4AI8A

Factor inhibiting hif-1 alpha in complex with daminozide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
339
structure length
339
Chain Sequence
SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Plant growth regulator daminozide is a selective inhibitor of human KDM2/7 histone demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4ai8A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ai8A01
3OD4A 1H2MA 3KCXA 4B7EA 2XUMA 1IZ3A 1H2KA 4Z2WA 1MZFA 4QU2A 1H2LA 1YCIA 4AI8A 4Z1VA 2WA3A 3D8CA 4NR1A 3KCYA 4B7KA 2CGNA 2W0XA 2YC0A 2YDEA 2WA4A 1MZEA 4BIOA 1H2NA 3P3PA 2Y0IA 5JWPA 4JAAA 2ILMA 2CGOA 3P3NA
chains in the Genus database with same CATH superfamily
3ZHUA 4MXWB 4IE4A 5F6KA 5JIUA 1OVPA 4I30A 4WBBA 4LR3A 4IXLA 4NXMO 1UOBA 3VOUA 2ZGPA 4P9LA 1UPIA 3SDLA 1NE6A 1FATA 1URXA 4OHWA 4HKLA 2E74B 3BALA 5HI0A 3I59A 1AYN3 1FMD3 3B5LB 2VGDA 3WDYA 2WNEA 5CNAA 3B9CA 1TUBB 2D6NA 2X0LA 4LWSB 5JVDA 3WF2A 2XKOA 5FCCA 2AUYA 1POQA 5GZDA 5BXZA 3AM2A 4UBGA 4K1ZA 5D8AB 2JDHA 3ABUA 1YCIA 3S7EA 3SCHA 4AFAA 2VMEA 3UGHA 5A33B 5FRAA 2ZGSA 5H5NA 4IDZA 4CDQA 2HLEA 1SC5B 3VQYA 1M93A 4B4QA 1RHI1 1I5YA 3JAWA 1YIPA 1XB9A 2AC1A 4D7YA 3INAA 4XDOA 2DDUA 1UF2C 2DMXA 3ZYJB 5B4NA 1H8TA 1Y7BA 2XQRA 2HJDA 4FLYA 2UY9A 1S55A 4XYXA 4O4JA 2KA3A 2LFSA 3T4ZA 3SISA 1ZRCA 3U11A 3RZKA 4YZ5A 5FZ0A 1JXNA 4HZ3A 1ENSA 3C2UA 1OPMA 4ZPIA 4P9PA 1Z5WA 4DIQA 2JRIA 2IU0A 2KM2A 3LEKA 2Q9LA 1S72V 2LUWA 3ZFEA 3CCVV 5IWAB 1FKAO 4XOGA 4A7KA 1NLSA 3D36A 1O4ZA 2D6MA 4AAXA 4CP1A 2RS33 1SA0A 2WLJA 4ZI7B 4A3XA 2M6YA 3VBFB 2JX9A 3PJSK 4FP2A 4YVSB 3MYXA 4QGLA 4U3JA 4DZGA 4MYEA 1OHFA 1QCEA 4G2KA 5F3GA 1NT2B 2JDPA 2PXJA 1LGNA 3AL6A 1LOBA 1LAJA 4LQRA 2P3JA 2P34A 2X10A 5GONA 3DL3A 2GBOA 1PK6B 4XDJA 2KR2A 2WUHA 2P3IA 4GCZA 1FAFA 5KAIZ 4YHHO 1ZBA3 1CX1A 1SLCA 3BUCA 5IYZB 4GX5A 2XGXA 1DDLA 4J6GA 3H3UA 5LYJA 2LW1A 5FLHA 1OLME 4XE9A 4NHXA 2VZ1A 4KXRA 3ZFFA 4LUKA 5GJ6A 3ZEDA 2ZKNA 4KHPB 4O4LB 4QXHA 4R8HA 5JAXA 1SFYA 1MS4A 1OA3A 1VQ7V 1CIWA 1DQ2A 1CZSA 4DR1O 2OIIA 3C7GA 5LWBA 4QWNA 4DK1A 1SQ4A 5FV3A 4UCSA 2X7RB 4LO5B 4DO2A 3R4SA 1GSLA 4QX1A 4JGSA 2JEXA 5EPAA 3FLPA 4CU6A 3ZSJA 1Q8IA 1T2XA 2YHJA 3DECA 4JTDB 1U12A 2YIDA 2ODMA 2BGCA 3O1VA 4Z82A 5A7OA 4DINB 4N53C 3F95A 4NAMA 3HKEB 1A8DA 1ZWIC 2QQLA 4TWKA 1QEXA 1WMXA 3G80A 3QH6A 4GZRB 3JU9A 3U4SA 5EBLC 2LJ2A 3ETDA 3VBHA 1ZL8A 4LC1A 4IYHA 5LGTA 2BFUL 2NP0A 2W3JA 3Q8EA 4FXGB 1VQPV 5SV5A 3CRQA 1G86A 2VW1A 4OHXA 4XZPA 5A3WA 1SZBA 1BQ0A 4PDRA 1YYNA 3LSSA 1NCRB 2XNDG 3CSXA 4Y20A 1COV2 3RFRA 3SPGA 1I5ZA 4XQWA 2WR9A 3T09A 3B4SA 3FBYA 4K1YA 2FZ2A 1C1FA 1CIYA 2YIBD 1ST8A 1ONAA 2AACA 2PYJA 2XH6A 3JD72 1W2AX 1G9AA 3Q4HA 1ZRIA 1VBD1 3OUSA 1LB2A 3Q8FA 1HX6A 4Y3OA 1L1FA 4S2GA 4RQFA 3OYWA 3JD0A 3VQVA 3F7VC 4HYOA 3N7JA 4C90A 1VB2A 5JOXA 1MZ6A 4YYOA 4Y1ZA 3FYEB 3RG0A 3LGRA 1UYXA 2D6OX 4KFMA 1E1RG 1OC1A 4AQTA 4R7CA 4PT6A 3ICXA 3ZYBA 5GTIZ 3AP5A 3H01A 1O5UA 1JJ2U 1FFXA 1WP7A 4ZU7A 1OZ0A 3ZXJA 1QWRA 1AB3A 3WHUA 1TEIA 3DKWA 4E4ZA 4JI7O 2WLIB 4JI6B 2ZE6A 5J09A 4XVHA 2QR4A 3SPHA 4UAPA 3KHCA 5C71A 2C0ZA 4GH4A 4LPLA 3THDA 5IHRA 2BVVA 3TEZA 4F6EA 5LATA 4GUNA 2BNNA 2Y26A 3LCPA 3VKNA 3NWKA 5J37A 4TSVA 4O4IB 1Y9GA 4CCMA 4PD4F 2VQFB 2J1UA 2QQMA 2EXHA 5FQ0A 4FPGA 2ZXWB 1AVMA 2WLHA 3LUTB 3DSQA 1DQ4A 1B09A 2JG8A 5FPVA 2XJSA 3H1LH 5JOYA 4UFIA 1DZRA 3AJZA 4URTA 3LFMA 5LA2A 1UFIA 1XU2A 3A7QA 2KD7A 4X89A 4GWMA 3RW0A 5ITZB 5E1RA 3WP5A 1JYWA 3K0GA 4QX0A 3KF5A 4H44B 2C9KA 4Q0SA 4N43A 3VGIA 1RUG2 4D7SA 1NQDA 2X5IB 5FZBA 5ABJB 1RIRA 1UOFA 1OHHG 1KEXA 3T2PA 2VNRA 1W6OA 3POEA 1Q6IA 4GXLA 4QKFA 1EAH2 2XPJA 2YDEA 1Q86W 1R64A 2R062 1IQAA 1FV3A 4MV2A 1PKXA 2XUEA 1IXMA 3STZC 2E51A 2JJ6A 1AI7A 2DU0A 1M4WA 5CKQA 2V73A 2YXHA 3CIHA 3RZJA 4WVMA 1MS3A 3BU0A 5FPBA 2XJPA 4GMP3 1UYPA 2O14A 2EZPA 4CBCA 1EUUA 5CEHA 3WNPA 1N34O 5JXJA 2LRPA 1POV3 1CAXA 1O4TA 3EBRA 3NVCA 4GIQA 1J1LA 4NWVA 4XUQA 5IJ9B 5CA1B 5I0SA 5JIAA 2RN9A 3JALA 1WW5A 4MT8A 1M5IA 1YRZA 3JBG2 4BJ0A 4ONUA 3JAKA 1VQ8V 4P14A 1AX0A 2IXKA 5JQGB 4DY3A 1RUNA 4SLIA 1HN0A 2XDVA 2WQZC 2ZEWA 4LO6B 5KHKA 5ANNA 3VZLA 1WGPA 4UFZA 1DGSA 3VLBB 4YGDA 2CHHA 5F7UA 2BEOA 2CAUA 4CZSA 4PF5A 1HXS2 4ABMA 2IH1C 5JOZA 4QJFB 1RP3B 3AZVA 1LNSA 5FP4A 4H7LA 1ZA4A 3M70A 1DLLA 2D3PA 5A2QN 2IXJA 4JAVA 2F17A 2YV8A 5FBZA 2CL2A 3WV6A 5F3IA 2R0FA 1L3JA 4EEQA 4Q8LA 4TQDA 3O1UA 4IEWA 4RFRB 1YVWA 3EXUA 1FXKA 4FIPC 3H3ZA 3W5NA 1R093 5E1AC 3PMEA 4Q5OA 1JZ8A 1CPNA 4RGGA 5FOBB 3SGIA 4WBNB 2QQNA 1SPPA 1QGLA 3ZYHA 2IJJA 3BTXA 1GAXA 2Y0OA 4X9QA 2HVKC 3VZOA 5DDJ2 1AZDA 4ISRA 1ROPA 1WP8A 4E8DA 2JICA 3S3WA 1OQEA 4NPLA 3HQRA 4LBQB 1SESA 3MHSC 4GX2A 3D3IA 1GZWA 4J1WA 4DRRA 1FXVA 1JTZX 4DR2O 5FJKA 5K0UB 3UO3A 4QX3A 2Y0PA 2KG7B 3VDBA 1QDOA 2ID4A 4QAWA 4JI1O 5JMOA 4E2SA 3OTOO 5CKNA 2F6BA 1KFXL 2VOTA 4F6RA 3WEZA 4N23A 2B9VA 2KKWA 2KSDA 4AVSA 3CCQV 2HWF3 1A34A 1KC8W 1V6JA 4U7NA 1KQSU 3L2YA 4BU2A 3V0AA 3ELNA 4B1MA 1M57C 1V55B 2EXIA 2WFPA 3AP4A 5KLVH 1BQZA 1Q82W 2WSSG 4X1IA 4AHCA 3GHNA 4N7IA 4JF3A 2CTPA 1H9PA 1PM4A 5JPMB 2UXCO 2WZR3 1KDMA 4F8AA 1TA8A 4YGBA 2DFBA 1IBKB 1ZM1A 3WY6A 2WLLA 2Z79A 5A1LA 4GLXA 1Y4MA 1HR0B 2FMDA 4UFJA 2ZGRA 4AEDC 3J8F2 3AMNA 3LPFA 1JBCA 4DV6O 4F4LA 2Y6GA 1V6LA 1PD3A 4UBHA 1ND2A 1GQPA 3I4IA 3CS5A 3LEIA 3TN91 3FKSG 4M3CE 2Q4PA 1I08A 1ENVA 1WPXA 5KAFZ 1VMGA 5FK7A 1SLTA 1IBMB 1QJX3 2ZAHA 3SPJA 1UO9A 5A6XA 4K20A 1BEV2 2ZE7A 4LBJA 1PGW1 1G6NA 2WIIB 4TYSA 4UF0B 3A4UA 3O12A 2HEPA 2I07B 3WHTA 5FY8A 1R6NA 3POBA 1REEA 1GO3F 4FTEA 4OULA 5HBAA 3M4FA 3VDDC 4P02B 3RRDA 4ZZ8A 1UZZA 1N47A 2XMLA 2WWSA 4YJ2B 5CA0B 4WM7A 2PQQA 3A23A 2HWD2 4BMEA 4I0BA 3CKHA 4QPGC 2NLRA 5BY1A 3SJQC 3UETA 3WNLA 3JASB 2QQUA 1H2NA 5A7NA 3W58A 3FBMA 5AFEA 1VMFA 3ZHQA 1C8NA 3K5NA 1O9GA 1VRH3 5E89A 1VQKV 3ZM8A 4OHYA 4OVEA 4PJ0Z 3I2JA 3J80N 3ZKUA 4XBQA 3THCA 4AQSA 3ACLA 4LF7B 1G8WA 3E86A 3OUJA 5A3NA 1C28A 1V9PA 4N8MA 3VZJA 4K8FA 2QQVA 1J59A 3ES4A 4Q4V2 1JS9A 3V0BB 3NJZA 3C8XA 1YQ8A 3E2EA 1HDKA 1M90W 1NOVA 2WQ4A 1TMF3 3R4DB 1JZ6A 1S5JA 4FLXA 4N90A 2AREA 2BTVC 3C3VA 4PLOA 1FPN1 3U0ZA 4K7JA 1ULCA 4IT5A 2PZSA 3Q8BA 4LH6A 4TTGA 4Q1PA 4XFHA 4YZ1A 3WU2Z 4HVQA 3FB7C 4X1KB 4OUSA 1AYN1 3MHZA 5A1FA 3DXRB 1S0CA 3V65A 4I50B 5ISLA 5DN6G 2DBIA 2WT2A 4TUYA 5ERLA 2B1IA 5FZOA 3VBRA 3R65A 4Y1UA 1OKQA 1G6UA 1ZAUA 3ZHRA 1W03A 1VF5B 4YW3A 2PAKA 1KBHA 3HR0A 4NXMB 1VIBA 1YQ2A 1P8JA 2Q4SA 4XDPA 3BI3A 4DR5O 5FBJA 3Q8CA 1R73A 2VCBA 4YG6A 1VQMV 5EYYA 1DQ5A 1H1MA 3H1JH 5IE9A 1NCQB 2VZPA 2IWGB 5B3SC 2VBBA 5JI9A 2CAZC 2NLJC 3NNMA 4YGEA 4JYYA 2IVJA 1AL22 4ORFA 3T0BA 1YEWA 4TOIA 1WAZA 3JCZA 2CU5A 1WW7A 2ZEXA 5FYTA 1ULPA 2ITDC 4Q20A 2JDKA 5FOJB 4DV7O 1NA1C 1JU4A 3AKQA 2CWMA 4EWAA 5FUNA 2WT0A 2I74A 5CZKA 3WP3A 3WNOA 5IVJA 2E63A 3RJRA 4TV8B 3H50A 1N3QA 2EJ7A 1Z7S3 2RS31 2QE7G 3GHMA 4XPVA 4DY5A 3CC4V 3L73H 2VD7A 1NTMH 2A0LA 4MVQA 2RDSA 3OEEG 2VPVA 4S2FA 4JDNA 3T0AA 4NIDA 1TAEA 3ILNA 3APQA 4RL7A 2RS12 2DV9A 1O9HA 1QMJA 4LTAA 5JXIA 2EIJC 3U10A 1YIJV 5H6QA 1SFNA 2ZR2A 5BNNB 3C90A 1VBC2 3OUHA 3GWOA 4X65B 5JWPA 4O4HA 1MR5A 4NAOA 1NU1H 4JGZA 5I8SA 4MTOA 4XZUG 4EZ4A 5FYMA 4FVVA 2XAFA 1MPXA 3NW4A 4BOWA 4FVMA 5CFCB 4E27A 2ZAAA 1W8OA 1ZBA1 3I49A 4L8JA 1VE0A 2CGPA 4XFAA 3W9AA 2WNUA 1YHQV 1WW4A 1Q8QA 4K3AA 2BOJA 1OI6A 5C8CB 1QLEB 5EYPA 3FJSA 4NMIA 1S0DA 2EF6A 2V1DA 3QF7A 4QX7A 4CP9A 2RHPA 3WDVA 1K5QA 3H8XA 4WVVA 1JODA 5FZ4A 4M4PA 2O1QA 4MVOA 2DFCA 1VIWB 2PHDA 1YXWA 5FK8A 1BZWA 1HB2A 1C8M2 5A32B 2EINC 4IGGA 2JG9C 2VMHA 3T2MA 1RUJ2 1SFPA 3VBUA 4XFIA 1SG3A 1LOGA 5LGUA 4CEYC 2P7TC 3AK0A 2CAVA 1JOJA 1WJZA 4JRLA 1OCOC 4LO7A 4GKXA 1WMFA 4OUEA 1LR1A 1V54B 3GJBA 5A6YA 5G05L 4L97A 4RQEA 1MS5A 1QNMA 4FLUA 4I3PA 3LOIA 5H6RA 5EXOA 2Q73A 4DR1B 3B02A 3N36A 1PM9A 1KD7A 4LO8A 1NTZH 1RUC2 3DXUA 4E2QA 1UY0A 5DEDA 2PAEA 1H2GA 3VL9A 1GV9A 1EZVH 3K77A 3ME2A 4PQ9A 4QPWA 4LEJA 1MS1A 4H55A 4IEVA 5EIBD 5IFTA 4P9XA 1JVMA 3THPA 5LK7B 1D5NA 3WNNA 2WRAA 2ZKOA 1D4M1 4GB32 5E6HA 4FM2A 3ACGA 3R4UA 3CMEV 1BZKA 4NXNO 1TE1B 1X36A 2UUAO 1LGBA 5CMUA 3OEBA 2H0BA 1OKOA 1JYXA 2WLNA 1NZCA 1KRIA 5F5QA 5FY1A 4WFGA 1TUBA 1MZEA 3LDDA 5JCOA 4YY3O 5DECA 1VEWA 2HR3A 1BMFG 5C7GA 1ZZ7A 3POGA 3WB1A 4DPNA 1R1A3 3I56V 1OSGA 5DABA 5D8AA 1QR8A 3BTZA 1AR1B 3OPWA 2DTWA 1H38A 5FDBA 3K04A 3ZMTA 3PMSA 4AGGA 3E83A 1ALYA 2QKCA 3ZYIB 1LESA 1Q5OA 1LHWA 3H1KH 3IFXA 1GP5A 5CBGA 1VJ2A 4CDUC 2BZDA 2C6SA 1H8EG 2VZRA 1WUVA 3AXDA 4EQVA 4LF5O 4AI9A 3GALA 1LOAA 2D6PA 4MXVA 1PMHX 1LU1A 1AXZA 4XXPA 3AKSA 4RQPC 3C3TA 3RI8A 2WFF2 1XQ8A 3N2KA 2VVDA 5IVYA 3J7HA 1HRV2 1Q8VA 1I5PA 1L7QA 2E7AA 4HMZA 1AR91 1HNXO 3VBOB 4ZXKA 4AVAA 4IEZA 1MQTB 3IM0A 3ZSEA 4Z8BA 1AR62 4JI7B 3S3XA 2ZDIC 3RWNA 2X09A 2VUJA 1H4GA 3FZ3A 1W6PA 4IV1B 2F43G 1T6BX 4P5HA 3VBBA 1KQRA 3ZPOA 3VBFA 1ENXA 3J7NA 2WC2A 4FSJA 2HWE3 4AGVA 3O1RA 1NKDA 2YXYA 4YVSC 3ABLB 1OA2A 1BK1A 2X05A 3N2GB 4UVCA 5EZWA 4QDSA 3CE2A 4MW3A 1AL23 1JHJA 5A3TA 4Y33A 4YM0A 4KU8A 1E57A 4CXWA 1L7LA 3KV5A 4PI2A 3ABTA 1JOPA 5B2GB 5CAZA 2WABA 2IXHA 1FAYA 5FY5A 4P9GA 4AI2A 1PK6C 4WF9V 3I3DA 2BERA 1STMA 1EYBA 2Q30A 2F93B 2UXXA 1HNZO 2D7FA 3JARB 4W65A 3RJ2X 3TJTA 1RUD2 5F2WA 3DGTA 4JDOA 4PDLA 5ACA2 1U5YA 5BNOB 2RDRA 1JQ0A 1FI2A 4UB8Z 4XMAA 4YLZA 5BNPB 5KX5B 1US3A 4MGKE 1XC6A 3THTA 3PHMA 2A7AA 1H4HA 4BIOA 2PUSA 3O7OA 1OD5A 1LECA 2DQ0A 3HWJA 2P4KA 4I9WA 2DF7A 1QBZA 1AR72 2UWBA 2WNOA 3AG4B 1BBT2 1W6MA 4MHRA 3VHOA 2W52A 4PV1B 2WNVB 4LFBO 4LO4B 3IIAA 2HWB2 4SBVA 1RTVA 3CX5F 4CDWC 1AHSA 1I3HA 4QDRA 5SV8A 3HKEA 2QTSA 2D44A 2YGMA 4AG4A 3AKRA 3SMHA 3V64A 1N34B 4Q4W3 4J1XA 3ZHTA 5FY4A 4FOWA 2B5UA 1WN7A 4GKJO 4LK7A 1J95A 4RS5C 4UCTA 5IT6A 4XF3A 3I59B 2ILMA 4LBEC 4JRAA 1DHKB 5LW9A 1AJKA 2P4EA 5L3DA 4UW4A 5JVDB 2GU9A 5FWJA 1R091 2Y4TA 1AROP 1TUEB 2OUHA 1Q8SA 4AE2A 2ZIOA 1NCRA 1SQFA 1B04A 4BIZA 1VF7A 4F7ZA 3CD6V 4CDQB 4HFSA 2WWJA 1SBDA 2PHLA 3KLSA 5FZ8A 3WFVA 5CISA 2A06H 3NAPB 5CIRA 3OUIA 1PIV2 3T1YO 2FDHA 2BNOA 5BV6A 1H8TB 3MEPA 4YFZA 1RUC3 1GNHA 3ZFGA 5B5EZ 5KXEA 1OURA 2HLDG 4BMBA 5B4XA 1VBB2 2BWAA 1I5XA 2JXAA 3U75A 1VARA 4Y22B 1AILA 1SRYA 4HNAB 5FPXA 1DP0A 2HWF1 3WG1A 5T5PA 1ULEA 1E5IA 1BHAA 3GBFA 1EP0A 1VBA2 1UIJA 4CEWC 5TSWA 3KT7A 2WS92 2RM23 1XREA 1D0HA 3MDPA 4DR2B 1CVNA 1MACA 3OCPA 4GAZA 3CRAA 4HZFA 1V9U2 3HBZA 4HKWA 5H9SA 1EV13 1RM1B 2FTKA 3OUFA 2W1SA 2WLQA 2WZR1 4O4IA 2W39A 4I02A 5JI7A 4XBFA 4ES9A 5K4LA 1VMJA 4JI1B 4U3JB 2WO3A 3OTOB 1QJU2 2E3CA 1HRI2 1JMKC 1HB1A 5F39A 1NS1A 2J42A 5K9YA 1W59A 2ZXWC 5LY2A 2W94A 1OLQA 4YG3A 5KHGA 3AZYA 2TBVA 2B8MA 1SKVA 3KV4A 1QU7A 1PO12 1M56B 2EIKC 3UT5A 3ZS8C 1J5EO 3DGEA 4XUOA 1RVF2 3T2TA 4DRVA 1P7GA 2UURA 2GN3A 1W05A 2ZHNA 1JZ3A 1BCXA 1IKQA 5JXGA 1HWYA 2XAGA 3ZIXA 5ITZA 3K5OA 1W2NA 1GP4A 5IYBO 2UXCB 2CDYA 4AZZA 3FX7A 1QJX1 3QO5A 3ABMB 2RMU2 1RUE3 2C1FA 4LHKA 1IS6A 2D5FA 4QM9A 4BQ3A 2EBOA 2AH2A 4MADA 2X5IA 2FMYA 1W3XA 2WAOA 5ABJC 2N74A 2PELA 4IEYA 1RMU2 5LEKA 3FX3A 1PMJX 4CS4A 2WKKA 3ZMNA 1NR1A 2YI9A 1NJIW 4XDQA 1RJ7A 3ZXAC 4LKFA 1HRV3 3ON7A 3E8BA 4DV6B 4H13B 2Q8OA 3BIEA 3E8GA 3K2OA 1Y4WA 3LWCA 2K1EA 4Q0PA 2N05A 1WLEA 5FZMA 3ZJZA 1YC61 2FDGA 2FQPA 1YFWA 2VTFA 2OQ6A 4QPIC 1AYM1 1RUI3 4YVWB 1ZA7A 4COZA 1M06G 3MAQA 4BQ2A 1KU9A 1BHGA 4G3YC 3DUIA 1LTEA 5L19A 2OIGA 3ILFA 3L71H 2BPA2 4HBNA 1QJY2 4XBLA 5CA1A 1VRH1 3ZHVA 1ENQA 1WLTA 1F8VA 3L2HA 1N0NA 4FFGA 3FAVA 1ND3B 4MSWC 3WF1A 3W7WA 1XYPA 4GULA 5F3EA 3VDAA 3VQWA 4W4ZA 2B4KA 3RSJA 3HEIA 3JATB 2GC0A 3AYEA 3LIHA 2CTVA 3FHIB 3CCMV 2XLAA 2XBO1 4PIXA 2P4VA 5IVVA 1JYTA 2VTXA 3WUCA 1ENRA 1XNKA 1X7NA 5IYYA 3WX5A 1RUD3 4NE9A 1TMF1 2DVBA 1S76D 1RINA 3B8NA 1W2TA 2XLFA 4AXOA 1V70A 2JWPA 5IVFA 1ZBE3 3POJA 1XHZA 1VRBA 3Q4HB 3H1YA 2WBKA 2NNUA 3BABA 2ET1A 4XXAA 5FYIA 5F3CA 4I09A 3POWA 4P2ZA 2OCCB 3HMYA 1PO22 2R073 1A8MA 5IJ0B 1AR73 4DXWA 5FXXA 4XJAA 2PLV3 4NR1A 4B7KA 2B9UA 1YFUA 1AJQA 2RS52 1G4YB 4XF0A 4Q0VA 4WBNA 1FFXB 1LNQA 1QJU1 1I9RA 2WLKA 4TSFG 3FWEA 3AG7A 3N9LA 2PHWA 1D2SA 4I7ZB 5B1AB 1WA8B 3W5MA 1HJGA 4LBQA 1KP2A 4R52A 5FPUA 1RUH1 1Z78A 2JDUA 4JTNA 4MVSA 5K0UC 2VZSA 2X6CA 1W9FA 2O0OA 2KG7A 5KUKA 2DYRC 2IVIB 1J3RA 3PVOA 4CH5A 5LP6C 3M3EA 2HKOA 3AJYA 3F7YC 2D6LX 1BCCH 2BV4A 1GR3A 3OMNB 1DGWA 1NYWA 3I3MA 1DBNA 2YXLA 4NIIA 5FZ3A 1GZCA 5GZEA 4JDMA 4RFT0 2RNBA 1CJPA 1OMIA 2FBEA 3BOWA 5EIBC 1GYKA 2G1MA 1W2BU 2GUZB 4DR5B 5FMOL 2K9PA 4D94A 2GSMB 4QPYA 3CWBH 2C24A 1OQ1A 2JDAA 4ES8A 1AI6A 3RZGA 4HOOA 4XFGA 4PLMA 3E35A 2P3KA 4D6QA 3H1IH 4DV3O 1QR9A 2CGOA 3RZHA 5CBFA 4DV7B 2EALA 4KUMA 5IY5B 1KUQA 5I0DA 1B35B 4QIWF 4Q4Y2 5JLVA 2OXBA 3FC0A 1BMV1 2Q8VA 1IG3A 2XXZA 1RXFA 1COWG 5J1XA 2WS93 1UOJA 1Z5VA 3KVAA 5EV7A 3K3OA 3SYCA 3N9QA 3KWVA 1GN6A 3KV9A 4Q29A 4UF0A 1CAXB 3ZHSA 5FZDA 2NQYA 1NY71 1HRI3 3OGVA 1YFXA 4IGPA 3CJIA 3D0JA 2ADDA 2AEYA 5CVRA 2GH8A 2XVKA 3RMXA 3JAKB 3MZHA 3SYQA 2ZE8A 5AC92 4RD7A 5C5UA 5LBBA 5DUXA 4FPEA 2O8OA 2BBVA 1V6NA 3ZX7A 2HWC1 4IQPA 4JKMA 4PDWA 3RWRD 5B1BC 1U97A 3USSA 3VV1A 1UY2A 4DUWA 4YJ2A 4WCEV 4P9JA 3M2MA 2XLGA 1YITV 1CEZA 3WDXA 1UPGA 4ET7A 3UM7A 1TME2 3JASA 3QO7A 4PCRA 4AFCA 3U1XA 2ES3A 4CXYA 2EICA 4RGAA 2RR13 4TT3G 4Q8KA 4Q27A 5EYXA 4ZKTB 4KWJA 2CWSA 4I4TB 1YJWV 2PYLA 1YZBA 2NMOA 1GQHA 5HCFA 1ACCA 2IUWA 2YZ4A 3H1WA 4JQTA 3PUAA 3TOJA 1FXKB 1Y6XA 4HKOA 3VBSC 4CRQA 2A7WA 2MEV2 5T5OA 1DGLA 4L87A 3V0BA 1DF4A 1ZZ8A 3MUZ1 1OCCB 2CSGA 1L0LH 2MHFA 4FOVA 3CCRV 4CDXC 1SPPB 3SH3A 3OD0A 4YW1A 4AI8A 3PURA 2HJFC 2QQOA 4EB6A 1H0BA 2QCSB 5KBFA 3WW2A 2JS3A 1EY2A 3QG5A 1YJNV 4XQ4A 3HN3A 2Q0AA 1E79G 4X1KA 1GZWB 5LBCA 1GN2A 1HQLA 3C7EA 1C1LA 1YF2A 3E6DA 2BTQA 1K4CC 2G4IA 4I50A 4D6RA 1W8HA 4IV3C 2ZX0A 3EO6A 4O2AB 3N35A 3URFA 5A3PA 3ROUA 2QDOA 4JYCA 4V2WA 1R1A1 3L74H 4AQ2A 1RUF1 1GUIA 3BY6A 2GC2A 4JGYC 2HJIA 4LLOA 4HT1T 1OFNA 1PVC3 4GX0A 4WFAV 1OLRA 5BPXA 4MOAA 1FFTB 4NXNB 3AFKA 3UJOA 3M1HA 4AI0A 2UUAB 4X1IB 5C4WC 1W0KG 1JZ7A 3H8RA 1XYOA 4MVMA 2QTOA 2JKXA 2Y64A 4MW8A 3G67A 4GWNA 2XHKA 1NCQA 3BYWA 1K9MW 4YY3B 2OWOA 3ZPYA 1QLNA 4HAMA 2G9FA 4QE9A 5L7OC 1SQXH 1LOFC 1F4HA 5DG1A 1ZZCA 5L3GA 4E9KA 3K9SA 3QCWA 5BZBA 3E22A 1KFUL 1MS0A 1MNGA 4OZXA 2RS53 1ODNA 2BWCA 1SMVA 1F5FA 4I0AA 1BJQA 2IU3A 2Q7GA 5FZ7A 4ATEA 5FO9B 1BK0A 3A2FA 1UQXA 1JZ4A 3HD8B 2FCVA 2PQSA 1OA4A 4XQDA 4XFBA 3B00A 5CA3A 4LF5B 2HWE1 3AG3C 1JHNA 1KB9F 1EUTA 5FUPA 3ZIAG 2W08A 4XDKA 2P2KA 3POFA 4X62O 5JR2A 4J10A 5EFUA 4AVCA 4NPRA 2B1GA 5EQUA 4QGMA 4C0HA 3MIFA 2VZVA 3AYDA 1XNBA 2DVAA 4E8CA 2Y69C 2Y6HA 5BNNC 2YGLA 1HNXB 1EN6A 1K42A 2IXCA 5JCTA 2V5YA 5EJ1B 4BW9A 4I0XB 1OCZB 4HK8A 2G19A 4RHV2 4J41A 4HXCA 1Q6HA 3I2DA 3PJQA 3PUSA 5CFCA 4R8CA 3P3PA 1TVGA 1Q8OA 1ZRDA 1N3PA 3UGGA 4D6TH 2R043 2N7GA 2UUBO 5C8CA 4A7YA 4DFSA 5LXTA 4UFKA 3AK3A 3TK1A 5I0RA 1VF6C 3RYPA 1E5SA 4FPHA 3K08A 3JZVA 1ASJ2 4COUA 1LCLA 1LHUA 2QQIA 4LMFA 3I2IA 1K5SA 1QDCA 2R9RB 5A32A 3B94A 3L75H 2SLIA 1KJRA 4GALA 4XJWA 4CDUA 1FD9A 2XT9A 4DV1O 3ZRSA 3BN6A 3I2KA 5FMOS 1NG0A 1Y66A 5L3FA 1EPWA 4RN5A 3F5TA 2ZNJA 3M7MX 1HNZB 3S6PA 1JU3A 1W8UA 2AHZA 2ERFA 2QWQB 3C3SA 4H7MA 4ZOLA 5FYBA 3J9SA 3IT8A 3K3WA 4CYDA 4RO2A 1Y3TA 3A0KA 2VQEO 2WZEA 4K21A 2DWEC 4Q4W1 2FKXA 2PFWA 4GZ9A 1GMGA 4JV5O 4H33A 1NH2D 1AJOA 3PDQA 3PUQA 2W1WA 3WW3A 4C7UA 5LA1A 2ZDIA 3JD4A 4LKEA 1BVP1 1SERA 1CONA 3E5QA 1QF3A 4QGPA 3U37A 2WZ8A 2C9AA 5F37A 1GFF2 5D5PA 5IAVA 2WA3A 4LFBB 3VBRB 2RDQA 2YFZA 2K46A 3FFQA 3CMAV 4L2NA 2GP3A 5ANQA 1LKNA 2VMCA 1MEC2 1OOPB 3SC7X 4B3SO 1IGOA 5J2TB 2L35A 2DYCA 4JZGA 4ITCA 2N04A 3ES1A 3I54A 4HN0A 5A1AA 1M1KW 5GLTA 2GTAA 3GZEA 2CGNA 5CKMA 4GKJB 3ZN0A 3RN4A 1TG7A 4JI2B 3GNEA 4ZXEA 4E2GA 4L8QA 3RS6A 4Q2FA 1C5HA 5J9PC 2D98A 2GP5A 1QNYA 1U5ZA 1GOGA 4DXRA 4AQYO 4ZS3A 2YMZA 5A3MA 5EK0A 5DAWA 4WVZA 3DPRC 1A3KA 3HNYM 4FPJA 2QZ2A 4YPJA 3LDKA 2V4DA 4XJ9A 4MTGA 1RITA 2O8QA 3I2HA 2WO7A 2ZGNA 1URFA 3WCRA 4CU9A 1HQNA 3KT4A 5KXBA 4FFIA 3T1YB 5CN0A 3ZYPA 2A3QA 2RM21 4NHYA 1W0NA 1R1ZA 3AMMA 1NE4A 5C3QA 3OTFA 2RVAA 5FP7A 1LULA 1EV11 4B4RA 4PF1A 4H14A 1DGRN 1NXD1 3B01A 1UYYA 1ULOA 2C2AA 2QSAA 1BQPA 1H6XA 1XILA 4QNHB 3TNQA 1W8ZA 4B7EA 4J7KA 4OFGA 3HB3B 3K3NA 1H2KA 1DQ1A 3RYHA 4WM8C 4M3CF 4FAGA 3MIEA 2A79B 1GANA 1RHI2 3CYOA 3VBOC 4KQ7A 4JGZB 2UWAA 1DQ6A 4IEOA 4RS5A 3ALQA 3SYAA 4ZU5A 1MQTC 2K2SA 4Q4X3 2ATKC 4IV1A 5I91A 4OUMA 2B7YA 4AVBA 2MNGA 4J9ZB 5C3SA 3X29B 4ZS2A 1SZXA 1KJLA 2R70A 2UWCA 5EYPB 2BSKB 3ATGA 2DVFA 3N2GA 2Q1FA 1ZX5A 4CCDA 4G28B 3KQ4B 1RUE1 5FLXN 1XBLA 3KCCA 2WYSA 1VB4A 1SQBH 4B08A 2QA4V 4PA9A 2E33A 1RUOA 4UXAA 4I55B 1R083 4BHPA 4OI2A 1OH4A 4UI9L 3WQ7A 1SQQH 4WZCA 1J5EB 2ZIMA 3L70H 3MHHC 3SXWA 1QQP3 5A6QA 3OOXA 5LBFA 1RPRA 2P6CA 1V6KA 2BGPA 4R50A 1AR83 1O3QA 4LXLA 1SLLA 1RUI1 2YC0A 3ZMUA 1K73W 4KI5M 2X6AA 3JARA 5H9CA 2UXBO 3WZ1A 2QWPB 3ZN1A 5EZYA 5BNOA 3K48A 4R9BA 2R72A 2RJ2A 4FJCC 3PVNA 3MD0A 4DS0A 2QM4A 4HANA 5KHJA 5BNPA 2NMNA 2Y38A 4RSUA 5KX5A 5F8PA 3DYMA 1QH7A 4IYIA 2J1TA 1H1IA 2BU9A 2LO1A 4UWDA 3ZVXA 3LAGA 1A78A 1J84A 1X9TA 2AZ2A 1YNAA 3GJAA 4EKWA 3OEHG 2ITCC 3OBAA 4TXWA 5G04L 1YDXA 2GDFA 4RHV3 4WVWA 5B1OA 1J3QA 4XBNA 4E4HA 5LB6A 2E53A 3WP6A 5T3NA 1DYPA 2WNVA 2G9ZA 5BR8O 3MW4A 2XHNA 1QKQA 3HKDA 3L9JT 2GALA 4BQYA 3ZCCA 3H8UA 4XCBA 4AVTA 1O6UA 3O5SA 1ZBE1 4A7ZA 2XWBB 4ATFA 1W6QB 4HPKA 4LIUA 1XQNA 4PIYA 3AP7A 1RXGA 3CCLV 3L9DA 4OXSA 1OCRB 5LHIA 1REDA 5A7PA 4QXKA 3QVNA 1D4VB 4AWDA 1SLBA 2R071 1ZSPA 4ARYA 1HV1A 4OPAA 2DU1A 2PLV1 2BGOA 4GKYA 4CCNA 5FO8B 4OGQB 4XAAA 4FFKA 2DE0X 1GLHA 2QDRA 4CDQC 4Y1YA 2AEZA 3NAPA 2JVDA 1ZRRA 1PL4A 3O1MA 2BOIA 3IDAA 1H8TC 4BK4A 1ODMA 1S4CA 2ZA9A 5FZIA 4EFBA 3AKTA 1AR5A 4LLFA 2ZQMA 4OMDA 5C3OA 3N2KB 1S5HC 2IBZH 4BR6A 1F51A 3KZIZ 4Y22A 5E88A 4HNAA 4N53B 2X6BA 1LOCA 2QM8A 4JVAA 1P7BA 1GN4A 2JDMA 4A4AA 2Q69A 3SPIA 4FQ4A 4LHLA 4M01A 4X65O 3MIBA 3EMRA 4JI8O 4LE3A 3DC6A 5AFBA 1V6MA 1VBD2 1KXGA 2DBNA 4PA4A 3ZFEC 2ETNA 3D82A 3D36C 3TXQA 1CQ9A 1IXBA 1W6PB 3WDTA 1RB8G 5EBMC 3AZZA 4NO4A 3BAAA 4QKDA 3CMGA 2QVSB 3DCQA 1R3IC 1QOTA 4GWIA 3N9MA 2AGAA 3WB2A 2Y8KA 1Q43A 2HKXA 5KUMA 4DO0A 3D6EA 2ZMLA 3M3IA 1UWWA 2DW4A 2OS2A 3LA3A 2Q68A 3SCGA 1JH5A 5KMGB 3RMYA 4JI3B 1W90A 2FDKA 1YQCA 3C7OA 1CAVA 5A7WA 1XE8A 4XJUA 4BXSV 3NMBA 2VOXA 5FP3A 2VE1A 2E7TA 5FL7G 2QEXV 4GJYA 1H9WA 5IUQA 5HCBA 3NR7A 4MZUA 3ZFFC 3KGLA 4DW1A 3AMPA 2UUCO 4DR3O 4DV3B 2R32A 4R6ZA 2BW8A 3VZKA 2DN9A 5DUVA 3ZXFA 4TLGA 2JDYA 3K57A 3WG7C 1G7YA 3TETA 4BWOA 2LM3A 2EA7A 1BHBA 3B3QE 3IBMA 4XEZA 1UNBA 4BK5A 1QVGU 3GBWA 1WCDJ 1W6MB 4LH7A 1NQJA 4XFFA 3T1LA 1C4RA 5DAXA 4YVWA 3WINE 2XASA 3WUDA 4X20A 5JPNB 3MUY1 4NROA 3NJYA 4BQ5A 1VP7A 2JDNA 5CB4B 1K5JA 5LMNO 1F23A 1S0JA 4ZHQA 3LD8A 2XB6C 1RL3A 4C91A 3EQEA 2RR11 3QLQA 1MZFA 3VBHC 2IXLA 2F4PA 2VQAA 3NKGA 3EFFK 3N9NA 3WP4A 1ND3A 4IGOA 1H8HG 1IS3A 1WKYA 2C5DA 1N4CA 4N21A 4QX2A 1XJAA 3JATA 4BH9A 2NR5A 2QM7A 4XUNA 4XIKA 3E89A 4U3FH 3O0VA 3P1IA 3DV8A 3ZX6A 1H2MA 1XEQA 3FMGA 2P22C 4INDA 1GWKA 3LIGA 3R6SA 4M4RA 4W8JA 5EHDA 2LP7A 2XAHA 2ORXA 2OTJV 5FMCA 2JB8A 4RYDA 2JK5C 2DWDC 1SETA 1GKFA 3ZR5A 2D43A 3OPZA 3WQ0A 4RUEA 2OKXA 1FNYA 1TNFA 1E1QG 4NJ4A 4E2LA 1VQNV 3ZFGB 1IPKA 3F5WC 3OMAB 5IJ0A 1Y74A 1ZX3A 1X8EA 2VNVA 1LJ7A 2ZGMA 1PNMA 1EN5A 2P6HA 5AG2A 2RMKB 4NTYA 2JDIG 3M8LA 2NZ9A 2YPJA 5FJHA 3OR7C 2YUAA 5H9RA 1PVC1 3LSEA 5F6LB 5FXVA 1GOFA 1HB3A 4K8ZA 1WA8A 2A3XA 4MHUA 4HONA 2E75B 1HQWA 3W59A 3HQXA 4GH4C 4J9YB 2JECA 4LF8O 4EV0A 4B29A 3RWKX 3DYPA 4Z1MG 5IVBA 3ABKC 4J42A 2VW0A 4FLWA 3UO2A 4ZU4A 3ZXLA 2R16A 1WMDA 5IT9N 1ZLZA 1VBE1 4P9YA 3UT5B 1N1VA 4FFHA 1JN2P 2JG8C 1J83A 2Q8CA 3ZXKA 2A6ZA 4E4EA 4CCKA 1AP5A 4S2DA 2ZPXA 2GUZA 3QOPA 3UESA 2WN3A 2H3OA 1CZTA 2CUGA 4N43C 2A6WA 1WB8A 1OVSA 2L9LA 1LOEA 1JYIA 4LF6O 3JD3A 3LB9A 4FPFA 4BE3A 1H2LA 5F5AA 1YO8A 4XF4A 3WCSA 2HG5C 2UU8A 2VXJA 5HV0A 4DR4O 3AG1B 1IVSA 1B35A 1K5MC 1W28A 4YG0A 1FOD1 2W95A 3APBA 1QHTA 1BGYH 1TQ5A 4EN0A 4CUBA 3RNSA 1CESA 3KZ4C 3IAYA 3CZUA 3DEMA 4R4XA 2ZKLA 5T5LA 4DMIA 2MW2B 2R041 3OG2A 3M3OA 1XDCA 2P3YA 4X1YB 2C26A 5A6ZA 2UYAA 5JVVA 3HR9A 4YW2A 2D2CB 1O4YA 3X2QC 2Q7EA 2EX3A 4CUAA 4X62B 5C5TA 3CJHA 4NRMA 3FN9A 4N9IA 2EXJA 2P1BA 1HB4A 4HLTA 3FAVB 3WVJA 4K0KO 3TN92 4NVPA 5C4WA 1XI1A 3LEMA 1BSMA 5K1PA 4AOCA 4UW6A 5LZ6A 2JE7A 2XVLA 2VZOA 4X8AA 4LNUB 3NO8A 5CFDA 1CXZB 1PGW2 5FKBA 3H7YA 2UUBB 3UYJA 2QKSA 4XFCA 1AJPA 2EILB 3VHRA 3JUUA 3GGLA 2VC9A 5C8YA 1XPWA 1IS5A 2OVUA 3UKNA 1JPXA 3DN7A 1SCSA 1ZRFA 4I4TA 1W06A 4IESA 4QQ2A 2XWJB 2GC1A 4XILA 4L92A 2W91A 3VZNA 3ML0A 3JCUZ 4LE4A 5JSPA 2BP6A 3T1HO 1SDWA 4K6BA 2ZGOA 5HXVA 1FXKC 4DV1B 5LHHA 1S2KA 5C9AA 3T3YA 1GKBA 3M7AA 2CTQA 3VQXA 3MO4A 3KG2A 3FLRA 1KKCA 2AZ5A 4ZIBA 1XXNA 5BUVA 4EZHA 4FP3A 1S0GA 1W0PA 3CO2A 4CH6A 4PHZA 4LITA 2EIEA 4QXCA 3HAGA 1WCSA 4JI5O 2Y48A 3ZOIA 2VQEB 5C8WA 3UK9A 3RVYA 1KS5A 3ST7A 1SEFA 2VBPA 3AG2C 1V00A 5A7SA 3CCUV 4LF4O 5FAXA 4JV5B 3T1CA 4YXWG 1DQ0A 3VDDB 3O1OA 1QQCA 4Q6GA 2OQ7A 4LK6A 5HXMA 5LRRA 2RQ6A 1ZNPA 3AZXA 4O2AA 4QPGB 3G6EV 3OE7G 2K0GA 5H9QA 5APAA 3KV6A 2VUDA 4DXSA 4YZ4A 1COV3 1GRJA 1FPN2 2W1UA 4QT6A 1S1AA 2XVGA 4FI9A 4B3SB 4JHTA 2BRTA 3T0DA 1CWPA 5BY5A 5C33A 2AYHA 1AYN2 4M00A 3JD73 3N4MA 1CPYA 3J7LA 1GH6A 4AF9A 1NI8A 4U36A 4NPMA 4DRXB 2VY0A 2FYUH 5JZGA 3FL7A 3DTUB 1WW6A 1YTFB 1F2NA 2V72A 4QU2A 4AQYB 4JYAO 4CUCA 2EAKA 2VOVA 2HEYF 1KYOF 2AHYA 1CGPA 1OT5A 4ARXA 4QQLA 3TRSB 2XONA 4UFLA 3ZXDA 1PX4A 3KHBA 1VAKA 3VHNA 2CDPA 3R0RA 1N36O 5LMUO 1ND2C 4Q4X1 4CU8A 5LA9A 2Y6JA 2GTSA 4DEVA 5HPOA 3MFAA 4LBKA 3AK1A 4LHSA 2GSYA 5BMVB 3MPPG 1CPMA 2YBPA 3HPNA 1GWLA 3OEAA 1RJ8A 5FYHA 2IFWA 4O61A 2DUQA 3PJYA 2ZGTA 2DVDA 2YIAA 4YW7A 1MA1A 3ZO0B 2QZ3A 3ASNC 3CJIB 2H6CA 1R081 3K59A 5TISZ 1A32A 3WW4A 2DCJA 5AVPA 5LBQA 3OGIB 4UCRA 5HCHA 3BPSA 4I0XA 1QQP1 2RS32 1VP6A 2QE3A 1OH3A 1OCZC 2PGGA 1K4DC 4Y5Z0 1AR81 4PDWB 1X4TA 5B3SB 4BISA 2FB5A 1DZTA 5EJZB 2OUJA 4WM7C 2JS5A 2FDFA 3IB3A 1X59A 3FLTA 2V09A 2XJUA 1YXBA 4QMAA 2VZQA 3OR6C 4ASMB 4X66O 1S5LZ 1RUG3 2VJXA 4P9IA 3E6CC 5KXCA 1DZQA 1WA4A 3VKOA 2I45A 2GNBA 3NV1A 5FNVB 3VUOA 1EAH3 3SYOA 1C3HA 2NN4A 1UKRA 2R063 2VOWA 2Y33A 3D0SA 2ZCEA 1JZ2A 5FY7A 1ZBA2 4DV4O 1YLLA 3J81N 4HK9A 4LULA 1FPOA 3CP1A 1XE0A 4KBBA 1G9BA 5IYDO 3G71V 4KP4A 2UXBB 2JENA 1KP3A 4B1LA 4NIHA 4HL0A 3L72H 4EB6B 1UMIA 3HBKA 1XSQA 1CD3G 1UCXA 4UV8A 2GNTA 4RUFA 5I0UA 4JTAB 1P84F 2WSVA 3GYDA 4PBPA 3ILRA 2HYXA 1P49A 3I5DA 4FLVA 1FMD1 3DF0A 2BTQB 3JBG3 1JR9A 1TVKB 3CXHF 4QPKA 3BIWE 3I3QA 5DZGA 3KB5A 3ZR6A 3TAYA 3ZLIA 1SQVH 5BR8B 1HXS3 3ZSMA 5FUIA 5J98B 1GZ9A 4GKKB 1OOPA 4DW0A 3CEIA 1AL0G 2P67A 5J2TA 2E7QA 1XNCA 5FREA 1XBFA 1UZVA 3IWZA 4YWAA 2H6BA 4W4KA 1IOAA 1JA8A 3RYCA 1LEMA 5FP9A 1MMMA 2QQPA 2XUMA 5JJJB 1CN1A 2A3YA 2TEPA 1VQ6V 1ZZ6A 4LFCO 4RR3C 2OYZA 4CEYB 2DYSC 4Z2AA 3AMQA 4NHMA 2B5HA 4UVAA 4GT1A 5D2AA 1D4M2 2VTXJ 3SNMA 1OCOB 3E22B 1I1EA 1FNZA 5I0TA 3GM8A 5DAVA 3QO8A 2CE4A 3NKTA 2DWRA 3H8OA 3NNJA 1YQ5A 3S57A 5DDJ3 1U5IA 3WDWA 2VCMA 4DEQA 3KF3A 3BGAA 3SCFA 4PQQA 4IL6Z 1IKPA 2F95B 4UCVA 5J3UA 2VCAA 4UYBA 1OD3A 2BQPA 4ASLA 1WD4A 2R49A 1VQLV 1HDJA 2D3OW 4EN6B 5FXZA 1WD3A 3K5MA 1JYCA 4X8PA 3JSLA 1AXKA 1RFYA 5FFOC 1FPN3 3OW2U 4JI8B 1AXYA 4YIOA 5EWSA 4JGZC 3EVKA 5KR7A 5I93A 1JYVA 4CE8A 2RE9A 4QPJA 4DOUA 4TWTA 1D5AA 3AZWA 5K1XA 4AW7A 1VAMA 2LW7A 2WNUC 1TNRA 5C6CA 2CTWA 2BSKA 4U7OA 2W1QA 2CYFA 1R6TA 2LALA 2XKPA 2Y60A 5LXTB 1AR92 4IE6A 2YU2A 3LE0A 3WDUA 4I55A 3D3AA 2ZINA 1V6IA 1WB7A 4QXBA 3J8F3 4NIGA 2YI8A 3K46A 1JFFA 4HETA 4QM8A 2CH7B 3GCXA 4CDUB 5C93A 3MFCA 1BS3A 3S5QA 1D7PM 3ZRXA 5GZFA 4DR6O 5KC6A 2A70A 1SCRA 3VBUC 2ZX1A 1UY1A 3LFIA 2A1XA 4ZOLB 3NL1A 1SQPH 4RQPB 4LBQD 1WLCA 2VH9A 5LHGA 3PLQA 1BEV3 3B2EE 4K3UA 2L6LA 4AHXA 1PNKA 2UUCB 5LCWL 4DR3B 1MVQA 1YWKA 2Q5ZA 3V56A 5JXHA 2OA2A 3O1PA 2ARBA 2ZGQA 3QNEA 1AJNA 2R1BA 3B09A 3ETQA 4CPBA 4Y1VA 2VCCA 2P6JA 4WV8A 2BNMA 5T5JA 3BOPA 4AEKA 3IDEA 4UCOA 3EB7A 2PF4E 5JSRA 1UPSA 2E76B 2GC3A 3SJBC 5FTTC 1QVFU 4QQOA 1HJFA 2HWD3 2DUPA 1QXRA 5LMNB 5A3LA 2OYQA 1YTFD 2QGNA 1LRHA 3IMNA 2Q8DA 2G38A 1W6QA 3RYIA 2P06A 3I8TA 1I0HA 3ZN6A 3CPWU 4AR2A 2FL4A 1OCRC 4PELA 4NRPA 2R0HA 5JCOC 2YC2A 3ZMVA 1PGL1 1JUIA 5B66Z 3OY8A 3IC9A 1F15A 3UNPA 1VAVA 4TV9A 3ACHA 4Q4V3 2EZOA 2WZPP 5D8AC 1QJEA 5IWFA 5FY0A 3CJXA 4M3CA 4JTOA 1WCKA 4LFAO 4QKNA 2JD9A 3ZDVA 4YW4A 2NPIA 2IXIA 3LDCA 4OX9O 2CTRA 2D3RA 3ZBHA 4DNYA 4L0PA 1MABG 3SQOA 1XNDA 1FT9A 4I3GA 3AVRA 3VHPA 1R092 1JOBA 3AL5A 4OI4A 2BOCC 1QOOA 3MGUA 3HKBA 1PV0A 5FYYA 3IPVA 2WINB 2PYTA 4CDWB 1XNQO 4JI4O 5B1NA 3WG4A 4N53A 1VPHA 3KMHA 3RYHB 2WLPA 4X88A 2YEVB 4A6SA 3ZYRA 3WF0A 5JDBA 3BVOA 2JD4A 4PI0A 4FM0A 2GH2A 4RS5B 2VWJA 4PA6A 2E31A 2CK3G 3PTRB 3KD4A 4IHJB 2JE9A 2OIEA 2WT1A 4Y24A 5FZLA 1WMEA 3VBFC 3VD7A 4OLLA 2GN7A 4LF8B 5LL6Y 4IIJA 3ETGA 4YARA 3RZLA 5FPLA 4MTXA 2HWF2 1IS4A 3WQBA 1PZ7A 4EE2A 2D97A 1D4M3 4I5SA 3E8HA 4C0BA 2G9GA 1Y67A 2WWWA 1K34A 3FE5A 3W7SA 4QB1A 4WZFA 1HIXA 1VQ5V 1UKGA 1RSOA 4F83A 3SYPA 5FZGA 5IW0A 3TEYA 5KMGA 2JIGA 1HV0A 3CHXA 2WZR2 2W68A 3F2ZA 4I0WB 5D21A 4DV2O 1BYHA 3NV2A 4DV5O 1AI4A 4BWAA 2DUOA 2W0XA 2HBUA 4EROA 4OZOA 4GMP1 5EZYB 3MW3A 3QH7A 4FLTA 1DGRA 3QACA 2Z5UA 1KS4A 2QJVA 4URAA 4QX8A 4LF6B 1POV1 2RS13 4OCTA 5GZCA 4YJ3A 4DR4B 1VBC3 2XJTA 4DYLA 1RYYA 1OXCA 5L73A 4CEWB 1OF4A 1NZIA 4B8EA 4DXZA 4BXFA 1L0NH 3T30A 4D8MA 1QJX2 2BJSA 4A45A 5J36A 5D1IA 1QNWA 1XSRA 4A6OA 3O9OA 3HKDB 2IH3C 2YS8A 2UY8A 4FPLA 4KNCA 5CB4A 1DYOA 4JCKA 1BT8A 3AB0A 2VXRA 3AVSA 3MIHA 5F5CA 3USUA 2EIKB 1AR93 3ORJA 4HPKB 3LEGA 3B77A 2H0VA 1GM9A 4JI2O 1W0OA 3ZN5A 4K0KB 1AYM2 1C8M3 4GMP0 4MVUA 2WYFA 3RYRA 3H7JA 1RUJ3 1I6XA 1POV0 3IAQA 3AFGA 1NCRC 2PHRA 3ASOB 3TB0A 3U07A 5GKAC 1VRH2 1IQDC 2VWKA 2OTLV 4MX3A 1QIQA 2YXSA 5GTHZ 1W0JG 4EWEA 1EPZA 2E32A 1K5MA 3HIFA 1LHNA 1KITA 3RYFB 1ZYBA 4JI0O 1IX9A 4AFDA 1UL9A 3MV01 4UFMA 1Q8PA 3T1HB 3JB4C 4QPIB 2XBO2 4ZBMA 1B6QA 3MDSA 3ZFGC 3KQRA 4IL7A 5DAPA 1Q6UA 4NHLA 1TMF2 1UU6A 3IJ4A 3SHRA 1ULFA 1XOYA 2WLMA 2W87A 2AXTZ 4BA6A 4R9AA 1COV1 3KKYA 2LS6A 3N9OA 4GB33 2OX0A 4JI5B 3AYCA 2Z69A 3JD71 2FCTA 4XACA 1XHXA 4A3ZA 4LF4B 3CCSV 3T1MA 3H1MA 1QY4A 3GF6A 3CRRA 3KVBA 4W6YA 1QOSA 2OPKA 4X8NA 5J2UA 2JDZA 3MV11 2ZABA 3AKPA 3VD5A 3CCJV 2QQKA 2E5LO 1N0JA 3HN1A 4Y4RA 1FV2A 4XJZA 2VQ0A 4XETA 2ZM6O 2Z3YA 1W6NB 4C1WA 3B40A 1RUH2 3PN1A 1EN4A 4AHWA 4NRQA 4JPRA 1CAVB 5A7WB 5F9TA 2YPDA 5FYVA 4FO9A 5BXXA 3EJKA 1NXMA 3FD9A 1DCSA 3JD1A 2DVGA 3UV9A 3AK2A 4JYAB 3M99B 2WAMA 3CCEV 2X5IC 4CS2A 2WFF3 3BCCH 2YBKA 2PN5A 5JOWA 3AG1C 1SDDB 1W8FA 2DQ3A 2YG0A 4ZHNA 4KWUA 4AFMA 4QE7A 3UKTA 1N36B 1Z7S2 1YI2V 4LJHA 1K12A 5LMUB 2X8KA 2YU1A 1AR63 2VNGA 3PIGA 3RZMA 3RI9A 2GHYA 1B3QA 1PPJH 2DYRB 3LDEA 4X20B 5LA6A 3WB0A 3HVDA 3NSTA 2XOKG 1DIWA 1BXHA 2HFEC 4X1YA 5LP6B 3STLC 5L9BA 2BE3A 1S0BA 1UD1A 4ZHQB 1RUG1 2XL9A 4CS3A 4CXXA 1EBOA 2ZEYA 2HEWF 3WLUA 1BMV2 5FLJA 3TEXA 4DUYO 1EAH1 3B8MA 2R061 4TN7A 3A0HZ 2BFUS 4QB2A 1GMMA 3WNKA 3OGCC 3OB8A 1XNRO 4F3JA 3I3EA 2IFRA 4COWA 1PNGA 5FWEA 1WBLA 3G6BA 2O57A 5JMCA 1GICA 5IVCA 4LNUA 1W8NA 1JYNA 3AP9A 1F31A 4BPZA 1OQDA 5DXDA 4FPYA 3GXUA 1HKDA 5ACA3 1NY72 3TCUA 2LQTA 1LUWA 1UZ0A 2EILC 3KS7A 4AEDA 4X66B 1PMIA 1UX6A 3NJVA 4ISQA 4MVTA 2GAUA 5LRSA 3U78A 5JJNB 4B4PA 3JYCA 4AILC 4K35A 3RQ0A 3MF6A 2HWC2 3JBG1 3ENRA 1V0AA 4DV4B 2HHHO 1Y74B 4AFBA 3ZYFA 1BBT3 3PU3A 1PM7A 4JC1A 2HWB3 3H9AA 1HXS1 4FFBB 3LNNA 3AC0A 2PAMA 3N3HA 4KBZA 3NRUA 5JH7A 3JQWA 1JW6A 2ZOEB 3SH5A 1DG6A 1N33O 2VVEA 1W8TA 1SF9A 2R7EB 4ZKIA 4D7TA 3JD2A 4NUBA 5FZ1A 3TGUH 3MLLA 2H94A 2GZWA 3VDDA 4CCJA 4CC5A 1UAIA 3MF9A 1AYM3 5B1BB 4W6WA 3M8AA 2IJKA 1DGWX 3CL1A 1Y76B 4QPGA 4UCUA 2AENA 2VVFA 3ZXGA 2E26A 2UU9O 2Z2SB 5E16A 2PMWB 1NT0A 3B7MA 3LOBA 1YFYA 2HVJC 4XAEA 4LKSA 3CDZB 3BCWA 5DDJ1 4LF9O 1PVXA 4JI3O 1IDSA 1F4MA 3K51A 1V55C 2ZCWA 3LPGA 3CBNA 3ZXEA 1MG1A 1N32O 1PIV3 3IDBB 1Z7S1 3ACIA 3SLIA 3TEWA 4ZONA 2R9AA 4PLNA 3LDBA 2GMPA 1RPOA 3VBSB 4DRXA 1IBLO 3GZTB 2RDCA 4UT5A 4I9QA 3D8CA 4YNIA 3HQUA 2XBO3 4LFCB 4O2BA 1R1A2 4PIZA 2JEMA 1RUF2 2Q67A 2VR4A 4IEPA 2ZNIA 1VBB3 5IDJA 4CDXB 2XQXA 4JASA 3IN9A 4ICGA 3CNAA 5FPZA 3T2OA 2VG9A 3D3QA 1VQ4V 2ADPA 2JJ1G 2W6IG 4IE0A 3FHQA 1K97A 1W99A 3BB6A 3CB2A 3OGJA 1VBA3 3POIA 5EBWC 4A42A 1M9NA 1W9TA 2ZHKA 4JAUA 2QQJA 2IJHA 4Z2WA 3K5LA 1DLCA 4IV3B 5BMVA 3BTYA 1V9U3 4DXTA 2Q7HA 3RYKA 5GW7A 4BW5A 1KKDA 1CAWA 4NYKA 5FPRA 3P6BA 2R9IA 4B3RO 5LOVB 1QJU3 1CR7A 3CJHB 4JGYB 3OBTA 3CU7A 3GVMA 5DZFA 5DG2A 3CJIC 4B3TO 1NTKH 5FPOA 5L3EA 3N7KA 3J8F1 1PO13 2OT5A 1H8VA 4AGRA 3VKFC 4G4FA 4IEXA 1BE3H 5C4WB 1RVF3 2QKAA 3BU7A 1RUH3 3ZRWA 4B3MO 1S2BA 1OPOA 2HWE2 3LNMB 3N7LA 4BIFA 4AHZA 4PDWC 2EVXA 1OF3A 5CFDB 1Q81W 4RR3A 4QHBA 1BLZA 3WD5A 5L7OB 3POSA 1AX1A 2J1RA 1OUSA 2RMU3 5EP9A 2DTYA 1BEV1 5C8YB 2TUNA 1UIKA 3CEWA 2PHXA 4HG6B 1R6KA 4BB3A 4FM1A 4L9BA 1QXJA 1G8MA 1RMU3 4QHOA 1NA1A 2GV9A 4Q1RA 1K7DA 5FNVA 1O91A 3WOGA 5LA0A 3PVBB 5HV4A 1K8AW 3CXCU 5FXWA 4FTBA 4Z07A 4PA3A 5C9AB 3OM3B 4C1XA 2W5FA 5KC5A 4X64O 3LQCA 3WSOA 4DR6B 2ZTNA 4MGTA 2YIBA 1KGYA 2A75A 3AG3B 1AP6A 5DQ0A 4D3WA 1N1YA 3HT2A 1X8MA 2HWD1 1DYKA 3BVCA 4KWKA 2A6XA 3UJQA 2VBDA 4DK0A 1SZTA 3OGGA 1IHMA 4YIPA 2Y69B 2Z5WA 1QJY3 2QBXA 1Q56A 4YW6A 2V5DA 4CH4A 4X6QB 3HKCB 2BTOA 4DQAA 2X29A 1TVKA 3B9IA 2KXLA 1PNLA 4LORA 3A0BZ 3CQOA 3K4DA 4J25A 4META 2CDOA 4AHYA 2K9ZA 4BCUA 2Y6FA 4GD4A 2RCVA 2FD8A 4Q4V1 3MICA 3OAAG 4LOSA 3WNMA 4EYUA 2ETEA 4Q4W2 1HP8A 1U5XA 2VZ3A 2XHBA 1D0GA 1UXXX 4IETA 4DUZO 1JI6A 2OT7A 2Y4UA 1W04A 4FT8A 1PL0A 3DC5A 4N9HA 1SHWB 2AGSA 2GNMA 4K8RB 2P5OA 5IK8A 2JG9A 1WZXA 3M3CA 5JZGB 3CZJA 1H2SB 2KQXA 2EIBA 3M3QA 1NCQC 2HWC3 2ARHA 4YHHB 2W2IA 5C3RA 3TYJA 2BYVE 4CEYA 1PO23 3IKWA 2BCCH 5A70A 2VU9A 1NLQA 5KXDA 4YGCA 4FFFA 1Y9MA 3H0OA 2QNKA 1QH6A 1US6A 2JGDA 1K33A 4LFAB 2YYOA 3P32A 3KGZA 3IAPA 3KCXA 3B93A 2VQUA 4IEUA 4OX9B 2ZEZA 3I2GA 1XMQO 1F4AA 5L3BA 4D6SA 2FDIA 5F5IA 2F4VO 4MSVA 3W20A 2WO2A 3K79A 4LA3A 4YM2A 2FCUA 4CP0A 5LASA 1O8SA 4J11A 2JIJA 2BOBC 1XNQB 4JI4B 4MXWA 1AL21 1YIFA 3PIJA 1UXZA 2Z4FA 3MI8A 2EJRA 1WCQA 1HNWO 5LK5A 3NXSA 1LUVA 2QWNB 5EC2C 3OMIB 2EULA 1H6YA 1O8PA 2RM22 1T5EA 2MK3A 2VZTA 5CYYA 1X50A 3AX4A 5CFCC 2WAAA 5L9VA 1EV12 2OZJA 4YSFA 2Z0AA 4LWSA 4WFBV 4MS2A 1VR3A 4LBLA 1FYUA 4KU7A 5C8CC 1PP9H 1QLEC 2F23A 3GDBA 5T50A 3OFNG 3DPRB 4RAIA 1RUF3 2EIMB 1GNZA 2RS11 5HCAA 1UN1A 3CC2V 5A33A 3MBWA 3GZAA 2QJ1A 3K58A 4OYUA 2ZGKA 4CSWA 2OPWA 3A0NA 1VBC1 1NUKA 1QXPA 2HBTA 1CP9A 3GBGA 2CH7A 4QU1A 4Q4Y3 2BDRA 1THZA 1DTOA 3O0XA 1S77D 4DV2B 1RUE2 4BLJA 4DV5B 2CNAA 1REFA 4RQPA 4MGSA 2B46X 2ZMKA 1A6CA 3O1SA 1E5RA 3B69A 3D4KA 3DYOA 3VZMA 1XMOO 1V54C 4BQ1A 4WM8B 1S0VA 4OI1A 1XOUA 2P5BA 1T6GC 2A5ZA 5DAQA 1JX9A 2F1MA 2ZX2A 1QU0A 3JQXA 2ZGUA 1OJHA 2PHTA 3PVEA 4XJ8A 5FYSA 4CA9A 3EHKA 1C8M1 1JJOA 1YJLA 3THOA 4TZDA 3S30A 5AC93 1RUI2 3AYAA 4V1PA 3NNLA 4ZI7A 3H1HH 5CB7A 1RUJ1 2VMGA 4YVSA 5CADA 1IPJA 4FPPA 3N27A 4FOQA 3CLPA 1S0FA 3ETPA 4LNVA 1PZ9A 1O3SA 1TME3 5FZFA 4WFHA 5EC1C 1WBFA 1E5HA 4BQXA 3LSQA 4DR7O 1ZREA 2LGWA 2E6VA 4L11A 3RYCB 2VULA 5E79Z 1CAUB 1NAEA 4LBOA 1PK6A 5L3CA 4LIVA 2VMIA 3FB6C 3K06A 1RUC1 3FB8C 4KMQA 1ZZBA 2B42B 2Z42A 2ZR3A 5FLIA 4CH3A 5IYZA 4EFEA 4FMTA 2MEV3 4XUPA 4CCCA 2Q8EA 4QHZA 4H3WA 3JSNA 3W7TA 1QJZA 3K4ZA 5FZKA 2WJSA 3TBDA 3BFRA 3QTCA 1ZBE2 4NWWA 1ZUQA 4IUGA 4O4LA 3QD6A 3PUHA 4GB31 5H9PA 1YSCA 4KGGA 3VKLA 4BLIA 5FP8A 3RDIA 3FFZA 2VUCA 4O9GA 2EIDA 4JI0B 2R072 2XAQA 3LA7A 4LA2A 1GBGA 3ZSKA 3I97A 3D5OA 2PLV2 1FS0G 1MSDA 2JKBA 1AVBA 3J26N 1R3JC 2Y0IA 3HNMA 4CDWA 4LOTA 2J7MA 2A9HA 3R05A 4MGQA 2RG4A 4NN0A 1AUYA 2YEVA 4NTXA 4DV0O 1YI9A 3RPQA 4E4SA 1FJGO 3SEPA 1UU5A 1R3KC 3NJXA 1OFSA 1JZ5A 3UGFA 2YBSA 3UT0A 4IHJA 1I7FA 4IV1C 5K7PA 3GZUC 3W7UA 3H9VA 3T2QA 4MLOA 4ZZ5A 2CV6A 3FB5C 5JSOA 5KA5A 4Q26A 3ABLC 1GTOA 5CG8A 2NN8A 3HNBM 2WFF1 3G6JB 4RWUA 2E5LB 2VW2A 4IE5A 1MOFA 4MG2A 1HRV1 3UQ8A 4TLFA 5K8SA 2ZM6B 1JFFB 2QKDA 2OW4A 3OGSA 1O7FA 3JAWB 1WA6X 4PBOA 5F2VO 3S0MA 4NOTA 1AR61 2A71A 2A6VA 5EJ3A 5GLWA 2UXDO 2PHFA 3N9PA 2ZBJA 3TWIA 4O4JB 3K03A 2JEUA 1LHVA 5KA6A 3KSCA 2VUAA 1W9SA 4DUXA 2M7WA 5BNOC 3BEHA 4NB5A 3U14A 1HLCA 4UUJC 3FUQA 3JCIA 4HVOA 2D5HA 1Q3EA 5BNPC 1XE7A 5GM0A 2B9ZA 4FPCA 2YSUB 4XDLA 3ZFEB 4LUMA 5I8YA 3P3NA 2WLIA 4AEJA 4OMCA 4CEWA 1ZVFA 1SBFA 4XURA 3DXTA 2DJVA 4COYA 1GU3A 1SA0B 2ADEA 1IURA 2XR4A 1UX7A 3RGBA 4TQFA 3AG4C 2QDNA 3NNFA 4W50A 1SS3A 4JTCB 2WNVC 4H0LB 4UV9A 2JB4A 3SJCC 1R3LC 4MUVA 1GQGA 1RUD1 4GKKO 1MS8A 1W2OA 3H3LA 5ACA1 4MH0E 1C57A 3GWKC 1KMIZ 3EXAA 3ETEA 3IDCB 2HEVF 5GONB 2EXKA 3RYIB 1N1SA 5FR3A 1VMHA 1ASJ3 5HFMA 3ZN6B 2ZJCA 1LU2A 4DUYB 3OSDA 1UW8A 3I3BA 4CTEA 3BKZA 4OQ8A 2J1AA 4JHZA 2VOKA 3OY8B 2Y34A 4HSLA 2HP8A 1XNRB 5LYJB 1AR71 3C7HA 2B39A 1BBT1 4TV9B 4YZ2A 3UKVA 5IFPA 2H8PC 3C7FA 2W46A 3I7DA 2ZS6B 2HWB1 3ZFFB 4U2AA 4M3CB 3ASOC 4FCAA 1W39A 5ABJA 2RR12 1C5IA 4XTMA 3QBQA 4YW5A 5KHHA 4LHNA 3ZRVA 3ZIWA 4AYUA 4Z92B 3LF7A 1UU4A 1XNAA 3WG7B 3NAPC 4A44A 1BVVA 5L9RA 2W9XA 2ZACA 5J96B 2QTWB 1K45A 3IZOA 3A21A 3RYFA 1B06A 3MW2A 3VB9A 2CY6A 2FMLA 1I94O 5FY9A 4QPIA 1LGCA 3HKBB 1APNA 3PL0A 1XRUA 1X33A 3J4UH 2VECA 5FZHA 2HHHB 3IPVB 5FZ6A 4K9SA 4A5UB 2WL1A 3OPTA 1LEDA 3SR2C 3VL8A 4OQ9A 5FZEA 1HW5A 4Y5SA 3PUIA 2RV9A 4FAHA 5BNQA 3ZMZA 3E97A 1SQGA 3EYPA 1O59A 4LR4A 2ZMNA 5DMYA 1UY3A 1MEC3 2ZZJA 3ASIA 3VBHB 4CC6A 5IJ9A 1ZL8B 1DF0A 1N33B 4R9CA 4HN1A 2WN2A 3UL2A 3CRMA 1PIV1 1F5JA 4UW5A 3O14A 4A2UA 4O65A 2X53S 1VALA 2VL4A 5JQGA 1L7RA 3SEEA 1YJ9V 1WNSA 1EZJA 2PY5A 1X9PA 1AI5A 1RM1C 3AP6A 4IIJB 3ACFA 5FZ9A 4Y20B 1VBB1 1PVC2 2UU9B 2ZXQA 2J22A 1M56C 3O1TA 3K75B 3K4AA 2BUKA 1W6NA 2P37A 1FX5A 4OHZA 1RSOB 3FHAA 3OJBA 5LEJA 2E9QA 4LF9B 3O65A 1UZYA 1Y43B 1VBA1 5FZCA 1N32B 3OYWB 3S5AA 5FKCA 2WS91 3LA2A 3OD4A 1UZWA 2GNDA 1IPSA 1IBLB 1M4UA 4ASUG 2ZHMA 1V9U1 3RZZA 1K92A 2ZT9B 1J1TA 3ABMC 2DCYA 5DM6V 2XJVA 1NQTA 2RJKA 1VBE2 3P5BA 4D0QA 5J48A 3Q9OA 4JQRA 4JAAA 4FBFA 1HRI1 1G9DA 1R1BA 4YJ3B 5IWAO 4Z1VA 4FOYA 4R4ZA 1PO11 1RHI3 5H2FZ 1GP6A 4CP2A 3A0RA 1RVF1 3SPCA 1U96A 1N1TA 4GH4B 5LGNA 1YJKA 3A8TA 2W6JG 5K0UA 4ASKA 5F2SA 4I2OA 3UKMA 3RVZA 5FYZA 1FYJA 2V7QG 2A73B 4N7UA 4YVWC 1PX3A 3W7XA 1MS9A 3ABKB 5LP6A 5FIXA 1D2QA 1NH2B 2WA4A 2ZE5A 5FQ0B 2RMU1 4COVA 2MPFA 3I2OA 4B3RB 5FYUA 4JYBA 3WF4A 1Q90D 1US2A 3USUB 4JX0A 4MGZE 1RMU1 1FOD2 1CZVA 2JG8B 2FDJA 4B3TB 4J7ZA 2AW9A 3ZMSA 1G9FA 1ND3C 1NKGA 3S7IA 2YB7A 4FPOB 2SBAA 4O9EA 2QWRB 5FPAA 1DK1A 2ARAA 3E8FA 2R042 1JOYA 1OBNA 4B3MB 4OPHA 2UYBA 5KWRA 4QGNA 2ZHLA 4N43B 1W8WA 4V2VA 5T54A 5L36A 4MVRA 1V6OA 4R9DA 4EN8B 4E4DX 2WSUA 5J7MA 4Q0QA 4KHPO 4HVRA 4ZY9A 2I2SA 1J58A 5DZEA 1NR7A 1W6OB 1O3TA 5A80A 2EIGA 1QJY1 1ULDA 1K5MB 1HN1A 4MVZA 4IE7A 2BBAA 4BM8A 2VMDA 3K9AA 4LBNA 4KH9A 3VKMA 4AI3A 4QQPA 3OT7A 2OCCC 4MGIE 4WFEA 4WVMB 1WCUA 3KCYA 2ENRA 1S2EA 4X64B 4XIOA 2YY1A 4P9OA 2ZZQA 1H1AA 4FFBA 1N8RW 3X2QB 4CCOA 2W47A 2QQWA 5CBHA 4K40A 2Q1MA 2JGUA 1EFRG 2DCZA 2OZ6A 3HT1A 3AMHA 3H42B 5T52A 3JALB 1F7YA 4IERA 5B1AC 1G1XB 2V4AA 3VN4A 2VQTA 4IW3A 2J1VA 4GWJA 3NNGA 4D69A 5J2UB 3SJAC 4EN9B 1Y76A 2XG3A 5CA0A 1XL6A 1PO21 2D40A 4GJZA 4BQ4A 4H2AA 2P17A 1LENA 4JV4A 2RS51 5F32A 4G9SB 4NIAA 2WO1A 5DUWA 4AL9A 3ZN4A 4DUZB 2J1SA 1DU3D 4AI1A 4JZRA 5DUUA 1O3RA 4Y4YA 1RGSA 5IVEA 1YI7A 4UFHA 3VBSA 5IK5A 1J3PA 4BIUA 5IK4A 2LTNA 4KG8A 3OF1A 5IYCO 5A7QA 4KG0A 1NVPB 5T55A 1KD1W 2OCHA 4KGQA 4LCUC 4JZ2A 5HFLA 1VQ9V 4CDXA 4EN7B 3LZZA 2AR6A 1UMZA 4CPBD 4FZ0A 2LGQA 1N3OA 2D6KA 3POYA 3T4DA 5JR7B 4LT5A 3MLKA 4JI6O 5IY5C 4DUVA 1XU1A 2ADQB 3AG2B 1B35C 4P00B 1VBD3 1XNTA 4C8DA 4EWDA 4Y1XA 4RA0A 4HSJA 2Q6AA 5GZGA 1W3VA 4UOJA 3MPBA 3GCWA 1HW7A 3JAMN 1K3IA 1XMQB 1OV9A 3BTAA 3DXRA 3AXEA 2XTAA 1W9YA 4IV3A 2F4VB 1UOGA 2YFUA 5LA6B 2VQFO 5LBEA 3KT1A 2ZD9A 4LP8A 4WFFA 4F6RB 4KWLA 3FYIB 1BKZA 3BODA 5LOVA 4CZZA 4JGYA 3OGRA 4QKBA 1XYNA 3WR0A 2QUOA 3T08A 1HNWB 3VDCA 3V0AB 1M57B 1QHDA 3SKVA 4Q4X2 3E5UA 1JCHA 5GALA 3T4VA 2YROA 4IGQA 1UY4A 4Q4Y1 5DN2A 3NV4A 4J80A 2F66C 5FMDA 2ARCA 2C4XA 4A41A 1AX2A 5GLUA 1UMHA 5CFDC 3ITQA 2DOSA 5L7OA 1LOFA 4FPKA 3T4HB 2Q1ZB 1MZ5A 1PZ8A 2ZX3A 4YFWA 2WLLB 4DB5A 2UXNA 1GN3A 2JE8A 4AEDB 3I55V 1R082 2IW5A 3TXSA 3DKQA 4J7JA 1VBE3 5FYCA 3HJRA 2VAUA 4Q0UA 4P30A 1ZTEA 4XTPA 4QQHA 1DFQA 1QQP2 4JKLA 1OUXA 1ND2B 2EAAA 1GZTA 1AR82 2J1EA 3EHBB 1H30A 4TV8A 5AVAA 1WPBA 4UVBA 2XJQA 5AC91 3GB7C 5C9AC 2IJIA 4AEMA 5EIYB 2VMFA 1LODA 4W6XA 2FZ1A 4S2HA 5I8TA 1OCCC 2D3SA 2VNOA 2YICA 2GDSA 4BZ4A 5JH7B 3O0WA 1GWMA 2PI5A 1TME1 3ASNB 1XMOB 4FK5C 3BPZA 4M0NA 5BNNA 3RBZA 4P5YA 3BA9A 1S3JA 2DCTA 2VO5A 1FOD3 4LBMA 1KECA 1VLNA 3HKCA 3ECQA 4NTWA 5CBLA 1U0AA 3WQ1A 5C3PA 3IMMA 2ET7A 1L8DA 1DF5A 5A9GA 2VS0A 4WM7B 2PHUA 2DURA 3SKJE 5DPNA 2MEV1 4PDMA 1YUDA 3WG3A 3J7AU 4H37A 3CF6E 2HH9A 1YQ6A 2A6YA 5A3UA 1VF6A 2DCKA 3IGAC 4XMIA 4CVUA 3P30A 1FMD2 1OLMA 4DR7B 2ATFA 3CRCA 2LW8A 3SH4A 2JJ2G 4M0HA 3N7MA 2RDNA 2XL7A 3G7DA 1Y9QA 4AQ6A 2GMMA 2QFEA 1F9KA 4MO3M 5JZGC 4JKKA 4QB6A 1SACA 4XHXA 4YRDA 1P4RA 5IK7A 3WG2A 1G9CA 4O2BB 1CJDA 1YHFA 4NHKA 4AK3A 4BAYA 3WNXA 1TGOA 5BYNA 3HOBA 1GM7A 3NV3A 1WLWA 1GOHA 2XOMA 1NBMG 3VD3A 3PNAA 1Q7YW 1NX9A 4AAPA 2WWUA 2VM9A 1F35A 5IAXA 4XF1A 4FZ1A 1PGSA 4CCEA 2PI4A 3RVHA 1W2UA 3NQHA 1IZ3A 3G4SV 4PA7A 4TUYB 1S0EA 2ZX4A 1CAWB 5JJEB 3E1F1 1PNFA 5FZOB 2ARXA 4EJRA 1NZ6A 2R1DA 4NKGB 2XJRA 1JMUB 3SITA 4XF9A 3HPLC 2TNFA 4CUGA 2KB1A 2YC4A 5C70A 1K3EA 2XAJA 3ZKYA 1UYZA 4G27B 2R6QA 4DV0B 1VQOV 5GLVA 4I01A 4YM3A 1ORQC 1JUHA 1FJGB 3K0DA 4MGYE 1SBEA 3ZRWB 4FQZA 1MVEA 5CG9A 4BDVB 5FZAA 4PDVA 1RC6A 2NM1A 2PA7A 2ORZA 1GM8A 3BHPA 4RR3B 4XW3A 2WDBA 2W92A 2DYSB 4XHBA 1IBKO 3LSUA 4FXKB 1QJFA 3U4XA 2BVBA 3DPRA 1ULGA 1HR0O 2Y6LA 4X6RB 1CX4A 2F4LA 3Q8AA 3RT3C 4XUTA 2GMEA 4GA9A 2EIMC 1PHMA 5A3OA 1UJWB 3ZMOA 1AF9A 1ZZ9A 3CC7V 1NA1B 3E6BA 3W21A 3JXSA 1GK9A 2Q5TA 2RJZA 1X82A 5D5QA 1S0IA 4YZ3A 3WXPA 4IEQA 5JUVA 5CA6A 3MIDA 3LSDA 4PJYA 1EM1A 4RHV1 1TZOA 1IBMO 2IM9A 4FTSA 2UXDB 3BRCA 2IZWA 4K8XA 5LY1A 2R30A 3VD4A 3A22A 1LR5A 5CU1A 3ZSLA 5E8AA 4P08A 1IG0A 4XABA 4RGKA 1Z2GA 1D2DA 3UCSC 4CU7A 2EIJB 3LKJA 1LHOA 4WM8A 2W0FC 4XCAA 4O4HB 1SLAA 1AR4A 1FXHA 3VBOA 5FO7B 2D93A 3JB8A 2V4VA 1ASJ1 2B45X 1MQTA 1WLDA 3TN93 5GLZA 3ZYGA 3PTYA 4XC9A 4CCLA 3VD9A 3WW1A 1XL4A 2WNUB 1KDKA 4UW3A 1DLBA 3OBZA 2Y6KA 3VBRC 1F4NA 4QDQA 3BA8A 3I2FA 1FXZA 3MLJA 2Q0OC 2IC1A 1OOPC 4CP9B 3AEIA 1GNYA 4YM1A 4FLZA 2VRZA 2JIZG 1NVPD 1W9WA 5IATA 2QWOB 1CAUA 4QX5A 4LF7O 2EINB 4BYYA 4OI0A 2JG9B 4Y5TA 4UXNA 3WF3A 2WPDG 3APOA 1SLIA 2RJLA 1WWYA 4GQ7A 2A3WA 5FMBA 5KHIA 3IIIA 3VBUB 4P9WA 4QD2A 3FUOA 4GX1A 4BQWA 4GYCB 3OBRA 3IC7A 4LKDA 4AVVA 2NYYA 2AZ0A 3KM5A 1XUQA 2LFRA 1O5LA 3TNPB 2JGDB 3E5XA 4MTFA 3LDRA 5IJRA 4KL1A 3WT3A 4Y26A 1MEC1 2HYKA 4OHVA 5F1RA 1BL8A 3MIGA 2VZUA 3ZDSA 3J7MA 1Z0HA 3R66A 5M0TA 2P90A 3ABZA 2FHRA 4L99A 2ZGLA 2YUEA 4B3NA 1MSWD 2LROA 1PGL2 2WQ8A 4O7XA 1I94B 4UB6Z 2PTMA 4W4LA 3PU8A 1NLRA
chains in the Genus database with same CATH topology
2UYAA 4CEWC 4X6QB 5JVVA 5TSWA 3KT7A 2WS92 3HR9A 4MXWB 4YW2A 4DQAA 2X29A 1O4YA 2RM23 5F6KA 5JIUA 1D0HA 3B9IA 4I30A 2KXLA 4WBBA 3MDPA 1CVNA 3OCPA 1MACA 4IXLA 4HZFA 1V9U2 3HBZA 4HKWA 5H9SA 2ZGPA 4P9LA 1EV13 4META 4N9IA 2EXJA 2WLQA 2WZR1 5JI7A 2W39A 4I02A 4ES9A 4AHYA 2K9ZA 4BCUA 4HLTA 1UPIA 1NE6A 1FATA 3WVJA 1URXA 4OHWA 4HKLA 3TN92 4Q4V1 3BALA 3MICA 4NVPA 5HI0A 3I59A 5C4WA 1AYN3 1FMD3 3B5LB 1QJU2 2VGDA 1HRI2 3WDYA 2WNEA 2ETEA 5CNAA 3B9CA 5K9YA 4Q4W2 2D6NA 4UW6A 1OLQA 4YG3A 5KHGA 1U5XA 2TBVA 3AZYA 2JE7A 2B8MA 2XVLA 1D0GA 1PO12 4IETA 3NO8A 5CFDA 4BHFA 2XKOA 4FT8A 1RVF2 3T2TA 1PGW2 4DRVA 2UURA 2GN3A 2AUYA 5FCCA 5GZDA 4N9HA 3AM2A 2AGSA 2GNMA 3H7YA 4UBGA 4K1ZA 2ZHNA 5D8AB 4Y0EA 1BCXA 1YCIA 5IK8A 4XFCA 3S7EA 3SCHA 2JG9A 3VHRA 4AFAA 3JUUA 1IKQA 3M3CA 5JZGB 5A33B 3ZIXA 1IS5A 2OVUA 5FRAA 3M3QA 3UKNA 1NCQC 2HWC3 2ZGSA 4CDQA 3DN7A 3TYJA 1SCSA 1ZRFA 1QJX1 2BYVE 4CEYA 1PO23 3IKWA 4IESA 2VU9A 4B4QA 1RHI1 2RMU2 4QQ2A 2XWJB 2GC1A 1RUE3 4L92A 4XILA 2C1FA 4LHKA 3VZNA 5KXDA 1YIPA 1IS6A 2D5FA 4YGCA 4LE4A 4QM9A 5JSPA 4D7YA 3INAA 2AH2A 2X5IA 2FMYA 3H0OA 1UF2C 3ZYJB 5ABJC 2QNKA 1H8TA 1SDWA 1Y7BA 4K6BA 2ZGOA 2PELA 5HXVA 4IEYA 1QH6A 1RMU2 2UY9A 3FX3A 5LEKA 1S55A 2WKKA 3ZMNA 1S2KA 2YYOA 4XDQA 2KA3A 4XYXA 1RJ7A 5C9AA 3ZXAC 1HRV3 3KGZA 3SISA 1ZRCA 3U11A 1GKBA 3KCXA 3M7AA 4YZ5A 3B93A 1JXNA 4IEUA 1ENSA 3C2UA 3FLRA 1OPMA 2AZ5A 1XXNA 3LWCA 2Q8OA 5BUVA 4FP3A 1S0GA 4Q0PA 1W0PA 3CO2A 2FQPA 1YFWA 1WCSA 3HAGA 4MSVA 2KM2A 4QPIC 1AYM1 5C8WA 1RUI3 4LA3A 4YVWB 3UK9A 4YM2A 4COZA 1M06G 1KS5A 3ST7A 1SEFA 1V00A 4CP0A 2LUWA 3ZFEA 4BHGA 4XOGA 4A7KA 1NLSA 1O4ZA 5FAXA 2D6MA 4G3YC 3DUIA 1LTEA 5L19A 4MXWA 1DQ0A 3VDDB 4CP1A 1AL21 1YIFA 2RS33 3ILFA 3MI8A 2BPA2 4HBNA 1QJY2 4A3XA 3VBFB 2JX9A 4XBLA 5LRRA 4FP2A 1ZNPA 4YVSB 3AZXA 5LK5A 1VRH1 4QPGB 3MYXA 1ENQA 1WLTA 1F8VA 3L2HA 2K0GA 5H9QA 4QGLA 1ND3B 2RM22 4DZGA 4MYEA 1OHFA 1XYPA 1VZ4A 4GULA 4YZ4A 1X50A 1COV3 3AX4A 5CFCC 1FPN2 1EV12 4QT6A 1S1AA 2XVGA 3RSJA 1LGNA 1LOBA 2OZJA 2GC0A 4YSFA 2P3JA 3AYEA 2P34A 2CTVA 3FHIB 1Y0ZA 2XLAA 2XBO1 5BY5A 4PIXA 1VR3A 5C33A 4LBLA 2AYHA 1FYUA 3DL3A 4KU7A 5C8CC 1AYN2 3WUCA 1PK6B 1ENRA 4M00A 3JD73 5T50A 1XNKA 1X7NA 3DPRB 3N4MA 2P3IA 3WX5A 1RUD3 1RUF3 1TMF1 4AF9A 2DVBA 4U36A 1GNZA 1RINA 2VY0A 2XLFA 4AXOA 5JZGA 1ZBA3 2RS11 1SLCA 1NLRA 5HCAA 1UN1A 1V70A 1WW6A 5A33A 1ZBE3 2XGXA 1F2NA 3GZAA 1DDLA<