4AIDA

Crystal structure of c. crescentus pnpase bound to rnase e recognition peptide
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
616
structure length
573
Chain Sequence
QDPMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKSASDGAKIKAAIDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase/peptide
molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
total genus 166
structure length 573
sequence length 616
chains with identical sequence B, C
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 4aidA02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aidA03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aidA01
3H1CA 2JEBB 4OO1F 4AIMA 2WNRA 2JE6B 4IFDA 3L7ZA 4OO1C 2PO2A 4BA2A 1UDQA 4OO1B 2NN6F 4IFDE 5K36C 3CDJA 3M7ND 2NN6D 1E3PA 5JEAB 2C38B 4BA1B 5K36B 1OYSA 3GLLA 2WP8B 5C0XB 4NBQA 4AIDA 2BA1G 3DD6A 2C39A 2C39B 5JEAC 4OO1D 2BR2A 5JEAF 3B4TA 4BA1A 2PO0B 2PNZA 2C38A 2C37A 5K36D 2BR2B 1E3HA 5C0XC 2C37B 2PO2B 5C0XE 3KRNA 5C0XD 4IFDD 2WNRB 1R6MA 2PNZB 2PO0A 3M85G 4IFDC 5K36E 2WP8A 2BA0G 5JEAE 2PO1A 5C0XA 2BA0D 1WHUA 3HKMA 3GCMA 5K36A 3M85D 5C0XF 3L7ZB 2JEAA 5JEAA 4AM3A 2JEBA 1OYPA 2NN6A 1UDOA 1UDSA 5K36F 4OO1A 4BA2B 4IFDB 2NN6B 2JE6A 4OO1E 5JEAD 2JEAB 3CDIA 3M7NG 3GMEA 2NN6E 2NN6C 4IFDF 2BA1D 1UDNA 3U1KA 1R6LA 2PO1B 1OYRA 3H36A
chains in the Genus database with same CATH superfamily
4OMZA 3DWLE 4NC7A 1ZH5A 4IRIA 5TJJA 4ZTFA 4OO1F 1V4RA 3OTOI 4ITVA 2GO3A 1HNXE 1OLTA 3UR3C 3ZKBA 2A2DA 1USSA 2R7VA 4MGRA 4FCYA 3QODA 4MFDA 1UDQA 4XN3A 2NN6F 4FW7A 3QOPA 1TQPA 3WHBA 1FWKA 3OIOA 3K4NA 4CCKA 2O1TA 2K9LA 3K69A 2CW0F 1QVUA 3DPLC 2V2ZA 3ZZUA 4U88A 3FHZA 1PUFB 4UY8I 2BV6A 1OYSA 3GLLA 4YY3I 2VB6A 4HV6A 2DEJA 2PFBA 2OUMA 1FLIA 1DU6A 5C0XB 1B9NA 1Y8QB 5C4JJ 1OR7C 4LF7I 4YIFA 5DUKA 2OI2A 3FISA 3J80Q 4BY1J 2BA1G 3K9TA 2G9WA 1WJCA 2CUZA 3I55I 3P7NA 2M8GX 1FYLA 3CD6I 1SEUA 5JEAC 4P55A 2LF7A 1VQ8I 2BV3A 1GT0C 1KU9A 3RPUA 2DDBA 3ESWB 3R0AA 3VSLA 2Z9OA 5DRPA 4P1WA 2F5FA 3QOEA 3W6JB 1E0EA 2QSHX 2EIJH 4G6TB 3CWVA 1I1GA 3U1DA 1BR2A 4AC0A 1Z1DA 5B1BH 1V5FA 2CUJA 5ICEA 4UNOA 2R7TA 4KYWA 2QVOA 2L2OA 4DV1E 2YS9A 1SFOJ 1LVKA 5DRQA 1F1ZA 4YG2F 1L0OC 2HQNA 1KZHA 4USKA 3CJTB 3KYLA 1MBHA 1R6MA 1HBXG 2IS6A 2V1DA 5FGMA 4IZKA 5FLXC 2HOAA 5EZHA 2E1MB 4CGZA 1L3LA 4A0ZA 4BS9A 3AG3H 3LSJA 1XGNA 4B43A 2HZDA 1YW7A 3DQVC 2QCOA 4M73A 2DFHA 4RB1A 2LP0A 4DBQA 2W57A 5GMEA 3TL4X 1CQTA 3UNGC 2FSWA 1FMWA 4U3DA 1T0FC 2EV0A 5ELWA 1YQAA 3LSPA 1ODDA 2VKEA 4CXFA 4DYQA 1EJ9A 4NHJA 4DR4E 1XSXA 2KMUA 3DBRB 2FMYA 2JPBA 2LKPA 4JI0I 2KP6A 1EI1A 5L3CA 2A61A 2CYYA 4Y7NJ 4RB2C 4NC6A 4A3IJ 4LF9I 5DNLA 1BM9A 4XSZF 5LMUI 4GYGA 5JLXA 3MKLA 3FF5A 1T98A 5TISC 1WQ2A 2DJIA 2Y0SN 3TBIA 2NN6E 1TQMA 1TLHB 3OYNA 3EETA 2ZJRF 3EYIA 2CG4A 3LMMA 3Q0UA 2EFNA 5FFXA 2OQGA 3OS0A 2STTA 5CYVA 3AAFA 2PJRB 3GFMA 1IBKE 2W00A 3FKIJ 4M3BA 2Z5EA 2JWTA 5JVGF 2VPLA 4C2TA 1ON2A 4NQWB 4E6KG 3VFZA 4BYYA 5HNHA 4I6ZA 1Y6IA 3AL0B 2UUAI 4DUZE 4LG3A 4XN0A 4A3CJ 3LFUA 1KQ8A 4X0GA 1KYZA 2JE6B 3Q3SA 1R1TA 4LLLA 3VB2A 2VXDA 4ZVIA 4F92B 5BPDA 2XPUA 4UVCA 1T0FA 3IUOA 3WU2C 2F5VA 5F0CA 3MWMA 2EV5A 2NNNA 1BIAA 4RM3A 3FWEA 2VL8A 2NRAC 1FWLA 1XXEA 2H09A 5B1AH 5LGNA 3OR1C 4ETSA 1W4MA 1I3AA 1P42A 2UXBI 4A0YA 1SFKA 2XSDC 5L3JA 5A2QQ 2RGVA 4HSTA 4LK1F 4M9SA 2WWYA 2DMTA 3HRSA 1LFPA 4OAYA 3V7SA 2IOQA 3NARA 1LJ9A 1JUMA 5LGUA 3OYDA 3CCEI 2LYCA 2H94A 1MMAA 1SMTA 2BR2A 2R42A 2X7IA 1MJAA 3PIOF 3PM1A 5LMUE 1JKRC 3BTCA 1VQOI 2QM3A 2W25A 2XAGA 3MN2A 2LVSA 1K78A 2IRFG 3IV5A 1X4PA 4BDZA 3W2WA 2KRHA 3BY6A 4QIWN 3AG4H 4AVZA 4MDTA 4PRXA 3JREA 1ETOA 1HNWI 3Q9VA 3I59A 1YG2A 1S16A 5C0XD 4DR2I 1VQ6I 5CVRA 4RGUA 5K7HA 5EG0A 2F4VI 2PX9A 2IBDA 2Y30A 3R60A 2YU3A 4WXHA 3HUGB 4GGGA 4JI5I 4MEYF 1S8NA 5EZGA 3C3WA 4ED4A 3KLOA 4H0EA 3GTOJ 1O3RA 2HU9A 3K4LA 2HS5A 1RRJA 3LA7A 2NVXJ 3CUQC 4KHPE 1DUXC 3HBLA 1EF4A 3S1MJ 1Z6TA 2V9KA 4AIKA 1K4TA 1PP8F 2QYOA 5FRMA 1N75A 3IL2A 2GLOA 4GXOA 4AM3A 3MCZA 3HOSA 4ZH4F 3J80Z 1RR8C 4BXXJ 4A69C 1KGSA 2L54A 1VTNC 2JVHA 2Y69H 1V55H 5FRNA 1K61A 2DA1A 5FO5A 2BVLA 1YX5A 3GTLJ 1ERDA 2UXCE 1OKRA 3IH2A 5JEAD 3PNTA 1FPQA 5M5YJ 3H5RA 1NG7A 1X1PA 4JI2E 1ZG1A 1YH8A 4WCGA 2VQGA 3LSMA 4I7HA 4EGYA 3PFYA 3OYHA 3GX4X 4EJTA 2VQEE 1B4AA 5M3MJ 1UJ8A 2IPQX 4WXDA 1MNMC 2AHQA 4LITA 4FISA 2BA1D 3JRIA 2JRMA 3CCLI 4LF9E 1XS9A 1B72A 2HKOA 2XROA 4HACA 4ZC3A 4J3DA 1GLNA 4OKGA 2F6CA 1QO0D 1DPUA 1B1BA 3B8HA 5HLHA 4X62I 1KQ9A 3H1CA 2X1CA 4DR3E 3IRQA 2BW3A 3HRMA 5LHIA 2V8PA 2K27A 1Z0TA 3KEOA 1DPRA 1X3UA 2GS8A 2E1OA 3QT5A 1U3EM 4HA8A 4NB5A 2QQAA 2X1DA 4PSWA 5EEHA 3ZMSA 2HXOA 4CZZA 2VLAA 1Z5CA 4OO1B 2VJ5A 3A1YA 3W6VA 4L9TA 4F55A 3VDXA 4NUBA 4U7BA 4B1RA 2R7FA 4DUZI 2A6EF 1ZRCA 4J19A 2X1EA 1A04A 4UB8C 4KISA 1R1VA 1MDMA 4R1HA 4E4HA 3K1NA 4P9UA 2XC7A 3LNQA 3S3OA 3S93A 3LSRA 1FYMA 2WW4A 3E7LA 4RAGA 2VJJA 3TGNA 2NYXA 4A0XA 2Z33A 1C0WA 5GPAA 1HKTA 1MBEA 2LKXA 1X2MA 1A31A 3MD2A 3ZQHA 2ZC2A 1P4AA 4I98B 1CF7B 1N77A 1FIAA 1JUPA 2CRGA 4BHPA 3GFIA 4Y52J 1HA8A 1NTCA 2LDUA 2F4OB 2Z5CA 4XTJA 3I56I 4AYBA 3HGYA 2C38A 2DMNA 2RDPA 3FXKA 4BL0B 4HQEA 2CWEA 2LREA 4K0KI 4BQNA 3A03A 1Z77A 3LAPA 2R7QA 1HNZI 2F2EA 2DA7A 2PO0A 4LOCA 2Q2EB 3RZOJ 2DOFA 2QUFA 2XF6A 5LRRA 1Y56A 1PIEA 3DXJF 4XSXF 3RDIA 1HOMA 4FTHA 3I9V2 5CVJA 4E7LA 1DP7P 2YPRA 2MH9A 2R7UA 1J0RA 1FOXA 2PI0A 4XORA 5LEJA 4JI8I 2R3SA 1ZM3A 1B72B 3S14J 4DR2E 4FQGA 2D1HA 4RPFA 1IN7A 4KA4A 3PS2A 2AXTC 3RIRA 5DTDA 3QT8A 2BA0D 1OCTC 1HW5A 2OV7A 3GCMA 2ZBKB 1GVJA 2R3VA 3KYCB 2O8XA 3VYTB 1D0ZA 3KZZA 1XMQE 1ETYA 3J7AY 4LJZF 2E19A 3FXLA 4BE1A 2M9HA 4HW0A 2ELHA 4C3HJ 1YJWI 4X64E 5DM7F 4DV0I 1Z59A 2Z5BB 2EINH 2UUCI 2VBYA 2JEAB 2Y0MA 5EGOB 2HKXA 4JYKA 3D5SC 4HX4A 1YTYA 3P3GA 1S7OA 2Q0OA 1UG2A 4L5IA 5EGOA 3H9JA 2HOTA 1R7JA 3A0HC 2IVMA 4L18B 4A3BJ 3RKXA 3BROA 1HKSA 4BKXA 1LDKB 4GKJI 3GFLA 2QZ8A 3I71A 1S9HA 1FTZA 5LMNI 2JN6A 4KN7X 2XKOA 1D5VA 2GXAA 1ZM9A 4FW5A 3V2UC 3OTOE 4MNUA 2UU9I 4ZYAA 3R4KA 1H88C 2FUG2 3KEQA 4BA2A 2XUBA 3Q9SA 2ZBKA 4Y4RA 2R5YA 1MMNA 2JTVA 3NWTA 3PO3J 3C18A 4G7ZF 1BL0A 4LCFA 3WHCA 3OYAA 2R7OA 1GV2A 2BY1A 4IHTA 1SAXA 1NK3P 3FXRA 2ZFWA 3K4CA 1WJAA 3ZMVA 1KU7A 3L2VA 4N4OB 2VXZA 4ZDLA 5DV5A 1YIJI 4KIGA 2ETHA 2DFEA 4M6XA 4EVIA 4IHWA 4JOMA 4CCNA 2X51A 4WXCA 4OO1D 1Z67A 3FZVA 2KZGA 1PVEA 3ABUA 2E34A 2ZXJA 3I4PA 1JJ8C 4UV9A 2KDOA 5E8GA 3QPHA 3TKYA 4RLQA 5JHFA 4RGRA 2VBZA 3G4SI 2K9QA 5EDNA 2L9SA 2O03A 3V7CA 3BPXA 2OZUA 4DR5I 4BACA 5ILVA 3OYFA 1H8AC 4B3RI 5HOOA 4AVPA 2O1WA 5AONA 1E17A 1IAWA 2O3FA 2HTJA 1T8IA 2K9MA 1JGGA 2QQ9A 4Y15A 3VPRA 1LNWA 2ELJA 4OMYA 3HSFA 2WTEA 1KU3A 4DV5E 1QBJA 2R93J 2M3AA 3ULQB 5GTIC 3P06A 1T2KA 4LFUA 1N78A 1JUSA 1HNXI 1QGPA 2O61A 3S17J 1WJ5A 4E7KA 1ZHFA 3RQ4A 1UEKA 2V79A 2OBPA 3EUKL 2H1KA 2BBYA 3F8BA 4YEJA 3MFKA 3U1YA 2LFBA 1D5YA 2VIXA 4HZFA 4LOMA 1YHCA 3GWZA 5F08A 1WCMJ 2L02A 5JR3A 4BQQA 1K79A 1UDOA 2NN6A 3T8RA 2E5LE 3G2BA 1W7PD 2NOJB 4DV4E 3QQAA 4RLFA 2X85A 1OMIA 1ZGWA 1MW7A 4PZJA 1WH5A 1W5TA 3GMEA 4M3FA 3GTKJ 2OPTA 1QZEA 1Z3YA 5B3SH 2BVMA 4HNUA 1ZM2A 1YLFA 1IW7F 1QZZA 1VQ4I 1JKPC 4I3HA 3M6AA 4HDVA 1YJ9I 3J7AG 2HOSA 4LFBI 3D5RC 4XLCA 3D4JA 4OU0A 5FD6A 3DBLB 5DEQA 5J4VA 4DXLA 4B3MI 2VQFI 2V7FA 3T1BA 1VQ5I 3ZMZA 1BJAA 4Z7CA 2JJ7A 4M71A 4AIJA 3L00A 1E3OC 4I76A 1S72I 4LCGA 3BTLA 3ZGKA 4Y13A 2GQQA 4AWXB 4BGDA 3GTMJ 3HHHA 4O5VA 1FBUA 2VESA 4EEFG 1YW8A 4DU7A 2DLLA 3GZ6A 4M6YA 2VASA 2V2QA 1ONVA 1SVOA 5D6FA 3TP0A 3RPQA 2VE9A 1RESA 4BBRJ 5JFRA 2DK8A 2NXNB 1B62A 1J5EI 3G1OA 2LR8A 2GQ0A 2FOWA 1X3ZB 2BGCA 4NBQA 5EG0B 4BXFA 3WTWC 3GF2A 3M8JA 3BG3A 2BHZA 3WTZA 1Y1VJ 4ESJA 2E71A 4ENJA 2IGMA 1F43A 1ENHA 2QSFX 3I54A 3BPVA 2CQXA 1P4XA 4RAFA 1G3WA 3HHGA 2K85A 5F1JA 3EPZA 3TW7A 4DBRA 4D5FA 2K86A 5ICCA 4DR7I 2M4GA 2UXDI 3CMAI 2VPRA 5CJ9A 3HTUA 4B44A 3HZJA 2P5LC 1X4OA 3R61A 3CCRI 1REPC 3Q6NA 5M5WJ 4GKKE 4A3GJ 2DBBA 3BR2A 3PNYA 3H35A 4XRSA 3COAC 1D3YA 3OWTA 3ZXSA 2JT1A 2CW7A 2DI3A 4Y3OA 4XOTA 1QPMA 2P81A 1R36A 3ERMA 5F1RA 2PBIA 2ID3A 1VQLI 2E1NA 3FXMA 4B8XA 5IPAA 2HYFA 4XLAA 3T1YI 3EUHA 2A68F 3BG5A 2HYGD 2PMZA 4BY7J 1I5ZA 1TWAJ 3RKQA 3OY9A 2DMUA 2FE3A 1VQNI 4RGSA 4A3EJ 2KRFA 3S2DJ 1R9TJ 1TBXA 2A5YB 2EJRA 4UVBA 2Z1DA 1XC5A 4PUSA 2LY1A 3LSHA 2ZXIA 4ON0A 4QNJA 4GFBA 3S15J 3WU1B 2DDAA 3CJNA 4JI0E 2LLKA 3NWSA 2F1DA 4URLA 2JRTA 2EZIA 5LGTA 2IXSA 3OYMA 2BZTA 4FHTA 4XKVA 2KKOA 5L3EA 1OFCX 4DV7I 2O5RA 2JK3A 1IRFA 2MGQA 2KLOA 4KIFA 4N0BA 2HNHA 1X58A 4Q4ZF 2RNJA 1BR4A 3KP7A 4B47A 3ZP5A 1BW6A 2XVCA 4M9XA 5BOXA 1SFUA 2XGDA 4A3FJ 5DCMA 3MQ0A 3P3EA 4D7MA 5BMZA 1ZK8A 3GUDA 5IT9C 1XCBA 2ZXWH 1U8RA 1R5HA 1UZCA 3OYIA 3GTGJ 3ZKDA 4RGXA 3CC7I 4LLNA 2HEOA 1DP3A 3PS3A 3CCMI 3F6OA 3I3LA 1QA6A 1PP7U 3PYFA 1EH7A 2F48A 4E7JA 3EUHC 1ZKGA 4ZYEA 3DKXA 2EV6A 3QRFF 1XHKA 5AIPA 3B82A 2NN6D 1E3PA 3Q5FA 5GADJ 2F5DA 5F0FA 5DM6F 2EA4A 2L4AA 2KIQA 3U9GA 5IT9K 4W97A 3OYJA 4Z2YA 4DV2E 3S1QJ 2IESA 2XIGA 2B0LA 3WE2A 4OIPF 1ZARA 2IJLA 3EYYA 4AYBN 1MIJA 1NG6A 2W7NA 2NPFA 1NHJA 4JI3E 2VQLA 4IZKB 5E18F 4IQJA 2PMHA 2FXAA 1VQ7I 3BTIA 4EGZA 1TT0A 1P2FA 2RV8A 3K17A 2KJBA 2DTRA 4G8XA 5FROA 4M74A 2FQ4A 1XMXA 1ORKA 1G3YA 2HQRA 3NAUA 3BZKA 4C9YA 3C2BA 1RHYA 3I4NJ 4EM2A 1R5GA 2B9SA 3BR5A 4XLNF 3EUAA 3E0JB 3ZQFA 3QT6A 1HKQA 2MLKA 5HLIA 2FJ1A 2VQEI 2ACJA 1UAAA 3LTOA 1LQ1A 2GOMA 4KNYA 5F0HA 2WNRB 1VFCA 1AKHA 4WX9A 3M1CA 1Q1HA 5IOYA 3HC7A 1YX3A 1IO2A 4HG2A 3BR3A 4XRFA 4MFEA 1R49A 1ZLKA 3HDDA 1HLVA 3I0TA 1I94I 3G71I 3CCQI 2X6OA 2ZSIB 2W85A 2XRLA 4B48A 1XDUA 3CO7C 2V26A 3HIFA 3MAJA 5IYBJ 2VODA 5EKWA 1ZN2A 5FKLA 2UZKA 2RNGA 5GPCA 5FLMJ 3RQIA 4PJJA 4Q48A 4HACB 1FZPB 2DMQA 2LTPA 5M5XJ 2N8GA 1RUNA 1WVRA 2KHMA 5E3LA 2R5YB 1IRXA 1U8BA 1UDSA 4LF6I 2PMUA 1YYVA 4BA2B 4XOPA 1ZQ3P 3FXOA 3DP7A 5D5XB 5BPIA 5FD5A 4OX9E 1P7JA 1FWZA 3BJAA 1Z0EA 1GDTA 5GAHJ 2I5UA 2BY2A 2HFHA 3H4LA 4YELA 3JRGA 1TL8A 4A12A 2DU9A 1IN4A 5IP6A 3WODF 1D1BA 5L3BA 3IWZA 3IWFA 2D45A 2VJIA 1JKOC 3U1KA 2Z3YA 2B63J 4MIMA 3KIOA 2HR3A 4X64I 5L3DA 3FXQA 1FJLA 1ULYA 4S0HB 4YY3E 4HLYA 1TWHJ 4EJVA 2LG4A 2ZMEC 2UUCE 4CO8A 5J1YA 1R4MB 1RKTA 2UXXA 4PU9A 5DD8A 3C2HA 3ZMDA 3VWBA 4XR6A 4C3JJ 3RYRA 2M34A 1ELOA 2M5WA 2CV2A 3GZNB 5LFAA 2Z5BA 1MBJA 1B8IA 5L3FA 2M30A 2EILH 4KT6A 1Y5YA 4EJUA 2R4GA 1WUUA 3QPLA 5B5EC 4DW6A 4A3DJ 4JQFA 4OWRB 3PYEA 4DPXA 4D5CA 2FQ3A 2CFXA 4OZEA 2XB5A 5B66C 1F4KA 4JI4I 2D1VA 2KIUA 3KX2A 1X3WB 2XF7A 3TP3A 1MG7A 2DT5A 1IRGA 5D5VB 4XRMA 1QZRA 4FWDA 4KT5C 1KONA 4AIDA 1Y6ZA 4CCLA 1FOKA 3JRAA 1ZG5A 2JUCA 1RZ4A 2VT2A 3WGHA 3DD6A 3HPHA 1APLC 4UTGA 2OCEA 3V8KA 1SANA 1IUYA 3JAMZ 1R4NB 2R5ZA 2WA0A 2XSJC 2PNZA 4DPWA 1EKEA 3T0YA 2Y75A 5J1UA 5EF6A 3Q1QA 2C37A 3L2RA 4UHTA 3D1NI 2QGUA 4HLXA 1RI7A 3PIPF 4HEA2 4HQMA 1S7EA 1MSEC 4BEHB 1WJDA 2EZLA 3CCUI 2HFSA 1Z0VA 5HNFA 3BR6A 1DARA 1HXDA 5E17F 4D0PA 1BBYA 2Z2SB 3DEEA 3H0DA 1QHGA 4JK1X 4DV6I 1Z9CA 4M3DA 4BBSJ 3ABKH 3FXJA 1XCVA 2VBWA 2WB1N 1O7LA 2RQPA 2ZB9A 3H3UA 4DPYA 3F8NA 3LSGA 4HF2A 4EV0A 2TCTA 3N97A 2O1UA 2XGCA 3DTEA 3K4KA 2PN6A 5HS8A 1HNWE 1DDNA 4NQWA 2UU9E 2A6HF 1UB9A 1MDMB 1IXRC 2WV0A 1AA7A 1D8KA 1OYIA 4A6EA 5E3MA 3BLYA 3U21A 3ZQLA 1I6XA 1EH6A 2IA2A 1SVMA 4UXNA 1XNQE 3KE2A 2LOOA 5ICGA 5A2QZ 4DV5I 4LFAI 3DCFA 3WG7H 1PJRA 1IN6A 4OO1A 2LRDA 2CUFA 2K3FA 3MMYB 4FW4A 1UELB 3WTYC 2ID6A 1KIJA 5JI6A 3FXUA 4DUYI 5K7FA 4I01A 4ZDPA 1W5CC 1ZTRA 3BR1A 4G9YA 5LHGA 3QPSA 2AJ4A 4XNFA 4JI1E 4RB3C 1WI9A 2IP2A 3TDUC 3GBGA 4U0VA 1HCRA 1UG0A 4OX9I 2KIMA 3OYLA 3R0JA 2DEIA 4KN4X 2BXZA 1NHAA 2UV1A 4LIUA 6PAXA 3JRBA 2UXBE 2ZM6I 5IWAI 3RKYA 3KCCA 1WKMA 4ZTJA 2VC0A 3I53A 2IT0A 1BR1A 3T5XA 2WNRA 2H27A 2YU9J 4L0ZB 3T1HI 5LMNE 5BS6A 2MH2A 3K1PA 1SFEA 3HRUA 3PJRA 4IHXA 4Q5SF 5IY5H 4KFCA 1EV7A 2LF8A 3ZQIA 2ZJPF 4N4NB 3QU3A 4D1QA 5FKKA 1SAUA 3G73A 3H9QA 3FK6A 3ONQA 4DR3I 3VYUB 3K85A 1H73A 1OCOH 2M0CA 3IP4B 1Y0UA 5D4RA 3J7ZI 2COBA 1HW2A 1XSDA 3J81Q 1U2RA 2W4SA 4J00A 2K40A 2ESHA 4MYUA 2M0MA 3ECHA 1HR0E 1RNLA 2DW4A 3B78A 4EJWA 3HG9A 1Z21A 2G7HA 1PYVA 4X65I 1XNRI 3S2WA 5C3EJ 1VISA 5FKNA 3D5LA 5E3NA 1TNTA 2P6TA 4IRHA 2DYSH 3HUGA 3ZZ0A 2E5LI 1XGSA 3DTKA 3P9IA 4O6JA 4LF8I 3CP8A 2CUEA 2CVEA 5HLGA 2FBHA 1KKHA 3E6CC 2HKEA 4BE0A 1PVGA 3ZM7A 4IQ4A 2FOKA 4XLEA 4N3OA 3MZ8A 1E3HA 1FC3A 3E5UA 4LCHA 1Z0WA 3CMEI 3JTHA 1BA5A 2PO2B 1W7PB 4KQVA 3FBIB 4NXNI 3RI4A 3OYBA 2R0QC 4IOCF 1HSJA 3CMMA 1XTAA 2FD5A 3J81C 4RDUA 3H0GJ 4KMFA 1USVA 5K36E 3DPUA 2GIVA 2VI6A 4PGGA 5E3OA 1H0MA 1Z05A 3W2VA 5ED4A 3S3MA 2E1MC 2GIZA 2MC3A 2WADA 5HS7A 3BQZA 2J7KA 3OIPA 3SQNA 2PEXA 3ZRGA 4IOAF 2BEOA 2YSRA 5DCFA 2E5NA 2ZNZA 4PK4A 3CUQB 2GWRA 1WHUA 3ZN0A 3HKMA 2LY9A 2VUMJ 4DV6E 5K5RA 1WH7A 5FLXK 1R22A 1B8IB 4GKKI 4CYCA 3QAHA 2NVTJ 4TV7A 4QLCU 2E7XA 2DO7A 4XONA 2VKVA 2OU2A 4QTRA 3OV8A 3X2QH 2V4JC 1MD0A 5LEKA 3HRTA 3Q0VA 1N25A 4S04A 3W2AA 3BR0A 2CQ7A 3A0BC 3J81Z 1N32E 3HGGA 2JE6A 1XX5A 4FE4A 2O1VA 2PG4A 4CCMA 4CCJA 1JE8A 1OPCA 1P92A 4UV8A 2A6TA 3ZQGA 4JI6I 2QQ8A 3KZIC 5IYDJ 1U2WA 2PMZN 4I09A 2O6GE 2IS2A 1XNQI 2AQFA 2NN6C 4IFDF 1X1DA 2NS8A 3OSGA 1VQKI 2PNLA 1MMGA 1FP2A 1J59A 4BJTA 4LGWA 4G7HF 2BXYA 2J5PA 1XN7A 2MD0A 2OF7A 1IV8A 3CF2A 3IH4A 4O3MA 4G6QA 2Y9ZA 1OCRH 2ELKA 3B6AA 2OJED 4LB6B 4XICA 1J9IA 1JHFA 1FOYA 2JA5J 5LBQA 1N33E 1OJ4A 4F7ZA 1O57A 2EBIA 1JKQC 1R71A 1RR9A 3I58A 2NS0A 1QU3A 4FWGA 4AD9A 5HLTA 3KP4A 3SDGA 4LF4I 4ESFA 5K36C 1Z5AA 3FBNB 3M8EA 1Z5BA 1T33A 3WTXC 1TP4A 2EFWA 3SZPA 5M3FJ 3F9KA 1QQIA 4IFDB 1VZ0A 1B6AA 1R5ID 2L0KA 3ZQQA 2FBIA 2VC1A 1ON1A 2MLGA 3BCBA 5DDGA 3P9KA 4YFNF 3HM5A 1UFMA 2LH9A 4ZDOA 2AXLA 1BC7C 1IBKI 1CGPA 4XQFA 3M7GA 1LPQA 1YRNB 1LUJB 2MA3A 1MJBA 3HJCA 3HXLA 1JXSA 1IV6A 2Y2ZA 1WJBA 3HTSB 4X1EA 3V42A 1D8JA 1HQCA 2XB0X 3A4CA 2VKDA 4DV2I 4NNJA 1LVAA 3A2KA 4IS9A 1W0TA 5C0XC 1LB2A 4FETA 1U9OA 2AQEA 1TWGJ 1K47A 2X48A 1WGXA 3FMSA 2RVCA 1S6LA 1VF9A 2DK5A 1ZELA 2KISA 2FMLA 3OS1A 4IO9F 1IGNA 4L9JA 3HOVJ 3M85G 2ZJQF 1LDDA 4DGWB 3F22A 4IRGA 3P9CA 2WAQN 4QPOA 1WJEA 2XHKA 1YFHA 2WP8A 4F93B 4EM0B 2Z16A 3RCOA 1QVTA 4ENNA 3HYIA 2M4KA 3K4JA 2BM0A 1U5TA 3IH3A 5C0XA 1AOYA 5FKOA 4XKWA 5H6QA 2JSPA 5CQGA 4MEXF 1EA3A 2WY8Q 3HOXJ 3KP3A 4DOZA 2K4BA 3CC4I 5FLVA 4PGHA 5EYRA 2R7DA 4M72A 1G59A 1MJ9A 1MH3A 2RN7A 4DR6E 4FE7A 1ACIA 4BU2A 1X2NA 5BR8I 1P9QC 2NN6B 3MZHA 2P5VA 4OO1E 2BHYA 1MBGA 2X0LA 5FLXQ 3RKWA 3L2CA 1HR0I 4JI6E 3BWGA 3BT9A 2XAJA 2ISZA 4OIQF 2C6YA 3GEZA 4X65E 4DU8A 2DA2A 4EMSA 2DFFA 2STWA 2Y48A 3PO2J 2JUGA 3A02A 1D6TA 4GYIA 2X6WA 2HVQA 2EFQA 2PO1B 3IHUA 2QSGX 1SFXA 1BJZA 2DJNA 3MVPA 2Q1ZB 2GA2A 2DT7B 2H8WA 2M7BA 1SD6A 3WE3A 2JQ7A 2R7ZJ 1MMDA 1WSUA 1FJGI 2VF3A 1BKNA 3GW2A 3F0NA 2VQCA 3JAMQ 4Y33A 4IFDA 1HSTA 3L7ZA 2LC2A 1KYWA 1MX0A 4M1KA 4X6AJ 5D5WB 4BDYA 2L7KA 5GTHC 4YIRX 1LFUP 4FW9A 3DFGA 5KAIC 1ZREA 1JTYA 3J7YJ 1ETWA 5J8FA 4RB0A 4A5MA 4CYCB 4HRIA 2P0WA 3TO9A 4IVNA 1GXQA 3CJQB 5D4SA 1OQYA 1N33I 1USUA 2VQFE 3GLXA 1I94E 3CUQA 1U9NA 4JI7I 3KZYA 5E1ZB 1I50J 1XMOI 4A3KJ 2AS5F 2ISYA 3H5AA 4H4KC 4XKCA 3JSOA 5BQTA 4YIIA 5F04A 1TQIA 1MBFA 2EQRA 4CCOA 5IP9J 1HW1A 3OYGA 5HODA 4RBOA 4BA1A 4U0YA 2LMDA 4JG4A 3E6MA 4W1UA 2HVSA 3LL7A 4NDLA 1N32I 1FMVA 2UXCI 5CKTA 2NVQJ 4WUDA 1MZBA 1S7AA 2EFOA 2X9DA 3IKVA 5D8LB 4BHBA 2E36A 2K4JA 3I64A 4MO7A 4L5JA 1QPIA 4HOBA 1WJFA 4UT4A 2RREA 2QWWA 3F6VA 2XF5A 3GO5A 3S32A 3LA2A 3OSFA 3S1RJ 3HPGA 5J3LA 1IRZA 2MC4A 5DS9A 5A2QC 3PQKA 4BJ6C 4PJNA 1U6GA 2VBXA 3CP2A 1PUEE 2CGPA 2OZ6A 1YHQI 4LG0B 1BN5A 2IS1A 5A2QK 3PUBA 1ZGAA 3RTRA 2EIMH 1D0XA 2G0EA 2JPCA 4XL9A 5LLQA 2JEAA 5FB2A 2EB7A 4IZJD 2K02A 1TW3A 3K2ZA 3HOZJ 3RPUD 3BTJA 1T56A 1RC9A 1U78A 2DTZA 4DR1E 3DKYA 3F72A 3VEPA 1FOWA 3E5QA 4UB6C 5KAFC 4ASNA 1H9TA 2COMA 3O6BB 4PCQA 1E2XA 1J5EE 2CQKA 4LLGF 2EA2A 3N05A 3JSPA 4M3GA 2X4HA 1Y1WJ 5BR8E 3FM3A 4IPAA 3NQOA 1G3SA 2LBFA 3OYEA 3S16J 2CMPA 2KPMA 2EZKA 4PJ0C 5ILUA 1OYRA 4CYDA 3J7AM 3WTUC 3H36A 2OTLI 1IXSB 2BE5F 3JW4A 2F5EA 1XPXA 4PSXA 1XMQI 2OC6A 1UCRA 3SZGA 1J5YA 2VN2A 2MABA 5J8CA 4NXMI 3FDYA 4LF7E 4IXAA 4CH7A 1FTTA 5DROA 4LF5E 1LDJA 4P9FA 4E7IA 3LPSA 2EWNA 4CSWA 1KA8A 4DPUA 5KHDA 3GTPJ 4MLOA 2HDDA 1K83J 2QF7A 1J09A 3E6BA 5J40A 2IGKA 2C38B 3P76A 4HXZA 2QEXI 4K2EA 1V5GA 2DN0A 4LB5A 2JT2A 2F4VE 3FX3A 5EJCA 2R7RA 4X62E 2HZTA 2FNAA 2X6YA 4JBAA 5DD4A 5IT9Q 1FNNA 4ZYDA 4LIVA 1IBME 2WBMA 5C4XJ 1GHCA 4D7NA 1OCPA 3FM5A 4QSHA 3SYTA 1JT0A 4ISAA 1X19A 4U3BA 4X66E 2XAUA 2HPIA 3O8GA 2LD5A 2KIFA 4JP0A 3BG7A 2ZFUA 1ZM4A 2EPFA 3H92A 4FX4A 1FSEA 3K1MA 4DV0E 2ME6A 2HQAA 2ME0A 1P6RA 2XPVA 3F8CA 4F91B 1XG1A 2WY7Q 4KITB 1ZR2A 1G2HA 3K70C 2C37B 4DV3I 4PJLA 3LQRA 3RJPA 2KL4A 4RMNA 4YFKF 2GZWA 1MSFC 2PNZB 4MU1A 2HXIA 2HKJA 2RC4A 4IFDC 3LWFA 1FI4A 1N0VC 1IBLE 3FMRA 2MG4A 2BY0A 2JA6J 1OR7A 2LBFB 4JYAI 3BC8A 2Z99A 1F9NA 1NHHA 4DYRA 2Q8KA 4K0KE 2CGEA 2ECCA 4EQQA 4DR7E 4PFPA 2H6CA 1XDSA 3OL3A 3J81K 3M85D 1JI8A 4OOIA 2QENA 2P7VB 2MD5A 5JEAA 3E97A 4L0YB 2ZMEB 3BJ6A 3HOWJ 1OYPA 2JEBA 3O3KA 4HYMA 2ICWG 2P8TA 2ADUA 3I5UA 3UHMA 4XLPF 4LMYA 4ZJZA 1ZRDA 4ZZDA 4JV5I 4QWQA 4E7ZA 1R6RA 1WFXA 3RSNA 2MW8A 1TT5B 2NNYA 3C7JA 2E2IJ 3K4BA 1XMOE 2IW5A 2HGCA 3QYBA 2PNMA 2GBYA 1RIOH 1O3SA 2G7UA 2UUBI 3KFWX 3WU4A 2A5WA 3SEZA 4C2UA 2A05A 3BOQA 1ZR4A 1Z3XA 3LOCA 4P52A 2CQQA 1FEXA 3CCYA 3CDHA 5HDNA 1Z6RA 4ZZLA 3NRVA 4IHYA 3OS2A 4C30A 3HULA 3UKGA 4JI3I 1F36A 3ZQ7A 2ZXHA 4MQ9F 1BC8C 1T08B 1JTXA 3G1LA 3FHNA 2HYJA 4BUPA 2ZMEA 2CV1A 2JEBB 1J7KA 5IP7J 2P5KA 4J01A 4C3IJ 3U2RA 2IA0A 1IG7A 1KTVA 2L9RA 4IFDE 5KK1A 1G3TA 2FNPA 2IGOA 3T1HE 2L7MP 4CHUA 4LFCE 2M2EA 2A07F 3PSFA 1VQ9I 4BA1B 3JTGA 2GA1A 1FP1D 4B3AA 2QA4I 2CO5A 1IN5A 2GOXB 4BQOA 1S29A 4E70A 2HHHE 3ISPA 4XMYA 1F5TA 5CQEA 3F23A 1H9GA 3K0LA 5J47A 4RAYA 2KFDA 1EH8A 1IBMI 2ZSHB 4FT8A 4U7DA 2C39B 3WTTC 1M1EB 1MBKA 2XRNA 2R7WA 2DXIA 2R7SA 4MYTA 1K4SA 3W3CA 2L9VA 3CUOA 1YS7A 2DA6A 3H5NA 4IX7A 1LE8B 3HOUJ 2CH0A 5TRDA 4DV4I 5TGTA 3GONA 4LK0F 1QRYA 5EEAA 2IAIA 1AHDP 2VONA 1BOAA 4IF4A 5HDKA 3L2QA 3QT7A 4WUBA 2L9NA 3I4MJ 2UUBE 1CF7A 3F3XA 1X1AA 3VYSB 2XGXA 4ZYHA 5C0XE 2LKSA 4HY1A 1Y8RB 4IFDD 2ZCWA 1IZ1A 1P4WA 3CLQA 4G6DA 1YW9A 2MYSA 1SD5A 3OYCA 2HTSA 1SC7A 1N34E 4GRIA 3V8LA 3HJEA 2DODA 2PO1A 3V8JA 2HQ5A 1N36I 2HI3A 1JT6A 3LSTA 2QBYA 5CVVA 2NVUB 3HKZA 3WU6A 4NXME 2VT3A 4LF5I 4RAZA 3ZZTA 5K36A 2DA5A 1HDDC 3KP6A 2E5ZA 3CCJI 1K7AA 4HF1A 3KEYA 4C2MJ 4ABZA 3L1PA 4BNCA 4U0WA 1U5TC 1NHIA 4CA0A 3FMQA 2E35A 3OMYA 3KLNA 2GAUA 3FKJA 2ESNA 3ABMH 4E7HA 3QU6A 3JAMC 3TO6A 2MBFA 3CESA 3CDIA 5DNXA 1IC8A 2BY3A 4DZPA 3G1MA 4GQUA 1IUFA 2WB1A 3ERED 1QZYA 5EL9A 2JA2A 2V1UA 4B3SI 3EDPA 3O2PE 4OAZA 1DU0A 1U5TB 3QYEA 3CCSI 3AL0C 3S1NJ 2M1BA 3J7AO 2K5CA 1S3JA 1H72C 3SZTA 1S4EA 2AE8A 2CG9A 3KP2A 1MNEA 2L3DA 3ZQCA 1S5LC 1MGTA 2QBYB 1RREA 4V19K 4ANJA 1RKWA 1X1CA 3E6DA 3ZMTA 4AIMA 2CJJA 2CZ9A 4KICA 2XV4S 4AQYI 4NC8A 1D1AA 2P7CB 1MH4A 5F6FA 1YOVB 3ZMUA 3EQLF 4L9VA 3CMYA 3K70D 3WGIA 1B63A 2H1LA 3L9FA 1IBLI 2M8EA 2DT6A 4I99C 2V6CA 3E5XA 4Y17A 4LG0A 5FLXZ 4BE2A 1TC3C 5GMDA 2LY2A 3SDBA 2I10A 3T8TA 2Y31A 2JSCA 4BQAA 1OCCH 5CPRB 3ZR8X 4ZYGA 1HNZE 2DAOA 3PFIA 3TOBA 5K7ZA 2RAEA 3LAJA 1LE8A 2VOOA 1BI3A 2XASA 4AIHA 4G12A 2DPUA 1I27A 3I59B 4KIBA 3H9GA 2C39A 3OIQA 2XAHA 2OQRA 1VQMI 1Y0NA 3TEDA 4DR6I 1WWXA 1R23A 2FX0A 4DIQA 1K78B 2JA7J 3RZDJ 3ECOA 3PQJA 3JAMK 2K7LA 4ESBA 1B59A 4A2UA 3PNVA 3TO7A 5ERIA 2KT0A 3HSRA 2BR2B 4D9JA 2WC2A 1MNDA 2FEZA 4EMDA 3MKYB 2LNBA 1J2XA 3DEWA 1FT9A 3DKWA 5JLWA 1Y4UA 1T6SA 3IRRA 3E1SA 1ZGJA 3WGGA 4WK8F 3KRNA 4M6VA 5HDGA 1ZXNA 2DQRA 4RA2A 5FJ8J 1XMKA 1U0JA 3M1EA 1UHWA 2KJCA 5KVRA 5E8IA 2Y0SA 2W82A 2E2JJ 3GTQJ 2WAFA 2R7XA 2EH3A 3ABTA 4LFCI 5D8KB 3F8MA 1W5SA 5LD2C 1OYYA 1YS6A 2X36A 3IAS2 1W1WE 3Q0WA 3F21A 4ENKA 2V9VA 2GXBA 2L4MA 4FX0A 2XPWA 1I39A 3VODA 2UXDE 2OA4A 1NK2P 2ZJ2A 2J5OA 2K9SA 3M8FA 2VE8A 2D5VA 2J65A 2CS3A 4DV7E 3QYFA 2F5CA 3L7ZB 3CF5F 3SJMA 4A6DA 3LQQA 3H3VK 2ZM6E 1W36D 1ETQA 3CO6C 1RETA 1G4DA 1PKPA 4DPTA 4GKJE 4MQYA 3DV8A 9ANTA 3VOEA 2NVYJ 2CSOA 3HSEA 3WG9A 2L5QA 1DGWY 5E1WA 2PJRA 2NOGA 4B3TI 3M7NG 1LEAA 4N9HA 1IDYA 2HHHI 3IAM2 1AWCA 3S2HJ 4CZCA 4JX6A 1H7UA 4HNVA 3PYDA 5CLSA 1PDNC 2PJPA 1FBSA 2F4IA 1RR7A 3B6CA 5GAEJ 1UDNA 1B9MA 2BM1A 1GXPA 2YX7A 3BG9A 3AFHA 1JGSA 1KQ0A 2M45A 4P5OA 4HPQA 1G8XA 1ZXMA 5J6XA 3L2UA 2EIKH 1QHHD 2NS7A 4EM1A 2E1RA 3IC7A 2DYRH 5E1XA 3GVAA 1FIPA 2E2HJ 4I0BA 3BG6A 5HS9A 1NZ0A 1W7PA 3ELKA 4A3MJ 3LFKA 1JJ6C 2PO2A 1POGA 3BQYA 3MZYA 4DR4I 1UHMA 3CDJA 3CZ6A 4AQYE 3K4MA 4YHHE 2Q2EA 3TMOA 5D5UB 4CICA 1IF1A 1H74A 4HBLA 2E7WA 5GP9A 1FNMA 5K36B 1G6NA 3JRFA 2WP8B 2UXNA 3G3ZA 2KQRA 3AG2H 1K6OA 1AU7A 1A6FA 2O0YA 4IHVA 3SXYA 1DQUA 3J80K 3GTJJ 1IJWC 3SFIA 3WTSC 2Z5CB 3VYRB 4DV1I 1USTA 3QPTA 1LKXA 1V54H 1ZG3A 1BIBA 2IOPA 1XD7A 4EJOA 1JHHA 4M3EA 2PQ8A 3NEUA 3WU5A 4OIRF 4EATA 2I8DA 3B02A 3C2GA 5HVQC 3CQZJ 3G6EI 1YJNI 3ROUA 4CUGA 5IYCJ 1IXCA 2TRTA 4IZJB 5JHUA 1FBQA 3MKZA 2VOPA 1O4XA 4V2GA 1O7FA 5D6EA 2IS4A 2HDCA 3CLOA 5DYMA 4QPQA 1YO5C 1GUUA 1BI1A 3MEXA 5IT3A 1YRNA 2W84A 2UUZA 5DUIA 3PS1A 2P6SA 1I6HJ 1XNRE 1XB4A 1LEBA 2BYVE 1R1UA 5F27A 2LJPA 1A6QA 1K6YA 2RKHA 1BW5A 1Z7UA 4JX4A 4UUTA 4KHPI 5JEAE 2Z5UA 4LD5A 4XKBA 4E7SA 1Z0BA 4JYAE 2V9PA 3K2AA 2XKPA 3HOYJ 4MTEA 5F64A 1FSHA 1ZRFA 3OOUA 4V2FA 5EEGA 3WU0A 1R58A 3TW6A 4RM2A 4YHHI 3BJOA 2IERA 3CCVI 3JR9A 4PJMA 3R6SA 2OAZA 5H2FC 1XGMA 2E60A 4S05A 1Z91A 1ZAOA 3SHFA 3D0SA 1IN8A 2CU7A 5E20A 4F52A 1OJLA 3GXOA 3JCUC 5CVIA 4IJAA 1Z0CA 2V6EA 5CVUA 1Y39A 3WTVC 1W36C 4B3ME 2HWVA 1A35A 4IHSA 1A36A 5AIQA 3KETA 4IEJA 1R00A 4AUXA 4PDKA 3WU3A 4HDUA 4B3TE 2JA8J 2PLYA 5KCMA 1OCZH 2DOEA 2KRCA 2W48A 4HSRA 1YIOA 3DTIA 5GAGJ 3F8FA 2DPDA 4A3JJ 1BOBA 4LF6E 3KP5A 3BZ6A 5E79C 2XGEA 3S8PA 4MTDA 1XSVA 4MU0A 3W6KB 3TDZC 2CFOA 4GO1A 4R79A 1ITYA 4OIOF 3ASNH 3DU6A 3CC2I 3LNUA 3V5RA 3JRCA 2JMWA 3ASOH 1QNTA 3L2WA 3OL4A 3DPTA 2E1CA 4OO1C 1VI7A 3ABLH 1WZ2A 3Q6MA 2YX4A 4KUMA 4DJAA 2ECBA 5K5OA 4FW6A 4BJ5C 3M7ND 4CDGA 3OR2C 3NZKA 5JEAB 1SD4A 2WV1A 4N9IA 1FKAE 5L3GA 3HB9A 1IDZA 1Y4SA 1FJGE 2XAQA 3K6GA 2JZYA 1VI0A 4A5NA 2LSOA 4JX5A 4WUCA 1ZLJA 4HX8A 3KYDB 3BCAA 3LA3A 1H7SA 2CQNA 2ZITA 4JI2I 4DR5E 1Z0XA 2KZVA 1WI3A 4B3RE 2EK5A 2V34A 4LFBE 4MQVA 4ENMA 3TQNA 2QKLB 1LFBA 3GZ5A 3ZN1A 1X1BA 1OISA 4HX7A 5JEAF 1TZLA 5ICFA 2ZNYA 2W1OA 3M9AA 4QNKA 2PO0B 3DLLF 3ZCOA 4JV5E 4X66I 2Y9YA 1BI2A 4I0AA 2DFIA 1Z7LA 1YITI 5K36D 4DUYE 4Z6YA 5J4YA 1HF0A 3L7WA 4MHGA 5LRSA 4G94A 1D1CA 2HPMA 1RPWA 2EFPA 3OOPA 1J75A 4OINF 2EFGA 3PYGA 4R8HA 3ML6A 4MU4A 3E3VA 1T38A 1TTYA 3PSIA 4GCVA 4B09A 2OD5A 4JI5E 4P7AA 1Q1VA 3S3NA 2BA0G 2IGNA 3JRHA 3HEFA 5IWAE 4P96A 4XBFA 4FN5A 2H6BA 2L7ZA 2HVRA 2VJ4A 3A01A 3DLAA 5H6RA 1GV5A 4KMUX 3PRYA 3ZPLA 5JVTA 1I1SA 4HV5A 4UUSA 1EA6A 5C0XF 2UWMA 4L9NA 4L5EA 3IKTA 2V1NA 1N34I 2B7EA 2KDZA 1GVDA 3M07A 1A5JA 5K36F 2GO4A 5FWKA 2X6XA 3DF8A 3H3ZA 3RYPA 1Y60A 1MMSA 3BZCA 3SEQA 4DNCA 2GM4A 1WRJA 2JVGA 3V4GA 2O3ZA 4NXNE 4XIDA 2P4WA 4KDPA 2BW3B 5FFZA 3P3CA 2W24A 2H8RA 3C1DA 4JI7E 1UHSA 2DQLA 1WPKA 4BHCA 1DGRM 3F0CA 2HFUA 4JI4E 4XM3A 2FBKA 2L7FP 5LHHA 4B3SE 2M87A 1TWCJ 5KNLA 2QKMB 5BNGA 2DCEA 5K5QA 4BH9A 4Z7YA 2O8KA 4LFAE 1STZA 1R6LA 1VNDA 2YUSA 4LF8E 4RS8A 2NAZA 2XDVA 4HAMA 1ETKA 5K1YA 2FF4A 1D0YA 4BAYA 4A93J 1H89C 1AKHB 3T1YE 3M4OJ 3FK7A 1O3QA 2RQQA 4PFOA 1UMQA 1TNSA 4UUSB 3MKWB 4DZJA 4BXUA 4WWCA 4GDFA 4I2OA 2FA5A 2WAEA 4UVAA 1O3TA 2YR2A 2TDXA 5J1RA 1FYKA 3A01B 4YRVA 4PRVA 4IL6C 4XLHA 2V2VA 4IZJA 5C44J 4R1FA 3K1JA 4II3A 1OYWA 4DYCA 3JRDA 2M7AA 1TWFJ 1N36E 1ETXA 2LK2A 4Q47A 3ZOBA 3HOTA 1HDPA 2BOLA 2DMPA 4AU7A 4JI1I 2EZHA 2OTJI 1YI2I 1VQPI 3REOA 2DA3A 4M9ZA 1XGOA 2GXGA 2QQBA 4KJZA 1FX7A 3V7RA 4BEHA 4FWHA 5H20A 4B4CA 2O9LA 1P7IA 2WAQA 3DU5A 1W0UA 4IKFA 2AO9A 2MSYA 1HC8A 3B4TA 3K7AJ 2XAFA 4UUVA 2DA4A 2MFZA 4HNTA 3CJRB 1BI0A 1Z0GA 2R5ZB 2ZKZA 2OCCH 2IEKA 1PUFA 1NH3A 4USMA 2F4MB 4HYEA 4FASD 1YE9A 3O8HA 4YFXF 1SVLA 3OYKA 3M3YJ 4B3XA 3CTAA 3P5JA 3GYHX 5IOZA 4DR1I 2DOAA 1SMYF 1V5EA 5IT9Z 3PUFA 4I02A 3AG1H 4HF0A 5DCMB 4XK4A 1T39A 2K9NA 1RUOA 2CV0A 1FY7A 2UUAE 2CW8A 2VQHA 1KVKA 2FRHA 4JI8E 2K3PA 4XLFA 3HL2A 3QP5A 3DEUA 4DV3E 3LSKA 1V3FA 3KPHA 3B73A 4II2A 1ZYRF 2V1XA 3N4MA 3L09A 4F3QA 3VSKA 3TOAA 2R92J 1XMAA 2O7OA 2VKHA 3BP8A 1HK7A 1SD7A 4LF4E 1T95A 3FIWA 4G7OF 2FU4A 2ZO4A 1A6IA 3GFJA 4IZZA 3QWLA 4DQ2A 2XEXA 4XRSG 1TW2A 1ETVA 2D2WA 3BDDA 3AKZA 3LSIA 5DRRA 4FW3A 2L01A 2A69F 2HOEA 5ILSA 1MU5A 2IA1A 1I3QJ 3CDLA 3SFZA 2A3SA 2QLZA 4WF2A 1N0UA 4LPFA 5FKMA 5LL6R 4U87A 4A3LJ 2HDWA 3DBHB 2HK2A 3K10A 3J80C 1MKMA 3PL8A 3QP6A 3HKZN 2HK3A 4MU3A 1KU2A 2A2CA
chains in the Genus database with same CATH topology
3H1CA 2JEBB 4OO1F 4AIMA 2WNRA 2JE6B 4IFDA 3L7ZA 4OO1C 2PO2A 4BA2A 1UDQA 4OO1B 2NN6F 4IFDE 5K36C 3CDJA 3M7ND 2NN6D 1E3PA 5JEAB 2C38B 4BA1B 5K36B 1OYSA 3GLLA 2WP8B 5C0XB 4NBQA 4AIDA 2BA1G 3DD6A 2C39A 2C39B 5JEAC 4OO1D 2BR2A 5JEAF 3B4TA 4BA1A 2PO0B 2PNZA 2C38A 2C37A 5K36D 2BR2B 1E3HA 5C0XC 2C37B 2PO2B 5C0XE 3KRNA 5C0XD 4IFDD 2WNRB 1R6MA 2PNZB 2PO0A 3M85G 4IFDC 5K36E 2WP8A 2BA0G 5JEAE 2PO1A 5C0XA 2BA0D 1WHUA 3HKMA 3GCMA 5K36A 3M85D 5C0XF 3L7ZB 2JEAA 5JEAA 4AM3A 2JEBA 1OYPA 2NN6A 1UDOA 1UDSA 5K36F 4OO1A 4BA2B 4IFDB 2NN6B 2JE6A 4OO1E 5JEAD 2JEAB 3CDIA 3M7NG 3GMEA 2NN6E 2NN6C 4IFDF 2BA1D 1UDNA 3U1KA 1R6LA 2PO1B 1OYRA 3H36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1C A;  2JEB B;  4OO1 F;  4AIM A;  2WNR A;  2JE6 B;  4IFD A;  3L7Z A;  4OO1 C;  2PO2 A;  4BA2 A;  1UDQ A;  4OO1 B;  2NN6 F;  4IFD E;  5K36 C;  3CDJ A;  3M7N D;  2NN6 D;  1E3P A;  5JEA B;  2C38 B;  4BA1 B;  5K36 B;  1OYS A;  3GLL A;  2WP8 B;  5C0X B;  4NBQ A;  4AID A;  2BA1 G;  3DD6 A;  2C39 A;  2C39 B;  5JEA C;  4OO1 D;  2BR2 A;  5JEA F;  3B4T A;  4BA1 A;  2PO0 B;  2PNZ A;  2C38 A;  2C37 A;  5K36 D;  2BR2 B;  1E3H A;  5C0X C;  2C37 B;  2PO2 B;  5C0X E;  3KRN A;  5C0X D;  4IFD D;  2WNR B;  1R6M A;  2PNZ B;  2PO0 A;  3M85 G;  4IFD C;  5K36 E;  2WP8 A;  2BA0 G;  5JEA E;  2PO1 A;  5C0X A;  2BA0 D;  1WHU A;  3HKM A;  3GCM A;  5K36 A;  3M85 D;  5C0X F;  3L7Z B;  2JEA A;  5JEA A;  4AM3 A;  2JEB A;  1OYP A;  2NN6 A;  1UDO A;  1UDS A;  5K36 F;  4OO1 A;  4BA2 B;  4IFD B;  2NN6 B;  2JE6 A;  4OO1 E;  5JEA D;  2JEA B;  3CDI A;  3M7N G;  3GME A;  2NN6 E;  2NN6 C;  4IFD F;  2BA1 D;  1UDN A;  3U1K A;  1R6L A;  2PO1 B;  1OYR A;  3H36 A; 
#chains in the Genus database with same CATH topology
 4OMZ A;  3DWL E;  4NC7 A;  1ZH5 A;  4IRI A;  5TJJ A;  4ZTF A;  4OO1 F;  1V4R A;  3OTO I;  4ITV A;  2GO3 A;  1HNX E;  1OLT A;  3UR3 C;  3ZKB A;  2A2D A;  1USS A;  2R7V A;  4MGR A;  4FCY A;  3QOD A;  4MFD A;  1UDQ A;  4XN3 A;  2NN6 F;  4FW7 A;  3QOP A;  1TQP A;  3WHB A;  1FWK A;  3OIO A;  3K4N A;  4CCK A;  2O1T A;  2K9L A;  3K69 A;  2CW0 F;  1QVU A;  3DPL C;  2V2Z A;  3ZZU A;  4U88 A;  3FHZ A;  1PUF B;  4UY8 I;  2BV6 A;  1OYS A;  3GLL A;  4YY3 I;  2VB6 A;  4HV6 A;  2DEJ A;  2PFB A;  2OUM A;  1FLI A;  1DU6 A;  5C0X B;  1B9N A;  1Y8Q B;  5C4J J;  1OR7 C;  4LF7 I;  4YIF A;  5DUK A;  2OI2 A;  3FIS A;  3J80 Q;  4BY1 J;  2BA1 G;  3K9T A;  2G9W A;  1WJC A;  2CUZ A;  3I55 I;  3P7N A;  2M8G X;  1FYL A;  3CD6 I;  1SEU A;  5JEA C;  4P55 A;  2LF7 A;  1VQ8 I;  2BV3 A;  1GT0 C;  1KU9 A;  3RPU A;  2DDB A;  3ESW B;  3R0A A;  3VSL A;  2Z9O A;  5DRP A;  4P1W A;  2F5F A;  3QOE A;  3W6J B;  1E0E A;  2QSH X;  2EIJ H;  4G6T B;  3CWV A;  1I1G A;  3U1D A;  1BR2 A;  4AC0 A;  1Z1D A;  5B1B H;  1V5F A;  2CUJ A;  5ICE A;  4UNO A;  2R7T A;  4KYW A;  2QVO A;  2L2O A;  4DV1 E;  2YS9 A;  1SFO J;  1LVK A;  5DRQ A;  1F1Z A;  4YG2 F;  1L0O C;  2HQN A;  1KZH A;  4USK A;  3CJT B;  3KYL A;  1MBH A;  1R6M A;  1HBX G;  2IS6 A;  2V1D A;  5FGM A;  4IZK A;  5FLX C;  2HOA A;  5EZH A;  2E1M B;  4CGZ A;  1L3L A;  4A0Z A;  4BS9 A;  3AG3 H;  3LSJ A;  1XGN A;  4B43 A;  2HZD A;  1YW7 A;  3DQV C;  2QCO A;  4M73 A;  2DFH A;  4RB1 A;  2LP0 A;  4DBQ A;  2W57 A;  5GME A;  3TL4 X;  1CQT A;  3UNG C;  2FSW A;  1FMW A;  4U3D A;  1T0F C;  2EV0 A;  5ELW A;  1YQA A;  3LSP A;  1ODD A;  2VKE A;  4CXF A;  4DYQ A;  1EJ9 A;  4NHJ A;  4DR4 E;  1XSX A;  2KMU A;  3DBR B;  2FMY A;  2JPB A;  2LKP A;  4JI0 I;  2KP6 A;  1EI1 A;  5L3C A;  2A61 A;  2CYY A;  4Y7N J;  4RB2 C;  4NC6 A;  4A3I J;  4LF9 I;  5DNL A;  1BM9 A;  4XSZ F;  5LMU I;  4GYG A;  5JLX A;  3MKL A;  3FF5 A;  1T98 A;  5TIS C;  1WQ2 A;  2DJI A;  2Y0S N;  3TBI A;  2NN6 E;  1TQM A;  1TLH B;  3OYN A;  3EET A;  2ZJR F;  3EYI A;  2CG4 A;  3LMM A;  3Q0U A;  2EFN A;  5FFX A;  2OQG A;  3OS0 A;  2STT A;  5CYV A;  3AAF A;  2PJR B;  3GFM A;  1IBK E;  2W00 A;  3FKI J;  4M3B A;  2Z5E A;  2JWT A;  5JVG F;  2VPL A;  4C2T A;  1ON2 A;  4NQW B;  4E6K G;  3VFZ A;  4BYY A;  5HNH A;  4I6Z A;  1Y6I A;  3AL0 B;  2UUA I;  4DUZ E;  4LG3 A;  4XN0 A;  4A3C J;  3LFU A;  1KQ8 A;  4X0G A;  1KYZ A;  2JE6 B;  3Q3S A;  1R1T A;  4LLL A;  3VB2 A;  2VXD A;  4ZVI A;  4F92 B;  5BPD A;  2XPU A;  4UVC A;  1T0F A;  3IUO A;  3WU2 C;  2F5V A;  5F0C A;  3MWM A;  2EV5 A;  2NNN A;  1BIA A;  4RM3 A;  3FWE A;  2VL8 A;  2NRA C;  1FWL A;  1XXE A;  2H09 A;  5B1A H;  5LGN A;  3OR1 C;  4ETS A;  1W4M A;  1I3A A;  1P42 A;  2UXB I;  4A0Y A;  1SFK A;  2XSD C;  5L3J A;  5A2Q Q;  2RGV A;  4HST A;  4LK1 F;  4M9S A;  2WWY A;  2DMT A;  3HRS A;  1LFP A;  4OAY A;  3V7S A;  2IOQ A;  3NAR A;  1LJ9 A;  1JUM A;  5LGU A;  3OYD A;  3CCE I;  2LYC A;  2H94 A;  1MMA A;  1SMT A;  2BR2 A;  2R42 A;  2X7I A;  1MJA A;  3PIO F;  3PM1 A;  5LMU E;  1JKR C;  3BTC A;  1VQO I;  2QM3 A;  2W25 A;  2XAG A;  3MN2 A;  2LVS A;  1K78 A;  2IRF G;  3IV5 A;  1X4P A;  4BDZ A;  3W2W A;  2KRH A;  3BY6 A;  4QIW N;  3AG4 H;  4AVZ A;  4MDT A;  4PRX A;  3JRE A;  1ETO A;  1HNW I;  3Q9V A;  3I59 A;  1YG2 A;  1S16 A;  5C0X D;  4DR2 I;  1VQ6 I;  5CVR A;  4RGU A;  5K7H A;  5EG0 A;  2F4V I;  2PX9 A;  2IBD A;  2Y30 A;  3R60 A;  2YU3 A;  4WXH A;  3HUG B;  4GGG A;  4JI5 I;  4MEY F;  1S8N A;  5EZG A;  3C3W A;  4ED4 A;  3KLO A;  4H0E A;  3GTO J;  1O3R A;  2HU9 A;  3K4L A;  2HS5 A;  1RRJ A;  3LA7 A;  2NVX J;  3CUQ C;  4KHP E;  1DUX C;  3HBL A;  1EF4 A;  3S1M J;  1Z6T A;  2V9K A;  4AIK A;  1K4T A;  1PP8 F;  2QYO A;  5FRM A;  1N75 A;  3IL2 A;  2GLO A;  4GXO A;  4AM3 A;  3MCZ A;  3HOS A;  4ZH4 F;  3J80 Z;  1RR8 C;  4BXX J;  4A69 C;  1KGS A;  2L54 A;  1VTN C;  2JVH A;  2Y69 H;  1V55 H;  5FRN A;  1K61 A;  2DA1 A;  5FO5 A;  2BVL A;  1YX5 A;  3GTL J;  1ERD A;  2UXC E;  1OKR A;  3IH2 A;  5JEA D;  3PNT A;  1FPQ A;  5M5Y J;  3H5R A;  1NG7 A;  1X1P A;  4JI2 E;  1ZG1 A;  1YH8 A;  4WCG A;  2VQG A;  3LSM A;  4I7H A;  4EGY A;  3PFY A;  3OYH A;  3GX4 X;  4EJT A;  2VQE E;  1B4A A;  5M3M J;  1UJ8 A;  2IPQ X;  4WXD A;  1MNM C;  2AHQ A;  4LIT A;  4FIS A;  2BA1 D;  3JRI A;  2JRM A;  3CCL I;  4LF9 E;  1XS9 A;  1B72 A;  2HKO A;  2XRO A;  4HAC A;  4ZC3 A;  4J3D A;  1GLN A;  4OKG A;  2F6C A;  1QO0 D;  1DPU A;  1B1B A;  3B8H A;  5HLH A;  4X62 I;  1KQ9 A;  3H1C A;  2X1C A;  4DR3 E;  3IRQ A;  2BW3 A;  3HRM A;  5LHI A;  2V8P A;  2K27 A;  1Z0T A;  3KEO A;  1DPR A;  1X3U A;  2GS8 A;  2E1O A;  3QT5 A;  1U3E M;  4HA8 A;  4NB5 A;  2QQA A;  2X1D A;  4PSW A;  5EEH A;  3ZMS A;  2HXO A;  4CZZ A;  2VLA A;  1Z5C A;  4OO1 B;  2VJ5 A;  3A1Y A;  3W6V A;  4L9T A;  4F55 A;  3VDX A;  4NUB A;  4U7B A;  4B1R A;  2R7F A;  4DUZ I;  2A6E F;  1ZRC A;  4J19 A;  2X1E A;  1A04 A;  4UB8 C;  4KIS A;  1R1V A;  1MDM A;  4R1H A;  4E4H A;  3K1N A;  4P9U A;  2XC7 A;  3LNQ A;  3S3O A;  3S93 A;  3LSR A;  1FYM A;  2WW4 A;  3E7L A;  4RAG A;  2VJJ A;  3TGN A;  2NYX A;  4A0X A;  2Z33 A;  1C0W A;  5GPA A;  1HKT A;  1MBE A;  2LKX A;  1X2M A;  1A31 A;  3MD2 A;  3ZQH A;  2ZC2 A;  1P4A A;  4I98 B;  1CF7 B;  1N77 A;  1FIA A;  1JUP A;  2CRG A;  4BHP A;  3GFI A;  4Y52 J;  1HA8 A;  1NTC A;  2LDU A;  2F4O B;  2Z5C A;  4XTJ A;  3I56 I;  4AYB A;  3HGY A;  2C38 A;  2DMN A;  2RDP A;  3FXK A;  4BL0 B;  4HQE A;  2CWE A;  2LRE A;  4K0K I;  4BQN A;  3A03 A;  1Z77 A;  3LAP A;  2R7Q A;  1HNZ I;  2F2E A;  2DA7 A;  2PO0 A;  4LOC A;  2Q2E B;  3RZO J;  2DOF A;  2QUF A;  2XF6 A;  5LRR A;  1Y56 A;  1PIE A;  3DXJ F;  4XSX F;  3RDI A;  1HOM A;  4FTH A;  3I9V 2;  5CVJ A;  4E7L A;  1DP7 P;  2YPR A;  2MH9 A;  2R7U A;  1J0R A;  1FOX A;  2PI0 A;  4XOR A;  5LEJ A;  4JI8 I;  2R3S A;  1ZM3 A;  1B72 B;  3S14 J;  4DR2 E;  4FQG A;  2D1H A;  4RPF A;  1IN7 A;  4KA4 A;  3PS2 A;  2AXT C;  3RIR A;  5DTD A;  3QT8 A;  2BA0 D;  1OCT C;  1HW5 A;  2OV7 A;  3GCM A;  2ZBK B;  1GVJ A;  2R3V A;  3KYC B;  2O8X A;  3VYT B;  1D0Z A;  3KZZ A;  1XMQ E;  1ETY A;  3J7A Y;  4LJZ F;  2E19 A;  3FXL A;  4BE1 A;  2M9H A;  4HW0 A;  2ELH A;  4C3H J;  1YJW I;  4X64 E;  5DM7 F;  4DV0 I;  1Z59 A;  2Z5B B;  2EIN H;  2UUC I;  2VBY A;  2JEA B;  2Y0M A;  5EGO B;  2HKX A;  4JYK A;  3D5S C;  4HX4 A;  1YTY A;  3P3G A;  1S7O A;  2Q0O A;  1UG2 A;  4L5I A;  5EGO A;  3H9J A;  2HOT A;  1R7J A;  3A0H C;  2IVM A;  4L18 B;  4A3B J;  3RKX A;  3BRO A;  1HKS A;  4BKX A;  1LDK B;  4GKJ I;  3GFL A;  2QZ8 A;  3I71 A;  1S9H A;  1FTZ A;  5LMN I;  2JN6 A;  4KN7 X;  2XKO A;  1D5V A;  2GXA A;  1ZM9 A;  4FW5 A;  3V2U C;  3OTO E;  4MNU A;  2UU9 I;  4ZYA A;  3R4K A;  1H88 C;  2FUG 2;  3KEQ A;  4BA2 A;  2XUB A;  3Q9S A;  2ZBK A;  4Y4R A;  2R5Y A;  1MMN A;  2JTV A;  3NWT A;  3PO3 J;  3C18 A;  4G7Z F;  1BL0 A;  4LCF A;  3WHC A;  3OYA A;  2R7O A;  1GV2 A;  2BY1 A;  4IHT A;  1SAX A;  1NK3 P;  3FXR A;  2ZFW A;  3K4C A;  1WJA A;  3ZMV A;  1KU7 A;  3L2V A;  4N4O B;  2VXZ A;  4ZDL A;  5DV5 A;  1YIJ I;  4KIG A;  2ETH A;  2DFE A;  4M6X A;  4EVI A;  4IHW A;  4JOM A;  4CCN A;  2X51 A;  4WXC A;  4OO1 D;  1Z67 A;  3FZV A;  2KZG A;  1PVE A;  3ABU A;  2E34 A;  2ZXJ A;  3I4P A;  1JJ8 C;  4UV9 A;  2KDO A;  5E8G A;  3QPH A;  3TKY A;  4RLQ A;  5JHF A;  4RGR A;  2VBZ A;  3G4S I;  2K9Q A;  5EDN A;  2L9S A;  2O03 A;  3V7C A;  3BPX A;  2OZU A;  4DR5 I;  4BAC A;  5ILV A;  3OYF A;  1H8A C;  4B3R I;  5HOO A;  4AVP A;  2O1W A;  5AON A;  1E17 A;  1IAW A;  2O3F A;  2HTJ A;  1T8I A;  2K9M A;  1JGG A;  2QQ9 A;  4Y15 A;  3VPR A;  1LNW A;  2ELJ A;  4OMY A;  3HSF A;  2WTE A;  1KU3 A;  4DV5 E;  1QBJ A;  2R93 J;  2M3A A;  3ULQ B;  5GTI C;  3P06 A;  1T2K A;  4LFU A;  1N78 A;  1JUS A;  1HNX I;  1QGP A;  2O61 A;  3S17 J;  1WJ5 A;  4E7K A;  1ZHF A;  3RQ4 A;  1UEK A;  2V79 A;  2OBP A;  3EUK L;  2H1K A;  2BBY A;  3F8B A;  4YEJ A;  3MFK A;  3U1Y A;  2LFB A;  1D5Y A;  2VIX A;  4HZF A;  4LOM A;  1YHC A;  3GWZ A;  5F08 A;  1WCM J;  2L02 A;  5JR3 A;  4BQQ A;  1K79 A;  1UDO A;  2NN6 A;  3T8R A;  2E5L E;  3G2B A;  1W7P D;  2NOJ B;  4DV4 E;  3QQA A;  4RLF A;  2X85 A;  1OMI A;  1ZGW A;  1MW7 A;  4PZJ A;  1WH5 A;  1W5T A;  3GME A;  4M3F A;  3GTK J;  2OPT A;  1QZE A;  1Z3Y A;  5B3S H;  2BVM A;  4HNU A;  1ZM2 A;  1YLF A;  1IW7 F;  1QZZ A;  1VQ4 I;  1JKP C;  4I3H A;  3M6A A;  4HDV A;  1YJ9 I;  3J7A G;  2HOS A;  4LFB I;  3D5R C;  4XLC A;  3D4J A;  4OU0 A;  5FD6 A;  3DBL B;  5DEQ A;  5J4V A;  4DXL A;  4B3M I;  2VQF I;  2V7F A;  3T1B A;  1VQ5 I;  3ZMZ A;  1BJA A;  4Z7C A;  2JJ7 A;  4M71 A;  4AIJ A;  3L00 A;  1E3O C;  4I76 A;  1S72 I;  4LCG A;  3BTL A;  3ZGK A;  4Y13 A;  2GQQ A;  4AWX B;  4BGD A;  3GTM J;  3HHH A;  4O5V A;  1FBU A;  2VES A;  4EEF G;  1YW8 A;  4DU7 A;  2DLL A;  3GZ6 A;  4M6Y A;  2VAS A;  2V2Q A;  1ONV A;  1SVO A;  5D6F A;  3TP0 A;  3RPQ A;  2VE9 A;  1RES A;  4BBR J;  5JFR A;  2DK8 A;  2NXN B;  1B62 A;  1J5E I;  3G1O A;  2LR8 A;  2GQ0 A;  2FOW A;  1X3Z B;  2BGC A;  4NBQ A;  5EG0 B;  4BXF A;  3WTW C;  3GF2 A;  3M8J A;  3BG3 A;  2BHZ A;  3WTZ A;  1Y1V J;  4ESJ A;  2E71 A;  4ENJ A;  2IGM A;  1F43 A;  1ENH A;  2QSF X;  3I54 A;  3BPV A;  2CQX A;  1P4X A;  4RAF A;  1G3W A;  3HHG A;  2K85 A;  5F1J A;  3EPZ A;  3TW7 A;  4DBR A;  4D5F A;  2K86 A;  5ICC A;  4DR7 I;  2M4G A;  2UXD I;  3CMA I;  2VPR A;  5CJ9 A;  3HTU A;  4B44 A;  3HZJ A;  2P5L C;  1X4O A;  3R61 A;  3CCR I;  1REP C;  3Q6N A;  5M5W J;  4GKK E;  4A3G J;  2DBB A;  3BR2 A;  3PNY A;  3H35 A;  4XRS A;  3COA C;  1D3Y A;  3OWT A;  3ZXS A;  2JT1 A;  2CW7 A;  2DI3 A;  4Y3O A;  4XOT A;  1QPM A;  2P81 A;  1R36 A;  3ERM A;  5F1R A;  2PBI A;  2ID3 A;  1VQL I;  2E1N A;  3FXM A;  4B8X A;  5IPA A;  2HYF A;  4XLA A;  3T1Y I;  3EUH A;  2A68 F;  3BG5 A;  2HYG D;  2PMZ A;  4BY7 J;  1I5Z A;  1TWA J;  3RKQ A;  3OY9 A;  2DMU A;  2FE3 A;  1VQN I;  4RGS A;  4A3E J;  2KRF A;  3S2D J;  1R9T J;  1TBX A;  2A5Y B;  2EJR A;  4UVB A;  2Z1D A;  1XC5 A;  4PUS A;  2LY1 A;  3LSH A;  2ZXI A;  4ON0 A;  4QNJ A;  4GFB A;  3S15 J;  3WU1 B;  2DDA A;  3CJN A;  4JI0 E;  2LLK A;  3NWS A;  2F1D A;  4URL A;  2JRT A;  2EZI A;  5LGT A;  2IXS A;  3OYM A;  2BZT A;  4FHT A;  4XKV A;  2KKO A;  5L3E A;  1OFC X;  4DV7 I;  2O5R A;  2JK3 A;  1IRF A;  2MGQ A;  2KLO A;  4KIF A;  4N0B A;  2HNH A;  1X58 A;  4Q4Z F;  2RNJ A;  1BR4 A;  3KP7 A;  4B47 A;  3ZP5 A;  1BW6 A;  2XVC A;  4M9X A;  5BOX A;  1SFU A;  2XGD A;  4A3F J;  5DCM A;  3MQ0 A;  3P3E A;  4D7M A;  5BMZ A;  1ZK8 A;  3GUD A;  5IT9 C;  1XCB A;  2ZXW H;  1U8R A;  1R5H A;  1UZC A;  3OYI A;  3GTG J;  3ZKD A;  4RGX A;  3CC7 I;  4LLN A;  2HEO A;  1DP3 A;  3PS3 A;  3CCM I;  3F6O A;  3I3L A;  1QA6 A;  1PP7 U;  3PYF A;  1EH7 A;  2F48 A;  4E7J A;  3EUH C;  1ZKG A;  4ZYE A;  3DKX A;  2EV6 A;  3QRF F;  1XHK A;  5AIP A;  3B82 A;  2NN6 D;  1E3P A;  3Q5F A;  5GAD J;  2F5D A;  5F0F A;  5DM6 F;  2EA4 A;  2L4A A;  2KIQ A;  3U9G A;  5IT9 K;  4W97 A;  3OYJ A;  4Z2Y A;  4DV2 E;  3S1Q J;  2IES A;  2XIG A;  2B0L A;  3WE2 A;  4OIP F;  1ZAR A;  2IJL A;  3EYY A;  4AYB N;  1MIJ A;  1NG6 A;  2W7N A;  2NPF A;  1NHJ A;  4JI3 E;  2VQL A;  4IZK B;  5E18 F;  4IQJ A;  2PMH A;  2FXA A;  1VQ7 I;  3BTI A;  4EGZ A;  1TT0 A;  1P2F A;  2RV8 A;  3K17 A;  2KJB A;  2DTR A;  4G8X A;  5FRO A;  4M74 A;  2FQ4 A;  1XMX A;  1ORK A;  1G3Y A;  2HQR A;  3NAU A;  3BZK A;  4C9Y A;  3C2B A;  1RHY A;  3I4N J;  4EM2 A;  1R5G A;  2B9S A;  3BR5 A;  4XLN F;  3EUA A;  3E0J B;  3ZQF A;  3QT6 A;  1HKQ A;  2MLK A;  5HLI A;  2FJ1 A;  2VQE I;  2ACJ A;  1UAA A;  3LTO A;  1LQ1 A;  2GOM A;  4KNY A;  5F0H A;  2WNR B;  1VFC A;  1AKH A;  4WX9 A;  3M1C A;  1Q1H A;  5IOY A;  3HC7 A;  1YX3 A;  1IO2 A;  4HG2 A;  3BR3 A;  4XRF A;  4MFE A;  1R49 A;  1ZLK A;  3HDD A;  1HLV A;  3I0T A;  1I94 I;  3G71 I;  3CCQ I;  2X6O A;  2ZSI B;  2W85 A;  2XRL A;  4B48 A;  1XDU A;  3CO7 C;  2V26 A;  3HIF A;  3MAJ A;  5IYB J;  2VOD A;  5EKW A;  1ZN2 A;  5FKL A;  2UZK A;  2RNG A;  5GPC A;  5FLM J;  3RQI A;  4PJJ A;  4Q48 A;  4HAC B;  1FZP B;  2DMQ A;  2LTP A;  5M5X J;  2N8G A;  1RUN A;  1WVR A;  2KHM A;  5E3L A;  2R5Y B;  1IRX A;  1U8B A;  1UDS A;  4LF6 I;  2PMU A;  1YYV A;  4BA2 B;  4XOP A;  1ZQ3 P;  3FXO A;  3DP7 A;  5D5X B;  5BPI A;  5FD5 A;  4OX9 E;  1P7J A;  1FWZ A;  3BJA A;  1Z0E A;  1GDT A;  5GAH J;  2I5U A;  2BY2 A;  2HFH A;  3H4L A;  4YEL A;  3JRG A;  1TL8 A;  4A12 A;  2DU9 A;  1IN4 A;  5IP6 A;  3WOD F;  1D1B A;  5L3B A;  3IWZ A;  3IWF A;  2D45 A;  2VJI A;  1JKO C;  3U1K A;  2Z3Y A;  2B63 J;  4MIM A;  3KIO A;  2HR3 A;  4X64 I;  5L3D A;  3FXQ A;  1FJL A;  1ULY A;  4S0H B;  4YY3 E;  4HLY A;  1TWH J;  4EJV A;  2LG4 A;  2ZME C;  2UUC E;  4CO8 A;  5J1Y A;  1R4M B;  1RKT A;  2UXX A;  4PU9 A;  5DD8 A;  3C2H A;  3ZMD A;  3VWB A;  4XR6 A;  4C3J J;  3RYR A;  2M34 A;  1ELO A;  2M5W A;  2CV2 A;  3GZN B;  5LFA A;  2Z5B A;  1MBJ A;  1B8I A;  5L3F A;  2M30 A;  2EIL H;  4KT6 A;  1Y5Y A;  4EJU A;  2R4G A;  1WUU A;  3QPL A;  5B5E C;  4DW6 A;  4A3D J;  4JQF A;  4OWR B;  3PYE A;  4DPX A;  4D5C A;  2FQ3 A;  2CFX A;  4OZE A;  2XB5 A;  5B66 C;  1F4K A;  4JI4 I;  2D1V A;  2KIU A;  3KX2 A;  1X3W B;  2XF7 A;  3TP3 A;  1MG7 A;  2DT5 A;  1IRG A;  5D5V B;  4XRM A;  1QZR A;  4FWD A;  4KT5 C;  1KON A;  4AID A;  1Y6Z A;  4CCL A;  1FOK A;  3JRA A;  1ZG5 A;  2JUC A;  1RZ4 A;  2VT2 A;  3WGH A;  3DD6 A;  3HPH A;  1APL C;  4UTG A;  2OCE A;  3V8K A;  1SAN A;  1IUY A;  3JAM Z;  1R4N B;  2R5Z A;  2WA0 A;  2XSJ C;  2PNZ A;  4DPW A;  1EKE A;  3T0Y A;  2Y75 A;  5J1U A;  5EF6 A;  3Q1Q A;  2C37 A;  3L2R A;  4UHT A;  3D1N I;  2QGU A;  4HLX A;  1RI7 A;  3PIP F;  4HEA 2;  4HQM A;  1S7E A;  1MSE C;  4BEH B;  1WJD A;  2EZL A;  3CCU I;  2HFS A;  1Z0V A;  5HNF A;  3BR6 A;  1DAR A;  1HXD A;  5E17 F;  4D0P A;  1BBY A;  2Z2S B;  3DEE A;  3H0D A;  1QHG A;  4JK1 X;  4DV6 I;  1Z9C A;  4M3D A;  4BBS J;  3ABK H;  3FXJ A;  1XCV A;  2VBW A;  2WB1 N;  1O7L A;  2RQP A;  2ZB9 A;  3H3U A;  4DPY A;  3F8N A;  3LSG A;  4HF2 A;  4EV0 A;  2TCT A;  3N97 A;  2O1U A;  2XGC A;  3DTE A;  3K4K A;  2PN6 A;  5HS8 A;  1HNW E;  1DDN A;  4NQW A;  2UU9 E;  2A6H F;  1UB9 A;  1MDM B;  1IXR C;  2WV0 A;  1AA7 A;  1D8K A;  1OYI A;  4A6E A;  5E3M A;  3BLY A;  3U21 A;  3ZQL A;  1I6X A;  1EH6 A;  2IA2 A;  1SVM A;  4UXN A;  1XNQ E;  3KE2 A;  2LOO A;  5ICG A;  5A2Q Z;  4DV5 I;  4LFA I;  3DCF A;  3WG7 H;  1PJR A;  1IN6 A;  4OO1 A;  2LRD A;  2CUF A;  2K3F A;  3MMY B;  4FW4 A;  1UEL B;  3WTY C;  2ID6 A;  1KIJ A;  5JI6 A;  3FXU A;  4DUY I;  5K7F A;  4I01 A;  4ZDP A;  1W5C C;  1ZTR A;  3BR1 A;  4G9Y A;  5LHG A;  3QPS A;  2AJ4 A;  4XNF A;  4JI1 E;  4RB3 C;  1WI9 A;  2IP2 A;  3TDU C;  3GBG A;  4U0V A;  1HCR A;  1UG0 A;  4OX9 I;  2KIM A;  3OYL A;  3R0J A;  2DEI A;  4KN4 X;  2BXZ A;  1NHA A;  2UV1 A;  4LIU A;  6PAX A;  3JRB A;  2UXB E;  2ZM6 I;  5IWA I;  3RKY A;  3KCC A;  1WKM A;  4ZTJ A;  2VC0 A;  3I53 A;  2IT0 A;  1BR1 A;  3T5X A;  2WNR A;  2H27 A;  2YU9 J;  4L0Z B;  3T1H I;  5LMN E;  5BS6 A;  2MH2 A;  3K1P A;  1SFE A;  3HRU A;  3PJR A;  4IHX A;  4Q5S F;  5IY5 H;  4KFC A;  1EV7 A;  2LF8 A;  3ZQI A;  2ZJP F;  4N4N B;  3QU3 A;  4D1Q A;  5FKK A;  1SAU A;  3G73 A;  3H9Q A;  3FK6 A;  3ONQ A;  4DR3 I;  3VYU B;  3K85 A;  1H73 A;  1OCO H;  2M0C A;  3IP4 B;  1Y0U A;  5D4R A;  3J7Z I;  2COB A;  1HW2 A;  1XSD A;  3J81 Q;  1U2R A;  2W4S A;  4J00 A;  2K40 A;  2ESH A;  4MYU A;  2M0M A;  3ECH A;  1HR0 E;  1RNL A;  2DW4 A;  3B78 A;  4EJW A;  3HG9 A;  1Z21 A;  2G7H A;  1PYV A;  4X65 I;  1XNR I;  3S2W A;  5C3E J;  1VIS A;  5FKN A;  3D5L A;  5E3N A;  1TNT A;  2P6T A;  4IRH A;  2DYS H;  3HUG A;  3ZZ0 A;  2E5L I;  1XGS A;  3DTK A;  3P9I A;  4O6J A;  4LF8 I;  3CP8 A;  2CUE A;  2CVE A;  5HLG A;  2FBH A;  1KKH A;  3E6C C;  2HKE A;  4BE0 A;  1PVG A;  3ZM7 A;  4IQ4 A;  2FOK A;  4XLE A;  4N3O A;  3MZ8 A;  1E3H A;  1FC3 A;  3E5U A;  4LCH A;  1Z0W A;  3CME I;  3JTH A;  1BA5 A;  2PO2 B;  1W7P B;  4KQV A;  3FBI B;  4NXN I;  3RI4 A;  3OYB A;  2R0Q C;  4IOC F;  1HSJ A;  3CMM A;  1XTA A;  2FD5 A;  3J81 C;  4RDU A;  3H0G J;  4KMF A;  1USV A;  5K36 E;  3DPU A;  2GIV A;  2VI6 A;  4PGG A;  5E3O A;  1H0M A;  1Z05 A;  3W2V A;  5ED4 A;  3S3M A;  2E1M C;  2GIZ A;  2MC3 A;  2WAD A;  5HS7 A;  3BQZ A;  2J7K A;  3OIP A;  3SQN A;  2PEX A;  3ZRG A;  4IOA F;  2BEO A;  2YSR A;  5DCF A;  2E5N A;  2ZNZ A;  4PK4 A;  3CUQ B;  2GWR A;  1WHU A;  3ZN0 A;  3HKM A;  2LY9 A;  2VUM J;  4DV6 E;  5K5R A;  1WH7 A;  5FLX K;  1R22 A;  1B8I B;  4GKK I;  4CYC A;  3QAH A;  2NVT J;  4TV7 A;  4QLC U;  2E7X A;  2DO7 A;  4XON A;  2VKV A;  2OU2 A;  4QTR A;  3OV8 A;  3X2Q H;  2V4J C;  1MD0 A;  5LEK A;  3HRT A;  3Q0V A;  1N25 A;  4S04 A;  3W2A A;  3BR0 A;  2CQ7 A;  3A0B C;  3J81 Z;  1N32 E;  3HGG A;  2JE6 A;  1XX5 A;  4FE4 A;  2O1V A;  2PG4 A;  4CCM A;  4CCJ A;  1JE8 A;  1OPC A;  1P92 A;  4UV8 A;  2A6T A;  3ZQG A;  4JI6 I;  2QQ8 A;  3KZI C;  5IYD J;  1U2W A;  2PMZ N;  4I09 A;  2O6G E;  2IS2 A;  1XNQ I;  2AQF A;  2NN6 C;  4IFD F;  1X1D A;  2NS8 A;  3OSG A;  1VQK I;  2PNL A;  1MMG A;  1FP2 A;  1J59 A;  4BJT A;  4LGW A;  4G7H F;  2BXY A;  2J5P A;  1XN7 A;  2MD0 A;  2OF7 A;  1IV8 A;  3CF2 A;  3IH4 A;  4O3M A;  4G6Q A;  2Y9Z A;  1OCR H;  2ELK A;  3B6A A;  2OJE D;  4LB6 B;  4XIC A;  1J9I A;  1JHF A;  1FOY A;  2JA5 J;  5LBQ A;  1N33 E;  1OJ4 A;  4F7Z A;  1O57 A;  2EBI A;  1JKQ C;  1R71 A;  1RR9 A;  3I58 A;  2NS0 A;  1QU3 A;  4FWG A;  4AD9 A;  5HLT A;  3KP4 A;  3SDG A;  4LF4 I;  4ESF A;  5K36 C;  1Z5A A;  3FBN B;  3M8E A;  1Z5B A;  1T33 A;  3WTX C;  1TP4 A;  2EFW A;  3SZP A;  5M3F J;  3F9K A;  1QQI A;  4IFD B;  1VZ0 A;  1B6A A;  1R5I D;  2L0K A;  3ZQQ A;  2FBI A;  2VC1 A;  1ON1 A;  2MLG A;  3BCB A;  5DDG A;  3P9K A;  4YFN F;  3HM5 A;  1UFM A;  2LH9 A;  4ZDO A;  2AXL A;  1BC7 C;  1IBK I;  1CGP A;  4XQF A;  3M7G A;  1LPQ A;  1YRN B;  1LUJ B;  2MA3 A;  1MJB A;  3HJC A;  3HXL A;  1JXS A;  1IV6 A;  2Y2Z A;  1WJB A;  3HTS B;  4X1E A;  3V42 A;  1D8J A;  1HQC A;  2XB0 X;  3A4C A;  2VKD A;  4DV2 I;  4NNJ A;  1LVA A;  3A2K A;  4IS9 A;  1W0T A;  5C0X C;  1LB2 A;  4FET A;  1U9O A;  2AQE A;  1TWG J;  1K47 A;  2X48 A;  1WGX A;  3FMS A;  2RVC A;  1S6L A;  1VF9 A;  2DK5 A;  1ZEL A;  2KIS A;  2FML A;  3OS1 A;  4IO9 F;  1IGN A;  4L9J A;  3HOV J;  3M85 G;  2ZJQ F;  1LDD A;  4DGW B;  3F22 A;  4IRG A;  3P9C A;  2WAQ N;  4QPO A;  1WJE A;  2XHK A;  1YFH A;  2WP8 A;  4F93 B;  4EM0 B;  2Z16 A;  3RCO A;  1QVT A;  4ENN A;  3HYI A;  2M4K A;  3K4J A;  2BM0 A;  1U5T A;  3IH3 A;  5C0X A;  1AOY A;  5FKO A;  4XKW A;  5H6Q A;  2JSP A;  5CQG A;  4MEX F;  1EA3 A;  2WY8 Q;  3HOX J;  3KP3 A;  4DOZ A;  2K4B A;  3CC4 I;  5FLV A;  4PGH A;  5EYR A;  2R7D A;  4M72 A;  1G59 A;  1MJ9 A;  1MH3 A;  2RN7 A;  4DR6 E;  4FE7 A;  1ACI A;  4BU2 A;  1X2N A;  5BR8 I;  1P9Q C;  2NN6 B;  3MZH A;  2P5V A;  4OO1 E;  2BHY A;  1MBG A;  2X0L A;  5FLX Q;  3RKW A;  3L2C A;  1HR0 I;  4JI6 E;  3BWG A;  3BT9 A;  2XAJ A;  2ISZ A;  4OIQ F;  2C6Y A;  3GEZ A;  4X65 E;  4DU8 A;  2DA2 A;  4EMS A;  2DFF A;  2STW A;  2Y48 A;  3PO2 J;  2JUG A;  3A02 A;  1D6T A;  4GYI A;  2X6W A;  2HVQ A;  2EFQ A;  2PO1 B;  3IHU A;  2QSG X;  1SFX A;  1BJZ A;  2DJN A;  3MVP A;  2Q1Z B;  2GA2 A;  2DT7 B;  2H8W A;  2M7B A;  1SD6 A;  3WE3 A;  2JQ7 A;  2R7Z J;  1MMD A;  1WSU A;  1FJG I;  2VF3 A;  1BKN A;  3GW2 A;  3F0N A;  2VQC A;  3JAM Q;  4Y33 A;  4IFD A;  1HST A;  3L7Z A;  2LC2 A;  1KYW A;  1MX0 A;  4M1K A;  4X6A J;  5D5W B;  4BDY A;  2L7K A;  5GTH C;  4YIR X;  1LFU P;  4FW9 A;  3DFG A;  5KAI C;  1ZRE A;  1JTY A;  3J7Y J;  1ETW A;  5J8F A;  4RB0 A;  4A5M A;  4CYC B;  4HRI A;  2P0W A;  3TO9 A;  4IVN A;  1GXQ A;  3CJQ B;  5D4S A;  1OQY A;  1N33 I;  1USU A;  2VQF E;  3GLX A;  1I94 E;  3CUQ A;  1U9N A;  4JI7 I;  3KZY A;  5E1Z B;  1I50 J;  1XMO I;  4A3K J;  2AS5 F;  2ISY A;  3H5A A;  4H4K C;  4XKC A;  3JSO A;  5BQT A;  4YII A;  5F04 A;  1TQI A;  1MBF A;  2EQR A;  4CCO A;  5IP9 J;  1HW1 A;  3OYG A;  5HOD A;  4RBO A;  4BA1 A;  4U0Y A;  2LMD A;  4JG4 A;  3E6M A;  4W1U A;  2HVS A;  3LL7 A;  4NDL A;  1N32 I;  1FMV A;  2UXC I;  5CKT A;  2NVQ J;  4WUD A;  1MZB A;  1S7A A;  2EFO A;  2X9D A;  3IKV A;  5D8L B;  4BHB A;  2E36 A;  2K4J A;  3I64 A;  4MO7 A;  4L5J A;  1QPI A;  4HOB A;  1WJF A;  4UT4 A;  2RRE A;  2QWW A;  3F6V A;  2XF5 A;  3GO5 A;  3S32 A;  3LA2 A;  3OSF A;  3S1R J;  3HPG A;  5J3L A;  1IRZ A;  2MC4 A;  5DS9 A;  5A2Q C;  3PQK A;  4BJ6 C;  4PJN A;  1U6G A;  2VBX A;  3CP2 A;  1PUE E;  2CGP A;  2OZ6 A;  1YHQ I;  4LG0 B;  1BN5 A;  2IS1 A;  5A2Q K;  3PUB A;  1ZGA A;  3RTR A;  2EIM H;  1D0X A;  2G0E A;  2JPC A;  4XL9 A;  5LLQ A;  2JEA A;  5FB2 A;  2EB7 A;  4IZJ D;  2K02 A;  1TW3 A;  3K2Z A;  3HOZ J;  3RPU D;  3BTJ A;  1T56 A;  1RC9 A;  1U78 A;  2DTZ A;  4DR1 E;  3DKY A;  3F72 A;  3VEP A;  1FOW A;  3E5Q A;  4UB6 C;  5KAF C;  4ASN A;  1H9T A;  2COM A;  3O6B B;  4PCQ A;  1E2X A;  1J5E E;  2CQK A;  4LLG F;  2EA2 A;  3N05 A;  3JSP A;  4M3G A;  2X4H A;  1Y1W J;  5BR8 E;  3FM3 A;  4IPA A;  3NQO A;  1G3S A;  2LBF A;  3OYE A;  3S16 J;  2CMP A;  2KPM A;  2EZK A;  4PJ0 C;  5ILU A;  1OYR A;  4CYD A;  3J7A M;  3WTU C;  3H36 A;  2OTL I;  1IXS B;  2BE5 F;  3JW4 A;  2F5E A;  1XPX A;  4PSX A;  1XMQ I;  2OC6 A;  1UCR A;  3SZG A;  1J5Y A;  2VN2 A;  2MAB A;  5J8C A;  4NXM I;  3FDY A;  4LF7 E;  4IXA A;  4CH7 A;  1FTT A;  5DRO A;  4LF5 E;  1LDJ A;  4P9F A;  4E7I A;  3LPS A;  2EWN A;  4CSW A;  1KA8 A;  4DPU A;  5KHD A;  3GTP J;  4MLO A;  2HDD A;  1K83 J;  2QF7 A;  1J09 A;  3E6B A;  5J40 A;  2IGK A;  2C38 B;  3P76 A;  4HXZ A;  2QEX I;  4K2E A;  1V5G A;  2DN0 A;  4LB5 A;  2JT2 A;  2F4V E;  3FX3 A;  5EJC A;  2R7R A;  4X62 E;  2HZT A;  2FNA A;  2X6Y A;  4JBA A;  5DD4 A;  5IT9 Q;  1FNN A;  4ZYD A;  4LIV A;  1IBM E;  2WBM A;  5C4X J;  1GHC A;  4D7N A;  1OCP A;  3FM5 A;  4QSH A;  3SYT A;  1JT0 A;  4ISA A;  1X19 A;  4U3B A;  4X66 E;  2XAU A;  2HPI A;  3O8G A;  2LD5 A;  2KIF A;  4JP0 A;  3BG7 A;  2ZFU A;  1ZM4 A;  2EPF A;  3H92 A;  4FX4 A;  1FSE A;  3K1M A;  4DV0 E;  2ME6 A;  2HQA A;  2ME0 A;  1P6R A;  2XPV A;  3F8C A;  4F91 B;  1XG1 A;  2WY7 Q;  4KIT B;  1ZR2 A;  1G2H A;  3K70 C;  2C37 B;  4DV3 I;  4PJL A;  3LQR A;  3RJP A;  2KL4 A;  4RMN A;  4YFK F;  2GZW A;  1MSF C;  2PNZ B;  4MU1 A;  2HXI A;  2HKJ A;  2RC4 A;  4IFD C;  3LWF A;  1FI4 A;  1N0V C;  1IBL E;  3FMR A;  2MG4 A;  2BY0 A;  2JA6 J;  1OR7 A;  2LBF B;  4JYA I;  3BC8 A;  2Z99 A;  1F9N A;  1NHH A;  4DYR A;  2Q8K A;  4K0K E;  2CGE A;  2ECC A;  4EQQ A;  4DR7 E;  4PFP A;  2H6C A;  1XDS A;  3OL3 A;  3J81 K;  3M85 D;  1JI8 A;  4OOI A;  2QEN A;  2P7V B;  2MD5 A;  5JEA A;  3E97 A;  4L0Y B;  2ZME B;  3BJ6 A;  3HOW J;  1OYP A;  2JEB A;  3O3K A;  4HYM A;  2ICW G;  2P8T A;  2ADU A;  3I5U A;  3UHM A;  4XLP F;  4LMY A;  4ZJZ A;  1ZRD A;  4ZZD A;  4JV5 I;  4QWQ A;  4E7Z A;  1R6R A;  1WFX A;  3RSN A;  2MW8 A;  1TT5 B;  2NNY A;  3C7J A;  2E2I J;  3K4B A;  1XMO E;  2IW5 A;  2HGC A;  3QYB A;  2PNM A;  2GBY A;  1RIO H;  1O3S A;  2G7U A;  2UUB I;  3KFW X;  3WU4 A;  2A5W A;  3SEZ A;  4C2U A;  2A05 A;  3BOQ A;  1ZR4 A;  1Z3X A;  3LOC A;  4P52 A;  2CQQ A;  1FEX A;  3CCY A;  3CDH A;  5HDN A;  1Z6R A;  4ZZL A;  3NRV A;  4IHY A;  3OS2 A;  4C30 A;  3HUL A;  3UKG A;  4JI3 I;  1F36 A;  3ZQ7 A;  2ZXH A;  4MQ9 F;  1BC8 C;  1T08 B;  1JTX A;  3G1L A;  3FHN A;  2HYJ A;  4BUP A;  2ZME A;  2CV1 A;  2JEB B;  1J7K A;  5IP7 J;  2P5K A;  4J01 A;  4C3I J;  3U2R A;  2IA0 A;  1IG7 A;  1KTV A;  2L9R A;  4IFD E;  5KK1 A;  1G3T A;  2FNP A;  2IGO A;  3T1H E;  2L7M P;  4CHU A;  4LFC E;  2M2E A;  2A07 F;  3PSF A;  1VQ9 I;  4BA1 B;  3JTG A;  2GA1 A;  1FP1 D;  4B3A A;  2QA4 I;  2CO5 A;  1IN5 A;  2GOX B;  4BQO A;  1S29 A;  4E70 A;  2HHH E;  3ISP A;  4XMY A;  1F5T A;  5CQE A;  3F23 A;  1H9G A;  3K0L A;  5J47 A;  4RAY A;  2KFD A;  1EH8 A;  1IBM I;  2ZSH B;  4FT8 A;  4U7D A;  2C39 B;  3WTT C;  1M1E B;  1MBK A;  2XRN A;  2R7W A;  2DXI A;  2R7S A;  4MYT A;  1K4S A;  3W3C A;  2L9V A;  3CUO A;  1YS7 A;  2DA6 A;  3H5N A;  4IX7 A;  1LE8 B;  3HOU J;  2CH0 A;  5TRD A;  4DV4 I;  5TGT A;  3GON A;  4LK0 F;  1QRY A;  5EEA A;  2IAI A;  1AHD P;  2VON A;  1BOA A;  4IF4 A;  5HDK A;  3L2Q A;  3QT7 A;  4WUB A;  2L9N A;  3I4M J;  2UUB E;  1CF7 A;  3F3X A;  1X1A A;  3VYS B;  2XGX A;  4ZYH A;  5C0X E;  2LKS A;  4HY1 A;  1Y8R B;  4IFD D;  2ZCW A;  1IZ1 A;  1P4W A;  3CLQ A;  4G6D A;  1YW9 A;  2MYS A;  1SD5 A;  3OYC A;  2HTS A;  1SC7 A;  1N34 E;  4GRI A;  3V8L A;  3HJE A;  2DOD A;  2PO1 A;  3V8J A;  2HQ5 A;  1N36 I;  2HI3 A;  1JT6 A;  3LST A;  2QBY A;  5CVV A;  2NVU B;  3HKZ A;  3WU6 A;  4NXM E;  2VT3 A;  4LF5 I;  4RAZ A;  3ZZT A;  5K36 A;  2DA5 A;  1HDD C;  3KP6 A;  2E5Z A;  3CCJ I;  1K7A A;  4HF1 A;  3KEY A;  4C2M J;  4ABZ A;  3L1P A;  4BNC A;  4U0W A;  1U5T C;  1NHI A;  4CA0 A;  3FMQ A;  2E35 A;  3OMY A;  3KLN A;  2GAU A;  3FKJ A;  2ESN A;  3ABM H;  4E7H A;  3QU6 A;  3JAM C;  3TO6 A;  2MBF A;  3CES A;  3CDI A;  5DNX A;  1IC8 A;  2BY3 A;  4DZP A;  3G1M A;  4GQU A;  1IUF A;  2WB1 A;  3ERE D;  1QZY A;  5EL9 A;  2JA2 A;  2V1U A;  4B3S I;  3EDP A;  3O2P E;  4OAZ A;  1DU0 A;  1U5T B;  3QYE A;  3CCS I;  3AL0 C;  3S1N J;  2M1B A;  3J7A O;  2K5C A;  1S3J A;  1H72 C;  3SZT A;  1S4E A;  2AE8 A;  2CG9 A;  3KP2 A;  1MNE A;  2L3D A;  3ZQC A;  1S5L C;  1MGT A;  2QBY B;  1RRE A;  4V19 K;  4ANJ A;  1RKW A;  1X1C A;  3E6D A;  3ZMT A;  4AIM A;  2CJJ A;  2CZ9 A;  4KIC A;  2XV4 S;  4AQY I;  4NC8 A;  1D1A A;  2P7C B;  1MH4 A;  5F6F A;  1YOV B;  3ZMU A;  3EQL F;  4L9V A;  3CMY A;  3K70 D;  3WGI A;  1B63 A;  2H1L A;  3L9F A;  1IBL I;  2M8E A;  2DT6 A;  4I99 C;  2V6C A;  3E5X A;  4Y17 A;  4LG0 A;  5FLX Z;  4BE2 A;  1TC3 C;  5GMD A;  2LY2 A;  3SDB A;  2I10 A;  3T8T A;  2Y31 A;  2JSC A;  4BQA A;  1OCC H;  5CPR B;  3ZR8 X;  4ZYG A;  1HNZ E;  2DAO A;  3PFI A;  3TOB A;  5K7Z A;  2RAE A;  3LAJ A;  1LE8 A;  2VOO A;  1BI3 A;  2XAS A;  4AIH A;  4G12 A;  2DPU A;  1I27 A;  3I59 B;  4KIB A;  3H9G A;  2C39 A;  3OIQ A;  2XAH A;  2OQR A;  1VQM I;  1Y0N A;  3TED A;  4DR6 I;  1WWX A;  1R23 A;  2FX0 A;  4DIQ A;  1K78 B;  2JA7 J;  3RZD J;  3ECO A;  3PQJ A;  3JAM K;  2K7L A;  4ESB A;  1B59 A;  4A2U A;  3PNV A;  3TO7 A;  5ERI A;  2KT0 A;  3HSR A;  2BR2 B;  4D9J A;  2WC2 A;  1MND A;  2FEZ A;  4EMD A;  3MKY B;  2LNB A;  1J2X A;  3DEW A;  1FT9 A;  3DKW A;  5JLW A;  1Y4U A;  1T6S A;  3IRR A;  3E1S A;  1ZGJ A;  3WGG A;  4WK8 F;  3KRN A;  4M6V A;  5HDG A;  1ZXN A;  2DQR A;  4RA2 A;  5FJ8 J;  1XMK A;  1U0J A;  3M1E A;  1UHW A;  2KJC A;  5KVR A;  5E8I A;  2Y0S A;  2W82 A;  2E2J J;  3GTQ J;  2WAF A;  2R7X A;  2EH3 A;  3ABT A;  4LFC I;  5D8K B;  3F8M A;  1W5S A;  5LD2 C;  1OYY A;  1YS6 A;  2X36 A;  3IAS 2;  1W1W E;  3Q0W A;  3F21 A;  4ENK A;  2V9V A;  2GXB A;  2L4M A;  4FX0 A;  2XPW A;  1I39 A;  3VOD A;  2UXD E;  2OA4 A;  1NK2 P;  2ZJ2 A;  2J5O A;  2K9S A;  3M8F A;  2VE8 A;  2D5V A;  2J65 A;  2CS3 A;  4DV7 E;  3QYF A;  2F5C A;  3L7Z B;  3CF5 F;  3SJM A;  4A6D A;  3LQQ A;  3H3V K;  2ZM6 E;  1W36 D;  1ETQ A;  3CO6 C;  1RET A;  1G4D A;  1PKP A;  4DPT A;  4GKJ E;  4MQY A;  3DV8 A;  9ANT A;  3VOE A;  2NVY J;  2CSO A;  3HSE A;  3WG9 A;  2L5Q A;  1DGW Y;  5E1W A;  2PJR A;  2NOG A;  4B3T I;  3M7N G;  1LEA A;  4N9H A;  1IDY A;  2HHH I;  3IAM 2;  1AWC A;  3S2H J;  4CZC A;  4JX6 A;  1H7U A;  4HNV A;  3PYD A;  5CLS A;  1PDN C;  2PJP A;  1FBS A;  2F4I A;  1RR7 A;  3B6C A;  5GAE J;  1UDN A;  1B9M A;  2BM1 A;  1GXP A;  2YX7 A;  3BG9 A;  3AFH A;  1JGS A;  1KQ0 A;  2M45 A;  4P5O A;  4HPQ A;  1G8X A;  1ZXM A;  5J6X A;  3L2U A;  2EIK H;  1QHH D;  2NS7 A;  4EM1 A;  2E1R A;  3IC7 A;  2DYR H;  5E1X A;  3GVA A;  1FIP A;  2E2H J;  4I0B A;  3BG6 A;  5HS9 A;  1NZ0 A;  1W7P A;  3ELK A;  4A3M J;  3LFK A;  1JJ6 C;  2PO2 A;  1POG A;  3BQY A;  3MZY A;  4DR4 I;  1UHM A;  3CDJ A;  3CZ6 A;  4AQY E;  3K4M A;  4YHH E;  2Q2E A;  3TMO A;  5D5U B;  4CIC A;  1IF1 A;  1H74 A;  4HBL A;  2E7W A;  5GP9 A;  1FNM A;  5K36 B;  1G6N A;  3JRF A;  2WP8 B;  2UXN A;  3G3Z A;  2KQR A;  3AG2 H;  1K6O A;  1AU7 A;  1A6F A;  2O0Y A;  4IHV A;  3SXY A;  1DQU A;  3J80 K;  3GTJ J;  1IJW C;  3SFI A;  3WTS C;  2Z5C B;  3VYR B;  4DV1 I;  1UST A;  3QPT A;  1LKX A;  1V54 H;  1ZG3 A;  1BIB A;  2IOP A;  1XD7 A;  4EJO A;  1JHH A;  4M3E A;  2PQ8 A;  3NEU A;  3WU5 A;  4OIR F;  4EAT A;  2I8D A;  3B02 A;  3C2G A;  5HVQ C;  3CQZ J;  3G6E I;  1YJN I;  3ROU A;  4CUG A;  5IYC J;  1IXC A;  2TRT A;  4IZJ B;  5JHU A;  1FBQ A;  3MKZ A;  2VOP A;  1O4X A;  4V2G A;  1O7F A;  5D6E A;  2IS4 A;  2HDC A;  3CLO A;  5DYM A;  4QPQ A;  1YO5 C;  1GUU A;  1BI1 A;  3MEX A;  5IT3 A;  1YRN A;  2W84 A;  2UUZ A;  5DUI A;  3PS1 A;  2P6S A;  1I6H J;  1XNR E;  1XB4 A;  1LEB A;  2BYV E;  1R1U A;  5F27 A;  2LJP A;  1A6Q A;  1K6Y A;  2RKH A;  1BW5 A;  1Z7U A;  4JX4 A;  4UUT A;  4KHP I;  5JEA E;  2Z5U A;  4LD5 A;  4XKB A;  4E7S A;  1Z0B A;  4JYA E;  2V9P A;  3K2A A;  2XKP A;  3HOY J;  4MTE A;  5F64 A;  1FSH A;  1ZRF A;  3OOU A;  4V2F A;  5EEG A;  3WU0 A;  1R58 A;  3TW6 A;  4RM2 A;  4YHH I;  3BJO A;  2IER A;  3CCV I;  3JR9 A;  4PJM A;  3R6S A;  2OAZ A;  5H2F C;  1XGM A;  2E60 A;  4S05 A;  1Z91 A;  1ZAO A;  3SHF A;  3D0S A;  1IN8 A;  2CU7 A;  5E20 A;  4F52 A;  1OJL A;  3GXO A;  3JCU C;  5CVI A;  4IJA A;  1Z0C A;  2V6E A;  5CVU A;  1Y39 A;  3WTV C;  1W36 C;  4B3M E;  2HWV A;  1A35 A;  4IHS A;  1A36 A;  5AIQ A;  3KET A;  4IEJ A;  1R00 A;  4AUX A;  4PDK A;  3WU3 A;  4HDU A;  4B3T E;  2JA8 J;  2PLY A;  5KCM A;  1OCZ H;  2DOE A;  2KRC A;  2W48 A;  4HSR A;  1YIO A;  3DTI A;  5GAG J;  3F8F A;  2DPD A;  4A3J J;  1BOB A;  4LF6 E;  3KP5 A;  3BZ6 A;  5E79 C;  2XGE A;  3S8P A;  4MTD A;  1XSV A;  4MU0 A;  3W6K B;  3TDZ C;  2CFO A;  4GO1 A;  4R79 A;  1ITY A;  4OIO F;  3ASN H;  3DU6 A;  3CC2 I;  3LNU A;  3V5R A;  3JRC A;  2JMW A;  3ASO H;  1QNT A;  3L2W A;  3OL4 A;  3DPT A;  2E1C A;  4OO1 C;  1VI7 A;  3ABL H;  1WZ2 A;  3Q6M A;  2YX4 A;  4KUM A;  4DJA A;  2ECB A;  5K5O A;  4FW6 A;  4BJ5 C;  3M7N D;  4CDG A;  3OR2 C;  3NZK A;  5JEA B;  1SD4 A;  2WV1 A;  4N9I A;  1FKA E;  5L3G A;  3HB9 A;  1IDZ A;  1Y4S A;  1FJG E;  2XAQ A;  3K6G A;  2JZY A;  1VI0 A;  4A5N A;  2LSO A;  4JX5 A;  4WUC A;  1ZLJ A;  4HX8 A;  3KYD B;  3BCA A;  3LA3 A;  1H7S A;  2CQN A;  2ZIT A;  4JI2 I;  4DR5 E;  1Z0X A;  2KZV A;  1WI3 A;  4B3R E;  2EK5 A;  2V34 A;  4LFB E;  4MQV A;  4ENM A;  3TQN A;  2QKL B;  1LFB A;  3GZ5 A;  3ZN1 A;  1X1B A;  1OIS A;  4HX7 A;  5JEA F;  1TZL A;  5ICF A;  2ZNY A;  2W1O A;  3M9A A;  4QNK A;  2PO0 B;  3DLL F;  3ZCO A;  4JV5 E;  4X66 I;  2Y9Y A;  1BI2 A;  4I0A A;  2DFI A;  1Z7L A;  1YIT I;  5K36 D;  4DUY E;  4Z6Y A;  5J4Y A;  1HF0 A;  3L7W A;  4MHG A;  5LRS A;  4G94 A;  1D1C A;  2HPM A;  1RPW A;  2EFP A;  3OOP A;  1J75 A;  4OIN F;  2EFG A;  3PYG A;  4R8H A;  3ML6 A;  4MU4 A;  3E3V A;  1T38 A;  1TTY A;  3PSI A;  4GCV A;  4B09 A;  2OD5 A;  4JI5 E;  4P7A A;  1Q1V A;  3S3N A;  2BA0 G;  2IGN A;  3JRH A;  3HEF A;  5IWA E;  4P96 A;  4XBF A;  4FN5 A;  2H6B A;  2L7Z A;  2HVR A;  2VJ4 A;  3A01 A;  3DLA A;  5H6R A;  1GV5 A;  4KMU X;  3PRY A;  3ZPL A;  5JVT A;  1I1S A;  4HV5 A;  4UUS A;  1EA6 A;  5C0X F;  2UWM A;  4L9N A;  4L5E A;  3IKT A;  2V1N A;  1N34 I;  2B7E A;  2KDZ A;  1GVD A;  3M07 A;  1A5J A;  5K36 F;  2GO4 A;  5FWK A;  2X6X A;  3DF8 A;  3H3Z A;  3RYP A;  1Y60 A;  1MMS A;  3BZC A;  3SEQ A;  4DNC A;  2GM4 A;  1WRJ A;  2JVG A;  3V4G A;  2O3Z A;  4NXN E;  4XID A;  2P4W A;  4KDP A;  2BW3 B;  5FFZ A;  3P3C A;  2W24 A;  2H8R A;  3C1D A;  4JI7 E;  1UHS A;  2DQL A;  1WPK A;  4BHC A;  1DGR M;  3F0C A;  2HFU A;  4JI4 E;  4XM3 A;  2FBK A;  2L7F P;  5LHH A;  4B3S E;  2M87 A;  1TWC J;  5KNL A;  2QKM B;  5BNG A;  2DCE A;  5K5Q A;  4BH9 A;  4Z7Y A;  2O8K A;  4LFA E;  1STZ A;  1R6L A;  1VND A;  2YUS A;  4LF8 E;  4RS8 A;  2NAZ A;  2XDV A;  4HAM A;  1ETK A;  5K1Y A;  2FF4 A;  1D0Y A;  4BAY A;  4A93 J;  1H89 C;  1AKH B;  3T1Y E;  3M4O J;  3FK7 A;  1O3Q A;  2RQQ A;  4PFO A;  1UMQ A;  1TNS A;  4UUS B;  3MKW B;  4DZJ A;  4BXU A;  4WWC A;  4GDF A;  4I2O A;  2FA5 A;  2WAE A;  4UVA A;  1O3T A;  2YR2 A;  2TDX A;  5J1R A;  1FYK A;  3A01 B;  4YRV A;  4PRV A;  4IL6 C;  4XLH A;  2V2V A;  4IZJ A;  5C44 J;  4R1F A;  3K1J A;  4II3 A;  1OYW A;  4DYC A;  3JRD A;  2M7A A;  1TWF J;  1N36 E;  1ETX A;  2LK2 A;  4Q47 A;  3ZOB A;  3HOT A;  1HDP A;  2BOL A;  2DMP A;  4AU7 A;  4JI1 I;  2EZH A;  2OTJ I;  1YI2 I;  1VQP I;  3REO A;  2DA3 A;  4M9Z A;  1XGO A;  2GXG A;  2QQB A;  4KJZ A;  1FX7 A;  3V7R A;  4BEH A;  4FWH A;  5H20 A;  4B4C A;  2O9L A;  1P7I A;  2WAQ A;  3DU5 A;  1W0U A;  4IKF A;  2AO9 A;  2MSY A;  1HC8 A;  3B4T A;  3K7A J;  2XAF A;  4UUV A;  2DA4 A;  2MFZ A;  4HNT A;  3CJR B;  1BI0 A;  1Z0G A;  2R5Z B;  2ZKZ A;  2OCC H;  2IEK A;  1PUF A;  1NH3 A;  4USM A;  2F4M B;  4HYE A;  4FAS D;  1YE9 A;  3O8H A;  4YFX F;  1SVL A;  3OYK A;  3M3Y J;  4B3X A;  3CTA A;  3P5J A;  3GYH X;  5IOZ A;  4DR1 I;  2DOA A;  1SMY F;  1V5E A;  5IT9 Z;  3PUF A;  4I02 A;  3AG1 H;  4HF0 A;  5DCM B;  4XK4 A;  1T39 A;  2K9N A;  1RUO A;  2CV0 A;  1FY7 A;  2UUA E;  2CW8 A;  2VQH A;  1KVK A;  2FRH A;  4JI8 E;  2K3P A;  4XLF A;  3HL2 A;  3QP5 A;  3DEU A;  4DV3 E;  3LSK A;  1V3F A;  3KPH A;  3B73 A;  4II2 A;  1ZYR F;  2V1X A;  3N4M A;  3L09 A;  4F3Q A;  3VSK A;  3TOA A;  2R92 J;  1XMA A;  2O7O A;  2VKH A;  3BP8 A;  1HK7 A;  1SD7 A;  4LF4 E;  1T95 A;  3FIW A;  4G7O F;  2FU4 A;  2ZO4 A;  1A6I A;  3GFJ A;  4IZZ A;  3QWL A;  4DQ2 A;  2XEX A;  4XRS G;  1TW2 A;  1ETV A;  2D2W A;  3BDD A;  3AKZ A;  3LSI A;  5DRR A;  4FW3 A;  2L01 A;  2A69 F;  2HOE A;  5ILS A;  1MU5 A;  2IA1 A;  1I3Q J;  3CDL A;  3SFZ A;  2A3S A;  2QLZ A;  4WF2 A;  1N0U A;  4LPF A;  5FKM A;  5LL6 R;  4U87 A;  4A3L J;  2HDW A;  3DBH B;  2HK2 A;  3K10 A;  3J80 C;  1MKM A;  3PL8 A;  3QP6 A;  3HKZ N;  2HK3 A;  4MU3 A;  1KU2 A;  2A2C A; 
#chains in the Genus database with same CATH homology
 3H1C A;  2JEB B;  4OO1 F;  4AIM A;  2WNR A;  2JE6 B;  4IFD A;  3L7Z A;  4OO1 C;  2PO2 A;  4BA2 A;  1UDQ A;  4OO1 B;  2NN6 F;  4IFD E;  5K36 C;  3CDJ A;  3M7N D;  2NN6 D;  1E3P A;  5JEA B;  2C38 B;  4BA1 B;  5K36 B;  1OYS A;  3GLL A;  2WP8 B;  5C0X B;  4NBQ A;  4AID A;  2BA1 G;  3DD6 A;  2C39 A;  2C39 B;  5JEA C;  4OO1 D;  2BR2 A;  5JEA F;  3B4T A;  4BA1 A;  2PO0 B;  2PNZ A;  2C38 A;  2C37 A;  5K36 D;  2BR2 B;  1E3H A;  5C0X C;  2C37 B;  2PO2 B;  5C0X E;  3KRN A;  5C0X D;  4IFD D;  2WNR B;  1R6M A;  2PNZ B;  2PO0 A;  3M85 G;  4IFD C;  5K36 E;  2WP8 A;  2BA0 G;  5JEA E;  2PO1 A;  5C0X A;  2BA0 D;  1WHU A;  3HKM A;  3GCM A;  5K36 A;  3M85 D;  5C0X F;  3L7Z B;  2JEA A;  5JEA A;  4AM3 A;  2JEB A;  1OYP A;  2NN6 A;  1UDO A;  1UDS A;  5K36 F;  4OO1 A;  4BA2 B;  4IFD B;  2NN6 B;  2JE6 A;  4OO1 E;  5JEA D;  2JEA B;  3CDI A;  3M7N G;  3GME A;  2NN6 E;  2NN6 C;  4IFD F;  2BA1 D;  1UDN A;  3U1K A;  1R6L A;  2PO1 B;  1OYR A;  3H36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...