D6OX 5ANNA 1VAMA 1M4UA 3H1KH 1ND2A 1E5RA 1HR0B 4LKDA 1ENRA 3T4HB 3NAPC 4CDUC 3VHRA 4JVAA 4WM7C 1SS3A 4X66O 2DDUA 2BGPA 1HW5A 3KLSA 1AX0A 4ZBMA 4U2AA 2RS51 1TME3 2UXCO 2MW2B 2NLRA 4XUQA 5DZGA 1UOFA 5L3CA 4PJ0Z 3OGSA 1WW4A 1H2NA 3M3QA 1W0OA 3KGLA 5LEKA 1V0AA 1WW7A 4QX2A 2JG8A 4LULA 4R7CA 1WAZA 4DR6B 2X7RB 2PI4A 1CAXB 4FLTA 1HB3A 4M0NA 1LUWA 1RUG2 3PTRB 3FYIB 1SLIA 1DFQA 4MG2A 2XMLA 1CN1A 1F4AA 3ZHQA 2CYFA 2UY8A 1NCRA 3ZYPA 1ZBE1 4LNVA 2WS91 1SBDA 4XE9A 1XE7A 2CTVA 2NR5A 5A7WB 3F5WC 5K0UA 2ZOEB 5DUUA 2PQQA 2XBO3 3O1MA 4XCBA 3U07A 2PN5A 2CL2A 3STZC 2Q0AA 4FVVA 2ZAAA 4Z1VA 1QNYA 3IC9A 2ZR3A 4FBFA 4X1KA 1ZBA3 3AP9A 3CJXA 1SQXH 3HNBM 4PF5A 1JZ7A 2ARXA 5IWAO 2JEUA 1WP7A 2QQOA 4ASMB 2RS33 3RFRA 3WB2A 2Y6FA 1XRUA 1VF5B 3I3MA 3CCUV 4JI6B 4B8EA 3SPCA 1FPN3 1T6BX 4HN1A 4LORA 2CDOA 2IFWA 1RUNA 4CH6A 3FX3A 4ZONA 2HEPA 4HL0A 4X8AA 1SLAA 4XF9A 3K5NA 2EF6A 2HJDA 3H42B 1AR93 1YFWA 3O7OA 1LOGA 1W9TA 3JAKB 3ZJZA 1SCSA 2VMIA 3UKTA 3W5NA 3BODA 1MZ5A 3VHOA 2VOTA 4AI1A 1UQXA 2EIMC 4AVTA 1U12A 2ZQMA 4C90A 1BJQA 1QF3A 2RVAA 4JYCA 4LF8B 4AHXA 3OBAA 4WVVA 4CEYC 1XQ8A 2B39A 5IVVA 3TNPB 4X20A 3FB7C 2WZR1 4HPKB 1DK1A 3AMPA 4AI3A 4F7ZA 1ZX5A 3H1LH 2GH8A 3OUSA 4PDWB 1LGCA 3GBFA 1SPPB 2XLAA 4XF4A 1GANA 2F43G 4E2QA 4UXNA 4OMDA 5EYPA 1BKZA 5EYYA 1J83A 5J48A 3SJQC 1LJ7A 2QZ2A 4IIJA 2JDMA 4EQVA 1V54B 1XQNA 4HBNA 2PHUA 1LU2A 3WNNA 4U3JA 4WFHA 5I0DA 5KX5B 2X05A 2YS8A 2AENA 2UUAO 1XYOA 2VU9A 5FZGA 4FFKA 2RMU1 1VBC1 5FLJA 3ZX7A 4W4LA 2OYQA 2QUOA 3ZVXA 3WUCA 2VVDA 3LZZA 4BZ4A 3MGUA 3K08A 3FAVB 3TRSB 3ZSLA 3W7WA 2WYSA 1O91A 3N2GB 2PMWB 1J1TA 3UV9A 1IOAA 4QAWA 5DDJ2 4ASKA 5IT6A 5A33B 2K9ZA 4DRXA 4JRLA 2ODMA 3ZKUA 2B42B 4O2AA 1Q81W 5C70A 3F5TA 4P00B 4J7KA 3FKSG 5CB7A 1KITA 3RZHA 2VGDA 1COV3 1W6NB 2DCJA 3UO2A 4YZ2A 1GZTA 5IYZB 5FL7G 3JUUA 3WG3A 1UYXA 1WPBA 5EJ1B 3K4ZA 1O3TA 3RYCA 2GNBA 4UXAA 2M6YA 5LL6Y 1VBD1 4AFMA 2ZDIC 3RYCB 2CTRA 2AW9A 5IFTA 2ZNIA 1OD3A 4M0HA 4OVEA 1NVPB 1NR1A 1MZ6A 2OYZA 4ICGA 1NTMH 4OCTA 4UBGA 1VBA3 2ATFA 1XBLA 1M5IA 3EYPA 2X10A 4ZHQA 3SEPA 5GZEA 3K4AA 3G71V 5CYYA 1JYNA 3RZGA 3N7LA 1WMFA 4MVOA 1AL0G 3OEEG 5LB6A 2Z5WA 1IHMA 4RGGA 1V54C 4FPGA 4U3JB 3AYCA 2BTQA 4TXWA 3OCPA 1Y4WA 4AXOA 3RYHB 1Q8VA 5FQ0B 3WCRA 3B2EE 2F93B 1Z0HA 2Q9LA 4BXFA 5CU1A 2QJVA 1D4M2 5GLUA 1UZYA 3POIA 5GJ6A 2BBVA 1IZ3A 3TJTA 2EAKA 1FV3A 1OCRC 4O4LA 1XNDA 3UCSC 1CAUA 1WA8A 2HR3A 3K04A 2PUSA 2HHHO 1X9TA 2WO1A 2ZGLA 1VAKA 1HDJA 2IXCA 1RSOA 2XJPA 3DYOA 4UV9A 4CP9A 2YPDA 1JMKC 2BTVC 3GWOA 4UFMA 1VBB3 3PNAA 2AHZA 3O9OA 5FPLA 3A23A 4AQ6A 3BFRA 2WBKA 2UYBA 1QLEC 4CPBD 5KAFZ 2QWRB 3V0AA 1WWYA 2HWE2 3SCGA 4H33A 4LITA 2N05A 4CE8A 1ACCA 5A3MA 3RZMA 3SYPA 4R9AA 3FFZA 2RR11 3E6DA 2ET7A 4B3RO 1BCCH 5EQUA 4HSLA 3KZ4C 4XVHA 2IUWA 1X7NA 3ZR5A 2QM7A 4BQYA 4GKYA 3WFVA 1Q8QA 4J7JA 5LGUA 1UMZA 3AG1C 3WQ0A 2WT0A 3J7HA 3MIDA 5BY5A 3CZJA 1XE0A 2DCZA 4E8DA 5BNPB 4GQ7A 1TMF2 3NKTA 3ON7A 3OTOB 4IGPA 4LP8A 5HV0A 4JZ2A 3P3PA 4BQ3A 1QJEA 4HZFA 2QDOA 3AK1A 3QF7A 1J5EO 5E1RA 4I55B 4CDQB 3IKWA 2WDBA 4JI5O 1SMVA 3TETA 5FYTA 3EHBB 5L19A 4JTOA 1HV1A 2P3IA 2RQ6A 5LGTA 1DQ4A 5GALA 3SR2C 4YIOA 5B1NA 1WUVA 4PLOA 1PGL1 1HNWB 5C71A 3O1OA 1YI9A 1GNZA 4X62O 1BQ0A 3O1UA 4YY3B 1Q5OA 2CUGA 3RYPA 4DV7O 3HMYA 1SHWB 5IVEA 4ARXA 3VB9A 3MFCA 4AQSA 3MEPA 3SKVA 4RD7A 3KZIZ 3H0OA 4FLWA 4IEOA 4XF3A 2Z0AA 2X6BA 2LGQA 1QR8A 4LMFA 2IW5A 4AI9A 3E8GA 5E6HA 4XHBA 2W9XA 3AZZA 1RUE3 3OOXA 1ZAUA 1VB2A 4EB6A 4LNUA 2ZMNA 5LGNA 1RUC2 2BP6A 4BWAA 2XHKA 1S4CA 5A7OA 4QQ2A 4DUXA 3THOA 2P6HA 1WN7A 1AI5A 4XJUA 4C1XA 2B9ZA 3H8OA 1R1ZA 2ZR2A 4QXKA 2NMOA 3WF4A 4AOCA 2CWSA 2EJ7A 2BZDA 2W0XA 2I07B 3R66A 3VBRB 2DJVA 5FJKA 5CKQA 3ZMVA 4FPJA 3OFNG 3DXRB 1J58A 2QKDA 2Q8CA 1KDMA 4PQ9A 3WW1A 2BFUL 3D82A 3PJSK 2FDHA 2GTSA 5LOVA 5DAQA 2O57A 3WP6A 4JI0O 1ZYBA 4XEZA 4F83A 5FP8A 5GKAC 3VBHA 3BN6A 1MMMA 5DDJ1 1W6OA 2P2KA 4O2BA 2C4XA 1EV12 1BMV2 4LA2A 1AI4A 3AKTA 3VBUB 4GWMA 2VUCA 2CSGA 4TZDA 1EAH3 3RWKX 2R30A 4UW5A 1APNA 2ET1A 5CG8A 3KG2A 2VXRA 2LP7A 1X9PA 1QDOA 5AC92 4C1WA 2PLV3 4D7YA 4JV5O 3I55V 4NRQA 1VMFA 4UFLA 1AR5A 4LNUB 4XF0A 2QGNA 1XMQB 2RDRA 1M06G 5DUWA 3OYWB 4TSFG 4K8FA 3I2OA 3SDLA 4BB3A 4K3AA 5JUVA 3QTCA 4L0PA 2RE9A 4HNAB 2CHHA 4ZI7A 3BEHA 2NYYA 3PVOA 1BK1A 5GLWA 4MOAA 2VQEB 3HN1A 3IWZA 3OT7A 2Q7EA 1YDXA 2CH7A 3MW4A 3LOBA 1IBKO 1VJ2A 1ZZ6A 2VR4A 2UXDB 2PHDA 4JI8B 4LO8A 1SDDB 3SYCA 4PD4F 2G9FA 4ONUA 2LJ2A 2YMZA 1R081 2HWC3 4QX5A 1WLCA 4YZ1A 1Y66A 2JJ1G 2F4LA 2DYSB 3GBWA 3LNMB 3WG4A 4DW1A 4I01A 3CC7V 5EZWA 3VBBA 1H0BA 4X1YB 1Y9QA 4QM9A 5JH7B 1P8JA 1LGBA 4KHPO 2XKOA 2KG7B 3POGA 4MUVA 2WFF3 1XNRB 5FZAA 4UI9L 1JHJA 4JI3O 3SJCC 2C0ZA 2JVDA 5H9CA 1JYIA 1D4M1 3KB5A 5A70A 1VPHA 4YVSC 1K5MB 1UPIA 3EFFK 4Y33A 1BSMA 1GOHA 3D0SA 3IIAA 4RFT0 3WUDA 3I2HA 4K3UA 4I0WB 1MVQA 1RUJ1 1NAEA 4DV4B 2A79B 4J41A 3U0ZA 2X53S 5DECA 5JCOA 1FOD2 4JKMA 1K5SA 2VECA 2BQPA 2J1UA 1YIFA 4LFCO 5A2QN 5T5LA 3AKSA 1XMOO 4F6RA 1D2SA 4XDQA 3JD71 3UGFA 3ZYBA 4AVBA 5LBBA 4X64O 1VMGA 4CUCA 2BCCH 4OQ9A 5BZBA 4TWKA 4WVMB 1QJX2 1TME1 5FZ4A 2D97A 2RR12 3ZMTA 4A7ZA 3ILFA 2R49A 1L7RA 2ZE6A 1POV1 3ROUA 5LA6A 1YLLA 2FL4A 1KKCA 1S0GA 1JJOA 4BIZA 2PFWA 1O59A 4EN7B 5FR3A 2W91A 1D7PM 2P67A 5FIXA 1TZOA 2FB5A 1QR9A 3E2EA 5T50A 1OCZB 3G6JB 1YEWA 4DV5O 1OH3A 2OW4A 4IE7A 4I0BA 4D0QA 3QBQA 1ZZ7A 3UNPA 2MNGA 2CNAA 3TAYA 1YJWV 1PO12 4S2HA 3FWEA 4RWUA 5FYYA 5C8CC 4QT6A 1BBT3 4IL7A 2WNEA 1OCOC 1QBZA 2QKAA 3WHUA 1MSWD 1ZWIC 3WP4A 1HKDA 3RYFA 4YGBA 1W6QA 1RP3B 2VH9A 4RHV2 4NR1A 5ABJA 1O7FA 3N2KB 4QQPA 1ZLZA 4NRMA 2AEYA 1G8WA 2ZKLA 1ZZBA 5ABJB 5JXIA 4KI5M 5CAZA 4E4SA 1B04A 2Z79A 2XWJB 4H7MA 2RG4A 3CQOA 4NWVA 3G6EV 1FJGB 1MS9A 4PIZA 4HYOA 1CESA 3ZYHA 2BVVA 3EQEA 4IL6Z 1MPXA 4YW6A 2VUAA 2X5IB 2P5OA 3Q8CA 4K1YA 1CPNA 5TSWA 3LB9A 3RPQA 4LFAB 5GTHZ 1M56C 4LFBB 4L11A 4WM8B 4DR1B 3MF9A 1URXA 5C3PA 3C7OA 4AEJA 2UXNA 4OUMA 3JATA 2XH6A 5LXTA 4H7LA 2DVGA 2XXZA 5J37A 2E26A 4TLGA 2JG8B 2N74A 3W7TA 1RUC3 4AFCA 3JCUZ 4V1PA 2IXHA 3WF2A 2WLIB 2MEV2 4KWLA 2ZX2A 3H50A 4LUMA 5C9AC 1C1FA 1C57A 4XQDA 5EFUA 5F5AA 5F5IA 3E8BA 1JOBA 1DF5A 2UXXA 2WQ8A 3RWNA 4YVWB 3VD4A 3RJ2X 4YW4A 1KJLA 4MSVA 1YTFD 1XSRA 4COVA 3AZYA 5F6LB 2HLEA 4BQXA 3BAAA 2FCVA 3JD3A 3CD6V 5IVCA 4CZSA 3OUHA 2JDIG 1KDKA 2JKXA 2Q0OC 5F8PA 4EV0A 1OCCB 4DUVA 5L3BA 4JI7B 5FYIA 4DW0A 5J2TB 3WXPA 5LA9A 1AR83 1JFFA 4U7OA 4RQPA 3C7HA 1EUTA 2XVLA 4O4HB 2DWRA 3DTUB 4RQEA 2B46X 1BLZA 2NLJC 1R3LC 3K79A 2X0LA 3PN1A 4INDA 4BYYA 2E32A 1Q6UA 1PNGA 4HKOA 5DN6G 4CEWB 4Z1MG 3AMNA 1H2KA 3N7JA 3WG7B 3M8AA 4O61A 2X5IA 1YQ2A 4U3FH 1ND2B 4ZOLA 3VV1A 3OTOO 1N8RW 4QHOA 2JB8A 5HXMA 3CCMV 2XT9A 4X65O 1CAUB 4XMIA 2JECA 2R063 3MPBA 2A3WA 1WLTA 2R0FA 5FZ0A 5JMOA 4RN5A 2O14A 5IYDO 2C9KA 2XR4A 3G80A 4CYDA 3JYCA 1VAVA 2J1TA 5JVDA 1PNLA 1W8UA 3KSCA 4OLLA 4XTMA 2M7WA 3AP7A 2YFUA 3F2ZA 3T09A 3POYA 1BQPA 3T30A 1SLTA 3AKQA 5EYXA 5FZKA 4FOVA 3N4MA 2VS0A 1NQTA 2OCCB 2D98A 5FY7A 4NAMA 2R072 3G6BA 4OX9O 1VBB1 5C5TA 2VJXA 1MEC1 5JSRA 1ULPA 3BTXA 4GD4A 2HWB2 3SJBC 4I7ZB 2ZGUA 3BABA 2XAGA 5FOBB 2K1EA 5D2AA 4YW7A 1WBLA 2HWF3 1UCXA 5LA6B 3ZYFA 1WCKA 1JR9A 3K77A 2R042 3ZYJB 4Q0UA 2D6NA 2EIMB 4QM8A 3RZZA 1HB2A 1GKFA 2Q5TA 1V6OA 3E6CC 1RIRA 1R1A2 1W99A 1O3SA 2BFUS 3JD2A 5FREA 5E79Z 3H8UA 2ATKC 2FDKA 1HWYA 5LRSA 4A3ZA 4OGQB 1LU1A 4HETA 1JU3A 2RMKB 5EHDA 3KCCA 1KGYA 4XJWA 3VBSA 1N4CA 3E5QA 4B1MA 4Z92B 2J1RA 3ZFFA 3OR7C 3FB8C 2BWCA 5F5QA 5LRRA 3SPIA 4JGZB 3VZLA 3VBSB 4LQRA 4TTGA 2WLNA 3AXDA 4Z82A 5D21A 3JATB 4AE2A 3HKEA 1V9U3 4XIOA 3IN9A 1ZVFA 4OMCA 2EULA 2ES3A 3DYMA 4N7UA 4V2WA 1PGW1 5JPNB 2YUEA 1WLWA 1QHDA 1FI2A 4XETA 3I2DA 4MGZE 5BNQA 3GCWA 5EBWC 4CEYB 5SV5A 3AVSA 5T5PA 2QNKA 3W58A 3PL0A 1LHOA 4A41A 2XBO2 3K3WA 2X8KA 2D44A 2CV6A 3NNLA 5J09A 1FFXA 1JYTA 1F5JA 4WM7A 4AEMA 3HVDA 4YVSA 2TEPA 3E5UA 1OHHG 3H9AA 4P9PA 2E51A 4TV9A 3H1HH 4B3TB 1UOBA 3FLRA 3LEGA 4FXGB 4Q0VA 1JZ4A 1E57A 3JZVA 3JALB 1DZQA 2IC1A 2YC4A 2MPFA 2WAAA 4LF5B 4NPRA 5HFMA 4ZZ8A 2Y38A 1XU2A 1TUBB 2WS93 3N2GA 2BWAA 2A3XA 4QKNA 1UIJA 5JZGA 3W5MA 1DHKB 3RRDA 2QVSB 1LHWA 3RI8A 2I74A 2XBO1 2XL7A 5BY1A 3UJOA 1W8WA 3AG2C 1HN1A 3W21A 3ETDA 1W6NA 3ZFGA 1XBFA 1GN2A 2LFRA 4O2BB 2PHWA 1XOYA 5F9TA 4MXWB 2FMLA 3M3EA 4FZ0A 1DGLA 5IK4A 3THTA 3AB0A 1W2UA 4GMP3 4LOSA 2GBOA 2ZGNA 3ZKYA 3X29B 1ULOA 2OKXA 5DZEA 5FUNA 5LZ6A 4CS4A 2SLIA 3QACA 4IETA 2ID4A 2IXIA 3ZFEC 4JCKA 2TNFA 1VR3A 5KC5A 1A3KA 1X59A 1KD1W 3A0RA 4LWSA 4FFGA 5H9PA 1BVVA 2R16A 5FWJA 4MTXA 2W3JA 2W1SA 2ETEA 1GMGA 2DUQA 1H38A 2DYRB 2H0VA 2VWKA 4NO4A 4IYHA 3F7VC 1WW5A 2X6AA 2ORZA 1J59A 4K7JA 4PCRA 2RM23 4OHVA 5EP9A 2DTWA 1VRH2 3ZN4A 1RJ7A 2JD4A 4B3RB 4AZZA 3IIIA 4YW3A 4QPJA 1R1BA 3WV6A 5C4WC 4UB6Z 5IW0A 1QJZA 2W46A 4LA3A 3Q8AA 4DRRA 3T08A 4P30A 1EPWA 1PM4A 2DCYA 2JWPA 3SITA 4XFGA 3NVCA 5IE9A 2QDRA 1DQ2A 2A6ZA 1I9RA 1OCZC 4BK4A 3N9LA 1Z7S3 2A75A 3UYJA 1BEV2 3RVYA 2WLJA 2B5HA 1CJPA 1J5EB 1FMD3 4HKWA 3SYAA 2XLGA 4DV4O 1VQ4V 4JYAO 3LE0A 3D3IA 1JI6A 3H7YA 2RDNA 3LSSA 1UAIA 3ITQA 4IHJB 1M90W 5FZ9A 4XIKA 3VOUA 5F37A 4QDQA 1EAH2 2IXLA 3C2UA 3IMNA 1G9BA 1XDCA 2OXBA 4RUEA 1P84F 4QU1A 3LAGA 2W92A 4AHWA 3FHAA 1BZWA 1S0DA 2XGXA 4X88A 1N32B 4X89A 2CU5A 3CCVV 4MX3A 4QKFA 4CUAA 2DV9A 2VUJA 1Y4MA 4LF9B 2R0HA 4XF1A 5B3SC 1N47A 5CFDB 1AYM2 3HKBA 3BCCH 5LHIA 4OI0A 4R9CA 3JCZA 2BVBA 2WL1A 5CBGA 1AB3A 3JD73 1PMHX 4MTOA 3OB8A 3T2PA 4LLOA 2BOBC 2W87A 4FJCC 1IDSA 5JJEB 3OGIB 5FZOA 4OHYA 5C4WB 4EKWA 5FZ8A 3ETPA 1PMJX 3S7EA 5LCWL 4JI4O 4LIVA 4JASA 2Y64A 2W2IA 2XUMA 4AVSA 4AEDC 3NNJA 3VZOA 1GAXA 3HD8B 1HDKA 3DPRB 3WZ1A 5EZYB 3JBG3 2ZM6B 3I4IA 4CU8A 1GUIA 1EFRG 2J22A 4QIWF 1UJWB 1SQ4A 2XHBA 3OGGA 5BNNA 2R041 5EBMC 4L2NA 3MV11 3MBWA 2ZHNA 4Q4Y2 3LCPA 2DU0A 2YU2A 2IXJA 4X62B 3E6BA 4CEWC 3P1IA 3N2KA 2C24A 3B4SA 1UKRA 1W0PA 3J8F3 5K0UC 1B06A 4DEQA 3ZFFC 3OPTA 4ES9A 4HXCA 1OXCA 2IZWA 4LKSA 4MGIE 4OI1A 1AX1A 1BEV1 3VKNA 1F4MA 4CU6A 3AG7A 1Q3EA 1CR7A 4YHHO 2PAKA 5FO8B 4FPCA 3PVEA 2F23A 2ZGQA 1QQP3 5C8YA 4BMEA 2BUKA 5B1AC 1OQDA 3AZVA 2P3YA 4P9LA 2RDCA 3NXSA 3ZN1A 1RHI2 5FMCA 3ILNA 1O3RA 1W8ZA 2Y0OA 5KHKA 5IYBO 3USUA 4DINB 1H6YA 3J9SA 1UY2A 4UWDA 2WZPP 4JI2B 2VZQA 2RR13 3AFKA 2KSDA 3FUQA 3CXCU 1J3PA 2IJHA 1LOBA 2Q30A 2VQEO 3NJYA 2MK3A 2UYAA 4LUKA 3KHBA 2FKXA 1ND2C 2HWD2 4ET7A 3ZDSA 3IDCB 3BA9A 1F9KA 4X64B 4X66B 4Q4X2 1E5HA 3PHMA 3DGEA 4CP2A 1IPKA 2DQ3A 4YM0A 1KJRA 2GC3A 3OE7G 3FHQA 3ZXEA 1OC1A 1GZCA 5DPNA 1R082 1GK9A 3VQXA 4Q0QA 4DR2O 5I0SA 3F7YC 4GULA 4NMIA 3CIHA 3OGCC 3UGGA 2WA3A 3VBFB 4XBLA 4JI1O 3OD4A 4NTYA 2ZDIA 2DYSC
chains in the Genus database with same CATH topology
5J48A 1LJ7A 4NN0A 2QZ2A 4FCAA 1WMEA 1YUDA 1VBE2 2OIIA 1N1TA 1O4YA 4N43C 4ITCA 1XQNA 1RHI3 2PHUA 4HBNA 1LU2A 5T5OA 4I3GA 4GMP0 2WWSA 5JIAA 3VL9A 1Q43A 4YG3A 3GZTB 1FXZA 3N7KA 4KL1A 4AG4A 1PK6B 4CTEA 2AENA 1O5UA 1XYOA 1Y3TA 2VU9A 4M3CF 1WCSA 3SCFA 2P17A 3KT1A 3ZXAC 2RMU1 1VBC1 5FLJA 3V56A 3ZX7A 1Z78A 3VBHB 2QUOA 3MS5A 1MQTA 3WCSA 3ZVXA 1VBC3 3WUCA 2VVDA 2GN3A 4M25A 3LZZA 2YV8A 4BZ4A 3MGUA 4FTEA 3TRSB 3ZSLA 2O0OA 1FNYA 4G9SB 1OFSA 5DG1A 1O91A 2E7AA 2FQPA 3UKNA 4AHYA 1PIV2 4YGCA 3EXUA 3KQRA 2VY0A 1J1TA 2P34A 2HWF2 3M4FA 3UV9A 1IOAA 5DDJ2 5BNNC 5IT6A 3TB0A 5A33B 2K9ZA 1QGLA 3R4SA 1VALA 3EHKA 3ZMOA 4Q1PA 3N35A 2PAEA 4JRLA 4RQPC 4ES8A 4RR3A 2B42B 3NV1A 4JDOA 2GNDA 2VVEA 5CB7A 1KITA 3ZMNA 2VGDA 1OA4A 1COV3 4XQ4A 1W6NB 2D3PA 1S0BA 1OPOA 4XFIA 2DCJA 1MQTC 1SACA 1OKQA 4IV3A 4YZ2A 2E63A 2Z69A 3PTYA 3JUUA 3K51A 4YG0A 3WG3A 2DF7A 5GZGA 5C4WA 1TEIA 4GB33 3I54A 3MW3A 1O3TA 2GH2A 5DZFA 2GNBA 1B09A 1QJX1 4XZPA 3KM5A 2ZAHA 3AYEA 3SISA 1HXS3 4UXAA 1H4HA 1WGPA 4I02A 3H1YA 4M26A 4BQ1A 5I93A 4M23A 1VBD1 4Y1VA 3VBFC 4AFMA 1X36A 5AC93 4H3WA 5KXEA 4Y20A 2LM3A 1NXMA 3AP4A 3FC0A 4L92A 1GY9A 5IK7A 4M0HA 1VRH3 2WFF2 4OVEA 3U10A 1AR62 1MZ6A 4MVTA 4DRVA 2OYZA 1LECA 2ZBJA 2WNVB 5AFBA 1MS8A 4UBGA 1VBA3 1REEA 2ATFA 4J6GA 1FAYA 5I8TA 1KS5A 5JSPA 3BTAA 2RS53 4XFAA 3WDWA 1PHMA 3VGIA 5L7OA 3KCYA 1J3RA 4CWDA 1ZNPA 5GZEA 4H14A 1VZ4A 2GNMA 2RM22 1S2KA 4P9GA 4XFBA 3N7LA 1WMFA 1AL0G 4CDXC 4D7SA 3WVJA 5F1RA 5JOXA 3VL8A 3CF6E 4KNCA 4M2EA 2Z5WA 1C8M2 1GYKA 1IHMA 3VBHC 4RGGA 4FPGA 2HWD1 1JTZX 3T2TA 3AYCA 3CLPA 2R061 4AF9A 3RJRA 3OCPA 4KU8A 4K20A 4AXOA 3FUOA 3HR9A 4WZFA 2P37A 5BNOB 1Q8VA 4YW5A 1DRTA 5FQ0B 4XJAA 5D8AC 3WCRA 1Z0HA 1RITA 2XJUA 3VDDC 4E2GA 3ZXKA 2HEVF 4DQAA 4IQPA 1CAVB 1LESA 4HMZA 1A8DA 2EXIA 5CU1A 4ZKTB 2QJVA 1HQLA 3USSA 3R6SA 1D2QA 4IEYA 2A70A 2VQ0A 1D4M2 5GLUA 1HIXA 1UZYA 3NV3A 4N90A 1AYN1 5GJ6A 5A33A 2BBVA 1IZ3A 3IDEA 2EAKA 4MYEA 2BGCA 1FV3A 1NY72 1SDWA 3WNXA 5FLHA 2YHJA 1XNDA 1CAUA 2XG3A 1YXWA 1V6IA 3FJSA 2UWBA 2ZGLA 1AYM3 1VAKA 2NZ9A 5CFCC 1AR81 2IXCA 2XJPA 1WD4A 2GMPA 1AR61 3P3NA 4DB5A 3WHTA 4EWDA 2PTMA 1NG0A 2BTVC 2LUWA 1CAVA 1U5YA 2VOWA 3R0RA 4PIYA 3VBUC 5J7MA 4IV3B 1RVF1 1VBB3 2DTYA 1QWRA 1RJ8A 3N36A 3QOPA 3PNAA 1H2MA 4JDNA 3MIBA 4Y0EA 4OHXA 1RUE1 5J3UA 1OIIA 2QFEA 4XJ9A 1EY2A 1VBE3 1R092 1YHFA 1UF2C 4AQ6A 1DGRN 3ZYIB 4C8RA 1Y0ZA 2WBQA