4AIDA

Crystal structure of c. crescentus pnpase bound to rnase e recognition peptide
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
616
structure length
573
Chain Sequence
QDPMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKSASDGAKIKAAIDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
molecule tags Transferase/peptide
source organism Caulobacter vibrioides
total genus 166
structure length 573
sequence length 616
chains with identical sequence B, C
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 4aidA02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aidA03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aidA01
3U1KA 1R6MA 3M85G 4AIMA 5JEAD 5K36B 1R6LA 5C0XC 2WP8B 2NN6C 2NN6B 2PO0B 2NN6D 2BA1G 2C38A 2BR2B 4IFDC 3GLLA 1E3PA 2WNRB 5K36A 2JE6A 2C37B 4OO1C 1UDOA 2BR2A 5C0XB 1UDQA 3L7ZB 2JEBB 1OYSA 2PO1B 5C0XD 3GMEA 5K36E 2PO2B 4IFDB 4BA1B 2JEAA 3GCMA 5JEAA 4IFDD 2BA0G 3HKMA 5JEAF 3M85D 2C39B 2WP8A 5K36F 2NN6A 1OYRA 3L7ZA 3M7NG 2PO0A 3CDJA 4OO1B 2PNZB 1E3HA 2BA1D 4OO1D 4NBQA 4BA1A 5JEAE 3CDIA 2WNRA 3KRNA 5C0XE 2NN6E 2C38B 4BA2B 3H1CA 4AM3A 2C37A 5JEAC 2PNZA 5K36C 5C0XA 1OYPA 2PO1A 2JEBA 2JE6B 5C0XF 2NN6F 5K36D 1UDSA 1WHUA 1UDNA 2PO2A 4IFDA 4BA2A 4IFDF 4OO1E 2BA0D 4AIDA 3H36A 2C39A 3DD6A 3M7ND 4OO1A 2JEAB 3B4TA 5JEAB 4OO1F 4IFDE
chains in the Genus database with same CATH superfamily
3U1KA 4YFXF 5LBQA 3KETA 1U5TC 1A36A 1H74A 3FBIB 1SMTA 1T2KA 4F7ZA 2KMUA 3LFUA 4JI1I 2HNHA 3VDXA 5IYBJ 1MNMC 1O3SA 5HS8A 4EMDA 2H8WA 1ZK8A 3MZYA 4I98B 5DD4A 5ILUA 4DV4I 1N33E 3HYIA 1SMYF 4AQYI 3REOA 3SEQA 3BZ6A 2A6TA 3L2CA 3LOCA 3T5XA 1P7JA 3QPHA 1FYLA 5C4XJ 3TDZC 1MMGA 3FKIJ 4H0EA 1EKEA 2JUCA 2ISYA 3K4CA 3N4MA 3HC7A 2HDCA 2Z2SB 4XLCA 5JR3A 2IA1A 1Z5BA 4V2FA 4C2TA 2L9NA 2HQ5A 2A3SA 2OCCH 2CUZA 1WJ5A 2F48A 1IBKI 1D8KA 1Z0CA 1K83J 4Q48A 2X48A 3TL4X 4XRSA 2GIVA 2EFQA 1OPCA 4GFBA 3DTEA 4DV6E 3DQVC 2VQLA 3SHFA 4C9YA 1R00A 2L01A 3K4NA 4EATA 3S2DJ 3K17A 2XAFA 3KPHA 4JOMA 2B9SA 3LMMA 4KMFA 2L9VA 3KCCA 2K9NA 5IOYA 2M0CA 3I4PA 3GZ6A 4IFDB 3O2PE 1ZREA 3C2HA 2M45A 4U7DA 4XN0A 1LNWA 5F04A 2LVSA 3FHZA 2EJRA 2UUCE 4IFDD 1LUJB 3WU4A 1P42A 1WJCA 2NAZA 2X6XA 2MW8A 2MD0A 4P9FA 1T38A 4Z2YA 3QU6A 1FT9A 1CGPA 3HKZN 3L7ZA 4K0KE 4JI0I 3ZQGA 5B5EC 2NOGA 3I9V2 1RHYA 5E20A 2WY8Q 2TDXA 4EV0A 3CUQC 2RNJA 1S9HA 4USMA 2LC2A 1A35A 2IP2A 2Q1ZB 1E17A 1BR2A 1G3YA 2NN6E 4OZEA 2NNNA 4IHWA 1WJBA 1FPQA 1Y4SA 4KISA 3BCAA 3MFKA 2AXLA 2D1HA 1U3EM 5LGUA 1P4AA 4NDLA 3CMMA 1ONVA 1ZLJA 3P3GA 4HF0A 4KICA 5K5RA 2VQEE 1LE8B 2O5RA 3QT5A 4DR7E 1U9NA 3V8JA 1YITI 2WA0A 1ZRCA 2Y75A 3ZMDA 1IRFA 4M3GA 4IZJA 2KJCA 4Y33A 3HKZA 3FXUA 3SXYA 1S4EA 1H8AC 1Y4UA 3OMYA 2RV8A 4YG2F 3WGGA 1AA7A 4XLEA 4AIKA 2NVXJ 4DR4E 3ZMTA 1BIBA 4XLNF 2V1XA 4YFNF 2QQ8A 3FK6A 4FQGA 2NYXA 4GDFA 3OS2A 1IRGA 1F43A 3K1NA 4AIMA 3I59B 1PP7U 4JI6E 2XAQA 3HTSB 2X6WA 1QVTA 3RPQA 3O8GA 4EMSA 1VQ8I 5C0XC 4DV0I 4I0AA 1S7EA 4U3DA 2BXYA 4MGRA 2L4AA 5EZGA 4RAZA 3C3WA 4UY8I 1F9NA 2R7ZJ 5GMEA 3KE2A 1WQ2A 2ACJA 5DCMB 4D7NA 1YHQI 3ZGKA 5F0HA 3P9KA 2JT2A 4WXHA 1XMQE 5IT9Q 1XMAA 2ZSIB 4LG0A 2M34A 2HKEA 3TOBA 3W2AA 5J8CA 2X51A 2QEXI 1RRJA 2Y48A 5GP9A 3OS0A 2VE8A 1Z77A 2VKEA 2QF7A 2XROA 2WWYA 1ITYA 3F8NA 2KDOA 1N78A 9ANTA 1SVOA 2M1BA 3PNVA 2OTLI 4BBSJ 2Z5CB 3BR2A 4HPQA 3TKYA 4DQ2A 2X1EA 4HRIA 3ZQQA 2GZWA 2K7LA 3DPUA 4KNYA 3CJTB 2A07F 4PSXA 4CCMA 2FBKA 3E6BA 4MQ9F 3ZQ7A 2KPMA 3A0BC 1ZGWA 3OYGA 4MNUA 4LF4E 2O1TA 4M74A 1BBYA 1JGGA 1XMOI 1GXPA 4XK4A 3ULQB 1UG2A 3F6VA 3HGYA 5H2FC 5GPCA 3LSIA 4P7AA 2W82A 1KU9A 3JRFA 1BKNA 4F52A 3K70D 4OO1B 1R49A 2X9DA 4N0BA 3HOZJ 4OO1D 1XMKA 4AYBN 3E7LA 1IN5A 1Y0UA 3T0YA 5HLTA 1JJ6C 5BR8E 4JI4E 1FOKA 1R4MB 4LF6I 3B6CA 3QP5A 4AC0A 3DEUA 2A2DA 2HZTA 5F64A 1W7PB 2OV7A 4CA0A 1EH8A 5LMUE 2ESNA 4F3QA 4OKGA 3HBLA 1W7PD 1VNDA 2MC4A 4UV9A 2PQ8A 3NWSA 4M6YA 3A2KA 1TW2A 1N32I 1ZM3A 4BJ6C 2XPUA 3OYJA 1KYZA 2WAQA 1N75A 1UCRA 2XIGA 3GFIA 5LHHA 2PJRA 2LOOA 3J80Q 2O7OA 3WU5A 2DOAA 3BR3A 2DYRH 2RKHA 3F72A 3HULA 4BEHB 3E1SA 3E6MA 3KYCB 4P55A 2DDBA 4Q5SF 4OO1E 1DQUA 1T56A 2FJ1A 2ZJ2A 2F2EA 4FHTA 3LAPA 1AKHB 2W85A 2AS5F 4AYBA 1VQKI 1KU3A 2OF7A 4MEXF 1VZ0A 2L5QA 3LA2A 4BXFA 1E3OC 2KLOA 2JEAB 3S14J 2DFIA 3QYBA 3J81K 3B4TA 1F1ZA 2UXCE 4B3RI 1XDUA 2EV6A 2GM4A 1U5TB 3R0JA 2CW8A 2LF7A 2IAIA 2CRGA 3PRYA 4NXNE 3TO7A 2Q8KA 1XNQI 1XGSA 1TNSA 1MG7A 1HSJA 3RCOA 4XQFA 3I54A 2X85A 2D5VA 1HR0I 4PZJA 1TBXA 1X1DA 2G9WA 3R6SA 4O6JA 2NVQJ 3RYPA 4S04A 3IV5A 4BQNA 1Z05A 2M5WA 3SFZA 2XAGA 3NEUA 4CZZA 3D5RC 2V1UA 2R5YA 2GIZA 3EUHA 3CCMI 4BY1J 3RDIA 1P6RA 3G1OA 4GKJE 3KP5A 3W6KB 4G7ZF 2DEJA 2DDAA 4X62E 4DW6A 4XMYA 4J00A 4C3HJ 1S6LA 5FFZA 4B4CA 2JEBB 1ZG3A 1Z5CA 1O7FA 2DFEA 5B3SH 3KP2A 5IY5H 2P5LC 2XC7A 4RGRA 3I64A 4RGSA 3DF8A 5E1XA 1JI8A 3EETA 2OU2A 2XKPA 4RB2C 3BOQA 3OIQA 1MDMA 5JEAA 3KZYA 3ZQFA 4A3MJ 1TLHB 2GBYA 5K5QA 4E7KA 2VOPA 3HKMA 5JEAF 3EPZA 1K7AA 3PSIA 1IGNA 3AL0B 2IERA 1T6SA 3BZCA 1H9GA 3RZDJ 2STWA 4HDVA 1YI2I 2PO0A 3RTRA 1NTCA 4I0BA 4L9TA 3CCLI 4IOAF 1LDKB 3S1NJ 3GTGJ 2ELJA 5F1JA 4ZJZA 4BQQA 2F6CA 4U87A 5IPAA 1PYVA 2UUZA 2BYVE 4HSRA 1O7LA 5J40A 1SD4A 2OJED 2CQQA 1GVDA 3B6AA 3J7YJ 1FSEA 1S72I 2O8KA 2PNZA 2DTRA 2XAJA 4KQVA 4RAYA 3IH2A 1J09A 1Y1WJ 1IJWC 2UU9I 1TWFJ 4TV7A 1RI7A 4EJOA 2PMHA 3ABTA 2CV1A 2BY1A 1LKXA 3CP8A 3EUHC 3RKXA 1TQIA 3JRDA 4DV5E 3J7AG 4YY3E 4XSZF 1T95A 3LNUA 1HW1A 3A02A 2QBYB 2Q2EA 5DCFA 3S32A 4FWDA 2H1LA 3BROA 3ZPLA 1RR7A 2FOWA 5KAIC 4QTRA 3QU3A 4U7BA 5F0FA 4HAMA 2R7SA 5LRRA 4MDTA 3E97A 4JQFA 5IP9J 5K1YA 1J59A 4DPUA 1OMIA 3TEDA 1YRNA 3J81C 2BVLA 3U1YA 1VQMI 3E5XA 3P76A 1S16A 2JSPA 1MD0A 4LITA 4JV5E 3RIRA 4Y3OA 3LWFA 3UNGC 5L3GA 4IHYA 3ZKBA 3MKWB 3RKQA 1UEKA 1VQ9I 3S3MA 5D5UB 1IBMI 2AO9A 1YTYA 2VXDA 5FROA 2XF6A 5ELWA 3PFIA 2HFSA 1GT0C 5C44J 4LB5A 4LFBE 3VOEA 4IHSA 1JXSA 3LAJA 1RZ4A 2NOJB 4W97A 1XD7A 1BI1A 1X4OA 1XSVA 3P9IA 1EJ9A 3QWLA 4ZH4F 1N77A 3HUGA 3PSFA 5DYMA 2ZFUA 2IW5A 2ME0A 2PNLA 4Q4ZF 2X6OA 1T33A 2XSJC 1UDOA 4EJVA 1U0JA 3C1DA 1IXRC 5AIPA 3HGGA 1R22A 1X3WB 3BWGA 4AIHA 4PGHA 4RLQA 2E5LI 2L7MP 3S15J 4O5VA 4X65I 4WCGA 1VQ4I 3A03A 4LF9E 2QKMB 4IKFA 4JI7I 5DRRA 2CMPA 2FRHA 2Y9ZA 4MU0A 4UB6C 2DA7A 1YS6A 2HVRA 4IZJD 1T98A 3Q0UA 1LVKA 1N0VC 3CF2A 3A4CA 3IRRA 1Z7UA 2A61A 1J5EI 5F1RA 3KYDB 2XAUA 1X19A 3HDDA 4DR3I 1RC9A 1R5ID 4LD5A 5B1AH 2F5CA 1RKTA 4LF5I 1E2XA 1QHGA 3V5RA 1QPMA 4BA1A 2MA3A 1N25A 3HL2A 3H3VK 3E6DA 2R5ZB 4KT6A 2IRFG 5E3MA 1Z6TA 2XDVA 3Q0VA 3SJMA 4DUYE 4MIMA 1ZM4A 2HS5A 2V1DA 1VQPI 4XKWA 5D4RA 3LPSA 3BTJA 3T8RA 5EEHA 2C37A 4PFOA 5HNFA 2YUSA 1NK3P 3CLOA 1IUFA 1OCOH 4HNUA 4HQMA 4KITB 5FO5A 5K7ZA 2E34A 3DLLF 5AONA 2V2QA 4MQYA 2M7BA 5BS6A 2HKXA 2KIQA 1OQYA 4DV2E 4DR1I 5EZHA 1IDYA 2UXBI 2FNAA 2EV5A 5EEGA 3TDUC 4HF2A 4E7LA 3H36A 2F4VE 4LG3A 1UJ8A 2QQBA 2Q0OA 1FLIA 3RQIA 5GADJ 1WWXA 2MG4A 3KEYA 2K5CA 3IC7A 1EA6A 4HNVA 1MW7A 5CJ9A 4B3TI 5D8LB 1K6YA 2F4MB 4RGUA 3ZN1A 3QRFF 2I8DA 5LHIA 4GQUA 1RKWA 1D0YA 2HKOA 4DUZE 1X1PA 5EYRA 4A3GJ 3FXMA 1KIJA 1KU7A 2O3FA 3H5NA 4RB3C 5HODA 4YELA 2ZM6I 5L3JA 3JSPA 1HNZE 4D9JA 2R7TA 3GO5A 2OC6A 2R3SA 3QPTA 4CCLA 4CCOA 3CC2I 1SD5A 1NG7A 1Z5AA 2C6YA 4HXZA 2KQRA 3TBIA 3PYFA 5FLXQ 5DTDA 3DKXA 2FUG2 3HSRA 5DUIA 2VB6A 2UUBE 4BXUA 1FBSA 2JVHA 2M30A 4PGGA 2ZFWA 4CCNA 1LPQA 1VQLI 2B0LA 3CCUI 4ENNA 5C4JJ 1FYKA 5IT3A 4AWXB 3ECOA 2LRDA 2XKOA 5K5OA 1D3YA 5EJCA 1XXEA 5FWKA 4LFCI 2QSHX 2HU9A 2COBA 4UB8C 1PJRA 4BE0A 1MU5A 2PJRB 2JA2A 3L7WA 4YHHI 2F1DA 1UDQA 2K3FA 5DNLA 2VQGA 5F27A 2JUGA 3TP0A 3GMEA 3HOTA 2R7OA 2XASA 1GUUA 3IAM2 3QT8A 1ZR4A 2JRTA 3OYKA 1HR0E 1SANA 1GV2A 4KIBA 3CJNA 1G4DA 1BR4A 4AIJA 1EV7A 3BC8A 4HYMA 3P3EA 2IA2A 3TOAA 4ESJA 3BTLA 2GXAA 2RDPA 4DGWB 2W48A 2W00A 2DFFA 4KN7X 4E7HA 1T8IA 2Y69H 2ZBKA 3BCBA 2IJLA 4JI2I 4GGGA 3NZKA 2G7HA 3E6CC 2IGNA 3OWTA 2I5UA 2GO4A 2EFGA 3Q9SA 1U78A 1P2FA 2VC0A 3K4BA 5D8KB 1ACIA 1Z91A 4L5JA 4IRHA 2WAFA 4JI5I 4MO7A 4HX7A 5ICEA 3CDIA 3F21A 1N34E 1L3LA 1K78A 2ZMEA 5FJ8J 4BA2B 1Z9CA 4QWQA 4F91B 1Z0VA 1WJAA 1B6AA 1KGSA 2UXXA 2V7FA 1WJDA 2LD5A 3F0NA 2HQAA 3OYBA 4HLYA 2NXNB 2W7NA 1G3WA 1EF4A 1HXDA 4IZKA 3IAS2 4QNKA 3GTPJ 2H8RA 1FJLA 3Q0WA 2R5YB 1IXCA 2OBPA 2OZUA 2FQ3A 4BQAA 1RR9A 1A6IA 4JK1X 1ZG1A 3OOUA 2IGMA 4DYRA 2YSRA 3OTOI 2A69F 4KIGA 5LLQA 1TTYA 4NC8A 2LTPA 4HF1A 2K02A 1ZKGA 2E36A 2QSFX 1HKSA 3HTUA 4MU4A 2MSYA 1JKOC 4XOPA 3Q6NA 3GW2A 3H9GA 4QPOA 4RA2A 2LBFB 4I02A 3CCJI 4ZYAA 3RKYA 3KP6A 4LMYA 4U0VA 5LGNA 4YIRX 4E4HA 4HW0A 3LQQA 1KQ9A 1MDMB 5DROA 5JEAB 1Z0EA 2AHQA 2IVMA 3C2BA 1NHHA 3JRCA 4XM3A 1FNMA 5JEAD 2KT0A 5ICGA 4NC6A 3GF2A 4CCKA 1JKRC 2GWRA 2A5YB 3K1MA 3KEOA 3BDDA 2UUCI 4DR6E 4M1KA 2PO0B 4FW3A 2RQPA 1Y1VJ 2L9RA 2WV1A 3FBNB 4E7IA 2IESA 2LMDA 3HRTA 1K79A 3GTKJ 1OCPA 3SDBA 2GQQA 4FW4A 1BL0A 1FIPA 4BL0B 2FX0A 4B09A 1BOAA 4PJNA 3LSMA 2ZMEC 1USSA 1TL8A 1P4WA 2LR8A 1S5LC 1DPUA 2V2ZA 2KKOA 4IVNA 1BJAA 1X4PA 3F6OA 4M6XA 2X36A 2XPWA 4CXFA 2BW3A 2MBFA 3CUQA 4HV5A 3JAMK 1KQ8A 3KP4A 2LY2A 4ZTJA 5CVJA 3IHUA 3RJPA 1CF7B 3ZMUA 2ZSHB 2LFBA 4URLA 4XIDA 3CJRB 4XRFA 4BU2A 4L9VA 4RAGA 2VN2A 5M3MJ 1VFCA 2WB1N 2VQEI 2O0YA 4XRSG 1OCCH 2Q2EB 2Z5BB 2R4GA 2XHKA 1TQMA 1UAAA 1MGTA 4GYGA 4A3IJ 2H09A 1HC8A 2RGVA 5HLHA 3GTOJ 3WU0A 3ZZUA 2QLZA 3NARA 1YRNB 5E8IA 3U2RA 3V7RA 4K2EA 1WI3A 4JX6A 3FXOA 3B73A 5D5WB 1IN8A 3RYRA 2DU9A 3HRMA 5JVGF 2MABA 2OA4A 2EZHA 2DI3A 2VQCA 2PFBA 3E5UA 3KZIC 4A3EJ 2K40A 3AG3H 2K27A 4OIOF 3PO2J 3GXOA 4WK8F 4PU9A 3VFZA 2ICWG 3P7NA 1X1CA 2Z3YA 3M1CA 5IT9Z 3T8TA 3FXLA 2ZXIA 1TT5B 1X3ZB 2Z33A 1REPC 1IC8A 1OCZH 1E0EA 4PJMA 5L3FA 1JTXA 3MVPA 4NC7A 4DR2E 2WB1A 1W5TA 2FU4A 2WBMA 2E2HJ 5C0XA 2E60A 5GAHJ 1A6FA 4ZYDA 4DV3I 1Z0WA 5TGTA 1XB4A 2JWTA 3GFJA 3HUGB 3B82A 2DTZA 5C0XF 3AAFA 2P6TA 2ZKZA 4R1FA 4G7HF 4NQWA 1LJ9A 2PO2A 1UELB 2O6GE 4XL9A 2P8TA 2CZ9A 4ESFA 2VJ5A 1BOBA 1ZRDA 3M6AA 1I3QJ 4PCQA 1MJBA 3PIPF 3BTIA 3DCFA 3JRIA 3MKZA 3N97A 2STTA 4L0YB 2MD5A 3SQNA 4UXNA 1YE9A 4RMNA 2DA5A 2O9LA 3LSPA 2CW7A 4IFDE 2BBYA 2DODA 2RNGA 2KRHA 4A3BJ 3DKWA 1K61A 2BVMA 4N4OB 5TISC 2JMWA 2DN0A 2RN7A 4LCGA 4MU1A 4IXAA 5GTIC 4G9YA 4U3BA 4V2GA 3SYTA 1U8BA 4DV7E 2X1CA 4NXME 4RPFA 2XAHA 3CTAA 4JI1E 3J7AO 3GZ5A 1S8NA 3DWLE 2BEOA 3F9KA 2DA4A 2WADA 5K36A 4HX4A 2FQ4A 2K4JA 3E0JB 4AQYE 3K4LA 5M3FJ 2C37B 4BHPA 4ISAA 1X3UA 3J80Z 5TJJA 5E3NA 1SFXA 2QGUA 2J5OA 1KVKA 2W25A 3PJRA 4FISA 3VEPA 5IP6A 5EF6A 3COAC 3JAMC 2RC4A 3VSLA 4M3EA 1FMVA 3VYRB 2AQFA 2KP6A 5A2QQ 3J7ZI 1IBKE 5E1ZB 2DA2A 4S05A 4BDYA 1XCVA 1YJ9I 1IN7A 1RR8C 4L9NA 1SFOJ 3DTKA 1Z59A 1MMSA 3DU6A 2EH3A 1ZRFA 3CJQB 3G2BA 2P7VB 3HG9A 4BY7J 3ZR8X 4GO1A 4L5IA 2UZKA 1XG1A 4FWGA 1FY7A 1W36C 1T08B 4C2UA 4ZYEA 3ONQA 2UXDI 1ORKA 4FW5A 4PJLA 1L0OC 4LOMA 1SAUA 5CLSA 1LFPA 1IV6A 2W4SA 1JUPA 1LQ1A 4FE7A 1I50J 5IYCJ 3IRQA 1GDTA 4UUSB 4BHBA 2NRAC 3H5AA 1ZARA 1MBJA 1HNWI 1RREA 3F8BA 5ERIA 4PFPA 2WAQN 3W6JB 1RETA 3FM3A 5D5XB 2HQNA 2HPIA 2QM3A 4EEFG 1TQPA 3CO6C 1X1BA 1SEUA 2R7FA 5EGOA 3W2VA 3HZJA 5E17F 1ETQA 2M3AA 3NRVA 2IS2A 5K36C 5LEJA 4MQVA 3HOVJ 4S0HB 2JN6A 1ZG5A 1KZHA 2GXGA 2P6SA 1FYMA 3CUOA 1AWCA 1LVAA 2VKDA 4N9HA 4KA4A 4G6TB 4BNCA 2Y9YA 2YX4A 3OSFA 3KLNA 2DBBA 3LSJA 4CCJA 1I27A 2JJ7A 5LEKA 1XNRI 2E1MB 3BY6A 4A0XA 3QYFA 4GKKI 5J47A 1Z21A 2I10A 2XPVA 1S3JA 1MNEA 3SEZA 1JHHA 4FX0A 1FTTA 3MCZA 1GLNA 2LG4A 2IXSA 4XN3A 2LLKA 2HR3A 4FT8A 4I3HA 5GAEJ 5HS7A 5DDGA 3CZ6A 4MFEA 2ZBKB 3I71A 3VYUB 1C0WA 1Y60A 3R0AA 1DDNA 2D1VA 3GUDA 1APLC 4UNOA 4A5MA 1J75A 1USTA 2IS4A 1J5YA 3QT7A 4XTJA 4B3XA 3QOEA 1RUOA 4KYWA 3S2WA 4CUGA 4JG4A 1ZQ3P 2ZNYA 3MZHA 3UKGA 3HIFA 3LA7A 3I58A 4DV0E 1E3PA 1WRJA 3CDHA 3A1YA 1YX5A 3KEQA 1LB2A 1ETWA 2ZMEB 2NVYJ 1HK7A 4FW9A 5FGMA 5EDNA 1MKMA 4XRMA 2CWEA 4EJUA 4WUBA 4N3OA 4B48A 1K47A 4E7JA 1OYYA 5KHDA 3L9FA 2HOEA 2B7EA 2IPQX 2O1UA 3FXQA 2BR2A 2NPFA 2P5VA 3OR1C 2A68F 1R1UA 1UHSA 3I0TA 4IZKB 4MYTA 5E3OA 3ESWB 1XHKA 2G7UA 2XGCA 3P5JA 2LH9A 4IZZA 3DPTA 1V5FA 4E7SA 2IA0A 4CYCA 4LF8I 3D1NI 2EA2A 2ZJRF 1DPRA 1FWLA 4H4KC 4DV5I 1PUFA 1WI9A 2HZDA 3DEEA 1CQTA 2O61A 3DLAA 5E3LA 4X6AJ 2JT1A 3O8HA 1G3TA 3OL4A 3F8MA 4I2OA 4JI3I 3EUKL 4A2UA 3GWZA 3OOPA 3OY9A 2HKJA 2HOAA 1B59A 5D6FA 5M5WJ 2CSOA 3VYSB 2IGKA 4D7MA 3W2WA 1MJ9A 3ZRGA 2VPLA 2CH0A 2QUFA 4XKCA 3FISA 1FBUA 2KZVA 4BKXA 4ZYGA 4QIWN 1ZM2A 4LOCA 3S3OA 2GA1A 4R1HA 2E19A 1I1GA 5LGTA 1FNNA 3KIOA 2KRCA 2OQRA 4B43A 4XR6A 3OYIA 3BJ6A 2XGDA 4CGZA 3MEXA 3H3ZA 4OU0A 4B3SI 1OCRH 3PUBA 3CMEI 1P9QC 1IRXA 3HRUA 1SC7A 4XLAA 1OYIA 1SVLA 4LFBI 2ELHA 2HXIA 3P3CA 2HDDA 2WV0A 2DPDA 1HNXI 1R1VA 2BW3B 2HTJA 3CUQB 5E8GA 1K4SA 1HDDC 4QNJA 2NVTJ 5DUKA 3PYDA 3AG1H 2GQ0A 3BT9A 1IF1A 3GFMA 3EQLF 1IBLI 3MZ8A 4HQEA 3QT6A 3V2UC 1MMNA 3MMYB 1K4TA 1IG7A 1R23A 4ITVA 4DXLA 2KZGA 4BQOA 3FKJA 3FF5A 5BPIA 4LF9I 4LIUA 1OCTC 2HOSA 1JHFA 2CQXA 2EIJH 4HACA 3PL8A 1SVMA 4DBRA 2PJPA 3CF5F 2VE9A 3WTXC 5FD6A 3P9CA 2TCTA 4M73A 5B66C 2OAZA 2F5EA 1JUSA 2BE5F 2EIKH 3HJEA 4EJTA 3B78A 3V8LA 4JX5A 3T1YI 5CQEA 3V8KA 2E1CA 1FZPB 3O3KA 2L4MA 4MHGA 5FLVA 5CVIA 3C18A 1I94I 2DAOA 2K9SA 2KJBA 4RGXA 4DIQA 5ICCA 2VLAA 3MKYB 2JE6A 2E5ZA 4HZFA 3LFKA 2X4HA 1IXSB 1YYVA 1G6NA 2V4JC 1N36I 4I6ZA 5C0XB 1XGMA 2WTEA 3TW6A 4OAYA 3U9GA 2M8EA 1OYSA 3DFGA 2O3ZA 3L7ZB 1T0FA 5C0XD 2EQRA 2R7XA 2M7AA 3ISPA 2LREA 3GTQJ 3Q9VA 3BQZA 1IRZA 1Z1DA 2PO2B 1R7JA 3M07A 2YU9J 3DBHB 1HSTA 2EZKA 5HDNA 4PSWA 4C30A 3ZOBA 2OD5A 4NUBA 2XSDC 2ZXHA 4C3JJ 4IOCF 1SD7A 3PQJA 2DYSH 3CCRI 1R1TA 2L02A 4CZCA 2QKLB 5FLMJ 2EZLA 3BPVA 1PUEE 2H27A 2NN6A 4LB6B 3BLYA 3OYCA 4HY1A 4LPFA 3FXKA 4JI8I 1UB9A 1E3HA 1JKPC 1A31A 2HOTA 2E7XA 4EM2A 1ZH5A 2XF7A 4DV1E 4A12A 1VI0A 4LFAE 1XC5A 5J1UA 4USKA 4Y4RA 3GVAA 3FXRA 5FLXZ 3R61A 2O1VA 2R3VA 2E35A 4OX9E 3S1QJ 4A3KJ 1TP4A 5E18F 2ZCWA 1HKQA 5D4SA 1ERDA 4IZJB 5C0XE 3HPHA 1HNZI 4UUVA 2R7UA 1RNLA 1XPXA 4JX4A 1IW7F 5B1BH 1QZZA 4XOTA 2CW0F 2DK5A 5DNXA 1U2WA 5LHGA 5HVQC 2K85A 3DBLB 4I01A 5E1WA 2LNBA 4JYAE 3KP7A 1HA8A 3P06A 2K9QA 3K2ZA 2ZJQF 4BE2A 1G2HA 4NB5A 4Y17A 2E2IJ 3PO3J 5K36D 2HYFA 2HHHI 4MTDA 1Z6RA 3MN2A 1FEXA 3T1HE 4FTHA 3WE2A 4X64E 2DXIA 1HCRA 1AU7A 2UU9E 3JR9A 2EPFA 4J3DA 1Z3XA 2JTVA 2J5PA 1B8IA 2CQKA 1T0FC 5FB2A 2EK5A 4BJTA 3ZQCA 2DJIA 2FOKA 2F4IA 2VODA 2UUAI 4A6EA 2VJIA 5CPRB 3NWTA 4II3A 3M7ND 3IKTA 3JRBA 3AFHA 4EM0B 2VQFI 5ED4A 2LJPA 1QO0D 2LKXA 3ZM7A 2Z9OA 1HKTA 3ZMVA 4XLHA 3H92A 2WC2A 1ENHA 1I5ZA 3C2GA 3M1EA 1T39A 4LG0B 3ZCOA 2NN6C 2ADUA 2PMUA 2X0LA 3W6VA 2J7KA 2FE3A 4G7OF 3K1PA 1EA3A 2E2JJ 4EVIA 1W0UA 3V4GA 3FK7A 2VT2A 3MKLA 1ETXA 4B3MI 4IFDC 2L7KA 2CVEA 1HQCA 3LSGA 3VWBA 1WFXA 2YU3A 3R60A 2R42A 2M4GA 1BW5A 3CQZJ 4WF2A 4CH7A 1IN6A 3I59A 3S3NA 1QQIA 3RPUA 2FMYA 3BG7A 4BBRJ 2B63J 2HK2A 1QVUA 1ZHFA 5LFAA 2XB5A 3OL3A 3PYGA 1XMXA 1O57A 3HM5A 3I5UA 2EFPA 5EGOB 4GYIA 3FMSA 2VQHA 1STZA 1BC7C 4MEYF 5J3LA 2L54A 2DO7A 3D5SC 6PAXA 5J1YA 3BR1A 1J2XA 4BS9A 5LMNE 2DEIA 1ON2A 5HDGA 1JE8A 3V7SA 4C2MJ 3OYHA 1H7SA 1MMAA 3BG3A 2P7CB 4XLFA 3K9TA 3TMOA 2LSOA 3J81Q 2E5LE 4D5CA 1ZXMA 4F93B 4X0GA 3LQRA 4X65E 3OYLA 3WGHA 1V5EA 4LK1F 5L3EA 4N9IA 3B8HA 3OIPA 5CVRA 1MJAA 3S17J 4JI7E 2GOMA 2Z5EA 3JRHA 2ZNZA 5K7FA 4A3CJ 4YRVA 5KK1A 3CCQI 3H9JA 3QODA 1YW8A 3H4LA 1QHHD 1XCBA 2O8XA 2W24A 1BI3A 4MLOA 1J5EE 4DPWA 4A6DA 3R4KA 1B4AA 4P9UA 2R7VA 5M5XJ 1B1BA 1UHWA 3DBRB 3HSFA 4KDPA 1Y5YA 1FJGI 3HOYJ 2WNRA 1JUMA 3UHMA 1QZEA 2LF8A 4ZYHA 4OMYA 4ENKA 4LF5E 1HF0A 4AM3A 5DM7F 4PJJA 2ID6A 2V6CA 1SAXA 5IP7J 4X66E 1LEAA 1VISA 5KVRA 4YIFA 4O3MA 3CCVI 4B47A 5IT9K 4FX4A 4DR5I 1ETOA 1D0XA 2H94A 2Y0MA 3ASNH 3G1LA 4NHJA 3BR6A 4OIRF 1UFMA 2R5ZA 1U6GA 1MSEC 3RKWA 1VQNI 3PS2A 1WHUA 4BE1A 1KYWA 2K4BA 2HQRA 4IL6C 3KFWX 3UR3C 1UDNA 1MBKA 1XSXA 2IOQA 1FMWA 2R7WA 5BQTA 4E6KG 1R5HA 4C3IJ 3A0HC 1FI4A 3CD6I 4HYEA 2UWMA 1WJEA 1RIOH 4A3FJ 2C39A 5H6QA 1TWAJ 2R93J 4QPQA 3S2HJ 3WTWC 5FRMA 2FBIA 4M6VA 4LLNA 2PI0A 4DR1E 4LF7E 4CYCB 1N33I 2MLKA 3KX2A 1R36A 5H20A 5HLIA 3WHCA 3NQOA 4Q47A 4J01A 3ZP5A 1PUFB 1FX7A 3I4NJ 1R6LA 4PRVA 4GRIA 1I6XA 2DT6A 3PS1A 1Z0GA 5DRPA 3PM1A 2XEXA 1JGSA 2Y30A 3CMAI 4B3TE 4ZDOA 3WU3A 2IBDA 1ELOA 1D8JA 4DZPA 1DU6A 4BXXJ 1Y56A 3QAHA 1KQ0A 3IH4A 4KMUX 4R79A 2C38A 2CGPA 2F4OB 2VPRA 1YOVB 2ZM6E 1B9NA 2VKHA 4BAYA 4GXOA 5D6EA 2CQ7A 2M9HA 1DP3A 3EYYA 4DV6I 5GPAA 4KIFA 1FP1D 4KT5C 1SFKA 1OR7C 4OO1C 2A6EF 2IS1A 3ABLH 3ZKDA 1AHDP 1MBFA 1Q1HA 2HTSA 2FNPA 2PMZN 3FHNA 2W1OA 5C3EJ 3J80K 3ECHA 3JCUC 4DR2I 1OKRA 1LFBA 2QENA 3KP3A 4K0KI 1Z67A 4D0PA 4LFCE 2D2WA 3K7AJ 3OV8A 5JFRA 1NK2P 2A2CA 3FMRA 3FDYA 2HYGD 1YW9A 4P52A 2VJJA 4KHPE 2VJ4A 1Y8RB 2R0QC 1KKHA 4G94A 2EBIA 2JA7J 3CCEI 4ED4A 2KISA 4IJAA 3WE3A 2CGEA 2JVGA 4M3DA 2LYCA 2PNZB 2CO5A 3IWZA 3AG2H 4HACB 4Y52J 3QP6A 2E5NA 5JEAE 5KAFC 4HOBA 5M5YJ 1J9IA 3BR5A 4JI2E 1YIOA 1ZN2A 3KRNA 4RM3A 2HI3A 4DJAA 4FN5A 2PMZA 2BV6A 2TRTA 2V79A 4DZJA 4DR7I 3K4KA 3H1CA 1R58A 3BG6A 2CJJA 2XUBA 4NXMI 4JI5E 1FOXA 3IL2A 2CU7A 4M3BA 1F4KA 1BA5A 5IT9C 3WTVC 3WG7H 2R7RA 3EDPA 2XGXA 5HDKA 2PO1A 3F0CA 1VI7A 2JE6B 1V55H 3JSOA 4I09A 5FD5A 4MU3A 4RS8A 2VL8A 4DR4I 3BJAA 5FKLA 4ON0A 5A2QZ 4FW7A 3S8PA 1YLFA 2DT5A 3G1MA 1ETKA 4CSWA 3WTUC 3AKZA 2BA0D 1DGRM 4HLXA 1ZGAA 2FD5A 2V9KA 4DPTA 4JI6I 2X6YA 3ZMSA 2VBZA 4A0YA 2BXZA 2E71A 1UHMA 4UTGA 2DCEA 2LY1A 5L3DA 1BM9A 3OTOE 1B63A 2V26A 5CVUA 1ZYRF 1R6MA 1XSDA 3HXLA 1F36A 3BPXA 1OISA 4IX7A 1D5VA 2QBYA 3H3UA 2CS3A 2D45A 2JA5J 2OTJI 1USUA 2NN6B 1XMQI 4IHTA 4HEA2 1Z0XA 2NN6D 3WTZA 1AOYA 4WXDA 1H89C 1YH8A 1XGOA 4L0ZB 5DEQA 3W3CA 1O3TA 2AE8A 4HA8A 1LDJA 3GLLA 4OWRB 3ZN0A 1S7OA 1ODDA 2A5WA 5HNHA 1EH7A 2ELKA 3HB9A 3PNYA 3JRGA 4LK0F 3HJCA 1MSFC 5IWAE 1TZLA 1NH3A 3AL0C 1WKMA 3DU5A 1FOWA 3NAUA 5FKMA 2RVCA 5HS9A 1TC3C 1EI1A 2NS7A 5LL6R 4M9ZA 2J65A 3GTJJ 2HFUA 3H0GJ 2Z5UA 4XORA 4LF4I 1W5CC 3IUOA 1X2NA 5JVTA 1MBHA 4B3AA 2Y2ZA 4LLLA 4BACA 2L7FP 1QU3A 3PFYA 3J80C 1WVRA 1ZELA 3LL7A 2YS9A 3MQ0A 1W4MA 3SZTA 1UMQA 5HLGA 3CESA 2MFZA 1R9TJ 4BA1B 2L2OA 2HFHA 3GCMA 4XONA 2UXNA 3S16J 1B8IB 3HOUJ 3S1MJ 3ZQHA 4DV4E 3M85D 2VUMJ 4I76A 4JI4I 4YFKF 2GLOA 3ML6A 5BR8I 2K9MA 4RDUA 1ZLKA 2NS8A 2WP8A 5K36F 1FBQA 4II2A 1GHCA 2ZITA 3M7NG 2HVQA 4UV8A 3L2RA 5LMUI 4B1RA 1H72C 2KRFA 1BIAA 3PNTA 3WGIA 4IO9F 1WH7A 2EIMH 3DTIA 1N0UA 2JA8J 3ASOH 3C7JA 1Y39A 4IRIA 4A3DJ 3PQKA 4OOIA 3U21A 1Y6ZA 2W84A 2CUEA 2K9LA 4AVZA 3OYAA 2ZXWH 4UVCA 4ZC3A 5KNLA 3LSKA 1U8RA 1P7IA 2ETHA 2EB7A 3LNQA 3L2WA 2LKSA 1H7UA 2L7ZA 5E79C 3Q3SA 2JPBA 5J8FA 2IGOA 5EG0A 4Y15A 3HPGA 4ZZLA 2HPMA 3GTMJ 4KUMA 3RPUD 4EM1A 1SD6A 1UDSA 2JA6J 2LKPA 3WU2C 5JI6A 5H6RA 2DOFA 2FBHA 3DP7A 1ZXNA 2GO3A 1WGXA 3BR0A 2EWNA 1VQ5I 2UXCI 4J19A 2XV4S 4DV3E 2VOOA 3TP3A 1IO2A 4JI0E 2IT0A 1PVEA 2OZ6A 2MC3A 4D1QA 5F6FA 1D1AA 5BNGA 2DLLA 1QGPA 4M9XA 4NXNI 1IAWA 5BOXA 1S29A 3DD6A 3TO6A 3JAMZ 2Z99A 4I7HA 3ABKH 3SFIA 1MZBA 1DU0A 3VB2A 2DMTA 3F8CA 3OS1A 1YG2A 1ZM9A 1G8XA 4BH9A 2V9VA 1NHIA 2F5DA 3TO9A 2HK3A 3GX4X 4IQ4A 2E1NA 1JJ8C 2R7QA 4F92B 2DK8A 3BTCA 1A04A 3OYNA 3CO7C 1TNTA 3DPLC 4CHUA 4MFDA 2ID3A 3RI4A 4GKJI 1UG0A 3RSNA 3SZPA 3QQAA 1ETYA 2EV0A 2WNRB 4X62I 4OIQF 4DU7A 4WX9A 3BG9A 4PK4A 3GFLA 3FIWA 1GXQA 4N4NB 3V42A 2IOPA 1FOYA 1A5JA 2E1RA 3LTOA 1O4XA 3F22A 1WUUA 5JHUA 1W5SA 1XN7A 3PS3A 4W1UA 2DA1A 1MH3A 2G0EA 3EUAA 3KZZA 3M8FA 4HV6A 2K3PA 1TWCJ 3Q1QA 4HNTA 4AUXA 4EQQA 1ZAOA 3WU1B 3CC7I 3H0DA 1O3RA 2KHMA 1P4XA 2KIFA 4XSXF 3PIOF 3ZZTA 4JYKA 1D1CA 5LD2C 1K78B 1HBXG 3M7GA 2C39B 4U88A 1YO5C 1Z0BA 1PKPA 2VIXA 1S7AA 3OYEA 1D1BA 1XTAA 1X2MA 2ZJPF 4DU8A 3GYHX 5BPDA 2CFXA 1O3QA 1D0ZA 4XLPF 1QBJA 3HOSA 3GTLJ 3CDJA 2QZ8A 2BA1D 3LSRA 4D5FA 4G12A 3DV8A 4ASNA 1Z3YA 3FM5A 1RUNA 1X1AA 4KJZA 2UXDE 1HW5A 4L9JA 3JTHA 1QA6A 3WODF 2C38B 4Z6YA 5FLXK 4P5OA 2ME6A 3OYMA 4V19K 1I3AA 4L5EA 4DPXA 2N8GA 4G8XA 4YY3I 5IYDJ 4WUCA 2WAEA 3HOXJ 3JAMQ 2XVCA 1M1EB 5JLXA 3TW7A 3D4JA 2LDUA 2JZYA 1HNWE 4Z7CA 2FEZA 2P4WA 3A01A 1ON1A 2IEKA 5J6XA 4DYQA 1BR1A 3I55I 4LIVA 4A0ZA 3F8FA 1XMOE 3IP4B 1Q1VA 2DFHA 2JPCA 5CKTA 4BA2A 2EA4A 2ZC2A 3ZMZA 1XS9A 1YIJI 2WW4A 2GXBA 1GV5A 4DNCA 1X58A 2VASA 2JQ7A 4RLFA 3M4OJ 4JV5I 4BHCA 5EEAA 4MYUA 3ROUA 5GTHC 3G3ZA 5LRSA 4LF6E 3K4JA 3HHHA 1XGNA 4PUSA 1XNRE 2VT3A 4A5NA 1JT0A 2MYSA 2EFNA 3CCYA 3M3YJ 3QPSA 2OQGA 4GKKE 4LLGF 3OYDA 1NZ0A 1JT6A 1R5GA 1Y0NA 3MD2A 2XRLA 4HBLA 1B72A 2IS6A 3L2QA 1N32E 2LBFA 2KIMA 4A69C 4FE4A 1H88C 2AJ4A 4IQJA 3QYEA 3GEZA 3QPLA 2VBXA 3PUFA 2DMPA 2DQLA 3WHBA 3I53A 4DV1I 2H6CA 3GBGA 4LCFA 2OPTA 1IDZA 2VKVA 4LFAI 1MH4A 5DV5A 2ZO4A 3E5QA 3CMYA 4L18B 3GZNB 4ESBA 2R7DA 4OX9I 1TWGJ 1V4RA 1I1SA 1PIEA 1IN4A 5EKWA 1K6OA 1Y8QB 1HW2A 2PO1B 1JTYA 1PDNC 2CQNA 2QQ9A 4IPAA 3FWEA 1YS7A 2H6BA 4JYAI 2FA5A 4ZDLA 4B3RE 5L3CA 3F3XA 1NG6A 4A93J 2PN6A 4QLCU 2BA0G 3G73A 2AXTC 4HDUA 1FTZA 4B8XA 1YFHA 1KA8A 1XNQE 2BHYA 4P1WA 3H5RA 1UZCA 1V3FA 2WY7Q 3CP2A 3OSGA 1QZYA 2VESA 4X64I 2FSWA 3T1HI 2BY3A 4RM2A 3K6GA 2A6HF 3K2AA 2RAEA 2V1NA 3MAJA 3S93A 3TQNA 4CICA 1CF7A 1BI0A 4IHVA 2X7IA 5CVVA 2P0WA 4DUYI 4LF8E 2VF3A 1OYWA 2GA2A 4UVAA 5KCMA 2BM1A 1Z0TA 3IWFA 3L09A 2L3DA 5J4VA 1FWKA 5IOZA 2Z5BA 3MWMA 3I4MJ 2HVSA 4JI3E 2P5KA 2XF5A 4NQWB 3OR2C 3EYIA 3GLXA 1H73A 1YJWI 4IHXA 3BG5A 1RPWA 5GAGJ 1GVJA 5FLXC 1TW3A 5FKKA 4DV2I 3WU6A 3VSKA 5JEAC 2BZTA 2BY0A 3LSHA 1P92A 2QCOA 4B44A 5L3BA 2VBWA 3WTTC 1WPKA 3OYFA 2QVOA 3GONA 3E3VA 3JRAA 3L2VA 2O03A 2VXZA 4HG2A 4QSHA 2F4VI 3G4SI 2BY2A 1RESA 2EINH 2NN6F 1W36D 1B62A 1U9OA 5FKOA 4IFDA 2KDZA 3CC4I 4PJ0C 2ISZA 1FP2A 2KFDA 1OFCX 2DA3A 2FMLA 4JP0A 4DUZI 4B3SE 4IFDF 1FSHA 4I99C 3J81Z 2Y0SN 4M9SA 1D5YA 1WH5A 2ECCA 3K10A 4UT4A 4IF4A 2L0KA 2NNYA 1HNXE 2OI2A 3L1PA 4LJZF 4MTEA 2HYJA 2KIUA 5LMNI 3JREA 4PRXA 4M3FA 4U0WA 2V2VA 2GOXB 4WXCA 3H35A 1JKQC 3M85G 1YW7A 1IBLE 1VF9A 4OAZA 1R71A 2M2EA 3I56I 5K36B 1XDSA 2BV3A 4XICA 3CLQA 4DBQA 3D0SA 2WP8B 4M72A 5ILSA 4OINF 4BJ5C 4CDGA 2OCEA 4ZTFA 3K4MA 4LCHA 1ZR2A 2CG4A 4A3JJ 4EGYA 5CQGA 4OMZA 1BJZA 1OJ4A 3S1RJ 2DT7B 1QPIA 2DA6A 4ENMA 2DOEA 4UUTA 1QNTA 1Z7LA 3IKVA 5JHFA 2A05A 4YEJA 3VYTB 2V6EA 3J7AM 2VBYA 5FFXA 1YJNI 1R6RA 4LFUA 5F0CA 2HGCA 2W57A 1IZ1A 4XKBA 3DKYA 4CYDA 2OUMA 1LE8A 1DARA 2MGQA 3T1YE 5BMZA 1KONA 2Y0SA 3ELKA 4FASD 1BI2A 2MH9A 2QSGX 1A6QA 3HSEA 1VTNC 1I94E 2Z1DA 1ETVA 5EG0B 4AVPA 5AIQA 3V7CA 4RB0A 1FC3A 1BN5A 3ZQLA 2DW4A 3FMQA 3J7AY 2BOLA 2XRNA 4R8HA 2QA4I 5J1RA 4FCYA 4X66I 2JSCA 4PDKA 3KLOA 5K36E 2VONA 1BW6A 3FX3A 4A3LJ 1N36E 2YX7A 3M9AA 2V9PA 4HX8A 1ZGJA 5DRQA 4IS9A 2LP0A 1BC8C 4IEJA 3WTYC 1IBME 3OIOA 3Q5FA 2M8GX 2V34A 5F08A 1N34I 1W1WE 2DPUA 1VQOI 3G71I 2DMNA 3LA3A 4LGWA 2FF4A 2M4KA 1KU2A 1MNDA 2F5VA 1NHAA 4NBQA 4KN4X 2HWVA 4LF7I 2JK3A 2L9SA 3JTGA 5DCMA 2UV1A 5JLWA 3BZKA 1D6TA 3DXJF 2UUBI 5ICFA 4JI8E 4JBAA 4ENJA 1I39A 4ANJA 3CCSI 2O1WA 4RAFA 4DPYA 1WZ2A 3PYEA 4ZDPA 4G6DA 4FETA 1XX5A 1WJFA 1HOMA 3CWVA 3M8EA 2Z5CA 2QWWA 2X1DA 2VI6A 4ABZA 3ZQIA 4F55A 1USVA 4E70A 4ETSA 2XB0X 1Y6IA 1VQ7I 4FW6A 3K0LA 3ZZ0A 4UUSA 2H1KA 4ZZDA 3L00A 4G6QA 4UHTA 5DD8A 2CV0A 1H0MA 2XGEA 3F23A 2CYYA 1YHCA 2AQEA 3K1JA 2E7WA 3FXJA 3WG9A 2VC1A 2DQRA 3M8JA 4WWCA 1IV8A 4DR3E 1TWHJ 2BGCA 2EILH 2DMUA 5A2QK 5CYVA 4NNJA 2R92J 5GMDA 2HHHE 4DR6I 4AU7A 3Q6MA 1OR7A 2GS8A 2QYOA 1ULYA 3FZVA 4OO1A 3BQYA 3IH3A 1W0TA 3H9QA 4OO1F 1B9MA 4Z7YA 2CG9A 4KFCA 3O6BB 1U2RA 2ECBA 4M71A 1R4NB 4DYCA 3HOWJ 2PX9A 2EFOA 1J0RA 1LEBA 1YX3A 4RB1A 2PNMA 2UUAE 3G6EI 4KHPI 1W7PA 2HDWA 2BA1G 3VODA 5FKNA 1MMDA 1PP8F 2VQFE 1MBGA 2BR2B 5HOOA 4XNFA 4AD9A 3ERMA 3I3LA 1DUXC 3BJOA 4CO8A 2MH2A 2CUFA 3ABMH 3SDGA 1FWZA 2YPRA 4RBOA 3ERED 2DMQA 2UXBE 3ABUA 4Y7NJ 1KTVA 4B3ME 1QRYA 4BEHA 2EFWA 2F5FA 2RREA 3JW4A 3LSTA 4BUPA 5J4YA 2LY9A 4XBFA 3A01B 4WUDA 2CUJA 1LFUP 2KL4A 2NS0A 1AKHA 3U1DA 1ZTRA 4BGDA 3ZXSA 2QQAA 1H9TA 4E7ZA 3SZGA 2PEXA 3HHGA 3N05A 2JEAA 1FIAA 2P81A 5K7HA 2HXOA 3K85A 3WTSC 2Z16A 3HEFA 1U5TA 2K86A 4X1EA 3K70C 1OJLA 3TGNA 1V54H 1OYRA 4P96A 3CDLA 1SFUA 3L2UA 2NVUB 4OIPF 4FWHA 1DP7P 1DGWY 1SFEA 2EZIA 2PG4A 3K69A 4U0YA 2DJNA 2GAUA 1QZRA 2BHZA 2M87A 4IRGA 2ZB9A 3B02A 2Y31A 2JRMA 1LDDA 2HEOA 2E1MC 4GCVA 4EGZA 3RQ4A 2E1OA 1B72B 3AG4H 3X2QH 2BM0A 1V5GA 5DS9A 1IUYA 4EJWA 2CV2A 4YHHE 2PLYA 3VPRA 2LK2A 1MX0A 4BYYA 1FJGE 5ILVA 1TT0A 2ESHA 4UVBA 1WCMJ 1EH6A 3D5LA 2FXAA 4DOZA 1OYPA 2JEBA 2V8PA 1NHJA 1F5TA 1HLVA 5TRDA 1MIJA 1WSUA 4XKVA 2RQQA 4BDZA 1G59A 4ZVIA 2COMA 5IWAI 1YQAA 4Y13A 3HRSA 3BP8A 5D5VB 3RZOJ 2ZXJA 2MLGA 5DM6F 2PBIA 4AIDA 3KYLA 4DR5E 1MBEA 1VQ6I 3DEWA 4HSTA 1FKAE 2M0MA 1I6HJ 1PVGA 1G3SA 1POGA 5A2QC 1J7KA 3T1BA 4YIIA 1HDPA 2CFOA 5FRNA 3QOPA 1OLTA 2YR2A 4DV7I 5EL9A
chains in the Genus database with same CATH topology
3U1KA 1R6MA 3M85G 4AIMA 5JEAD 5K36B 1R6LA 5C0XC 2WP8B 2NN6C 2NN6B 2PO0B 2NN6D 2BA1G 2C38A 2BR2B 4IFDC 3GLLA 1E3PA 2WNRB 5K36A 2JE6A 2C37B 4OO1C 1UDOA 2BR2A 5C0XB 1UDQA 3L7ZB 2JEBB 1OYSA 2PO1B 5C0XD 3GMEA 5K36E 2PO2B 4IFDB 4BA1B 2JEAA 3GCMA 5JEAA 4IFDD 2BA0G 3HKMA 5JEAF 3M85D 2C39B 2WP8A 5K36F 2NN6A 1OYRA 3L7ZA 3M7NG 2PO0A 3CDJA 4OO1B 2PNZB 1E3HA 2BA1D 4OO1D 4NBQA 4BA1A 5JEAE 3CDIA 2WNRA 3KRNA 5C0XE 2NN6E 2C38B 4BA2B 3H1CA 4AM3A 2C37A 5JEAC 2PNZA 5K36C 5C0XA 1OYPA 2PO1A 2JEBA 2JE6B 5C0XF 2NN6F 5K36D 1UDSA 1WHUA 1UDNA 2PO2A 4IFDA 4BA2A 4IFDF 4OO1E 2BA0D 4AIDA 3H36A 2C39A 3DD6A 3M7ND 4OO1A 2JEAB 3B4TA 5JEAB 4OO1F 4IFDE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1K A;  1R6M A;  3M85 G;  4AIM A;  5JEA D;  5K36 B;  1R6L A;  5C0X C;  2WP8 B;  2NN6 C;  2NN6 B;  2PO0 B;  2NN6 D;  2BA1 G;  2C38 A;  2BR2 B;  4IFD C;  3GLL A;  1E3P A;  2WNR B;  5K36 A;  2JE6 A;  2C37 B;  4OO1 C;  1UDO A;  2BR2 A;  5C0X B;  1UDQ A;  3L7Z B;  2JEB B;  1OYS A;  2PO1 B;  5C0X D;  3GME A;  5K36 E;  2PO2 B;  4IFD B;  4BA1 B;  2JEA A;  3GCM A;  5JEA A;  4IFD D;  2BA0 G;  3HKM A;  5JEA F;  3M85 D;  2C39 B;  2WP8 A;  5K36 F;  2NN6 A;  1OYR A;  3L7Z A;  3M7N G;  2PO0 A;  3CDJ A;  4OO1 B;  2PNZ B;  1E3H A;  2BA1 D;  4OO1 D;  4NBQ A;  4BA1 A;  5JEA E;  3CDI A;  2WNR A;  3KRN A;  5C0X E;  2NN6 E;  2C38 B;  4BA2 B;  3H1C A;  4AM3 A;  2C37 A;  5JEA C;  2PNZ A;  5K36 C;  5C0X A;  1OYP A;  2PO1 A;  2JEB A;  2JE6 B;  5C0X F;  2NN6 F;  5K36 D;  1UDS A;  1WHU A;  1UDN A;  2PO2 A;  4IFD A;  4BA2 A;  4IFD F;  4OO1 E;  2BA0 D;  4AID A;  3H36 A;  2C39 A;  3DD6 A;  3M7N D;  4OO1 A;  2JEA B;  3B4T A;  5JEA B;  4OO1 F;  4IFD E; 
#chains in the Genus database with same CATH topology
 3U1K A;  4YFX F;  5LBQ A;  3KET A;  1U5T C;  1A36 A;  1H74 A;  3FBI B;  1SMT A;  1T2K A;  4F7Z A;  2KMU A;  3LFU A;  4JI1 I;  2HNH A;  3VDX A;  5IYB J;  1MNM C;  1O3S A;  5HS8 A;  4EMD A;  2H8W A;  1ZK8 A;  3MZY A;  4I98 B;  5DD4 A;  5ILU A;  4DV4 I;  1N33 E;  3HYI A;  1SMY F;  4AQY I;  3REO A;  3SEQ A;  3BZ6 A;  2A6T A;  3L2C A;  3LOC A;  3T5X A;  1P7J A;  3QPH A;  1FYL A;  5C4X J;  3TDZ C;  1MMG A;  3FKI J;  4H0E A;  1EKE A;  2JUC A;  2ISY A;  3K4C A;  3N4M A;  3HC7 A;  2HDC A;  2Z2S B;  4XLC A;  5JR3 A;  2IA1 A;  1Z5B A;  4V2F A;  4C2T A;  2L9N A;  2HQ5 A;  2A3S A;  2OCC H;  2CUZ A;  1WJ5 A;  2F48 A;  1IBK I;  1D8K A;  1Z0C A;  1K83 J;  4Q48 A;  2X48 A;  3TL4 X;  4XRS A;  2GIV A;  2EFQ A;  1OPC A;  4GFB A;  3DTE A;  4DV6 E;  3DQV C;  2VQL A;  3SHF A;  4C9Y A;  1R00 A;  2L01 A;  3K4N A;  4EAT A;  3S2D J;  3K17 A;  2XAF A;  3KPH A;  4JOM A;  2B9S A;  3LMM A;  4KMF A;  2L9V A;  3KCC A;  2K9N A;  5IOY A;  2M0C A;  3I4P A;  3GZ6 A;  4IFD B;  3O2P E;  1ZRE A;  3C2H A;  2M45 A;  4U7D A;  4XN0 A;  1LNW A;  5F04 A;  2LVS A;  3FHZ A;  2EJR A;  2UUC E;  4IFD D;  1LUJ B;  3WU4 A;  1P42 A;  1WJC A;  2NAZ A;  2X6X A;  2MW8 A;  2MD0 A;  4P9F A;  1T38 A;  4Z2Y A;  3QU6 A;  1FT9 A;  1CGP A;  3HKZ N;  3L7Z A;  4K0K E;  4JI0 I;  3ZQG A;  5B5E C;  2NOG A;  3I9V 2;  1RHY A;  5E20 A;  2WY8 Q;  2TDX A;  4EV0 A;  3CUQ C;  2RNJ A;  1S9H A;  4USM A;  2LC2 A;  1A35 A;  2IP2 A;  2Q1Z B;  1E17 A;  1BR2 A;  1G3Y A;  2NN6 E;  4OZE A;  2NNN A;  4IHW A;  1WJB A;  1FPQ A;  1Y4S A;  4KIS A;  3BCA A;  3MFK A;  2AXL A;  2D1H A;  1U3E M;  5LGU A;  1P4A A;  4NDL A;  3CMM A;  1ONV A;  1ZLJ A;  3P3G A;  4HF0 A;  4KIC A;  5K5R A;  2VQE E;  1LE8 B;  2O5R A;  3QT5 A;  4DR7 E;  1U9N A;  3V8J A;  1YIT I;  2WA0 A;  1ZRC A;  2Y75 A;  3ZMD A;  1IRF A;  4M3G A;  4IZJ A;  2KJC A;  4Y33 A;  3HKZ A;  3FXU A;  3SXY A;  1S4E A;  1H8A C;  1Y4U A;  3OMY A;  2RV8 A;  4YG2 F;  3WGG A;  1AA7 A;  4XLE A;  4AIK A;  2NVX J;  4DR4 E;  3ZMT A;  1BIB A;  4XLN F;  2V1X A;  4YFN F;  2QQ8 A;  3FK6 A;  4FQG A;  2NYX A;  4GDF A;  3OS2 A;  1IRG A;  1F43 A;  3K1N A;  4AIM A;  3I59 B;  1PP7 U;  4JI6 E;  2XAQ A;  3HTS B;  2X6W A;  1QVT A;  3RPQ A;  3O8G A;  4EMS A;  1VQ8 I;  5C0X C;  4DV0 I;  4I0A A;  1S7E A;  4U3D A;  2BXY A;  4MGR A;  2L4A A;  5EZG A;  4RAZ A;  3C3W A;  4UY8 I;  1F9N A;  2R7Z J;  5GME A;  3KE2 A;  1WQ2 A;  2ACJ A;  5DCM B;  4D7N A;  1YHQ I;  3ZGK A;  5F0H A;  3P9K A;  2JT2 A;  4WXH A;  1XMQ E;  5IT9 Q;  1XMA A;  2ZSI B;  4LG0 A;  2M34 A;  2HKE A;  3TOB A;  3W2A A;  5J8C A;  2X51 A;  2QEX I;  1RRJ A;  2Y48 A;  5GP9 A;  3OS0 A;  2VE8 A;  1Z77 A;  2VKE A;  2QF7 A;  2XRO A;  2WWY A;  1ITY A;  3F8N A;  2KDO A;  1N78 A;  9ANT A;  1SVO A;  2M1B A;  3PNV A;  2OTL I;  4BBS J;  2Z5C B;  3BR2 A;  4HPQ A;  3TKY A;  4DQ2 A;  2X1E A;  4HRI A;  3ZQQ A;  2GZW A;  2K7L A;  3DPU A;  4KNY A;  3CJT B;  2A07 F;  4PSX A;  4CCM A;  2FBK A;  3E6B A;  4MQ9 F;  3ZQ7 A;  2KPM A;  3A0B C;  1ZGW A;  3OYG A;  4MNU A;  4LF4 E;  2O1T A;  4M74 A;  1BBY A;  1JGG A;  1XMO I;  1GXP A;  4XK4 A;  3ULQ B;  1UG2 A;  3F6V A;  3HGY A;  5H2F C;  5GPC A;  3LSI A;  4P7A A;  2W82 A;  1KU9 A;  3JRF A;  1BKN A;  4F52 A;  3K70 D;  4OO1 B;  1R49 A;  2X9D A;  4N0B A;  3HOZ J;  4OO1 D;  1XMK A;  4AYB N;  3E7L A;  1IN5 A;  1Y0U A;  3T0Y A;  5HLT A;  1JJ6 C;  5BR8 E;  4JI4 E;  1FOK A;  1R4M B;  4LF6 I;  3B6C A;  3QP5 A;  4AC0 A;  3DEU A;  2A2D A;  2HZT A;  5F64 A;  1W7P B;  2OV7 A;  4CA0 A;  1EH8 A;  5LMU E;  2ESN A;  4F3Q A;  4OKG A;  3HBL A;  1W7P D;  1VND A;  2MC4 A;  4UV9 A;  2PQ8 A;  3NWS A;  4M6Y A;  3A2K A;  1TW2 A;  1N32 I;  1ZM3 A;  4BJ6 C;  2XPU A;  3OYJ A;  1KYZ A;  2WAQ A;  1N75 A;  1UCR A;  2XIG A;  3GFI A;  5LHH A;  2PJR A;  2LOO A;  3J80 Q;  2O7O A;  3WU5 A;  2DOA A;  3BR3 A;  2DYR H;  2RKH A;  3F72 A;  3HUL A;  4BEH B;  3E1S A;  3E6M A;  3KYC B;  4P55 A;  2DDB A;  4Q5S F;  4OO1 E;  1DQU A;  1T56 A;  2FJ1 A;  2ZJ2 A;  2F2E A;  4FHT A;  3LAP A;  1AKH B;  2W85 A;  2AS5 F;  4AYB A;  1VQK I;  1KU3 A;  2OF7 A;  4MEX F;  1VZ0 A;  2L5Q A;  3LA2 A;  4BXF A;  1E3O C;  2KLO A;  2JEA B;  3S14 J;  2DFI A;  3QYB A;  3J81 K;  3B4T A;  1F1Z A;  2UXC E;  4B3R I;  1XDU A;  2EV6 A;  2GM4 A;  1U5T B;  3R0J A;  2CW8 A;  2LF7 A;  2IAI A;  2CRG A;  3PRY A;  4NXN E;  3TO7 A;  2Q8K A;  1XNQ I;  1XGS A;  1TNS A;  1MG7 A;  1HSJ A;  3RCO A;  4XQF A;  3I54 A;  2X85 A;  2D5V A;  1HR0 I;  4PZJ A;  1TBX A;  1X1D A;  2G9W A;  3R6S A;  4O6J A;  2NVQ J;  3RYP A;  4S04 A;  3IV5 A;  4BQN A;  1Z05 A;  2M5W A;  3SFZ A;  2XAG A;  3NEU A;  4CZZ A;  3D5R C;  2V1U A;  2R5Y A;  2GIZ A;  3EUH A;  3CCM I;  4BY1 J;  3RDI A;  1P6R A;  3G1O A;  4GKJ E;  3KP5 A;  3W6K B;  4G7Z F;  2DEJ A;  2DDA A;  4X62 E;  4DW6 A;  4XMY A;  4J00 A;  4C3H J;  1S6L A;  5FFZ A;  4B4C A;  2JEB B;  1ZG3 A;  1Z5C A;  1O7F A;  2DFE A;  5B3S H;  3KP2 A;  5IY5 H;  2P5L C;  2XC7 A;  4RGR A;  3I64 A;  4RGS A;  3DF8 A;  5E1X A;  1JI8 A;  3EET A;  2OU2 A;  2XKP A;  4RB2 C;  3BOQ A;  3OIQ A;  1MDM A;  5JEA A;  3KZY A;  3ZQF A;  4A3M J;  1TLH B;  2GBY A;  5K5Q A;  4E7K A;  2VOP A;  3HKM A;  5JEA F;  3EPZ A;  1K7A A;  3PSI A;  1IGN A;  3AL0 B;  2IER A;  1T6S A;  3BZC A;  1H9G A;  3RZD J;  2STW A;  4HDV A;  1YI2 I;  2PO0 A;  3RTR A;  1NTC A;  4I0B A;  4L9T A;  3CCL I;  4IOA F;  1LDK B;  3S1N J;  3GTG J;  2ELJ A;  5F1J A;  4ZJZ A;  4BQQ A;  2F6C A;  4U87 A;  5IPA A;  1PYV A;  2UUZ A;  2BYV E;  4HSR A;  1O7L A;  5J40 A;  1SD4 A;  2OJE D;  2CQQ A;  1GVD A;  3B6A A;  3J7Y J;  1FSE A;  1S72 I;  2O8K A;  2PNZ A;  2DTR A;  2XAJ A;  4KQV A;  4RAY A;  3IH2 A;  1J09 A;  1Y1W J;  1IJW C;  2UU9 I;  1TWF J;  4TV7 A;  1RI7 A;  4EJO A;  2PMH A;  3ABT A;  2CV1 A;  2BY1 A;  1LKX A;  3CP8 A;  3EUH C;  3RKX A;  1TQI A;  3JRD A;  4DV5 E;  3J7A G;  4YY3 E;  4XSZ F;  1T95 A;  3LNU A;  1HW1 A;  3A02 A;  2QBY B;  2Q2E A;  5DCF A;  3S32 A;  4FWD A;  2H1L A;  3BRO A;  3ZPL A;  1RR7 A;  2FOW A;  5KAI C;  4QTR A;  3QU3 A;  4U7B A;  5F0F A;  4HAM A;  2R7S A;  5LRR A;  4MDT A;  3E97 A;  4JQF A;  5IP9 J;  5K1Y A;  1J59 A;  4DPU A;  1OMI A;  3TED A;  1YRN A;  3J81 C;  2BVL A;  3U1Y A;  1VQM I;  3E5X A;  3P76 A;  1S16 A;  2JSP A;  1MD0 A;  4LIT A;  4JV5 E;  3RIR A;  4Y3O A;  3LWF A;  3UNG C;  5L3G A;  4IHY A;  3ZKB A;  3MKW B;  3RKQ A;  1UEK A;  1VQ9 I;  3S3M A;  5D5U B;  1IBM I;  2AO9 A;  1YTY A;  2VXD A;  5FRO A;  2XF6 A;  5ELW A;  3PFI A;  2HFS A;  1GT0 C;  5C44 J;  4LB5 A;  4LFB E;  3VOE A;  4IHS A;  1JXS A;  3LAJ A;  1RZ4 A;  2NOJ B;  4W97 A;  1XD7 A;  1BI1 A;  1X4O A;  1XSV A;  3P9I A;  1EJ9 A;  3QWL A;  4ZH4 F;  1N77 A;  3HUG A;  3PSF A;  5DYM A;  2ZFU A;  2IW5 A;  2ME0 A;  2PNL A;  4Q4Z F;  2X6O A;  1T33 A;  2XSJ C;  1UDO A;  4EJV A;  1U0J A;  3C1D A;  1IXR C;  5AIP A;  3HGG A;  1R22 A;  1X3W B;  3BWG A;  4AIH A;  4PGH A;  4RLQ A;  2E5L I;  2L7M P;  3S15 J;  4O5V A;  4X65 I;  4WCG A;  1VQ4 I;  3A03 A;  4LF9 E;  2QKM B;  4IKF A;  4JI7 I;  5DRR A;  2CMP A;  2FRH A;  2Y9Z A;  4MU0 A;  4UB6 C;  2DA7 A;  1YS6 A;  2HVR A;  4IZJ D;  1T98 A;  3Q0U A;  1LVK A;  1N0V C;  3CF2 A;  3A4C A;  3IRR A;  1Z7U A;  2A61 A;  1J5E I;  5F1R A;  3KYD B;  2XAU A;  1X19 A;  3HDD A;  4DR3 I;  1RC9 A;  1R5I D;  4LD5 A;  5B1A H;  2F5C A;  1RKT A;  4LF5 I;  1E2X A;  1QHG A;  3V5R A;  1QPM A;  4BA1 A;  2MA3 A;  1N25 A;  3HL2 A;  3H3V K;  3E6D A;  2R5Z B;  4KT6 A;  2IRF G;  5E3M A;  1Z6T A;  2XDV A;  3Q0V A;  3SJM A;  4DUY E;  4MIM A;  1ZM4 A;  2HS5 A;  2V1D A;  1VQP I;  4XKW A;  5D4R A;  3LPS A;  3BTJ A;  3T8R A;  5EEH A;  2C37 A;  4PFO A;  5HNF A;  2YUS A;  1NK3 P;  3CLO A;  1IUF A;  1OCO H;  4HNU A;  4HQM A;  4KIT B;  5FO5 A;  5K7Z A;  2E34 A;  3DLL F;  5AON A;  2V2Q A;  4MQY A;  2M7B A;  5BS6 A;  2HKX A;  2KIQ A;  1OQY A;  4DV2 E;  4DR1 I;  5EZH A;  1IDY A;  2UXB I;  2FNA A;  2EV5 A;  5EEG A;  3TDU C;  4HF2 A;  4E7L A;  3H36 A;  2F4V E;  4LG3 A;  1UJ8 A;  2QQB A;  2Q0O A;  1FLI A;  3RQI A;  5GAD J;  1WWX A;  2MG4 A;  3KEY A;  2K5C A;  3IC7 A;  1EA6 A;  4HNV A;  1MW7 A;  5CJ9 A;  4B3T I;  5D8L B;  1K6Y A;  2F4M B;  4RGU A;  3ZN1 A;  3QRF F;  2I8D A;  5LHI A;  4GQU A;  1RKW A;  1D0Y A;  2HKO A;  4DUZ E;  1X1P A;  5EYR A;  4A3G J;  3FXM A;  1KIJ A;  1KU7 A;  2O3F A;  3H5N A;  4RB3 C;  5HOD A;  4YEL A;  2ZM6 I;  5L3J A;  3JSP A;  1HNZ E;  4D9J A;  2R7T A;  3GO5 A;  2OC6 A;  2R3S A;  3QPT A;  4CCL A;  4CCO A;  3CC2 I;  1SD5 A;  1NG7 A;  1Z5A A;  2C6Y A;  4HXZ A;  2KQR A;  3TBI A;  3PYF A;  5FLX Q;  5DTD A;  3DKX A;  2FUG 2;  3HSR A;  5DUI A;  2VB6 A;  2UUB E;  4BXU A;  1FBS A;  2JVH A;  2M30 A;  4PGG A;  2ZFW A;  4CCN A;  1LPQ A;  1VQL I;  2B0L A;  3CCU I;  4ENN A;  5C4J J;  1FYK A;  5IT3 A;  4AWX B;  3ECO A;  2LRD A;  2XKO A;  5K5O A;  1D3Y A;  5EJC A;  1XXE A;  5FWK A;  4LFC I;  2QSH X;  2HU9 A;  2COB A;  4UB8 C;  1PJR A;  4BE0 A;  1MU5 A;  2PJR B;  2JA2 A;  3L7W A;  4YHH I;  2F1D A;  1UDQ A;  2K3F A;  5DNL A;  2VQG A;  5F27 A;  2JUG A;  3TP0 A;  3GME A;  3HOT A;  2R7O A;  2XAS A;  1GUU A;  3IAM 2;  3QT8 A;  1ZR4 A;  2JRT A;  3OYK A;  1HR0 E;  1SAN A;  1GV2 A;  4KIB A;  3CJN A;  1G4D A;  1BR4 A;  4AIJ A;  1EV7 A;  3BC8 A;  4HYM A;  3P3E A;  2IA2 A;  3TOA A;  4ESJ A;  3BTL A;  2GXA A;  2RDP A;  4DGW B;  2W48 A;  2W00 A;  2DFF A;  4KN7 X;  4E7H A;  1T8I A;  2Y69 H;  2ZBK A;  3BCB A;  2IJL A;  4JI2 I;  4GGG A;  3NZK A;  2G7H A;  3E6C C;  2IGN A;  3OWT A;  2I5U A;  2GO4 A;  2EFG A;  3Q9S A;  1U78 A;  1P2F A;  2VC0 A;  3K4B A;  5D8K B;  1ACI A;  1Z91 A;  4L5J A;  4IRH A;  2WAF A;  4JI5 I;  4MO7 A;  4HX7 A;  5ICE A;  3CDI A;  3F21 A;  1N34 E;  1L3L A;  1K78 A;  2ZME A;  5FJ8 J;  4BA2 B;  1Z9C A;  4QWQ A;  4F91 B;  1Z0V A;  1WJA A;  1B6A A;  1KGS A;  2UXX A;  2V7F A;  1WJD A;  2LD5 A;  3F0N A;  2HQA A;  3OYB A;  4HLY A;  2NXN B;  2W7N A;  1G3W A;  1EF4 A;  1HXD A;  4IZK A;  3IAS 2;  4QNK A;  3GTP J;  2H8R A;  1FJL A;  3Q0W A;  2R5Y B;  1IXC A;  2OBP A;  2OZU A;  2FQ3 A;  4BQA A;  1RR9 A;  1A6I A;  4JK1 X;  1ZG1 A;  3OOU A;  2IGM A;  4DYR A;  2YSR A;  3OTO I;  2A69 F;  4KIG A;  5LLQ A;  1TTY A;  4NC8 A;  2LTP A;  4HF1 A;  2K02 A;  1ZKG A;  2E36 A;  2QSF X;  1HKS A;  3HTU A;  4MU4 A;  2MSY A;  1JKO C;  4XOP A;  3Q6N A;  3GW2 A;  3H9G A;  4QPO A;  4RA2 A;  2LBF B;  4I02 A;  3CCJ I;  4ZYA A;  3RKY A;  3KP6 A;  4LMY A;  4U0V A;  5LGN A;  4YIR X;  4E4H A;  4HW0 A;  3LQQ A;  1KQ9 A;  1MDM B;  5DRO A;  5JEA B;  1Z0E A;  2AHQ A;  2IVM A;  3C2B A;  1NHH A;  3JRC A;  4XM3 A;  1FNM A;  5JEA D;  2KT0 A;  5ICG A;  4NC6 A;  3GF2 A;  4CCK A;  1JKR C;  2GWR A;  2A5Y B;  3K1M A;  3KEO A;  3BDD A;  2UUC I;  4DR6 E;  4M1K A;  2PO0 B;  4FW3 A;  2RQP A;  1Y1V J;  2L9R A;  2WV1 A;  3FBN B;  4E7I A;  2IES A;  2LMD A;  3HRT A;  1K79 A;  3GTK J;  1OCP A;  3SDB A;  2GQQ A;  4FW4 A;  1BL0 A;  1FIP A;  4BL0 B;  2FX0 A;  4B09 A;  1BOA A;  4PJN A;  3LSM A;  2ZME C;  1USS A;  1TL8 A;  1P4W A;  2LR8 A;  1S5L C;  1DPU A;  2V2Z A;  2KKO A;  4IVN A;  1BJA A;  1X4P A;  3F6O A;  4M6X A;  2X36 A;  2XPW A;  4CXF A;  2BW3 A;  2MBF A;  3CUQ A;  4HV5 A;  3JAM K;  1KQ8 A;  3KP4 A;  2LY2 A;  4ZTJ A;  5CVJ A;  3IHU A;  3RJP A;  1CF7 B;  3ZMU A;  2ZSH B;  2LFB A;  4URL A;  4XID A;  3CJR B;  4XRF A;  4BU2 A;  4L9V A;  4RAG A;  2VN2 A;  5M3M J;  1VFC A;  2WB1 N;  2VQE I;  2O0Y A;  4XRS G;  1OCC H;  2Q2E B;  2Z5B B;  2R4G A;  2XHK A;  1TQM A;  1UAA A;  1MGT A;  4GYG A;  4A3I J;  2H09 A;  1HC8 A;  2RGV A;  5HLH A;  3GTO J;  3WU0 A;  3ZZU A;  2QLZ A;  3NAR A;  1YRN B;  5E8I A;  3U2R A;  3V7R A;  4K2E A;  1WI3 A;  4JX6 A;  3FXO A;  3B73 A;  5D5W B;  1IN8 A;  3RYR A;  2DU9 A;  3HRM A;  5JVG F;  2MAB A;  2OA4 A;  2EZH A;  2DI3 A;  2VQC A;  2PFB A;  3E5U A;  3KZI C;  4A3E J;  2K40 A;  3AG3 H;  2K27 A;  4OIO F;  3PO2 J;  3GXO A;  4WK8 F;  4PU9 A;  3VFZ A;  2ICW G;  3P7N A;  1X1C A;  2Z3Y A;  3M1C A;  5IT9 Z;  3T8T A;  3FXL A;  2ZXI A;  1TT5 B;  1X3Z B;  2Z33 A;  1REP C;  1IC8 A;  1OCZ H;  1E0E A;  4PJM A;  5L3F A;  1JTX A;  3MVP A;  4NC7 A;  4DR2 E;  2WB1 A;  1W5T A;  2FU4 A;  2WBM A;  2E2H J;  5C0X A;  2E60 A;  5GAH J;  1A6F A;  4ZYD A;  4DV3 I;  1Z0W A;  5TGT A;  1XB4 A;  2JWT A;  3GFJ A;  3HUG B;  3B82 A;  2DTZ A;  5C0X F;  3AAF A;  2P6T A;  2ZKZ A;  4R1F A;  4G7H F;  4NQW A;  1LJ9 A;  2PO2 A;  1UEL B;  2O6G E;  4XL9 A;  2P8T A;  2CZ9 A;  4ESF A;  2VJ5 A;  1BOB A;  1ZRD A;  3M6A A;  1I3Q J;  4PCQ A;  1MJB A;  3PIP F;  3BTI A;  3DCF A;  3JRI A;  3MKZ A;  3N97 A;  2STT A;  4L0Y B;  2MD5 A;  3SQN A;  4UXN A;  1YE9 A;  4RMN A;  2DA5 A;  2O9L A;  3LSP A;  2CW7 A;  4IFD E;  2BBY A;  2DOD A;  2RNG A;  2KRH A;  4A3B J;  3DKW A;  1K61 A;  2BVM A;  4N4O B;  5TIS C;  2JMW A;  2DN0 A;  2RN7 A;  4LCG A;  4MU1 A;  4IXA A;  5GTI C;  4G9Y A;  4U3B A;  4V2G A;  3SYT A;  1U8B A;  4DV7 E;  2X1C A;  4NXM E;  4RPF A;  2XAH A;  3CTA A;  4JI1 E;  3J7A O;  3GZ5 A;  1S8N A;  3DWL E;  2BEO A;  3F9K A;  2DA4 A;  2WAD A;  5K36 A;  4HX4 A;  2FQ4 A;  2K4J A;  3E0J B;  4AQY E;  3K4L A;  5M3F J;  2C37 B;  4BHP A;  4ISA A;  1X3U A;  3J80 Z;  5TJJ A;  5E3N A;  1SFX A;  2QGU A;  2J5O A;  1KVK A;  2W25 A;  3PJR A;  4FIS A;  3VEP A;  5IP6 A;  5EF6 A;  3COA C;  3JAM C;  2RC4 A;  3VSL A;  4M3E A;  1FMV A;  3VYR B;  2AQF A;  2KP6 A;  5A2Q Q;  3J7Z I;  1IBK E;  5E1Z B;  2DA2 A;  4S05 A;  4BDY A;  1XCV A;  1YJ9 I;  1IN7 A;  1RR8 C;  4L9N A;  1SFO J;  3DTK A;  1Z59 A;  1MMS A;  3DU6 A;  2EH3 A;  1ZRF A;  3CJQ B;  3G2B A;  2P7V B;  3HG9 A;  4BY7 J;  3ZR8 X;  4GO1 A;  4L5I A;  2UZK A;  1XG1 A;  4FWG A;  1FY7 A;  1W36 C;  1T08 B;  4C2U A;  4ZYE A;  3ONQ A;  2UXD I;  1ORK A;  4FW5 A;  4PJL A;  1L0O C;  4LOM A;  1SAU A;  5CLS A;  1LFP A;  1IV6 A;  2W4S A;  1JUP A;  1LQ1 A;  4FE7 A;  1I50 J;  5IYC J;  3IRQ A;  1GDT A;  4UUS B;  4BHB A;  2NRA C;  3H5A A;  1ZAR A;  1MBJ A;  1HNW I;  1RRE A;  3F8B A;  5ERI A;  4PFP A;  2WAQ N;  3W6J B;  1RET A;  3FM3 A;  5D5X B;  2HQN A;  2HPI A;  2QM3 A;  4EEF G;  1TQP A;  3CO6 C;  1X1B A;  1SEU A;  2R7F A;  5EGO A;  3W2V A;  3HZJ A;  5E17 F;  1ETQ A;  2M3A A;  3NRV A;  2IS2 A;  5K36 C;  5LEJ A;  4MQV A;  3HOV J;  4S0H B;  2JN6 A;  1ZG5 A;  1KZH A;  2GXG A;  2P6S A;  1FYM A;  3CUO A;  1AWC A;  1LVA A;  2VKD A;  4N9H A;  4KA4 A;  4G6T B;  4BNC A;  2Y9Y A;  2YX4 A;  3OSF A;  3KLN A;  2DBB A;  3LSJ A;  4CCJ A;  1I27 A;  2JJ7 A;  5LEK A;  1XNR I;  2E1M B;  3BY6 A;  4A0X A;  3QYF A;  4GKK I;  5J47 A;  1Z21 A;  2I10 A;  2XPV A;  1S3J A;  1MNE A;  3SEZ A;  1JHH A;  4FX0 A;  1FTT A;  3MCZ A;  1GLN A;  2LG4 A;  2IXS A;  4XN3 A;  2LLK A;  2HR3 A;  4FT8 A;  4I3H A;  5GAE J;  5HS7 A;  5DDG A;  3CZ6 A;  4MFE A;  2ZBK B;  3I71 A;  3VYU B;  1C0W A;  1Y60 A;  3R0A A;  1DDN A;  2D1V A;  3GUD A;  1APL C;  4UNO A;  4A5M A;  1J75 A;  1UST A;  2IS4 A;  1J5Y A;  3QT7 A;  4XTJ A;  4B3X A;  3QOE A;  1RUO A;  4KYW A;  3S2W A;  4CUG A;  4JG4 A;  1ZQ3 P;  2ZNY A;  3MZH A;  3UKG A;  3HIF A;  3LA7 A;  3I58 A;  4DV0 E;  1E3P A;  1WRJ A;  3CDH A;  3A1Y A;  1YX5 A;  3KEQ A;  1LB2 A;  1ETW A;  2ZME B;  2NVY J;  1HK7 A;  4FW9 A;  5FGM A;  5EDN A;  1MKM A;  4XRM A;  2CWE A;  4EJU A;  4WUB A;  4N3O A;  4B48 A;  1K47 A;  4E7J A;  1OYY A;  5KHD A;  3L9F A;  2HOE A;  2B7E A;  2IPQ X;  2O1U A;  3FXQ A;  2BR2 A;  2NPF A;  2P5V A;  3OR1 C;  2A68 F;  1R1U A;  1UHS A;  3I0T A;  4IZK B;  4MYT A;  5E3O A;  3ESW B;  1XHK A;  2G7U A;  2XGC A;  3P5J A;  2LH9 A;  4IZZ A;  3DPT A;  1V5F A;  4E7S A;  2IA0 A;  4CYC A;  4LF8 I;  3D1N I;  2EA2 A;  2ZJR F;  1DPR A;  1FWL A;  4H4K C;  4DV5 I;  1PUF A;  1WI9 A;  2HZD A;  3DEE A;  1CQT A;  2O61 A;  3DLA A;  5E3L A;  4X6A J;  2JT1 A;  3O8H A;  1G3T A;  3OL4 A;  3F8M A;  4I2O A;  4JI3 I;  3EUK L;  4A2U A;  3GWZ A;  3OOP A;  3OY9 A;  2HKJ A;  2HOA A;  1B59 A;  5D6F A;  5M5W J;  2CSO A;  3VYS B;  2IGK A;  4D7M A;  3W2W A;  1MJ9 A;  3ZRG A;  2VPL A;  2CH0 A;  2QUF A;  4XKC A;  3FIS A;  1FBU A;  2KZV A;  4BKX A;  4ZYG A;  4QIW N;  1ZM2 A;  4LOC A;  3S3O A;  2GA1 A;  4R1H A;  2E19 A;  1I1G A;  5LGT A;  1FNN A;  3KIO A;  2KRC A;  2OQR A;  4B43 A;  4XR6 A;  3OYI A;  3BJ6 A;  2XGD A;  4CGZ A;  3MEX A;  3H3Z A;  4OU0 A;  4B3S I;  1OCR H;  3PUB A;  3CME I;  1P9Q C;  1IRX A;  3HRU A;  1SC7 A;  4XLA A;  1OYI A;  1SVL A;  4LFB I;  2ELH A;  2HXI A;  3P3C A;  2HDD A;  2WV0 A;  2DPD A;  1HNX I;  1R1V A;  2BW3 B;  2HTJ A;  3CUQ B;  5E8G A;  1K4S A;  1HDD C;  4QNJ A;  2NVT J;  5DUK A;  3PYD A;  3AG1 H;  2GQ0 A;  3BT9 A;  1IF1 A;  3GFM A;  3EQL F;  1IBL I;  3MZ8 A;  4HQE A;  3QT6 A;  3V2U C;  1MMN A;  3MMY B;  1K4T A;  1IG7 A;  1R23 A;  4ITV A;  4DXL A;  2KZG A;  4BQO A;  3FKJ A;  3FF5 A;  5BPI A;  4LF9 I;  4LIU A;  1OCT C;  2HOS A;  1JHF A;  2CQX A;  2EIJ H;  4HAC A;  3PL8 A;  1SVM A;  4DBR A;  2PJP A;  3CF5 F;  2VE9 A;  3WTX C;  5FD6 A;  3P9C A;  2TCT A;  4M73 A;  5B66 C;  2OAZ A;  2F5E A;  1JUS A;  2BE5 F;  2EIK H;  3HJE A;  4EJT A;  3B78 A;  3V8L A;  4JX5 A;  3T1Y I;  5CQE A;  3V8K A;  2E1C A;  1FZP B;  3O3K A;  2L4M A;  4MHG A;  5FLV A;  5CVI A;  3C18 A;  1I94 I;  2DAO A;  2K9S A;  2KJB A;  4RGX A;  4DIQ A;  5ICC A;  2VLA A;  3MKY B;  2JE6 A;  2E5Z A;  4HZF A;  3LFK A;  2X4H A;  1IXS B;  1YYV A;  1G6N A;  2V4J C;  1N36 I;  4I6Z A;  5C0X B;  1XGM A;  2WTE A;  3TW6 A;  4OAY A;  3U9G A;  2M8E A;  1OYS A;  3DFG A;  2O3Z A;  3L7Z B;  1T0F A;  5C0X D;  2EQR A;  2R7X A;  2M7A A;  3ISP A;  2LRE A;  3GTQ J;  3Q9V A;  3BQZ A;  1IRZ A;  1Z1D A;  2PO2 B;  1R7J A;  3M07 A;  2YU9 J;  3DBH B;  1HST A;  2EZK A;  5HDN A;  4PSW A;  4C30 A;  3ZOB A;  2OD5 A;  4NUB A;  2XSD C;  2ZXH A;  4C3J J;  4IOC F;  1SD7 A;  3PQJ A;  2DYS H;  3CCR I;  1R1T A;  2L02 A;  4CZC A;  2QKL B;  5FLM J;  2EZL A;  3BPV A;  1PUE E;  2H27 A;  2NN6 A;  4LB6 B;  3BLY A;  3OYC A;  4HY1 A;  4LPF A;  3FXK A;  4JI8 I;  1UB9 A;  1E3H A;  1JKP C;  1A31 A;  2HOT A;  2E7X A;  4EM2 A;  1ZH5 A;  2XF7 A;  4DV1 E;  4A12 A;  1VI0 A;  4LFA E;  1XC5 A;  5J1U A;  4USK A;  4Y4R A;  3GVA A;  3FXR A;  5FLX Z;  3R61 A;  2O1V A;  2R3V A;  2E35 A;  4OX9 E;  3S1Q J;  4A3K J;  1TP4 A;  5E18 F;  2ZCW A;  1HKQ A;  5D4S A;  1ERD A;  4IZJ B;  5C0X E;  3HPH A;  1HNZ I;  4UUV A;  2R7U A;  1RNL A;  1XPX A;  4JX4 A;  1IW7 F;  5B1B H;  1QZZ A;  4XOT A;  2CW0 F;  2DK5 A;  5DNX A;  1U2W A;  5LHG A;  5HVQ C;  2K85 A;  3DBL B;  4I01 A;  5E1W A;  2LNB A;  4JYA E;  3KP7 A;  1HA8 A;  3P06 A;  2K9Q A;  3K2Z A;  2ZJQ F;  4BE2 A;  1G2H A;  4NB5 A;  4Y17 A;  2E2I J;  3PO3 J;  5K36 D;  2HYF A;  2HHH I;  4MTD A;  1Z6R A;  3MN2 A;  1FEX A;  3T1H E;  4FTH A;  3WE2 A;  4X64 E;  2DXI A;  1HCR A;  1AU7 A;  2UU9 E;  3JR9 A;  2EPF A;  4J3D A;  1Z3X A;  2JTV A;  2J5P A;  1B8I A;  2CQK A;  1T0F C;  5FB2 A;  2EK5 A;  4BJT A;  3ZQC A;  2DJI A;  2FOK A;  2F4I A;  2VOD A;  2UUA I;  4A6E A;  2VJI A;  5CPR B;  3NWT A;  4II3 A;  3M7N D;  3IKT A;  3JRB A;  3AFH A;  4EM0 B;  2VQF I;  5ED4 A;  2LJP A;  1QO0 D;  2LKX A;  3ZM7 A;  2Z9O A;  1HKT A;  3ZMV A;  4XLH A;  3H92 A;  2WC2 A;  1ENH A;  1I5Z A;  3C2G A;  3M1E A;  1T39 A;  4LG0 B;  3ZCO A;  2NN6 C;  2ADU A;  2PMU A;  2X0L A;  3W6V A;  2J7K A;  2FE3 A;  4G7O F;  3K1P A;  1EA3 A;  2E2J J;  4EVI A;  1W0U A;  3V4G A;  3FK7 A;  2VT2 A;  3MKL A;  1ETX A;  4B3M I;  4IFD C;  2L7K A;  2CVE A;  1HQC A;  3LSG A;  3VWB A;  1WFX A;  2YU3 A;  3R60 A;  2R42 A;  2M4G A;  1BW5 A;  3CQZ J;  4WF2 A;  4CH7 A;  1IN6 A;  3I59 A;  3S3N A;  1QQI A;  3RPU A;  2FMY A;  3BG7 A;  4BBR J;  2B63 J;  2HK2 A;  1QVU A;  1ZHF A;  5LFA A;  2XB5 A;  3OL3 A;  3PYG A;  1XMX A;  1O57 A;  3HM5 A;  3I5U A;  2EFP A;  5EGO B;  4GYI A;  3FMS A;  2VQH A;  1STZ A;  1BC7 C;  4MEY F;  5J3L A;  2L54 A;  2DO7 A;  3D5S C;  6PAX A;  5J1Y A;  3BR1 A;  1J2X A;  4BS9 A;  5LMN E;  2DEI A;  1ON2 A;  5HDG A;  1JE8 A;  3V7S A;  4C2M J;  3OYH A;  1H7S A;  1MMA A;  3BG3 A;  2P7C B;  4XLF A;  3K9T A;  3TMO A;  2LSO A;  3J81 Q;  2E5L E;  4D5C A;  1ZXM A;  4F93 B;  4X0G A;  3LQR A;  4X65 E;  3OYL A;  3WGH A;  1V5E A;  4LK1 F;  5L3E A;  4N9I A;  3B8H A;  3OIP A;  5CVR A;  1MJA A;  3S17 J;  4JI7 E;  2GOM A;  2Z5E A;  3JRH A;  2ZNZ A;  5K7F A;  4A3C J;  4YRV A;  5KK1 A;  3CCQ I;  3H9J A;  3QOD A;  1YW8 A;  3H4L A;  1QHH D;  1XCB A;  2O8X A;  2W24 A;  1BI3 A;  4MLO A;  1J5E E;  4DPW A;  4A6D A;  3R4K A;  1B4A A;  4P9U A;  2R7V A;  5M5X J;  1B1B A;  1UHW A;  3DBR B;  3HSF A;  4KDP A;  1Y5Y A;  1FJG I;  3HOY J;  2WNR A;  1JUM A;  3UHM A;  1QZE A;  2LF8 A;  4ZYH A;  4OMY A;  4ENK A;  4LF5 E;  1HF0 A;  4AM3 A;  5DM7 F;  4PJJ A;  2ID6 A;  2V6C A;  1SAX A;  5IP7 J;  4X66 E;  1LEA A;  1VIS A;  5KVR A;  4YIF A;  4O3M A;  3CCV I;  4B47 A;  5IT9 K;  4FX4 A;  4DR5 I;  1ETO A;  1D0X A;  2H94 A;  2Y0M A;  3ASN H;  3G1L A;  4NHJ A;  3BR6 A;  4OIR F;  1UFM A;  2R5Z A;  1U6G A;  1MSE C;  3RKW A;  1VQN I;  3PS2 A;  1WHU A;  4BE1 A;  1KYW A;  2K4B A;  2HQR A;  4IL6 C;  3KFW X;  3UR3 C;  1UDN A;  1MBK A;  1XSX A;  2IOQ A;  1FMW A;  2R7W A;  5BQT A;  4E6K G;  1R5H A;  4C3I J;  3A0H C;  1FI4 A;  3CD6 I;  4HYE A;  2UWM A;  1WJE A;  1RIO H;  4A3F J;  2C39 A;  5H6Q A;  1TWA J;  2R93 J;  4QPQ A;  3S2H J;  3WTW C;  5FRM A;  2FBI A;  4M6V A;  4LLN A;  2PI0 A;  4DR1 E;  4LF7 E;  4CYC B;  1N33 I;  2MLK A;  3KX2 A;  1R36 A;  5H20 A;  5HLI A;  3WHC A;  3NQO A;  4Q47 A;  4J01 A;  3ZP5 A;  1PUF B;  1FX7 A;  3I4N J;  1R6L A;  4PRV A;  4GRI A;  1I6X A;  2DT6 A;  3PS1 A;  1Z0G A;  5DRP A;  3PM1 A;  2XEX A;  1JGS A;  2Y30 A;  3CMA I;  4B3T E;  4ZDO A;  3WU3 A;  2IBD A;  1ELO A;  1D8J A;  4DZP A;  1DU6 A;  4BXX J;  1Y56 A;  3QAH A;  1KQ0 A;  3IH4 A;  4KMU X;  4R79 A;  2C38 A;  2CGP A;  2F4O B;  2VPR A;  1YOV B;  2ZM6 E;  1B9N A;  2VKH A;  4BAY A;  4GXO A;  5D6E A;  2CQ7 A;  2M9H A;  1DP3 A;  3EYY A;  4DV6 I;  5GPA A;  4KIF A;  1FP1 D;  4KT5 C;  1SFK A;  1OR7 C;  4OO1 C;  2A6E F;  2IS1 A;  3ABL H;  3ZKD A;  1AHD P;  1MBF A;  1Q1H A;  2HTS A;  2FNP A;  2PMZ N;  3FHN A;  2W1O A;  5C3E J;  3J80 K;  3ECH A;  3JCU C;  4DR2 I;  1OKR A;  1LFB A;  2QEN A;  3KP3 A;  4K0K I;  1Z67 A;  4D0P A;  4LFC E;  2D2W A;  3K7A J;  3OV8 A;  5JFR A;  1NK2 P;  2A2C A;  3FMR A;  3FDY A;  2HYG D;  1YW9 A;  4P52 A;  2VJJ A;  4KHP E;  2VJ4 A;  1Y8R B;  2R0Q C;  1KKH A;  4G94 A;  2EBI A;  2JA7 J;  3CCE I;  4ED4 A;  2KIS A;  4IJA A;  3WE3 A;  2CGE A;  2JVG A;  4M3D A;  2LYC A;  2PNZ B;  2CO5 A;  3IWZ A;  3AG2 H;  4HAC B;  4Y52 J;  3QP6 A;  2E5N A;  5JEA E;  5KAF C;  4HOB A;  5M5Y J;  1J9I A;  3BR5 A;  4JI2 E;  1YIO A;  1ZN2 A;  3KRN A;  4RM3 A;  2HI3 A;  4DJA A;  4FN5 A;  2PMZ A;  2BV6 A;  2TRT A;  2V79 A;  4DZJ A;  4DR7 I;  3K4K A;  3H1C A;  1R58 A;  3BG6 A;  2CJJ A;  2XUB A;  4NXM I;  4JI5 E;  1FOX A;  3IL2 A;  2CU7 A;  4M3B A;  1F4K A;  1BA5 A;  5IT9 C;  3WTV C;  3WG7 H;  2R7R A;  3EDP A;  2XGX A;  5HDK A;  2PO1 A;  3F0C A;  1VI7 A;  2JE6 B;  1V55 H;  3JSO A;  4I09 A;  5FD5 A;  4MU3 A;  4RS8 A;  2VL8 A;  4DR4 I;  3BJA A;  5FKL A;  4ON0 A;  5A2Q Z;  4FW7 A;  3S8P A;  1YLF A;  2DT5 A;  3G1M A;  1ETK A;  4CSW A;  3WTU C;  3AKZ A;  2BA0 D;  1DGR M;  4HLX A;  1ZGA A;  2FD5 A;  2V9K A;  4DPT A;  4JI6 I;  2X6Y A;  3ZMS A;  2VBZ A;  4A0Y A;  2BXZ A;  2E71 A;  1UHM A;  4UTG A;  2DCE A;  2LY1 A;  5L3D A;  1BM9 A;  3OTO E;  1B63 A;  2V26 A;  5CVU A;  1ZYR F;  1R6M A;  1XSD A;  3HXL A;  1F36 A;  3BPX A;  1OIS A;  4IX7 A;  1D5V A;  2QBY A;  3H3U A;  2CS3 A;  2D45 A;  2JA5 J;  2OTJ I;  1USU A;  2NN6 B;  1XMQ I;  4IHT A;  4HEA 2;  1Z0X A;  2NN6 D;  3WTZ A;  1AOY A;  4WXD A;  1H89 C;  1YH8 A;  1XGO A;  4L0Z B;  5DEQ A;  3W3C A;  1O3T A;  2AE8 A;  4HA8 A;  1LDJ A;  3GLL A;  4OWR B;  3ZN0 A;  1S7O A;  1ODD A;  2A5W A;  5HNH A;  1EH7 A;  2ELK A;  3HB9 A;  3PNY A;  3JRG A;  4LK0 F;  3HJC A;  1MSF C;  5IWA E;  1TZL A;  1NH3 A;  3AL0 C;  1WKM A;  3DU5 A;  1FOW A;  3NAU A;  5FKM A;  2RVC A;  5HS9 A;  1TC3 C;  1EI1 A;  2NS7 A;  5LL6 R;  4M9Z A;  2J65 A;  3GTJ J;  2HFU A;  3H0G J;  2Z5U A;  4XOR A;  4LF4 I;  1W5C C;  3IUO A;  1X2N A;  5JVT A;  1MBH A;  4B3A A;  2Y2Z A;  4LLL A;  4BAC A;  2L7F P;  1QU3 A;  3PFY A;  3J80 C;  1WVR A;  1ZEL A;  3LL7 A;  2YS9 A;  3MQ0 A;  1W4M A;  3SZT A;  1UMQ A;  5HLG A;  3CES A;  2MFZ A;  1R9T J;  4BA1 B;  2L2O A;  2HFH A;  3GCM A;  4XON A;  2UXN A;  3S16 J;  1B8I B;  3HOU J;  3S1M J;  3ZQH A;  4DV4 E;  3M85 D;  2VUM J;  4I76 A;  4JI4 I;  4YFK F;  2GLO A;  3ML6 A;  5BR8 I;  2K9M A;  4RDU A;  1ZLK A;  2NS8 A;  2WP8 A;  5K36 F;  1FBQ A;  4II2 A;  1GHC A;  2ZIT A;  3M7N G;  2HVQ A;  4UV8 A;  3L2R A;  5LMU I;  4B1R A;  1H72 C;  2KRF A;  1BIA A;  3PNT A;  3WGI A;  4IO9 F;  1WH7 A;  2EIM H;  3DTI A;  1N0U A;  2JA8 J;  3ASO H;  3C7J A;  1Y39 A;  4IRI A;  4A3D J;  3PQK A;  4OOI A;  3U21 A;  1Y6Z A;  2W84 A;  2CUE A;  2K9L A;  4AVZ A;  3OYA A;  2ZXW H;  4UVC A;  4ZC3 A;  5KNL A;  3LSK A;  1U8R A;  1P7I A;  2ETH A;  2EB7 A;  3LNQ A;  3L2W A;  2LKS A;  1H7U A;  2L7Z A;  5E79 C;  3Q3S A;  2JPB A;  5J8F A;  2IGO A;  5EG0 A;  4Y15 A;  3HPG A;  4ZZL A;  2HPM A;  3GTM J;  4KUM A;  3RPU D;  4EM1 A;  1SD6 A;  1UDS A;  2JA6 J;  2LKP A;  3WU2 C;  5JI6 A;  5H6R A;  2DOF A;  2FBH A;  3DP7 A;  1ZXN A;  2GO3 A;  1WGX A;  3BR0 A;  2EWN A;  1VQ5 I;  2UXC I;  4J19 A;  2XV4 S;  4DV3 E;  2VOO A;  3TP3 A;  1IO2 A;  4JI0 E;  2IT0 A;  1PVE A;  2OZ6 A;  2MC3 A;  4D1Q A;  5F6F A;  1D1A A;  5BNG A;  2DLL A;  1QGP A;  4M9X A;  4NXN I;  1IAW A;  5BOX A;  1S29 A;  3DD6 A;  3TO6 A;  3JAM Z;  2Z99 A;  4I7H A;  3ABK H;  3SFI A;  1MZB A;  1DU0 A;  3VB2 A;  2DMT A;  3F8C A;  3OS1 A;  1YG2 A;  1ZM9 A;  1G8X A;  4BH9 A;  2V9V A;  1NHI A;  2F5D A;  3TO9 A;  2HK3 A;  3GX4 X;  4IQ4 A;  2E1N A;  1JJ8 C;  2R7Q A;  4F92 B;  2DK8 A;  3BTC A;  1A04 A;  3OYN A;  3CO7 C;  1TNT A;  3DPL C;  4CHU A;  4MFD A;  2ID3 A;  3RI4 A;  4GKJ I;  1UG0 A;  3RSN A;  3SZP A;  3QQA A;  1ETY A;  2EV0 A;  2WNR B;  4X62 I;  4OIQ F;  4DU7 A;  4WX9 A;  3BG9 A;  4PK4 A;  3GFL A;  3FIW A;  1GXQ A;  4N4N B;  3V42 A;  2IOP A;  1FOY A;  1A5J A;  2E1R A;  3LTO A;  1O4X A;  3F22 A;  1WUU A;  5JHU A;  1W5S A;  1XN7 A;  3PS3 A;  4W1U A;  2DA1 A;  1MH3 A;  2G0E A;  3EUA A;  3KZZ A;  3M8F A;  4HV6 A;  2K3P A;  1TWC J;  3Q1Q A;  4HNT A;  4AUX A;  4EQQ A;  1ZAO A;  3WU1 B;  3CC7 I;  3H0D A;  1O3R A;  2KHM A;  1P4X A;  2KIF A;  4XSX F;  3PIO F;  3ZZT A;  4JYK A;  1D1C A;  5LD2 C;  1K78 B;  1HBX G;  3M7G A;  2C39 B;  4U88 A;  1YO5 C;  1Z0B A;  1PKP A;  2VIX A;  1S7A A;  3OYE A;  1D1B A;  1XTA A;  1X2M A;  2ZJP F;  4DU8 A;  3GYH X;  5BPD A;  2CFX A;  1O3Q A;  1D0Z A;  4XLP F;  1QBJ A;  3HOS A;  3GTL J;  3CDJ A;  2QZ8 A;  2BA1 D;  3LSR A;  4D5F A;  4G12 A;  3DV8 A;  4ASN A;  1Z3Y A;  3FM5 A;  1RUN A;  1X1A A;  4KJZ A;  2UXD E;  1HW5 A;  4L9J A;  3JTH A;  1QA6 A;  3WOD F;  2C38 B;  4Z6Y A;  5FLX K;  4P5O A;  2ME6 A;  3OYM A;  4V19 K;  1I3A A;  4L5E A;  4DPX A;  2N8G A;  4G8X A;  4YY3 I;  5IYD J;  4WUC A;  2WAE A;  3HOX J;  3JAM Q;  2XVC A;  1M1E B;  5JLX A;  3TW7 A;  3D4J A;  2LDU A;  2JZY A;  1HNW E;  4Z7C A;  2FEZ A;  2P4W A;  3A01 A;  1ON1 A;  2IEK A;  5J6X A;  4DYQ A;  1BR1 A;  3I55 I;  4LIV A;  4A0Z A;  3F8F A;  1XMO E;  3IP4 B;  1Q1V A;  2DFH A;  2JPC A;  5CKT A;  4BA2 A;  2EA4 A;  2ZC2 A;  3ZMZ A;  1XS9 A;  1YIJ I;  2WW4 A;  2GXB A;  1GV5 A;  4DNC A;  1X58 A;  2VAS A;  2JQ7 A;  4RLF A;  3M4O J;  4JV5 I;  4BHC A;  5EEA A;  4MYU A;  3ROU A;  5GTH C;  3G3Z A;  5LRS A;  4LF6 E;  3K4J A;  3HHH A;  1XGN A;  4PUS A;  1XNR E;  2VT3 A;  4A5N A;  1JT0 A;  2MYS A;  2EFN A;  3CCY A;  3M3Y J;  3QPS A;  2OQG A;  4GKK E;  4LLG F;  3OYD A;  1NZ0 A;  1JT6 A;  1R5G A;  1Y0N A;  3MD2 A;  2XRL A;  4HBL A;  1B72 A;  2IS6 A;  3L2Q A;  1N32 E;  2LBF A;  2KIM A;  4A69 C;  4FE4 A;  1H88 C;  2AJ4 A;  4IQJ A;  3QYE A;  3GEZ A;  3QPL A;  2VBX A;  3PUF A;  2DMP A;  2DQL A;  3WHB A;  3I53 A;  4DV1 I;  2H6C A;  3GBG A;  4LCF A;  2OPT A;  1IDZ A;  2VKV A;  4LFA I;  1MH4 A;  5DV5 A;  2ZO4 A;  3E5Q A;  3CMY A;  4L18 B;  3GZN B;  4ESB A;  2R7D A;  4OX9 I;  1TWG J;  1V4R A;  1I1S A;  1PIE A;  1IN4 A;  5EKW A;  1K6O A;  1Y8Q B;  1HW2 A;  2PO1 B;  1JTY A;  1PDN C;  2CQN A;  2QQ9 A;  4IPA A;  3FWE A;  1YS7 A;  2H6B A;  4JYA I;  2FA5 A;  4ZDL A;  4B3R E;  5L3C A;  3F3X A;  1NG6 A;  4A93 J;  2PN6 A;  4QLC U;  2BA0 G;  3G73 A;  2AXT C;  4HDU A;  1FTZ A;  4B8X A;  1YFH A;  1KA8 A;  1XNQ E;  2BHY A;  4P1W A;  3H5R A;  1UZC A;  1V3F A;  2WY7 Q;  3CP2 A;  3OSG A;  1QZY A;  2VES A;  4X64 I;  2FSW A;  3T1H I;  2BY3 A;  4RM2 A;  3K6G A;  2A6H F;  3K2A A;  2RAE A;  2V1N A;  3MAJ A;  3S93 A;  3TQN A;  4CIC A;  1CF7 A;  1BI0 A;  4IHV A;  2X7I A;  5CVV A;  2P0W A;  4DUY I;  4LF8 E;  2VF3 A;  1OYW A;  2GA2 A;  4UVA A;  5KCM A;  2BM1 A;  1Z0T A;  3IWF A;  3L09 A;  2L3D A;  5J4V A;  1FWK A;  5IOZ A;  2Z5B A;  3MWM A;  3I4M J;  2HVS A;  4JI3 E;  2P5K A;  2XF5 A;  4NQW B;  3OR2 C;  3EYI A;  3GLX A;  1H73 A;  1YJW I;  4IHX A;  3BG5 A;  1RPW A;  5GAG J;  1GVJ A;  5FLX C;  1TW3 A;  5FKK A;  4DV2 I;  3WU6 A;  3VSK A;  5JEA C;  2BZT A;  2BY0 A;  3LSH A;  1P92 A;  2QCO A;  4B44 A;  5L3B A;  2VBW A;  3WTT C;  1WPK A;  3OYF A;  2QVO A;  3GON A;  3E3V A;  3JRA A;  3L2V A;  2O03 A;  2VXZ A;  4HG2 A;  4QSH A;  2F4V I;  3G4S I;  2BY2 A;  1RES A;  2EIN H;  2NN6 F;  1W36 D;  1B62 A;  1U9O A;  5FKO A;  4IFD A;  2KDZ A;  3CC4 I;  4PJ0 C;  2ISZ A;  1FP2 A;  2KFD A;  1OFC X;  2DA3 A;  2FML A;  4JP0 A;  4DUZ I;  4B3S E;  4IFD F;  1FSH A;  4I99 C;  3J81 Z;  2Y0S N;  4M9S A;  1D5Y A;  1WH5 A;  2ECC A;  3K10 A;  4UT4 A;  4IF4 A;  2L0K A;  2NNY A;  1HNX E;  2OI2 A;  3L1P A;  4LJZ F;  4MTE A;  2HYJ A;  2KIU A;  5LMN I;  3JRE A;  4PRX A;  4M3F A;  4U0W A;  2V2V A;  2GOX B;  4WXC A;  3H35 A;  1JKQ C;  3M85 G;  1YW7 A;  1IBL E;  1VF9 A;  4OAZ A;  1R71 A;  2M2E A;  3I56 I;  5K36 B;  1XDS A;  2BV3 A;  4XIC A;  3CLQ A;  4DBQ A;  3D0S A;  2WP8 B;  4M72 A;  5ILS A;  4OIN F;  4BJ5 C;  4CDG A;  2OCE A;  4ZTF A;  3K4M A;  4LCH A;  1ZR2 A;  2CG4 A;  4A3J J;  4EGY A;  5CQG A;  4OMZ A;  1BJZ A;  1OJ4 A;  3S1R J;  2DT7 B;  1QPI A;  2DA6 A;  4ENM A;  2DOE A;  4UUT A;  1QNT A;  1Z7L A;  3IKV A;  5JHF A;  2A05 A;  4YEJ A;  3VYT B;  2V6E A;  3J7A M;  2VBY A;  5FFX A;  1YJN I;  1R6R A;  4LFU A;  5F0C A;  2HGC A;  2W57 A;  1IZ1 A;  4XKB A;  3DKY A;  4CYD A;  2OUM A;  1LE8 A;  1DAR A;  2MGQ A;  3T1Y E;  5BMZ A;  1KON A;  2Y0S A;  3ELK A;  4FAS D;  1BI2 A;  2MH9 A;  2QSG X;  1A6Q A;  3HSE A;  1VTN C;  1I94 E;  2Z1D A;  1ETV A;  5EG0 B;  4AVP A;  5AIQ A;  3V7C A;  4RB0 A;  1FC3 A;  1BN5 A;  3ZQL A;  2DW4 A;  3FMQ A;  3J7A Y;  2BOL A;  2XRN A;  4R8H A;  2QA4 I;  5J1R A;  4FCY A;  4X66 I;  2JSC A;  4PDK A;  3KLO A;  5K36 E;  2VON A;  1BW6 A;  3FX3 A;  4A3L J;  1N36 E;  2YX7 A;  3M9A A;  2V9P A;  4HX8 A;  1ZGJ A;  5DRQ A;  4IS9 A;  2LP0 A;  1BC8 C;  4IEJ A;  3WTY C;  1IBM E;  3OIO A;  3Q5F A;  2M8G X;  2V34 A;  5F08 A;  1N34 I;  1W1W E;  2DPU A;  1VQO I;  3G71 I;  2DMN A;  3LA3 A;  4LGW A;  2FF4 A;  2M4K A;  1KU2 A;  1MND A;  2F5V A;  1NHA A;  4NBQ A;  4KN4 X;  2HWV A;  4LF7 I;  2JK3 A;  2L9S A;  3JTG A;  5DCM A;  2UV1 A;  5JLW A;  3BZK A;  1D6T A;  3DXJ F;  2UUB I;  5ICF A;  4JI8 E;  4JBA A;  4ENJ A;  1I39 A;  4ANJ A;  3CCS I;  2O1W A;  4RAF A;  4DPY A;  1WZ2 A;  3PYE A;  4ZDP A;  4G6D A;  4FET A;  1XX5 A;  1WJF A;  1HOM A;  3CWV A;  3M8E A;  2Z5C A;  2QWW A;  2X1D A;  2VI6 A;  4ABZ A;  3ZQI A;  4F55 A;  1USV A;  4E70 A;  4ETS A;  2XB0 X;  1Y6I A;  1VQ7 I;  4FW6 A;  3K0L A;  3ZZ0 A;  4UUS A;  2H1K A;  4ZZD A;  3L00 A;  4G6Q A;  4UHT A;  5DD8 A;  2CV0 A;  1H0M A;  2XGE A;  3F23 A;  2CYY A;  1YHC A;  2AQE A;  3K1J A;  2E7W A;  3FXJ A;  3WG9 A;  2VC1 A;  2DQR A;  3M8J A;  4WWC A;  1IV8 A;  4DR3 E;  1TWH J;  2BGC A;  2EIL H;  2DMU A;  5A2Q K;  5CYV A;  4NNJ A;  2R92 J;  5GMD A;  2HHH E;  4DR6 I;  4AU7 A;  3Q6M A;  1OR7 A;  2GS8 A;  2QYO A;  1ULY A;  3FZV A;  4OO1 A;  3BQY A;  3IH3 A;  1W0T A;  3H9Q A;  4OO1 F;  1B9M A;  4Z7Y A;  2CG9 A;  4KFC A;  3O6B B;  1U2R A;  2ECB A;  4M71 A;  1R4N B;  4DYC A;  3HOW J;  2PX9 A;  2EFO A;  1J0R A;  1LEB A;  1YX3 A;  4RB1 A;  2PNM A;  2UUA E;  3G6E I;  4KHP I;  1W7P A;  2HDW A;  2BA1 G;  3VOD A;  5FKN A;  1MMD A;  1PP8 F;  2VQF E;  1MBG A;  2BR2 B;  5HOO A;  4XNF A;  4AD9 A;  3ERM A;  3I3L A;  1DUX C;  3BJO A;  4CO8 A;  2MH2 A;  2CUF A;  3ABM H;  3SDG A;  1FWZ A;  2YPR A;  4RBO A;  3ERE D;  2DMQ A;  2UXB E;  3ABU A;  4Y7N J;  1KTV A;  4B3M E;  1QRY A;  4BEH A;  2EFW A;  2F5F A;  2RRE A;  3JW4 A;  3LST A;  4BUP A;  5J4Y A;  2LY9 A;  4XBF A;  3A01 B;  4WUD A;  2CUJ A;  1LFU P;  2KL4 A;  2NS0 A;  1AKH A;  3U1D A;  1ZTR A;  4BGD A;  3ZXS A;  2QQA A;  1H9T A;  4E7Z A;  3SZG A;  2PEX A;  3HHG A;  3N05 A;  2JEA A;  1FIA A;  2P81 A;  5K7H A;  2HXO A;  3K85 A;  3WTS C;  2Z16 A;  3HEF A;  1U5T A;  2K86 A;  4X1E A;  3K70 C;  1OJL A;  3TGN A;  1V54 H;  1OYR A;  4P96 A;  3CDL A;  1SFU A;  3L2U A;  2NVU B;  4OIP F;  4FWH A;  1DP7 P;  1DGW Y;  1SFE A;  2EZI A;  2PG4 A;  3K69 A;  4U0Y A;  2DJN A;  2GAU A;  1QZR A;  2BHZ A;  2M87 A;  4IRG A;  2ZB9 A;  3B02 A;  2Y31 A;  2JRM A;  1LDD A;  2HEO A;  2E1M C;  4GCV A;  4EGZ A;  3RQ4 A;  2E1O A;  1B72 B;  3AG4 H;  3X2Q H;  2BM0 A;  1V5G A;  5DS9 A;  1IUY A;  4EJW A;  2CV2 A;  4YHH E;  2PLY A;  3VPR A;  2LK2 A;  1MX0 A;  4BYY A;  1FJG E;  5ILV A;  1TT0 A;  2ESH A;  4UVB A;  1WCM J;  1EH6 A;  3D5L A;  2FXA A;  4DOZ A;  1OYP A;  2JEB A;  2V8P A;  1NHJ A;  1F5T A;  1HLV A;  5TRD A;  1MIJ A;  1WSU A;  4XKV A;  2RQQ A;  4BDZ A;  1G59 A;  4ZVI A;  2COM A;  5IWA I;  1YQA A;  4Y13 A;  3HRS A;  3BP8 A;  5D5V B;  3RZO J;  2ZXJ A;  2MLG A;  5DM6 F;  2PBI A;  4AID A;  3KYL A;  4DR5 E;  1MBE A;  1VQ6 I;  3DEW A;  4HST A;  1FKA E;  2M0M A;  1I6H J;  1PVG A;  1G3S A;  1POG A;  5A2Q C;  1J7K A;  3T1B A;  4YII A;  1HDP A;  2CFO A;  5FRN A;  3QOP A;  1OLT A;  2YR2 A;  4DV7 I;  5EL9 A; 
#chains in the Genus database with same CATH homology
 3U1K A;  1R6M A;  3M85 G;  4AIM A;  5JEA D;  5K36 B;  1R6L A;  5C0X C;  2WP8 B;  2NN6 C;  2NN6 B;  2PO0 B;  2NN6 D;  2BA1 G;  2C38 A;  2BR2 B;  4IFD C;  3GLL A;  1E3P A;  2WNR B;  5K36 A;  2JE6 A;  2C37 B;  4OO1 C;  1UDO A;  2BR2 A;  5C0X B;  1UDQ A;  3L7Z B;  2JEB B;  1OYS A;  2PO1 B;  5C0X D;  3GME A;  5K36 E;  2PO2 B;  4IFD B;  4BA1 B;  2JEA A;  3GCM A;  5JEA A;  4IFD D;  2BA0 G;  3HKM A;  5JEA F;  3M85 D;  2C39 B;  2WP8 A;  5K36 F;  2NN6 A;  1OYR A;  3L7Z A;  3M7N G;  2PO0 A;  3CDJ A;  4OO1 B;  2PNZ B;  1E3H A;  2BA1 D;  4OO1 D;  4NBQ A;  4BA1 A;  5JEA E;  3CDI A;  2WNR A;  3KRN A;  5C0X E;  2NN6 E;  2C38 B;  4BA2 B;  3H1C A;  4AM3 A;  2C37 A;  5JEA C;  2PNZ A;  5K36 C;  5C0X A;  1OYP A;  2PO1 A;  2JEB A;  2JE6 B;  5C0X F;  2NN6 F;  5K36 D;  1UDS A;  1WHU A;  1UDN A;  2PO2 A;  4IFD A;  4BA2 A;  4IFD F;  4OO1 E;  2BA0 D;  4AID A;  3H36 A;  2C39 A;  3DD6 A;  3M7N D;  4OO1 A;  2JEA B;  3B4T A;  5JEA B;  4OO1 F;  4IFD E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...