4AIDA

Crystal structure of c. crescentus pnpase bound to rnase e recognition peptide
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
616
structure length
573
Chain Sequence
QDPMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKSASDGAKIKAAIDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase/peptide
total genus 166
structure length 573
sequence length 616
chains with identical sequence B, C
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 4aidA02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aidA03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aidA01
3KRNA 5JEAD 4OO1A 4BA2A 2NN6E 1OYRA 2PO2A 3CDJA 2BA0G 3U1KA 3B4TA 4IFDC 1UDQA 3CDIA 4IFDF 4AIDA 5K36C 1R6LA 2BA0D 5K36F 2NN6A 1R6MA 4BA1B 5JEAE 2C37A 1UDOA 2C39B 3DD6A 2BR2A 3M7NG 3GMEA 2PO0A 2JEAB 5C0XE 2PO1B 4IFDB 4OO1B 2JE6A 3M7ND 2WNRA 5JEAA 5K36B 4AIMA 4OO1C 5C0XD 4OO1F 3HKMA 3H36A 3GLLA 5C0XA 1UDNA 2WP8B 2PNZA 4IFDD 3L7ZB 4NBQA 2JEBA 3GCMA 2NN6C 2NN6F 2BA1G 1WHUA 1UDSA 4BA2B 2PO2B 2BA1D 3M85G 5JEAC 4IFDE 4OO1E 2C38A 4BA1A 5JEAF 3M85D 5K36E 2C39A 2NN6B 4OO1D 2PNZB 5C0XC 5K36D 2JEAA 3H1CA 2C37B 2JEBB 5C0XF 2PO1A 4IFDA 1E3PA 1E3HA 1OYPA 2BR2B 5K36A 2PO0B 2JE6B 2NN6D 2WNRB 5JEAB 4AM3A 1OYSA 2WP8A 3L7ZA 2C38B 5C0XB
chains in the Genus database with same CATH superfamily
2VBZA 4DR2I 1OKRA 1YI2I 4ETSA 1BM9A 2CU7A 2DOAA 3WHCA 2KZVA 1FOWA 2Z99A 1HK7A 2KRFA 2MC4A 2M8GX 5GP9A 4MHGA 2K4JA 1FC3A 2KHMA 3OYBA 3V5RA 4FISA 4UT4A 4NXME 2DMNA 3LA3A 1YS6A 3OYMA 5TRDA 1IGNA 1ZYRF 3LFUA 3BT9A 5HVQC 2RQQA 4FW7A 3BCBA 4FWHA 4LG0A 1WJEA 5FLXC 3MKWB 1IN8A 2E35A 1A6FA 1IBKE 1UDOA 3R6SA 1RI7A 4LFBI 1TNSA 2CWEA 2LF8A 1GVJA 2G9WA 2BR2A 1F36A 4DR1I 3E3VA 2XF6A 5C0XE 2STWA 1T98A 4CCOA 4U0WA 4WX9A 3JRFA 3GBGA 3HOVJ 4V19K 2CH0A 4XK4A 5F08A 2R0QC 1OJLA 1ZM9A 4DW6A 1YQAA 1J5EE 5HDNA 2V8PA 2PN6A 4HX7A 2QBYB 2OUMA 2ZXHA 2W82A 4QTRA 2F5DA 2E1CA 4F93B 4CZZA 4B3MI 2DFFA 2VPRA 2P8TA 2WP8B 1J09A 1P6RA 2BXYA 2P6SA 1F4KA 1XMXA 4DV1I 1P4AA 4LB5A 2ZITA 2JSCA 4HLYA 2M7BA 4CCKA 2DT7B 2E34A 2YR2A 3QWLA 4X1EA 4WWCA 3FDYA 1BIBA 1PUFA 1T08B 4LPFA 4DR5I 1XHKA 2IEKA 4JI1E 4II3A 3V8KA 2ZJQF 4JI2E 4HACA 2DA7A 3SFIA 2JA7J 3C2BA 3BPVA 3F8MA 2A05A 4MYUA 2DA6A 3BR3A 2E5ZA 4HA8A 2NRAC 4UVCA 3S8PA 3E0JB 2DT5A 2CQNA 4ZYAA 4DGWB 1SD4A 4WUDA 1K47A 2XVCA 3M4OJ 3HIFA 4DV2E 1X4OA 3V7RA 1LE8B 2KT0A 4DV5I 2Z3YA 5IT9C 1N32I 3HKZA 1VQOI 3RZDJ 2GBYA 4Z7YA 3H3VK 4LLLA 2E2JJ 3S14J 5K36D 3FBNB 1IXSB 2DFEA 3N4MA 4OIPF 3S16J 4HRIA 3NEUA 2PX9A 4UY8I 4C3IJ 4GFBA 1BI0A 1YHQI 1XD7A 2DOEA 1R22A 4M6VA 4CCJA 3B78A 1ZG3A 2MH2A 2VQEE 3J7AG 3QODA 3CCSI 2QQ9A 4JI6I 2X36A 3NARA 2JT1A 3HSEA 3Q5FA 1R5ID 1W7PD 3ZMVA 2O6GE 2GO4A 2NAZA 1N32E 2PMZA 4RB2C 1JKQC 4BEHB 1VQMI 1ETOA 1WQ2A 1B72A 3P76A 2DDBA 2V1UA 1EV7A 4TV7A 1Z1DA 3DKXA 2DW4A 2H1KA 4LG3A 2CZ9A 1FOYA 4LF8I 2DA5A 2GXAA 4M3FA 3BG3A 4YEJA 2HHHI 3LAJA 4JX6A 4DUZI 1MJBA 3HEFA 4AIDA 5LGTA 4G9YA 1BW6A 5GPCA 1YYVA 4ZYDA 3HUGB 2F48A 3N05A 2VKEA 5IY5H 5E20A 4PCQA 3MZHA 2JWTA 2FF4A 5IOYA 3F0CA 1JKOC 5B1BH 1Z5BA 3NZKA 2UU9E 2FOWA 4DYQA 4I2OA 3HRTA 3R60A 1RNLA 1VZ0A 4OAZA 3HOTA 2R5ZB 3TW6A 2JEAB 3K4BA 4LF8E 3J81Z 1H7UA 2HGCA 1TWHJ 4BHBA 1JKRC 2IOQA 1VF9A 3V8LA 1HLVA 3BG9A 3M6AA 3CTAA 4LK1F 1N33I 2E71A 2F2EA 3ABLH 3KIOA 3JRBA 4LFCE 1FNMA 5CQEA 3L00A 1IUYA 5J1RA 4JI8E 1FJLA 3KP5A 2Z5EA 4DV7I 2KRHA 4WCGA 3CMYA 4FW5A 1BJZA 3M9AA 1YIOA 1D1AA 2M30A 2MLKA 1ZR2A 2GO3A 1R7JA 4XRFA 1IBMI 3K4CA 1TWAJ 2HKOA 3PQKA 1U3EM 1G3WA 2IP2A 3Q9SA 2OZUA 3IP4B 3S3OA 2H6BA 1GDTA 5FLXQ 4N4OB 2PO2B 3BZCA 2ME6A 4BXUA 1FYKA 2ELKA 3M8FA 1W36C 4DNCA 3CCVI 4KICA 5JEAC 2BXZA 1S72I 3VYRB 5K36E 2QENA 4CSWA 3KZIC 1JJ8C 5FKOA 5JR3A 1EKEA 2KIMA 1ZG5A 2VKVA 4XNFA 1ORKA 3QYBA 2DCEA 3HOUJ 1PVEA 1AA7A 1DU6A 3ZMSA 3T1HI 3QT7A 3GONA 1FTZA 5ICEA 1E3PA 2ZXWH 2A61A 1IBME 2FSWA 1OYPA 4M1KA 4JX5A 1MMSA 2CRGA 3ZQLA 4PJ0C 1KQ8A 4UB8C 4XLEA 2FBHA 1Y39A 5ED4A 2X51A 4RAGA 2NNNA 4ZJZA 2QBYA 4DV4I 3SYTA 2LKPA 4EJVA 4PDKA 3FIWA 3KYLA 5GMDA 3QYEA 3OYHA 2PBIA 1BOBA 4HPQA 5EZGA 3BG5A 1H73A 5DD8A 1PP7U 2WP8A 1D6TA 3CC2I 4YIIA 1Z6RA 3WG7H 2B9SA 3CD6I 3ZM7A 1D0ZA 4D0PA 1U78A 3CMEI 1QA6A 3I5UA 2OCCH 2OQRA 2JRTA 4URLA 3K4MA 1SVLA 5F6FA 4ESBA 1FYLA 2DI3A 4P9FA 1VQKI 1YH8A 2CMPA 1FLIA 3UHMA 3PSIA 3QP5A 1UEKA 4C9YA 2K9NA 2C6YA 1LEAA 2LBFB 2ID6A 4PJNA 5M5XJ 4A6EA 4DV4E 2OU2A 4F52A 4YRVA 4U3DA 2O8XA 2HVQA 4D9JA 2UXDE 1GV5A 1D1CA 4CCNA 4AWXB 5A2QZ 1I3AA 2DT6A 2HVRA 2HPIA 2HEOA 4KYWA 3RPUD 1LE8A 4PSWA 4DZJA 1R6MA 2LKSA 3HDDA 5LEKA 3CCYA 1ZXNA 1EA6A 5LMNI 4JV5E 1XNRI 4UXNA 3ZR8X 2Z9OA 4ON0A 1JHFA 4Z6YA 4HBLA 1YX3A 3X2QH 2DQRA 1D0YA 4C2UA 4DR3E 2IJLA 4PFPA 5DS9A 2XF7A 4YFKF 4LF9I 1Z0CA 4OINF 1IXCA 3LQQA 3BLYA 3L2VA 4ZVIA 4AU7A 3ZZUA 4DV3E 1TWGJ 2COMA 1IXRC 2JPBA 1VFCA 2IS4A 1U2RA 3TGNA 1RIOH 4OO1C 2M45A 2DTZA 2V79A 2JQ7A 2IGNA 4JYKA 3CC4I 2L3DA 3BR2A 2CQKA 3GFMA 3ZKDA 2V9VA 3L2CA 3WU6A 3J81C 3MMYB 1M1EB 4XLCA 1IZ1A 2Q8KA 1YITI 1QPIA 2CUEA 1PJRA 5E3MA 3E6BA 2F4VI 3RQIA 4BEHA 4CGZA 5D5WB 1BKNA 1XMOE 2FUG2 5EYRA 1JI8A 1X2MA 1VQ7I 2NN6C 2X1EA 3RZOJ 2DFHA 1ENHA 3EUHC 3E1SA 5E3LA 4HYEA 3ISPA 3DKYA 2PNMA 1IBLE 1TW3A 2QKLB 3KP2A 2NYXA 3LAPA 2LRDA 4W97A 2A68F 1MDMB 2FU4A 2Y48A 3HUGA 3IC7A 1FT9A 3BZKA 2NVUB 2YX4A 1LVAA 2WAFA 3A03A 3ESWB 4UUSB 2ESNA 4HEA2 4X65I 2EIMH 3FK7A 4HAMA 2HYGD 2RQPA 4DZPA 2LYCA 2E2IJ 5DNXA 1FSEA 4DYCA 1DARA 4OIQF 4N0BA 4RBOA 3LQRA 2X6OA 5DNLA 2XV4S 2R5ZA 3FXUA 2JEAA 3F21A 2K40A 4F55A 5HS9A 1WZ2A 4FE7A 4BL0B 2PG4A 3E5XA 3AG2H 5LLQA 5ICFA 2DK8A 2M1BA 1RESA 3ZMTA 4EEFG 4RGUA 4RPFA 2J65A 5F1RA 4IEJA 1QRYA 3H4LA 3ABUA 3BC8A 2CW7A 3LSKA 5CYVA 1OYSA 3TEDA 4QPOA 3RQ4A 5IYDJ 2AQFA 4DOZA 4B43A 1A6QA 4NXNI 3EETA 5FROA 2QEXI 2R7TA 1EA3A 2LLKA 4LFUA 2LK2A 1I6XA 1QO0D 2RKHA 1FBSA 4X0GA 1V5FA 4Y3OA 2L7MP 3D1NI 3DXJF 4BY7J 2O03A 2W25A 4DR6E 2VPLA 4K0KI 2ZMEC 1K4SA 1R9TJ 3K1MA 4OWRB 1H0MA 3S17J 4DR7I 2PO2A 3U9GA 3DCFA 4IHSA 2QGUA 3K85A 4LF6I 2QWWA 5EG0B 2BOLA 3OIOA 2BM0A 1NHAA 2CVEA 2ZSIB 2VJJA 2ZNZA 2ELJA 2XAQA 4Q48A 1DDNA 1JKPC 3BTJA 1P2FA 3OMYA 1K79A 1ETYA 2QVOA 4C30A 1T0FC 4JI7I 2VC0A 1P7IA 5E79C 2OC6A 1HW2A 4B8XA 2HVSA 1XG1A 1PYVA 3F9KA 2Z33A 3SZTA 1RR9A 2EFPA 4R79A 4UUVA 3BR5A 2E36A 5K5OA 1N34E 2W85A 5B66C 1JUSA 5LMUI 4L5JA 1HXDA 1QZEA 1G8XA 1B63A 4MFDA 2F4MB 1PIEA 1HBXG 2VONA 2WB1A 4E7KA 1S7OA 1X1BA 4S04A 1BA5A 3P3GA 2L5QA 2DA1A 4MQVA 2R7DA 1U6GA 3ECHA 1SFKA 4IZJB 2UUBI 1TQPA 4GRIA 1FP1D 2IGKA 2HK3A 2Z5BB 2HDWA 3PYGA 1MNEA 1N75A 4YHHI 2L4MA 1UDNA 2CG4A 1Z0XA 2ISYA 5IYBJ 4OX9I 1YW8A 2UUCI 3RPUA 1T2KA 1FEXA 3OTOI 3CUOA 2LFBA 4MO7A 1FZPB 4IZJD 1A31A 3KYCB 2HPMA 2HYJA 2O8KA 4BBSJ 1QHHD 4ZZLA 5J8FA 4DUYI 1WFXA 2OA4A 1JHHA 2LBFA 2A2CA 3ZKBA 4BH9A 5E1XA 4KN4X 3K70C 2BY1A 2VN2A 3Q9VA 2EILH 3OYEA 2UUBE 4DU7A 1MBHA 1X4PA 4LFAI 4EJOA 2FX0A 4DYRA 1O57A 3D0SA 2L01A 3P3EA 2VJ4A 3B6AA 5KK1A 4BHCA 4ESFA 2QSGX 2MGQA 5BR8E 3OYJA 4ZC3A 2IXSA 4ZDLA 1ZR4A 2OCEA 3EUAA 1BR1A 2C37B 4NQWB 2CGEA 1H7SA 3TBIA 3RI4A 3DPTA 1XS9A 3BG7A 1MW7A 3F8CA 3G1OA 4YELA 3WU4A 3J81Q 4I0BA 1KGSA 4MEYF 3Q0UA 2PO0B 3TKYA 4CO8A 4QPQA 3SZPA 1RUOA 4GCVA 2UXCI 4X64E 2BBYA 3OL4A 1TLHB 5JEAB 3WTSC 3GVAA 4N4NB 4DR4E 2CO5A 2BVLA 1ODDA 3GX4X 1YJ9I 1BJAA 1FIAA 2EZIA 2P5VA 2W4SA 4XONA 2RNGA 4W1UA 3Q1QA 3K2ZA 3VOEA 2O1TA 4KQVA 2HQ5A 1XCBA 3A0BC 4L9NA 3LNQA 1R71A 1UFMA 1BR4A 1IG7A 1W36D 4BJTA 1FOKA 3OIPA 3K4NA 3TOBA 5JEAD 3D5LA 3RCOA 4WF2A 2GAUA 1RZ4A 4E6KG 4DPYA 2L7KA 2JRMA 4B3RE 2LREA 2WAQA 4UUTA 3F23A 1MDMA 4M72A 5LGNA 4LIVA 1LVKA 3I56I 4XKVA 2BHZA 2VKHA 2Y0SA 3JTHA 4G7ZF 4UUSA 3J7AY 1BI1A 4PUSA 1VQ5I 1Z91A 1UHWA 2XAJA 5F0CA 5HS8A 2M9HA 3C7JA 2QM3A 2BY0A 1L0OC 3DU5A 1ACIA 4KIGA 5KAIC 2KISA 3UNGC 2EFOA 2G7HA 4DBQA 1LFBA 1VQNI 2VJ5A 3WU1B 2M7AA 2C39B 3Q0VA 5E3NA 4LF7E 2JN6A 4XKBA 1EH8A 3KP7A 3T5XA 4BAYA 2UUAE 4HDVA 2E1NA 3P5JA 3Q3SA 3ZQHA 3ZN1A 3OYGA 2DMUA 5FGMA 4BNCA 3O8GA 4PSXA 5J3LA 1ZRFA 5L3GA 2DEIA 4I0AA 5FD6A 5GAGJ 3HKMA 3U1YA 4MLOA 4EGZA 1S16A 4XTJA 4IRIA 2R93J 3CJTB 5BOXA 4LF5I 3UKGA 2LY9A 2E5LE 5KVRA 3HKZN 4M9SA 5HLTA 2XIGA 3HHGA 1E0EA 3DU6A 3MKZA 4EMDA 1MBEA 2A6TA 2V9PA 3FXMA 4BUPA 4FW6A 1J75A 3JAMK 2O3FA 2R7RA 5FFXA 2GA1A 3QYFA 1ETWA 3GFIA 4B3SI 1Y0NA 4XQFA 3GYHX 5A2QQ 5IWAE 2OQGA 4PRXA 5FJ8J 2R3SA 3KZYA 2KIQA 1VQ9I 4P96A 2M5WA 3BG6A 3TDZC 1BW5A 4KMUX 2RN7A 3OIQA 1DQUA 2NN6B 4M74A 2BY2A 1HNWI 4OO1D 4RM3A 3J7YJ 1Z7UA 3PNVA 5E18F 4DPUA 5IT9K 2EPFA 3L2UA 1UELB 4ZTJA 1DU0A 4FASD 4IOCF 4IZJA 4OKGA 1KYWA 1W1WE 1W5CC 3NRVA 3RDIA 4IOAF 1J5YA 2AE8A 4M9ZA 4XR6A 2Z5BA 1UHMA 4HF1A 2VQHA 2J7KA 2NN6D 2DJIA 1XDSA 2HOSA 3CJNA 4L5EA 2HKEA 5DD4A 2UUZA 2B7EA 2CGPA 2YUSA 1OQYA 1W5TA 4WUCA 4Z7CA 3OYAA 2VE8A 4I01A 3PQJA 3ERED 1Y1WJ 3JRIA 1KU9A 4GKKI 4XOTA 2MW8A 3T1BA 4HF2A 1NHJA 3CO7C 1OYRA 5CPRB 2F5VA 2QLZA 3PRYA 4I76A 3NWSA 4GDFA 2ADUA 3CDIA 2V4JC 4B09A 4DBRA 3PNTA 1OJ4A 2FBIA 3BQYA 3IH2A 2QQ8A 2DJNA 4R8HA 4KNYA 1AHDP 1E17A 3E5UA 1G3SA 4DXLA 3J80Z 2H09A 1T95A 2IAIA 2WADA 3A1YA 4MIMA 1A35A 2C37A 1ERDA 4GXOA 4NQWA 2BEOA 2FMLA 5HNFA 2MA3A 1IBKI 4LJZF 2ZMEB 1O7FA 2HWVA 4GKKE 4I09A 5CVUA 1J2XA 1WI3A 3E6DA 5IOZA 2PO0A 4ZZDA 2NPFA 5M3MJ 4BJ5C 3BTIA 4KJZA 1X58A 4MQ9F 1D5YA 5JEAA 3OYCA 4KIFA 4EGYA 4M3GA 5HLGA 1Q1VA 2ZSHB 2VT3A 2A2DA 1GVDA 1IO2A 2DOFA 2L7ZA 2V1NA 4ZH4F 1J5EI 3KLOA 2PFBA 1SAXA 1USUA 5GPAA 3K0LA 4DV0I 1I1GA 2E2HJ 3KETA 4IHYA 2HQAA 1IDZA 4LIUA 2PNZA 1U5TB 2CFXA 2PI0A 5E8GA 1P42A 4WK8F 2FD5A 2LMDA 2LSOA 2VQFE 1B4AA 4A0XA 3T1YI 4FT8A 4UVBA 4U0YA 1T39A 1GXQA 4C3HJ 4U7DA 1Z0TA 4M9XA 1YLFA 2GLOA 4JI5E 1TWFJ 5HODA 2CJJA 4LMYA 3PL8A 2EA2A 2IPQX 1Y56A 1UDSA 4JI1I 2HKXA 3BZ6A 4AYBA 2VUMJ 4X66E 4JI2I 2ELHA 5FFZA 4RAZA 2V1XA 3DEEA 1O3SA 2JZYA 3OWTA 4AQYE 1FNNA 3I55I 4OO1E 2K9QA 2YX7A 3M85D 1G2HA 4PGHA 4DV0E 2C39A 3CF2A 2WTEA 1B9MA 2ECCA 3W6KB 4ZYHA 1SD5A 1BI2A 4L5IA 4DV2I 3ZCOA 2XGDA 2GXBA 4GKJE 3T1YE 4PK4A 1DGWY 1SVOA 2L4AA 5E1WA 5ILUA 2JA5J 4CCMA 2CG9A 2R7UA 2ZCWA 4O6JA 2DMPA 1ZLKA 2BHYA 1Y6ZA 1S7AA 5J8CA 3AG4H 3WE2A 3FMRA 2W24A 5D4SA 2X9DA 4E7SA 2WC2A 3VEPA 1XPXA 1C0WA 1VI0A 1H9GA 2PJPA 3HOZJ 2JE6B 3K1PA 1QPMA 3HM5A 2VQEI 2GWRA 2RV8A 3MWMA 1J0RA 2CUJA 3PIPF 1AWCA 4D7NA 4BQNA 3K70D 3CCLI 3ZN0A 3TOAA 2EZKA 3K69A 3WGGA 1FSHA 4HYMA 2OTLI 2J5OA 1EH7A 1R1VA 3F72A 3I0TA 3ZXSA 2BVMA 3K10A 1Y8RB 3HPHA 3TO6A 2PMHA 4AD9A 4OO1A 4YY3E 3KX2A 5IT3A 2X7IA 1NG6A 3F22A 1P9QC 3W3CA 4BQOA 3FXKA 3MKYB 3TDUC 1NHIA 4UVAA 1ZRDA 2UXBE 3WTTC 5J4YA 2ZXIA 2H27A 4J00A 4NC7A 2NVTJ 2Z5UA 3SDBA 2UV1A 1MJAA 5ILVA 2NN6A 2YU3A 2M8EA 2JT2A 3L2QA 3A0HC 3EUHA 1FMVA 1MBJA 4XKWA 4EM0B 2KMUA 4BY1J 2UU9I 3B6CA 1HR0I 2Y31A 4CXFA 4FW3A 1V5EA 4JBAA 3EYIA 3CCMI 4A5NA 5KNLA 4X62E 4MU1A 4BU2A 2MD0A 3P9IA 1S9HA 2IGMA 3DBHB 3KP3A 3RTRA 4AIHA 5JHFA 2E7WA 2E5NA 2ZKZA 2E1RA 1GLNA 1WRJA 1P4WA 1V5GA 4B1RA 1FPQA 5LGUA 2R3VA 2G0EA 3WHBA 2E1MB 4LFCI 3I59B 2VOOA 3WU5A 2RNJA 4JI8I 4IHVA 5IP6A 1JGGA 3J81K 5IP7J 4R1HA 1R4NB 2ZFUA 2XASA 1XGNA 1HR0E 1MIJA 1QZRA 3L1PA 1FYMA 2EV6A 2VODA 3GTPJ 4G94A 1KZHA 2HU9A 3RSNA 4BKXA 4IZZA 3OR2C 3D5RC 2EV5A 2H94A 3LOCA 1GUUA 2QZ8A 3JRGA 4OAYA 1MU5A 2GIZA 4O5VA 1H8AC 2JVGA 4WXHA 1VQLI 2CYYA 2IS1A 5ERIA 2DYRH 3F8FA 3M85G 2L9NA 5JI6A 4BDYA 3GFLA 3G2BA 3I4NJ 2FNAA 4YFNF 1X19A 5LD2C 3IWZA 2YU9J 3F6OA 2X4HA 2UXNA 3TO9A 5D5VB 3FMSA 4LF4E 5FKKA 3DPUA 3RPQA 3OS2A 2ZMEA 1HA8A 3Q0WA 3FXJA 5D6FA 4ZTFA 5D4RA 5K7FA 2IA0A 1QBJA 1U9NA 3BWGA 1MMNA 2CW0F 3FXLA 1N77A 2CQQA 3K2AA 1T0FA 3I71A 1VTNC 3K17A 1IDYA 4G8XA 4CICA 1AKHB 4BE0A 2WV0A 5BS6A 1HW5A 5EEHA 2GQQA 3REOA 5LFAA 5H2FC 2H1LA 1UG2A 3RKYA 3VB2A 1OYIA 1T56A 2CV2A 4DV6E 3P9KA 1D8JA 4YFXF 2V26A 1MG7A 2KZGA 1FKAE 1EJ9A 2DA3A 4MQYA 1OCRH 2STTA 2X6YA 4RS8A 3FXRA 1BC7C 3KEQA 5FKMA 4NC6A 2GA2A 4H4KC 4MGRA 3HGYA 2GZWA 4XLAA 2WB1N 5TGTA 4IFDC 2ZO4A 1X1DA 3HHHA 4XICA 1UDQA 3CMMA 2B0LA 3GTQJ 1V54H 4EVIA 1WSUA 2BA0D 3VYUB 2HFUA 2MD5A 4BE2A 2UXDI 1S6LA 3KFWX 3MZYA 3LTOA 6PAXA 3OL3A 4JQFA 2XAHA 2RVCA 4C2MJ 1YHCA 1YS7A 2DQLA 4NUBA 1LB2A 2NVYJ 4WXDA 3ULQB 3QPSA 2F1DA 4JV5I 2IS6A 3DD6A 2XDVA 1FWKA 3TQNA 3H5RA 1YJNI 4AVPA 4DR3I 1ZGJA 1LFPA 4M3DA 2LNBA 2O7OA 3BP8A 3KCCA 3S3NA 3LWFA 5DUKA 1YJWI 3O3KA 4QWQA 5CVIA 2JE6A 3G73A 1I50J 1LDDA 1MH3A 3BDDA 4FCYA 4DV3I 4JI0E 4G7HF 5C4XJ 3A01B 1PP8F 3LA7A 3A2KA 4AUXA 1E3OC 2MSYA 2M2EA 1V4RA 1CGPA 4UV9A 5EZHA 5EEGA 3PJRA 2MFZA 3ONQA 1HOMA 2FQ4A 3V8JA 1KTVA 1ELOA 4B3XA 1RPWA 1S7EA 1Z05A 3F8NA 4A5MA 2R42A 1D5VA 2X1DA 3S2HJ 2DLLA 2R7QA 2CUFA 2TDXA 2ZJRF 1XMOI 3VDXA 1FMWA 3C1DA 3IL2A 2LY2A 1OPCA 2XKPA 3WU0A 1IV6A 4Q5SF 2CV1A 3PS1A 1IBLI 2EINH 1EI1A 2LOOA 4I6ZA 3DF8A 1QVUA 3ZMZA 3L9FA 3JSOA 1FBUA 2EV0A 1WGXA 1Z3XA 3IAM2 4WXCA 4CYDA 4F91B 3GW2A 5B1AH 2XC7A 2Z5CB 2VL8A 3SXYA 5DRRA 1FIPA 3ZQ7A 4A3CJ 5JEAF 4XSXF 4N9IA 4II2A 5DUIA 3J80Q 3BOQA 5F1JA 2XB5A 3PS3A 2E7XA 3S2WA 2HFHA 5C0XC 3GEZA 1B59A 4XOPA 3T8TA 5LHGA 4I3HA 1REPC 4HNUA 2AHQA 2JK3A 4E7IA 3GTLJ 3QAHA 1E2XA 4BGDA 1OCPA 4J19A 1MNDA 2FOKA 4FN5A 4FQGA 2VI6A 1Z5AA 4A3DJ 4L0YB 4MYTA 2FRHA 3I59A 4JI4I 4FWGA 1QVTA 2ZJPF 2IVMA 2R7SA 3DTEA 4FHTA 1ZHFA 1TBXA 1UZCA 4BXFA 3OYDA 4MU0A 3W6JB 5KCMA 1TT5B 2EB7A 1LDJA 4G12A 4AC0A 4RDUA 3EQLF 3KPHA 3GUDA 4U88A 3IV5A 5E3OA 4ABZA 1UMQA 1YW9A 3DLLF 3ZRGA 3L7WA 4F7ZA 4DR6I 3I58A 3OS0A 1RR8C 3S1MJ 2BA0G 2P4WA 5JLWA 4OOIA 2GOMA 5CVVA 1JT6A 4QNJA 5CKTA 3BCAA 4P52A 2EA4A 3RKQA 4JI4E 1MD0A 5IP9J 4HV6A 3CLOA 5EEAA 3CO6C 4N9HA 1XXEA 4BQAA 2VQCA 5L3DA 2DODA 1ZXMA 1LKXA 3HJCA 3I53A 4EJUA 4RGXA 4FE4A 2LF7A 2D45A 3T8RA 5DTDA 1N34I 2A6EF 1KKHA 4OZEA 1I39A 1WH7A 3KYDB 5AIQA 1AKHA 2JSPA 1QZYA 2KJCA 3WODF 2M0CA 3DFGA 1Z5CA 3BY6A 1X1CA 4XORA 4J01A 1NZ0A 4ZYEA 4MU3A 3S1RJ 5EGOB 4OO1F 3JRHA 4IX7A 2K5CA 2XROA 2OF7A 1N78A 1FWZA 3GLLA 2CSOA 4OIRF 1XMAA 1FJGE 5GMEA 3BR1A 1HQCA 1HSJA 2NOGA 3CCRI 3DPLC 3S93A 2RDPA 1HDPA 2NVXJ 1U5TC 1XMQE 3H35A 5A2QC 2NN6F 2UXXA 9ANTA 2IS2A 4I98B 1GV2A 2WAEA 1ETXA 2BA1G 1NHHA 4A3EJ 1R1UA 3O6BB 2XRLA 3LSGA 4IQ4A 1Y8QB 1WVRA 3ELKA 2QQBA 2FQ3A 3PYEA 3S2DJ 1ZG1A 2XUBA 1IAWA 1SD7A 2PLYA 2NS0A 4A69C 4BXXJ 3JW4A 1SFUA 4JI3E 2PMUA 1U8RA 1X1PA 2NOJB 2YS9A 1N36E 2V2QA 2OPTA 4KT6A 2K4BA 4P5OA 1IUFA 4U7BA 1JTYA 5BR8I 2K9MA 5D5UB 4EJWA 2JEBB 1SEUA 3WE3A 4M3EA 1FP2A 4P7AA 4F92B 5DM7F 2B63J 2BW3B 3A01A 3LNUA 3GTJJ 5AONA 3HGGA 2R7WA 3TL4X 5EF6A 1QQIA 2D5VA 3WGHA 2W00A 2HNHA 2FMYA 2RREA 4X64I 4RM2A 3GZ6A 1MSFC 4HZFA 4DR4I 2QSFX 3QT5A 2MH9A 2NS8A 1SANA 2V9KA 1RC9A 4NC8A 2FA5A 3RKWA 3DV8A 1PUEE 2K27A 1FX7A 2P7CB 5M5WJ 2LDUA 2A5WA 3L09A 2PEXA 5DRQA 2GM4A 2TRTA 4CH7A 1O3TA 1XCVA 1L3LA 3NQOA 5B3SH 1IN5A 2XGCA 2Y9YA 4USMA 3OYIA 4B3RI 2AXLA 2K9LA 4HF0A 5DDGA 4MTEA 1K6OA 5BQTA 2Z5CA 3PSFA 5J1UA 4FW9A 4PRVA 1UB9A 1K61A 4A93J 4V2GA 5K36C 3PFIA 2DMQA 4LOCA 3R4KA 4L9TA 1YTYA 3OSFA 3DBRB 4M6YA 1A5JA 4A6DA 4O3MA 4A3BJ 4KHPE 4CCLA 2MABA 1TZLA 4KT5C 3MEXA 3ZOBA 4C3JJ 4EATA 2O1VA 4LF7I 4B4CA 5DCFA 3QOEA 1MZBA 2UUAI 2DN0A 3G3ZA 3OY9A 1SFXA 4IFDB 2V6CA 5JFRA 2HTJA 4RB3C 4AYBN 1WI9A 4RMNA 1ULYA 4I7HA 4JX4A 2LVSA 4B3TE 2DYSH 5K5RA 2BM1A 4IRHA 5KHDA 4Y33A 3IUOA 1F5TA 3ECOA 4IFDD 2VXZA 2E1MC 2BV3A 2L54A 1YX5A 3BJAA 4CUGA 2QA4I 1HNXE 2E5LI 1FTTA 2KDOA 1Z9CA 5TISC 2C38B 2H8WA 1B1BA 1R6RA 2OAZA 5FLXK 4LLNA 1Y5YA 2M4GA 3C3WA 2LP0A 1I94E 1IJWC 2MYSA 4DPTA 1QZZA 1Z6TA 1HKSA 3DTIA 4B44A 4BA2B 4IO9F 5DEQA 2FE3A 2R4GA 2RAEA 1W0TA 2QUFA 2HFSA 1S3JA 4IXAA 2L7FP 3ZQQA 1JXSA 3CUQB 5IWAI 4H0EA 3GZ5A 3JRAA 2NXNB 1HSTA 4GQUA 3BR6A 2BZTA 2E1OA 4JYAE 4A3KJ 2HZTA 2QYOA 5CLSA 2OTJI 4ESJA 2VQLA 3O8HA 1P92A 4KIBA 2VBYA 2R5YB 1Z59A 3G1LA 2M34A 3DP7A 2WW4A 1FWLA 1VQ4I 3E97A 2IGOA 3VFZA 2DPDA 1MBGA 4GGGA 1RR7A 1WJDA 5EG0A 1YW7A 3KLNA 2LD5A 2ZC2A 2HS5A 4XLFA 4USKA 5EGOA 1Z3YA 2M0MA 2LTPA 2XB0X 2DDAA 5IYCJ 1HCRA 5FD5A 2WWYA 3I4PA 1WKMA 2KRCA 1U0JA 3KEOA 1PDNC 4KFCA 2WY8Q 3AL0C 3HOWJ 2MC3A 3PFYA 3KZZA 5C0XB 1I3QJ 5F27A 1UAAA 3P9CA 2ZBKB 2O3ZA 2Y9ZA 2EK5A 1S8NA 2PMZN 2XPVA 3KRNA 2ETHA 2CW8A 4IZKB 3E7LA 5K7HA 4D1QA 4C2TA 3FF5A 1Z77A 3ZQGA 5HDKA 2KP6A 2XF5A 4BQQA 5J47A 3ZGKA 3K1NA 4EJTA 1IRFA 4ENJA 1BL0A 3HJEA 1K83J 4AVZA 2IA1A 3JAMZ 2K85A 5KAFC 2I5UA 2KLOA 4E7HA 1ZH5A 2LH9A 2ZM6E 1XTAA 3I64A 5CVRA 4XN0A 4XBFA 1HDDC 1EF4A 4HXZA 1OCOH 2VQGA 5JEAE 1LUJB 3CCEI 4IKFA 4M73A 3SZGA 1RREA 1D3YA 2FJ1A 5E8IA 2VC1A 1GXPA 2BW3A 3CWVA 4CA0A 4E4HA 4RLQA 4LB6B 4QLCU 3F6VA 1BBYA 3HTSB 2PNLA 2O61A 2EQRA 1WJAA 1OCCH 3AAFA 3CJQB 3H3ZA 5HLHA 2P6TA 5IT9Z 2DU9A 4AIMA 1YG2A 2XAFA 5DYMA 4YG2F 3OV8A 1H9TA 3HL2A 3ZPLA 3H5AA 4IHTA 2IESA 3RJPA 5JVTA 1YO5C 3JSPA 3HYIA 1V3FA 2ZB9A 4MTDA 5EL9A 2K86A 3BJOA 4ZDPA 3M07A 5HNHA 1ETKA 2V6EA 2VLAA 2DA2A 2VQFI 1BIAA 1HKQA 2D2WA 4XM3A 4RAYA 2XPUA 4A0ZA 3TP0A 2AJ4A 4IPAA 2X85A 3HTUA 4ITVA 4L9VA 3FM3A 4A12A 2IRFG 3MZ8A 4JI5I 4Y4RA 1VNDA 2WV1A 1Z0WA 1V55H 4X66I 3MAJA 2V2ZA 1ZGWA 1VQ8I 3VPRA 1G3YA 2F5FA 3EPZA 4Y52J 1U2WA 4DPXA 4AQYI 4JK1X 2COBA 3RYPA 3HOSA 1B62A 4P9UA 5C4JJ 1IV8A 2W57A 4LCGA 2KIUA 1R1TA 2P5KA 1NH3A 4LITA 1USSA 1NK3P 4B47A 2R92J 3ABMH 3V42A 3QP6A 4IFDA 4GKJI 1WH5A 2EFWA 2DO7A 2I8DA 3PM1A 2P81A 2O9LA 4KUMA 4RLFA 3OYFA 2NNYA 1J59A 2HKJA 2RC4A 2GXGA 1G4DA 3SJMA 3GTOJ 1A36A 2WNRB 1JGSA 5F04A 4AIKA 4HX4A 3A4CA 4AM3A 2K3PA 4LLGF 4RGRA 3S3MA 4HNTA 4XLNF 2HYFA 1GHCA 2QQAA 1IRGA 3ZZ0A 2HDDA 4FX4A 4DR2E 1DP7P 3K7AJ 5ICCA 3HRSA 2JMWA 1NG7A 4MDTA 4Y15A 5HS7A 1LNWA 1OR7A 2E19A 3HZJA 4BA2A 2NN6E 3H3UA 1XNQI 1RKTA 3CP8A 2K9SA 2ECBA 2MG4A 1ZELA 3KEYA 2DEJA 2D1HA 3BROA 3W2WA 3U1KA 4YY3I 4DQ2A 1FOXA 1APLC 3CUQA 2A6HF 3HSFA 3PYFA 4EQQA 2UXBI 4DU8A 3ZQCA 2R7ZJ 2P7VB 4B48A 4UHTA 4D7MA 1B8IB 4P55A 2R5YA 2V7FA 1K6YA 3M7GA 2DK5A 2KL4A 5K5QA 4R1FA 5ELWA 1SAUA 1JTXA 4QIWN 5JVGF 4LFBE 3LSIA 2EBIA 5DCMB 3QT6A 4DR1E 3SFZA 1Y4UA 3JAMC 4LCFA 1JJ6C 3TO7A 1I1SA 1YOVB 1XNQE 2PO1B 3D5SC 4E7JA 3PIOF 2EJRA 1Z0VA 3CJRB 4X62I 4KMFA 5K36B 3GZNB 2BA1D 5FKLA 1DP3A 2F4OB 3HSRA 1W4MA 3ZMDA 2M3AA 4FTHA 4PZJA 4B3ME 5C0XA 2M4KA 2IOPA 4MU4A 3DEUA 4OMYA 1I27A 2ZBKA 2OJED 1A6IA 2R7VA 1F9NA 3LMMA 2GIVA 2VESA 4DV1E 1A04A 2OZ6A 4IZKA 2O5RA 3VSKA 3JR9A 4PJJA 3BPXA 1T38A 4Y17A 1TNTA 1XSDA 2Y69H 3BTLA 2DXIA 1W7PB 2CQ7A 2ME0A 4DR5E 3GWZA 3V4GA 2O1UA 3KP4A 3J80C 2X1CA 3OOUA 3SQNA 4XIDA 1TT0A 1ONVA 2HQRA 3JRCA 2EFGA 1H74A 2CS3A 1G6NA 3FX3A 1IW7F 2R7OA 1K78B 1Z67A 2EIKH 2L9RA 3NAUA 4A0YA 1MMGA 2BYVE 2UWMA 1D1BA 1USVA 4DV5E 3FXOA 3FXQA 1VI7A 4LF4I 2CUZA 1H89C 1XGOA 2EWNA 5H20A 3IH4A 4HQMA 5EDNA 2Z2SB 2P5LC 1G59A 1VQ6I 2VASA 2Y30A 2X0LA 4V2FA 4B3AA 4UB6C 1TC3C 2XKOA 3LFKA 3WTUC 1E3HA 4RB1A 3H0DA 1X3WB 3F8BA 3T0YA 3LPSA 1YIJI 2P0WA 3C2GA 3FM5A 3PO3J 4MEXF 3MCZA 4JI6E 3MN2A 2LKXA 1WPKA 5D6EA 2VJIA 1JUMA 2W1OA 3E5QA 4DV6I 3I54A 1T8IA 3HOXJ 3CC7I 3QU6A 3CESA 1B9NA 2HTSA 3CDLA 3JREA 1ZREA 1MMDA 3ZP5A 1T33A 1QHGA 4IQJA 2HXIA 1YFHA 1MBKA 1MSEC 3QT8A 4E7ZA 2HHHE 1SFEA 2IA2A 5D8KB 2XGXA 4DUZE 3B4TA 1ZKGA 3OS1A 3K4JA 3ABTA 2J5PA 4JG4A 1CQTA 4U3BA 1R6LA 4ENNA 5LHIA 2X6WA 1MNMC 1RUNA 3AL0B 3FISA 4JOMA 2N8GA 1NTCA 2ZFWA 3LSTA 1U5TA 3AG3H 4ED4A 1ZARA 2EFQA 3G1MA 3VODA 2K7LA 3QPTA 3DWLE 3FBIB 3QPHA 5DM6F 5GTIC 3U1DA 3ZQFA 3QU3A 4KDPA 2OI2A 2H8RA 5J40A 2EFNA 4RGSA 3G4SI 1OYWA 3LSPA 2O0YA 3M7ND 3E6MA 2R7XA 2WNRA 2CFOA 2Y75A 3JCUC 4LK0F 1OCZH 3M1CA 4YIFA 1KU7A 4CHUA 1N33E 4JI0I 4A3GJ 1TL8A 4XLPF 1IRXA 3CCJI 2IERA 1J7KA 2NVQJ 1I5ZA 4DV7E 1I6HJ 3B8HA 2JA6J 3VYSB 1F1ZA 4ZDOA 3L7ZB 1SD6A 1X3ZB 3IH3A 1UJ8A 2JA2A 1FY7A 3GCMA 4Y13A 3B73A 1RHYA 4QSHA 3J7AO 5L3JA 1JUPA 5GAHJ 4MFEA 5A2QK 1ZQ3P 1HC8A 1WHUA 1B6AA 3PNYA 1OISA 4PJLA 3O2PE 2VKDA 1WJBA 3ZQIA 2O1WA 3H92A 5DV5A 2PQ8A 2ISZA 3QPLA 1LJ9A 1OR7C 5J4VA 3JAMQ 1Z21A 3HC7A 1WCMJ 4RAFA 1B8IA 2V34A 1IF1A 4U0VA 1RETA 1Q1HA 1R5GA 1NK2P 3S15J 4Z2YA 1U9OA 4IL6C 3CUQC 5DCMA 1BR2A 1S4EA 2XGEA 1LEBA 1BN5A 1XB4A 2VB6A 3T1HE 1Y4SA 5JHUA 2EZHA 5F0HA 2LJPA 1SMYF 2DA4A 1ZM4A 2PO1A 4AIJA 2W84A 3CQZJ 3H0GJ 4I02A 3H9QA 3M3YJ 5K36A 3LSRA 2D1VA 2EZLA 3L2WA 1FBQA 3A02A 3HRUA 3PUBA 1JE8A 5IT9Q 5FLMJ 3FWEA 5FRNA 2QKMB 1P7JA 2MLGA 4HLXA 4HV5A 1OLTA 1ZLJA 3CZ6A 2NS7A 3DQVC 1TP4A 4LCHA 1H72C 4ENKA 2HZDA 2BY3A 3H5NA 2DAOA 3VWBA 4BHPA 4U87A 3BR0A 3SEQA 3JRDA 3IAS2 4G6DA 2XAGA 2I10A 2HI3A 4PU9A 1W7PA 2OBPA 4HW0A 4CYCB 1R49A 4S05A 1R58A 2FNPA 2HR3A 3AG1H 3RIRA 4E7LA 3OSGA 4S0HB 5M3FJ 5C44J 4NHJA 1N25A 2WAQN 3H9JA 2L2OA 4BYYA 2XAUA 5L3FA 2XHKA 4IF4A 3WGIA 1K78A 3TW7A 2JUGA 2Y0SN 2CV0A 1KIJA 4IFDF 1TWCJ 4XLHA 5CVJA 3VSLA 5FWKA 3ASNH 5GTHC 2R7FA 3QQAA 3GF2A 2K3FA 1X1AA 4A3IJ 4FW4A 3IRRA 3DBLB 4EMSA 4BA1B 1G3TA 2XPWA 4XSZF 1LFUP 5LMNE 3BQZA 1XNRE 3OR1C 4LGWA 3EUKL 1BOAA 1D0XA 3V7SA 1RKWA 2H6CA 1W0UA 2KDZA 2VOPA 3M7NG 1OYYA 1ON2A 3IKVA 3BTCA 3JTGA 2JA8J 3B82A 4LF9E 4BJ6C 1XDUA 1TTYA 3M1EA 1AOYA 1KU3A 3GXOA 4A3LJ 3GTKJ 4A3MJ 3FZVA 4F3QA 2QF7A 1GT0C 4DJAA 2AS5F 2W7NA 2W48A 3K4KA 2G7UA 4NDLA 5D5XB 1KONA 1XSVA 3HOYJ 2F4VE 3IHUA 3HXLA 4IHXA 1FJGI 5BMZA 4KA4A 4A2UA 4NBQA 1R4MB 3N97A 2DFIA 4RB0A 1OMIA 4ENMA 4DPWA 5K7ZA 3FK6A 1XMQI 2GS8A 1TQMA 2KIFA 4ANJA 1KQ9A 1R00A 2QCOA 4D5FA 5L3EA 2A3SA 2L9VA 3MKLA 2HOEA 1CF7B 4HY1A 1OCTC 2XRNA 4BDZA 1VISA 1QU3A 4K2EA 3HG9A 4FX0A 1KQ0A 3PS2A 2DPUA 3K4LA 3F0NA 4X65E 1WWXA 1WJFA 3B02A 3M8JA 1IN6A 1X2NA 2JPCA 4FWDA 4JI3I 4HX8A 3SEZA 1N36I 1HW1A 2VT2A 2CQXA 4Q47A 2PJRB 2JVHA 2LR8A 1Y6IA 5FLVA 3H1CA 5TJJA 5C0XF 1MMAA 5FB2A 1AU7A 4YIRX 2VE9A 4XRSG 4A3JJ 4NB5A 1Y0UA 5E17F 1QNTA 5D8LB 3I9V2 3C18A 4CZCA 3S1QJ 2A69F 3U21A 5L3BA 4GYGA 1IN7A 2Q2EB 4EV0A 3ASOH 4P1WA 3DTKA 1O3QA 1H88C 4NXNE 4XMYA 5FO5A 5CQGA 3L7ZA 4N3OA 3HRMA 5CJ9A 4HOBA 1X3UA 2A5YB 3PO2J 2V1DA 2HQNA 4Q4ZF 1BI3A 2F5EA 4XN3A 2ZXJA 3BJ6A 4K0KE 2LY1A 1ZK8A 3OYNA 4DR7E 4PGGA 1IC8A 2OD5A 3V2UC 3LA2A 4LF6E 2IT0A 3M8EA 4D5CA 1EH6A 3CDJA 2HOAA 2KPMA 4BE1A 5LL6R 1HKTA 1KYZA 1D8KA 5K1YA 4JI7E 1WJ5A 2F5CA 1YE9A 3U2RA 1F43A 4XRSA 2UZKA 5FKNA 4XL9A 3GLXA 3UR3C 2QSHX 3GTGJ 4A3FJ 3IWFA 1U8BA 5M5YJ 4KHPI 4NNJA 3MQ0A 4LOMA 1XMKA 1ZM2A 2FEZA 2Z16A 3R0JA 5LMUE 1ETVA 3C2HA 3GMEA 1R23A 3EYYA 3TP3A 2VBXA 5HOOA 1DPUA 1PKPA 3CDHA 3MD2A 3QOPA 1YRNB 3IRQA 2X48A 1KA8A 1MKMA 3ERMA 2WBMA 5HLIA 5GADJ 3L2RA 1WJCA 1HF0A 2TCTA 4YHHE 5LHHA 1J9IA 1Y60A 3CCQI 3ML6A 4B3TI 3R61A 3MFKA 4OX9E 2VIXA 2UUCE 2LG4A 1N0VC 2EH3A 5JLXA 3OTOE 1UHSA 4CYCA 3CMAI 1ZM3A 4KISA 3RYRA 2Q0OA 1KVKA 3FKJA 1HNXI 5E1ZB 1POGA 1TW2A 2BE5F 3FKIJ 2KKOA 5BPDA 4DUYE 1IRZA 2HOTA 3J7AM 2IW5A 4L18B 1I94I 5B5EC 1KU2A 3S32A 4G6TB 3MVPA 4OU0A 1MJ9A 1O3RA 3R0AA 3P06A 4M71A 1O4XA 4LFAE 3ABKH 2KFDA 4UTGA 2AO9A 1WUUA 2GQ0A 3OOPA 4BA1A 5ILSA 2BV6A 3S1NJ 1DUXC 1ZRCA 4XKCA 3H9GA 1Y1VJ 3AFHA 1RRJA 1MGTA 1ON1A 2Y2ZA 4JYAI 3HBLA 2AQEA 2M87A 3F3XA 4GO1A 4PFOA 4LG0B 2PNZB 3Q6MA 3G71I 1ZN2A 4GYIA 3COAC 1SC7A 1TQIA 1LQ1A 2WA0A 3LSHA 2BGCA 1MBFA 4XRMA 1LPQA 3SDGA 2BR2B 3ROUA 1K7AA 3W6VA 4M6XA 2UXCE 2FBKA 5EKWA 3K9TA 4HNVA 4HSRA 2RGVA 3RKXA 3DEWA 2JTVA 4ISAA 1MX0A 4KN7X 3TMOA 1Z0EA 4IHWA 5AIPA 3K1JA 4EM1A 3I4MJ 4L9JA 4G7OF 4LD5A 1XX5A 2DMTA 2AXTC 2L9SA 3ZZTA 3P7NA 5LBQA 5F0FA 4E70A 3WTZA 1O7LA 2XSJC 5F64A 5H6RA 5J6XA 2ID3A 3W2VA 3IKTA 1ZAOA 1ZTRA 1XN7A 1CF7A 1ITYA 4BBRJ 2IBDA 4L0ZB 1OFCX 2YSRA 3G6EI 2K02A 2VBWA 1VQPI 1PUFB 4HG2A 3PUFA 5FLXZ 1UG0A 5LRSA 4HACB 1P4XA 5J1YA 4FETA 1Z0BA 3KP6A 3CCUI 2MBFA 5K36F 1S5LC 5L3CA 2A07F 4WUBA 1XGMA 1R36A 2HK2A 2ZM6I 2ACJA 1MH4A 2EIJH 2PJRA 2DBBA 5DRPA 3FMQA 5DROA 4JP0A 3V7CA 1SMTA 1ZGAA 4IRGA 5LRRA 4DIQA 4ZYGA 3J7ZI 1XGSA 3WTYC 1JT0A 3PYDA 2F4IA 1N0UA 2LC2A 4ASNA 4G6QA 1FI4A 4BACA 3I3LA 1ETQA 4OO1B 5HDGA 3D4JA 4J3DA 5BPIA 2Q2EA 2HXOA 3EDPA 2XSDC 3HB9A 2DTRA 4Y7NJ 3E6CC 5C0XD 4EM2A 4IVNA 2XEXA 5EJCA 1S29A 4I99C 3W2AA 3H36A 5FRMA 3NWTA 1HNZI 1XC5A 4LF5E 1SFOJ 2GOXB 2HDCA 1PVGA 1Z7LA 2ICWG 3WG9A 3Q6NA 2JEBA 3FHNA 3ZMUA 3GTMJ 2F6CA 3FHZA 4OIOF 2JUCA 4BS9A 4CDGA 3VYTB 2VXDA 4HDUA 4KITB 3OYLA 1LDKB 1B72B 3WTXC 3K6GA 3AKZA 4UNOA 3HULA 3LSJA 4RA2A 1UCRA 5C3EJ 4B3SE 2FXAA 2E60A 2V2VA 1XSXA 3WU3A 4MNUA 4HQEA 2VF3A 1Z0GA 2KQRA 3J80K 3GO5A 2X6XA 4IFDE 1USTA 5BNGA 2JJ7A 1QGPA 2C38A 3CLQA 3DKWA 2OV7A 2Z1DA 1T6SA 1HNZE 1R5HA 3LSMA 4UV8A 1HNWE 1BC8C 4HSTA 1K4TA 2Q1ZB 1SVMA 3SHFA 3KE2A 4X6AJ 2L0KA 3WU2C 1STZA 4PJMA 1YRNA 4M3BA 3GFJA 2KJBA 1W5SA 5ICGA 5H6QA 3LL7A 3CP2A 2YPRA 3DLAA 5GAEJ 2ZNYA 4NXMI 3P3CA 2ESHA 3WTVC 4IJAA 5IPAA 4OMZA 3WTWC 1IN4A 3QRFF 4IS9A 2Y0MA 4QNKA 1DGRM 2ZJ2A 5LEJA 3HPGA 1DPRA 3OYKA 2WY7Q 3CF5F 2L02A
chains in the Genus database with same CATH topology
3KRNA 5JEAD 4OO1A 4BA2A 2NN6E 1OYRA 2PO2A 3CDJA 2BA0G 3U1KA 3B4TA 4IFDC 1UDQA 3CDIA 4IFDF 4AIDA 5K36C 1R6LA 2BA0D 5K36F 2NN6A 1R6MA 4BA1B 5JEAE 2C37A 1UDOA 2C39B 3DD6A 2BR2A 3M7NG 3GMEA 2PO0A 2JEAB 5C0XE 2PO1B 4IFDB 4OO1B 2JE6A 3M7ND 2WNRA 5JEAA 5K36B 4AIMA 4OO1C 5C0XD 4OO1F 3HKMA 3H36A 3GLLA 5C0XA 1UDNA 2WP8B 2PNZA 4IFDD 3L7ZB 4NBQA 2JEBA 3GCMA 2NN6C 2NN6F 2BA1G 1WHUA 1UDSA 4BA2B 2PO2B 2BA1D 3M85G 5JEAC 4IFDE 4OO1E 2C38A 4BA1A 5JEAF 3M85D 5K36E 2C39A 2NN6B 4OO1D 2PNZB 5C0XC 5K36D 2JEAA 3H1CA 2C37B 2JEBB 5C0XF 2PO1A 4IFDA 1E3PA 1E3HA 1OYPA 2BR2B 5K36A 2PO0B 2JE6B 2NN6D 2WNRB 5JEAB 4AM3A 1OYSA 2WP8A 3L7ZA 2C38B 5C0XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRN A;  5JEA D;  4OO1 A;  4BA2 A;  2NN6 E;  1OYR A;  2PO2 A;  3CDJ A;  2BA0 G;  3U1K A;  3B4T A;  4IFD C;  1UDQ A;  3CDI A;  4IFD F;  4AID A;  5K36 C;  1R6L A;  2BA0 D;  5K36 F;  2NN6 A;  1R6M A;  4BA1 B;  5JEA E;  2C37 A;  1UDO A;  2C39 B;  3DD6 A;  2BR2 A;  3M7N G;  3GME A;  2PO0 A;  2JEA B;  5C0X E;  2PO1 B;  4IFD B;  4OO1 B;  2JE6 A;  3M7N D;  2WNR A;  5JEA A;  5K36 B;  4AIM A;  4OO1 C;  5C0X D;  4OO1 F;  3HKM A;  3H36 A;  3GLL A;  5C0X A;  1UDN A;  2WP8 B;  2PNZ A;  4IFD D;  3L7Z B;  4NBQ A;  2JEB A;  3GCM A;  2NN6 C;  2NN6 F;  2BA1 G;  1WHU A;  1UDS A;  4BA2 B;  2PO2 B;  2BA1 D;  3M85 G;  5JEA C;  4IFD E;  4OO1 E;  2C38 A;  4BA1 A;  5JEA F;  3M85 D;  5K36 E;  2C39 A;  2NN6 B;  4OO1 D;  2PNZ B;  5C0X C;  5K36 D;  2JEA A;  3H1C A;  2C37 B;  2JEB B;  5C0X F;  2PO1 A;  4IFD A;  1E3P A;  1E3H A;  1OYP A;  2BR2 B;  5K36 A;  2PO0 B;  2JE6 B;  2NN6 D;  2WNR B;  5JEA B;  4AM3 A;  1OYS A;  2WP8 A;  3L7Z A;  2C38 B;  5C0X B; 
#chains in the Genus database with same CATH topology
 2VBZ A;  4DR2 I;  1OKR A;  1YI2 I;  4ETS A;  1BM9 A;  2CU7 A;  2DOA A;  3WHC A;  2KZV A;  1FOW A;  2Z99 A;  1HK7 A;  2KRF A;  2MC4 A;  2M8G X;  5GP9 A;  4MHG A;  2K4J A;  1FC3 A;  2KHM A;  3OYB A;  3V5R A;  4FIS A;  4UT4 A;  4NXM E;  2DMN A;  3LA3 A;  1YS6 A;  3OYM A;  5TRD A;  1IGN A;  1ZYR F;  3LFU A;  3BT9 A;  5HVQ C;  2RQQ A;  4FW7 A;  3BCB A;  4FWH A;  4LG0 A;  1WJE A;  5FLX C;  3MKW B;  1IN8 A;  2E35 A;  1A6F A;  1IBK E;  1UDO A;  3R6S A;  1RI7 A;  4LFB I;  1TNS A;  2CWE A;  2LF8 A;  1GVJ A;  2G9W A;  2BR2 A;  1F36 A;  4DR1 I;  3E3V A;  2XF6 A;  5C0X E;  2STW A;  1T98 A;  4CCO A;  4U0W A;  4WX9 A;  3JRF A;  3GBG A;  3HOV J;  4V19 K;  2CH0 A;  4XK4 A;  5F08 A;  2R0Q C;  1OJL A;  1ZM9 A;  4DW6 A;  1YQA A;  1J5E E;  5HDN A;  2V8P A;  2PN6 A;  4HX7 A;  2QBY B;  2OUM A;  2ZXH A;  2W82 A;  4QTR A;  2F5D A;  2E1C A;  4F93 B;  4CZZ A;  4B3M I;  2DFF A;  2VPR A;  2P8T A;  2WP8 B;  1J09 A;  1P6R A;  2BXY A;  2P6S A;  1F4K A;  1XMX A;  4DV1 I;  1P4A A;  4LB5 A;  2ZIT A;  2JSC A;  4HLY A;  2M7B A;  4CCK A;  2DT7 B;  2E34 A;  2YR2 A;  3QWL A;  4X1E A;  4WWC A;  3FDY A;  1BIB A;  1PUF A;  1T08 B;  4LPF A;  4DR5 I;  1XHK A;  2IEK A;  4JI1 E;  4II3 A;  3V8K A;  2ZJQ F;  4JI2 E;  4HAC A;  2DA7 A;  3SFI A;  2JA7 J;  3C2B A;  3BPV A;  3F8M A;  2A05 A;  4MYU A;  2DA6 A;  3BR3 A;  2E5Z A;  4HA8 A;  2NRA C;  4UVC A;  3S8P A;  3E0J B;  2DT5 A;  2CQN A;  4ZYA A;  4DGW B;  1SD4 A;  4WUD A;  1K47 A;  2XVC A;  3M4O J;  3HIF A;  4DV2 E;  1X4O A;  3V7R A;  1LE8 B;  2KT0 A;  4DV5 I;  2Z3Y A;  5IT9 C;  1N32 I;  3HKZ A;  1VQO I;  3RZD J;  2GBY A;  4Z7Y A;  3H3V K;  4LLL A;  2E2J J;  3S14 J;  5K36 D;  3FBN B;  1IXS B;  2DFE A;  3N4M A;  4OIP F;  3S16 J;  4HRI A;  3NEU A;  2PX9 A;  4UY8 I;  4C3I J;  4GFB A;  1BI0 A;  1YHQ I;  1XD7 A;  2DOE A;  1R22 A;  4M6V A;  4CCJ A;  3B78 A;  1ZG3 A;  2MH2 A;  2VQE E;  3J7A G;  3QOD A;  3CCS I;  2QQ9 A;  4JI6 I;  2X36 A;  3NAR A;  2JT1 A;  3HSE A;  3Q5F A;  1R5I D;  1W7P D;  3ZMV A;  2O6G E;  2GO4 A;  2NAZ A;  1N32 E;  2PMZ A;  4RB2 C;  1JKQ C;  4BEH B;  1VQM I;  1ETO A;  1WQ2 A;  1B72 A;  3P76 A;  2DDB A;  2V1U A;  1EV7 A;  4TV7 A;  1Z1D A;  3DKX A;  2DW4 A;  2H1K A;  4LG3 A;  2CZ9 A;  1FOY A;  4LF8 I;  2DA5 A;  2GXA A;  4M3F A;  3BG3 A;  4YEJ A;  2HHH I;  3LAJ A;  4JX6 A;  4DUZ I;  1MJB A;  3HEF A;  4AID A;  5LGT A;  4G9Y A;  1BW6 A;  5GPC A;  1YYV A;  4ZYD A;  3HUG B;  2F48 A;  3N05 A;  2VKE A;  5IY5 H;  5E20 A;  4PCQ A;  3MZH A;  2JWT A;  2FF4 A;  5IOY A;  3F0C A;  1JKO C;  5B1B H;  1Z5B A;  3NZK A;  2UU9 E;  2FOW A;  4DYQ A;  4I2O A;  3HRT A;  3R60 A;  1RNL A;  1VZ0 A;  4OAZ A;  3HOT A;  2R5Z B;  3TW6 A;  2JEA B;  3K4B A;  4LF8 E;  3J81 Z;  1H7U A;  2HGC A;  1TWH J;  4BHB A;  1JKR C;  2IOQ A;  1VF9 A;  3V8L A;  1HLV A;  3BG9 A;  3M6A A;  3CTA A;  4LK1 F;  1N33 I;  2E71 A;  2F2E A;  3ABL H;  3KIO A;  3JRB A;  4LFC E;  1FNM A;  5CQE A;  3L00 A;  1IUY A;  5J1R A;  4JI8 E;  1FJL A;  3KP5 A;  2Z5E A;  4DV7 I;  2KRH A;  4WCG A;  3CMY A;  4FW5 A;  1BJZ A;  3M9A A;  1YIO A;  1D1A A;  2M30 A;  2MLK A;  1ZR2 A;  2GO3 A;  1R7J A;  4XRF A;  1IBM I;  3K4C A;  1TWA J;  2HKO A;  3PQK A;  1U3E M;  1G3W A;  2IP2 A;  3Q9S A;  2OZU A;  3IP4 B;  3S3O A;  2H6B A;  1GDT A;  5FLX Q;  4N4O B;  2PO2 B;  3BZC A;  2ME6 A;  4BXU A;  1FYK A;  2ELK A;  3M8F A;  1W36 C;  4DNC A;  3CCV I;  4KIC A;  5JEA C;  2BXZ A;  1S72 I;  3VYR B;  5K36 E;  2QEN A;  4CSW A;  3KZI C;  1JJ8 C;  5FKO A;  5JR3 A;  1EKE A;  2KIM A;  1ZG5 A;  2VKV A;  4XNF A;  1ORK A;  3QYB A;  2DCE A;  3HOU J;  1PVE A;  1AA7 A;  1DU6 A;  3ZMS A;  3T1H I;  3QT7 A;  3GON A;  1FTZ A;  5ICE A;  1E3P A;  2ZXW H;  2A61 A;  1IBM E;  2FSW A;  1OYP A;  4M1K A;  4JX5 A;  1MMS A;  2CRG A;  3ZQL A;  4PJ0 C;  1KQ8 A;  4UB8 C;  4XLE A;  2FBH A;  1Y39 A;  5ED4 A;  2X51 A;  4RAG A;  2NNN A;  4ZJZ A;  2QBY A;  4DV4 I;  3SYT A;  2LKP A;  4EJV A;  4PDK A;  3FIW A;  3KYL A;  5GMD A;  3QYE A;  3OYH A;  2PBI A;  1BOB A;  4HPQ A;  5EZG A;  3BG5 A;  1H73 A;  5DD8 A;  1PP7 U;  2WP8 A;  1D6T A;  3CC2 I;  4YII A;  1Z6R A;  3WG7 H;  2B9S A;  3CD6 I;  3ZM7 A;  1D0Z A;  4D0P A;  1U78 A;  3CME I;  1QA6 A;  3I5U A;  2OCC H;  2OQR A;  2JRT A;  4URL A;  3K4M A;  1SVL A;  5F6F A;  4ESB A;  1FYL A;  2DI3 A;  4P9F A;  1VQK I;  1YH8 A;  2CMP A;  1FLI A;  3UHM A;  3PSI A;  3QP5 A;  1UEK A;  4C9Y A;  2K9N A;  2C6Y A;  1LEA A;  2LBF B;  2ID6 A;  4PJN A;  5M5X J;  4A6E A;  4DV4 E;  2OU2 A;  4F52 A;  4YRV A;  4U3D A;  2O8X A;  2HVQ A;  4D9J A;  2UXD E;  1GV5 A;  1D1C A;  4CCN A;  4AWX B;  5A2Q Z;  1I3A A;  2DT6 A;  2HVR A;  2HPI A;  2HEO A;  4KYW A;  3RPU D;  1LE8 A;  4PSW A;  4DZJ A;  1R6M A;  2LKS A;  3HDD A;  5LEK A;  3CCY A;  1ZXN A;  1EA6 A;  5LMN I;  4JV5 E;  1XNR I;  4UXN A;  3ZR8 X;  2Z9O A;  4ON0 A;  1JHF A;  4Z6Y A;  4HBL A;  1YX3 A;  3X2Q H;  2DQR A;  1D0Y A;  4C2U A;  4DR3 E;  2IJL A;  4PFP A;  5DS9 A;  2XF7 A;  4YFK F;  4LF9 I;  1Z0C A;  4OIN F;  1IXC A;  3LQQ A;  3BLY A;  3L2V A;  4ZVI A;  4AU7 A;  3ZZU A;  4DV3 E;  1TWG J;  2COM A;  1IXR C;  2JPB A;  1VFC A;  2IS4 A;  1U2R A;  3TGN A;  1RIO H;  4OO1 C;  2M45 A;  2DTZ A;  2V79 A;  2JQ7 A;  2IGN A;  4JYK A;  3CC4 I;  2L3D A;  3BR2 A;  2CQK A;  3GFM A;  3ZKD A;  2V9V A;  3L2C A;  3WU6 A;  3J81 C;  3MMY B;  1M1E B;  4XLC A;  1IZ1 A;  2Q8K A;  1YIT I;  1QPI A;  2CUE A;  1PJR A;  5E3M A;  3E6B A;  2F4V I;  3RQI A;  4BEH A;  4CGZ A;  5D5W B;  1BKN A;  1XMO E;  2FUG 2;  5EYR A;  1JI8 A;  1X2M A;  1VQ7 I;  2NN6 C;  2X1E A;  3RZO J;  2DFH A;  1ENH A;  3EUH C;  3E1S A;  5E3L A;  4HYE A;  3ISP A;  3DKY A;  2PNM A;  1IBL E;  1TW3 A;  2QKL B;  3KP2 A;  2NYX A;  3LAP A;  2LRD A;  4W97 A;  2A68 F;  1MDM B;  2FU4 A;  2Y48 A;  3HUG A;  3IC7 A;  1FT9 A;  3BZK A;  2NVU B;  2YX4 A;  1LVA A;  2WAF A;  3A03 A;  3ESW B;  4UUS B;  2ESN A;  4HEA 2;  4X65 I;  2EIM H;  3FK7 A;  4HAM A;  2HYG D;  2RQP A;  4DZP A;  2LYC A;  2E2I J;  5DNX A;  1FSE A;  4DYC A;  1DAR A;  4OIQ F;  4N0B A;  4RBO A;  3LQR A;  2X6O A;  5DNL A;  2XV4 S;  2R5Z A;  3FXU A;  2JEA A;  3F21 A;  2K40 A;  4F55 A;  5HS9 A;  1WZ2 A;  4FE7 A;  4BL0 B;  2PG4 A;  3E5X A;  3AG2 H;  5LLQ A;  5ICF A;  2DK8 A;  2M1B A;  1RES A;  3ZMT A;  4EEF G;  4RGU A;  4RPF A;  2J65 A;  5F1R A;  4IEJ A;  1QRY A;  3H4L A;  3ABU A;  3BC8 A;  2CW7 A;  3LSK A;  5CYV A;  1OYS A;  3TED A;  4QPO A;  3RQ4 A;  5IYD J;  2AQF A;  4DOZ A;  4B43 A;  1A6Q A;  4NXN I;  3EET A;  5FRO A;  2QEX I;  2R7T A;  1EA3 A;  2LLK A;  4LFU A;  2LK2 A;  1I6X A;  1QO0 D;  2RKH A;  1FBS A;  4X0G A;  1V5F A;  4Y3O A;  2L7M P;  3D1N I;  3DXJ F;  4BY7 J;  2O03 A;  2W25 A;  4DR6 E;  2VPL A;  4K0K I;  2ZME C;  1K4S A;  1R9T J;  3K1M A;  4OWR B;  1H0M A;  3S17 J;  4DR7 I;  2PO2 A;  3U9G A;  3DCF A;  4IHS A;  2QGU A;  3K85 A;  4LF6 I;  2QWW A;  5EG0 B;  2BOL A;  3OIO A;  2BM0 A;  1NHA A;  2CVE A;  2ZSI B;  2VJJ A;  2ZNZ A;  2ELJ A;  2XAQ A;  4Q48 A;  1DDN A;  1JKP C;  3BTJ A;  1P2F A;  3OMY A;  1K79 A;  1ETY A;  2QVO A;  4C30 A;  1T0F C;  4JI7 I;  2VC0 A;  1P7I A;  5E79 C;  2OC6 A;  1HW2 A;  4B8X A;  2HVS A;  1XG1 A;  1PYV A;  3F9K A;  2Z33 A;  3SZT A;  1RR9 A;  2EFP A;  4R79 A;  4UUV A;  3BR5 A;  2E36 A;  5K5O A;  1N34 E;  2W85 A;  5B66 C;  1JUS A;  5LMU I;  4L5J A;  1HXD A;  1QZE A;  1G8X A;  1B63 A;  4MFD A;  2F4M B;  1PIE A;  1HBX G;  2VON A;  2WB1 A;  4E7K A;  1S7O A;  1X1B A;  4S04 A;  1BA5 A;  3P3G A;  2L5Q A;  2DA1 A;  4MQV A;  2R7D A;  1U6G A;  3ECH A;  1SFK A;  4IZJ B;  2UUB I;  1TQP A;  4GRI A;  1FP1 D;  2IGK A;  2HK3 A;  2Z5B B;  2HDW A;  3PYG A;  1MNE A;  1N75 A;  4YHH I;  2L4M A;  1UDN A;  2CG4 A;  1Z0X A;  2ISY A;  5IYB J;  4OX9 I;  1YW8 A;  2UUC I;  3RPU A;  1T2K A;  1FEX A;  3OTO I;  3CUO A;  2LFB A;  4MO7 A;  1FZP B;  4IZJ D;  1A31 A;  3KYC B;  2HPM A;  2HYJ A;  2O8K A;  4BBS J;  1QHH D;  4ZZL A;  5J8F A;  4DUY I;  1WFX A;  2OA4 A;  1JHH A;  2LBF A;  2A2C A;  3ZKB A;  4BH9 A;  5E1X A;  4KN4 X;  3K70 C;  2BY1 A;  2VN2 A;  3Q9V A;  2EIL H;  3OYE A;  2UUB E;  4DU7 A;  1MBH A;  1X4P A;  4LFA I;  4EJO A;  2FX0 A;  4DYR A;  1O57 A;  3D0S A;  2L01 A;  3P3E A;  2VJ4 A;  3B6A A;  5KK1 A;  4BHC A;  4ESF A;  2QSG X;  2MGQ A;  5BR8 E;  3OYJ A;  4ZC3 A;  2IXS A;  4ZDL A;  1ZR4 A;  2OCE A;  3EUA A;  1BR1 A;  2C37 B;  4NQW B;  2CGE A;  1H7S A;  3TBI A;  3RI4 A;  3DPT A;  1XS9 A;  3BG7 A;  1MW7 A;  3F8C A;  3G1O A;  4YEL A;  3WU4 A;  3J81 Q;  4I0B A;  1KGS A;  4MEY F;  3Q0U A;  2PO0 B;  3TKY A;  4CO8 A;  4QPQ A;  3SZP A;  1RUO A;  4GCV A;  2UXC I;  4X64 E;  2BBY A;  3OL4 A;  1TLH B;  5JEA B;  3WTS C;  3GVA A;  4N4N B;  4DR4 E;  2CO5 A;  2BVL A;  1ODD A;  3GX4 X;  1YJ9 I;  1BJA A;  1FIA A;  2EZI A;  2P5V A;  2W4S A;  4XON A;  2RNG A;  4W1U A;  3Q1Q A;  3K2Z A;  3VOE A;  2O1T A;  4KQV A;  2HQ5 A;  1XCB A;  3A0B C;  4L9N A;  3LNQ A;  1R71 A;  1UFM A;  1BR4 A;  1IG7 A;  1W36 D;  4BJT A;  1FOK A;  3OIP A;  3K4N A;  3TOB A;  5JEA D;  3D5L A;  3RCO A;  4WF2 A;  2GAU A;  1RZ4 A;  4E6K G;  4DPY A;  2L7K A;  2JRM A;  4B3R E;  2LRE A;  2WAQ A;  4UUT A;  3F23 A;  1MDM A;  4M72 A;  5LGN A;  4LIV A;  1LVK A;  3I56 I;  4XKV A;  2BHZ A;  2VKH A;  2Y0S A;  3JTH A;  4G7Z F;  4UUS A;  3J7A Y;  1BI1 A;  4PUS A;  1VQ5 I;  1Z91 A;  1UHW A;  2XAJ A;  5F0C A;  5HS8 A;  2M9H A;  3C7J A;  2QM3 A;  2BY0 A;  1L0O C;  3DU5 A;  1ACI A;  4KIG A;  5KAI C;  2KIS A;  3UNG C;  2EFO A;  2G7H A;  4DBQ A;  1LFB A;  1VQN I;  2VJ5 A;  3WU1 B;  2M7A A;  2C39 B;  3Q0V A;  5E3N A;  4LF7 E;  2JN6 A;  4XKB A;  1EH8 A;  3KP7 A;  3T5X A;  4BAY A;  2UUA E;  4HDV A;  2E1N A;  3P5J A;  3Q3S A;  3ZQH A;  3ZN1 A;  3OYG A;  2DMU A;  5FGM A;  4BNC A;  3O8G A;  4PSX A;  5J3L A;  1ZRF A;  5L3G A;  2DEI A;  4I0A A;  5FD6 A;  5GAG J;  3HKM A;  3U1Y A;  4MLO A;  4EGZ A;  1S16 A;  4XTJ A;  4IRI A;  2R93 J;  3CJT B;  5BOX A;  4LF5 I;  3UKG A;  2LY9 A;  2E5L E;  5KVR A;  3HKZ N;  4M9S A;  5HLT A;  2XIG A;  3HHG A;  1E0E A;  3DU6 A;  3MKZ A;  4EMD A;  1MBE A;  2A6T A;  2V9P A;  3FXM A;  4BUP A;  4FW6 A;  1J75 A;  3JAM K;  2O3F A;  2R7R A;  5FFX A;  2GA1 A;  3QYF A;  1ETW A;  3GFI A;  4B3S I;  1Y0N A;  4XQF A;  3GYH X;  5A2Q Q;  5IWA E;  2OQG A;  4PRX A;  5FJ8 J;  2R3S A;  3KZY A;  2KIQ A;  1VQ9 I;  4P96 A;  2M5W A;  3BG6 A;  3TDZ C;  1BW5 A;  4KMU X;  2RN7 A;  3OIQ A;  1DQU A;  2NN6 B;  4M74 A;  2BY2 A;  1HNW I;  4OO1 D;  4RM3 A;  3J7Y J;  1Z7U A;  3PNV A;  5E18 F;  4DPU A;  5IT9 K;  2EPF A;  3L2U A;  1UEL B;  4ZTJ A;  1DU0 A;  4FAS D;  4IOC F;  4IZJ A;  4OKG A;  1KYW A;  1W1W E;  1W5C C;  3NRV A;  3RDI A;  4IOA F;  1J5Y A;  2AE8 A;  4M9Z A;  4XR6 A;  2Z5B A;  1UHM A;  4HF1 A;  2VQH A;  2J7K A;  2NN6 D;  2DJI A;  1XDS A;  2HOS A;  3CJN A;  4L5E A;  2HKE A;  5DD4 A;  2UUZ A;  2B7E A;  2CGP A;  2YUS A;  1OQY A;  1W5T A;  4WUC A;  4Z7C A;  3OYA A;  2VE8 A;  4I01 A;  3PQJ A;  3ERE D;  1Y1W J;  3JRI A;  1KU9 A;  4GKK I;  4XOT A;  2MW8 A;  3T1B A;  4HF2 A;  1NHJ A;  3CO7 C;  1OYR A;  5CPR B;  2F5V A;  2QLZ A;  3PRY A;  4I76 A;  3NWS A;  4GDF A;  2ADU A;  3CDI A;  2V4J C;  4B09 A;  4DBR A;  3PNT A;  1OJ4 A;  2FBI A;  3BQY A;  3IH2 A;  2QQ8 A;  2DJN A;  4R8H A;  4KNY A;  1AHD P;  1E17 A;  3E5U A;  1G3S A;  4DXL A;  3J80 Z;  2H09 A;  1T95 A;  2IAI A;  2WAD A;  3A1Y A;  4MIM A;  1A35 A;  2C37 A;  1ERD A;  4GXO A;  4NQW A;  2BEO A;  2FML A;  5HNF A;  2MA3 A;  1IBK I;  4LJZ F;  2ZME B;  1O7F A;  2HWV A;  4GKK E;  4I09 A;  5CVU A;  1J2X A;  1WI3 A;  3E6D A;  5IOZ A;  2PO0 A;  4ZZD A;  2NPF A;  5M3M J;  4BJ5 C;  3BTI A;  4KJZ A;  1X58 A;  4MQ9 F;  1D5Y A;  5JEA A;  3OYC A;  4KIF A;  4EGY A;  4M3G A;  5HLG A;  1Q1V A;  2ZSH B;  2VT3 A;  2A2D A;  1GVD A;  1IO2 A;  2DOF A;  2L7Z A;  2V1N A;  4ZH4 F;  1J5E I;  3KLO A;  2PFB A;  1SAX A;  1USU A;  5GPA A;  3K0L A;  4DV0 I;  1I1G A;  2E2H J;  3KET A;  4IHY A;  2HQA A;  1IDZ A;  4LIU A;  2PNZ A;  1U5T B;  2CFX A;  2PI0 A;  5E8G A;  1P42 A;  4WK8 F;  2FD5 A;  2LMD A;  2LSO A;  2VQF E;  1B4A A;  4A0X A;  3T1Y I;  4FT8 A;  4UVB A;  4U0Y A;  1T39 A;  1GXQ A;  4C3H J;  4U7D A;  1Z0T A;  4M9X A;  1YLF A;  2GLO A;  4JI5 E;  1TWF J;  5HOD A;  2CJJ A;  4LMY A;  3PL8 A;  2EA2 A;  2IPQ X;  1Y56 A;  1UDS A;  4JI1 I;  2HKX A;  3BZ6 A;  4AYB A;  2VUM J;  4X66 E;  4JI2 I;  2ELH A;  5FFZ A;  4RAZ A;  2V1X A;  3DEE A;  1O3S A;  2JZY A;  3OWT A;  4AQY E;  1FNN A;  3I55 I;  4OO1 E;  2K9Q A;  2YX7 A;  3M85 D;  1G2H A;  4PGH A;  4DV0 E;  2C39 A;  3CF2 A;  2WTE A;  1B9M A;  2ECC A;  3W6K B;  4ZYH A;  1SD5 A;  1BI2 A;  4L5I A;  4DV2 I;  3ZCO A;  2XGD A;  2GXB A;  4GKJ E;  3T1Y E;  4PK4 A;  1DGW Y;  1SVO A;  2L4A A;  5E1W A;  5ILU A;  2JA5 J;  4CCM A;  2CG9 A;  2R7U A;  2ZCW A;  4O6J A;  2DMP A;  1ZLK A;  2BHY A;  1Y6Z A;  1S7A A;  5J8C A;  3AG4 H;  3WE2 A;  3FMR A;  2W24 A;  5D4S A;  2X9D A;  4E7S A;  2WC2 A;  3VEP A;  1XPX A;  1C0W A;  1VI0 A;  1H9G A;  2PJP A;  3HOZ J;  2JE6 B;  3K1P A;  1QPM A;  3HM5 A;  2VQE I;  2GWR A;  2RV8 A;  3MWM A;  1J0R A;  2CUJ A;  3PIP F;  1AWC A;  4D7N A;  4BQN A;  3K70 D;  3CCL I;  3ZN0 A;  3TOA A;  2EZK A;  3K69 A;  3WGG A;  1FSH A;  4HYM A;  2OTL I;  2J5O A;  1EH7 A;  1R1V A;  3F72 A;  3I0T A;  3ZXS A;  2BVM A;  3K10 A;  1Y8R B;  3HPH A;  3TO6 A;  2PMH A;  4AD9 A;  4OO1 A;  4YY3 E;  3KX2 A;  5IT3 A;  2X7I A;  1NG6 A;  3F22 A;  1P9Q C;  3W3C A;  4BQO A;  3FXK A;  3MKY B;  3TDU C;  1NHI A;  4UVA A;  1ZRD A;  2UXB E;  3WTT C;  5J4Y A;  2ZXI A;  2H27 A;  4J00 A;  4NC7 A;  2NVT J;  2Z5U A;  3SDB A;  2UV1 A;  1MJA A;  5ILV A;  2NN6 A;  2YU3 A;  2M8E A;  2JT2 A;  3L2Q A;  3A0H C;  3EUH A;  1FMV A;  1MBJ A;  4XKW A;  4EM0 B;  2KMU A;  4BY1 J;  2UU9 I;  3B6C A;  1HR0 I;  2Y31 A;  4CXF A;  4FW3 A;  1V5E A;  4JBA A;  3EYI A;  3CCM I;  4A5N A;  5KNL A;  4X62 E;  4MU1 A;  4BU2 A;  2MD0 A;  3P9I A;  1S9H A;  2IGM A;  3DBH B;  3KP3 A;  3RTR A;  4AIH A;  5JHF A;  2E7W A;  2E5N A;  2ZKZ A;  2E1R A;  1GLN A;  1WRJ A;  1P4W A;  1V5G A;  4B1R A;  1FPQ A;  5LGU A;  2R3V A;  2G0E A;  3WHB A;  2E1M B;  4LFC I;  3I59 B;  2VOO A;  3WU5 A;  2RNJ A;  4JI8 I;  4IHV A;  5IP6 A;  1JGG A;  3J81 K;  5IP7 J;  4R1H A;  1R4N B;  2ZFU A;  2XAS A;  1XGN A;  1HR0 E;  1MIJ A;  1QZR A;  3L1P A;  1FYM A;  2EV6 A;  2VOD A;  3GTP J;  4G94 A;  1KZH A;  2HU9 A;  3RSN A;  4BKX A;  4IZZ A;  3OR2 C;  3D5R C;  2EV5 A;  2H94 A;  3LOC A;  1GUU A;  2QZ8 A;  3JRG A;  4OAY A;  1MU5 A;  2GIZ A;  4O5V A;  1H8A C;  2JVG A;  4WXH A;  1VQL I;  2CYY A;  2IS1 A;  5ERI A;  2DYR H;  3F8F A;  3M85 G;  2L9N A;  5JI6 A;  4BDY A;  3GFL A;  3G2B A;  3I4N J;  2FNA A;  4YFN F;  1X19 A;  5LD2 C;  3IWZ A;  2YU9 J;  3F6O A;  2X4H A;  2UXN A;  3TO9 A;  5D5V B;  3FMS A;  4LF4 E;  5FKK A;  3DPU A;  3RPQ A;  3OS2 A;  2ZME A;  1HA8 A;  3Q0W A;  3FXJ A;  5D6F A;  4ZTF A;  5D4R A;  5K7F A;  2IA0 A;  1QBJ A;  1U9N A;  3BWG A;  1MMN A;  2CW0 F;  3FXL A;  1N77 A;  2CQQ A;  3K2A A;  1T0F A;  3I71 A;  1VTN C;  3K17 A;  1IDY A;  4G8X A;  4CIC A;  1AKH B;  4BE0 A;  2WV0 A;  5BS6 A;  1HW5 A;  5EEH A;  2GQQ A;  3REO A;  5LFA A;  5H2F C;  2H1L A;  1UG2 A;  3RKY A;  3VB2 A;  1OYI A;  1T56 A;  2CV2 A;  4DV6 E;  3P9K A;  1D8J A;  4YFX F;  2V26 A;  1MG7 A;  2KZG A;  1FKA E;  1EJ9 A;  2DA3 A;  4MQY A;  1OCR H;  2STT A;  2X6Y A;  4RS8 A;  3FXR A;  1BC7 C;  3KEQ A;  5FKM A;  4NC6 A;  2GA2 A;  4H4K C;  4MGR A;  3HGY A;  2GZW A;  4XLA A;  2WB1 N;  5TGT A;  4IFD C;  2ZO4 A;  1X1D A;  3HHH A;  4XIC A;  1UDQ A;  3CMM A;  2B0L A;  3GTQ J;  1V54 H;  4EVI A;  1WSU A;  2BA0 D;  3VYU B;  2HFU A;  2MD5 A;  4BE2 A;  2UXD I;  1S6L A;  3KFW X;  3MZY A;  3LTO A;  6PAX A;  3OL3 A;  4JQF A;  2XAH A;  2RVC A;  4C2M J;  1YHC A;  1YS7 A;  2DQL A;  4NUB A;  1LB2 A;  2NVY J;  4WXD A;  3ULQ B;  3QPS A;  2F1D A;  4JV5 I;  2IS6 A;  3DD6 A;  2XDV A;  1FWK A;  3TQN A;  3H5R A;  1YJN I;  4AVP A;  4DR3 I;  1ZGJ A;  1LFP A;  4M3D A;  2LNB A;  2O7O A;  3BP8 A;  3KCC A;  3S3N A;  3LWF A;  5DUK A;  1YJW I;  3O3K A;  4QWQ A;  5CVI A;  2JE6 A;  3G73 A;  1I50 J;  1LDD A;  1MH3 A;  3BDD A;  4FCY A;  4DV3 I;  4JI0 E;  4G7H F;  5C4X J;  3A01 B;  1PP8 F;  3LA7 A;  3A2K A;  4AUX A;  1E3O C;  2MSY A;  2M2E A;  1V4R A;  1CGP A;  4UV9 A;  5EZH A;  5EEG A;  3PJR A;  2MFZ A;  3ONQ A;  1HOM A;  2FQ4 A;  3V8J A;  1KTV A;  1ELO A;  4B3X A;  1RPW A;  1S7E A;  1Z05 A;  3F8N A;  4A5M A;  2R42 A;  1D5V A;  2X1D A;  3S2H J;  2DLL A;  2R7Q A;  2CUF A;  2TDX A;  2ZJR F;  1XMO I;  3VDX A;  1FMW A;  3C1D A;  3IL2 A;  2LY2 A;  1OPC A;  2XKP A;  3WU0 A;  1IV6 A;  4Q5S F;  2CV1 A;  3PS1 A;  1IBL I;  2EIN H;  1EI1 A;  2LOO A;  4I6Z A;  3DF8 A;  1QVU A;  3ZMZ A;  3L9F A;  3JSO A;  1FBU A;  2EV0 A;  1WGX A;  1Z3X A;  3IAM 2;  4WXC A;  4CYD A;  4F91 B;  3GW2 A;  5B1A H;  2XC7 A;  2Z5C B;  2VL8 A;  3SXY A;  5DRR A;  1FIP A;  3ZQ7 A;  4A3C J;  5JEA F;  4XSX F;  4N9I A;  4II2 A;  5DUI A;  3J80 Q;  3BOQ A;  5F1J A;  2XB5 A;  3PS3 A;  2E7X A;  3S2W A;  2HFH A;  5C0X C;  3GEZ A;  1B59 A;  4XOP A;  3T8T A;  5LHG A;  4I3H A;  1REP C;  4HNU A;  2AHQ A;  2JK3 A;  4E7I A;  3GTL J;  3QAH A;  1E2X A;  4BGD A;  1OCP A;  4J19 A;  1MND A;  2FOK A;  4FN5 A;  4FQG A;  2VI6 A;  1Z5A A;  4A3D J;  4L0Y B;  4MYT A;  2FRH A;  3I59 A;  4JI4 I;  4FWG A;  1QVT A;  2ZJP F;  2IVM A;  2R7S A;  3DTE A;  4FHT A;  1ZHF A;  1TBX A;  1UZC A;  4BXF A;  3OYD A;  4MU0 A;  3W6J B;  5KCM A;  1TT5 B;  2EB7 A;  1LDJ A;  4G12 A;  4AC0 A;  4RDU A;  3EQL F;  3KPH A;  3GUD A;  4U88 A;  3IV5 A;  5E3O A;  4ABZ A;  1UMQ A;  1YW9 A;  3DLL F;  3ZRG A;  3L7W A;  4F7Z A;  4DR6 I;  3I58 A;  3OS0 A;  1RR8 C;  3S1M J;  2BA0 G;  2P4W A;  5JLW A;  4OOI A;  2GOM A;  5CVV A;  1JT6 A;  4QNJ A;  5CKT A;  3BCA A;  4P52 A;  2EA4 A;  3RKQ A;  4JI4 E;  1MD0 A;  5IP9 J;  4HV6 A;  3CLO A;  5EEA A;  3CO6 C;  4N9H A;  1XXE A;  4BQA A;  2VQC A;  5L3D A;  2DOD A;  1ZXM A;  1LKX A;  3HJC A;  3I53 A;  4EJU A;  4RGX A;  4FE4 A;  2LF7 A;  2D45 A;  3T8R A;  5DTD A;  1N34 I;  2A6E F;  1KKH A;  4OZE A;  1I39 A;  1WH7 A;  3KYD B;  5AIQ A;  1AKH A;  2JSP A;  1QZY A;  2KJC A;  3WOD F;  2M0C A;  3DFG A;  1Z5C A;  3BY6 A;  1X1C A;  4XOR A;  4J01 A;  1NZ0 A;  4ZYE A;  4MU3 A;  3S1R J;  5EGO B;  4OO1 F;  3JRH A;  4IX7 A;  2K5C A;  2XRO A;  2OF7 A;  1N78 A;  1FWZ A;  3GLL A;  2CSO A;  4OIR F;  1XMA A;  1FJG E;  5GME A;  3BR1 A;  1HQC A;  1HSJ A;  2NOG A;  3CCR I;  3DPL C;  3S93 A;  2RDP A;  1HDP A;  2NVX J;  1U5T C;  1XMQ E;  3H35 A;  5A2Q C;  2NN6 F;  2UXX A;  9ANT A;  2IS2 A;  4I98 B;  1GV2 A;  2WAE A;  1ETX A;  2BA1 G;  1NHH A;  4A3E J;  1R1U A;  3O6B B;  2XRL A;  3LSG A;  4IQ4 A;  1Y8Q B;  1WVR A;  3ELK A;  2QQB A;  2FQ3 A;  3PYE A;  3S2D J;  1ZG1 A;  2XUB A;  1IAW A;  1SD7 A;  2PLY A;  2NS0 A;  4A69 C;  4BXX J;  3JW4 A;  1SFU A;  4JI3 E;  2PMU A;  1U8R A;  1X1P A;  2NOJ B;  2YS9 A;  1N36 E;  2V2Q A;  2OPT A;  4KT6 A;  2K4B A;  4P5O A;  1IUF A;  4U7B A;  1JTY A;  5BR8 I;  2K9M A;  5D5U B;  4EJW A;  2JEB B;  1SEU A;  3WE3 A;  4M3E A;  1FP2 A;  4P7A A;  4F92 B;  5DM7 F;  2B63 J;  2BW3 B;  3A01 A;  3LNU A;  3GTJ J;  5AON A;  3HGG A;  2R7W A;  3TL4 X;  5EF6 A;  1QQI A;  2D5V A;  3WGH A;  2W00 A;  2HNH A;  2FMY A;  2RRE A;  4X64 I;  4RM2 A;  3GZ6 A;  1MSF C;  4HZF A;  4DR4 I;  2QSF X;  3QT5 A;  2MH9 A;  2NS8 A;  1SAN A;  2V9K A;  1RC9 A;  4NC8 A;  2FA5 A;  3RKW A;  3DV8 A;  1PUE E;  2K27 A;  1FX7 A;  2P7C B;  5M5W J;  2LDU A;  2A5W A;  3L09 A;  2PEX A;  5DRQ A;  2GM4 A;  2TRT A;  4CH7 A;  1O3T A;  1XCV A;  1L3L A;  3NQO A;  5B3S H;  1IN5 A;  2XGC A;  2Y9Y A;  4USM A;  3OYI A;  4B3R I;  2AXL A;  2K9L A;  4HF0 A;  5DDG A;  4MTE A;  1K6O A;  5BQT A;  2Z5C A;  3PSF A;  5J1U A;  4FW9 A;  4PRV A;  1UB9 A;  1K61 A;  4A93 J;  4V2G A;  5K36 C;  3PFI A;  2DMQ A;  4LOC A;  3R4K A;  4L9T A;  1YTY A;  3OSF A;  3DBR B;  4M6Y A;  1A5J A;  4A6D A;  4O3M A;  4A3B J;  4KHP E;  4CCL A;  2MAB A;  1TZL A;  4KT5 C;  3MEX A;  3ZOB A;  4C3J J;  4EAT A;  2O1V A;  4LF7 I;  4B4C A;  5DCF A;  3QOE A;  1MZB A;  2UUA I;  2DN0 A;  3G3Z A;  3OY9 A;  1SFX A;  4IFD B;  2V6C A;  5JFR A;  2HTJ A;  4RB3 C;  4AYB N;  1WI9 A;  4RMN A;  1ULY A;  4I7H A;  4JX4 A;  2LVS A;  4B3T E;  2DYS H;  5K5R A;  2BM1 A;  4IRH A;  5KHD A;  4Y33 A;  3IUO A;  1F5T A;  3ECO A;  4IFD D;  2VXZ A;  2E1M C;  2BV3 A;  2L54 A;  1YX5 A;  3BJA A;  4CUG A;  2QA4 I;  1HNX E;  2E5L I;  1FTT A;  2KDO A;  1Z9C A;  5TIS C;  2C38 B;  2H8W A;  1B1B A;  1R6R A;  2OAZ A;  5FLX K;  4LLN A;  1Y5Y A;  2M4G A;  3C3W A;  2LP0 A;  1I94 E;  1IJW C;  2MYS A;  4DPT A;  1QZZ A;  1Z6T A;  1HKS A;  3DTI A;  4B44 A;  4BA2 B;  4IO9 F;  5DEQ A;  2FE3 A;  2R4G A;  2RAE A;  1W0T A;  2QUF A;  2HFS A;  1S3J A;  4IXA A;  2L7F P;  3ZQQ A;  1JXS A;  3CUQ B;  5IWA I;  4H0E A;  3GZ5 A;  3JRA A;  2NXN B;  1HST A;  4GQU A;  3BR6 A;  2BZT A;  2E1O A;  4JYA E;  4A3K J;  2HZT A;  2QYO A;  5CLS A;  2OTJ I;  4ESJ A;  2VQL A;  3O8H A;  1P92 A;  4KIB A;  2VBY A;  2R5Y B;  1Z59 A;  3G1L A;  2M34 A;  3DP7 A;  2WW4 A;  1FWL A;  1VQ4 I;  3E97 A;  2IGO A;  3VFZ A;  2DPD A;  1MBG A;  4GGG A;  1RR7 A;  1WJD A;  5EG0 A;  1YW7 A;  3KLN A;  2LD5 A;  2ZC2 A;  2HS5 A;  4XLF A;  4USK A;  5EGO A;  1Z3Y A;  2M0M A;  2LTP A;  2XB0 X;  2DDA A;  5IYC J;  1HCR A;  5FD5 A;  2WWY A;  3I4P A;  1WKM A;  2KRC A;  1U0J A;  3KEO A;  1PDN C;  4KFC A;  2WY8 Q;  3AL0 C;  3HOW J;  2MC3 A;  3PFY A;  3KZZ A;  5C0X B;  1I3Q J;  5F27 A;  1UAA A;  3P9C A;  2ZBK B;  2O3Z A;  2Y9Z A;  2EK5 A;  1S8N A;  2PMZ N;  2XPV A;  3KRN A;  2ETH A;  2CW8 A;  4IZK B;  3E7L A;  5K7H A;  4D1Q A;  4C2T A;  3FF5 A;  1Z77 A;  3ZQG A;  5HDK A;  2KP6 A;  2XF5 A;  4BQQ A;  5J47 A;  3ZGK A;  3K1N A;  4EJT A;  1IRF A;  4ENJ A;  1BL0 A;  3HJE A;  1K83 J;  4AVZ A;  2IA1 A;  3JAM Z;  2K85 A;  5KAF C;  2I5U A;  2KLO A;  4E7H A;  1ZH5 A;  2LH9 A;  2ZM6 E;  1XTA A;  3I64 A;  5CVR A;  4XN0 A;  4XBF A;  1HDD C;  1EF4 A;  4HXZ A;  1OCO H;  2VQG A;  5JEA E;  1LUJ B;  3CCE I;  4IKF A;  4M73 A;  3SZG A;  1RRE A;  1D3Y A;  2FJ1 A;  5E8I A;  2VC1 A;  1GXP A;  2BW3 A;  3CWV A;  4CA0 A;  4E4H A;  4RLQ A;  4LB6 B;  4QLC U;  3F6V A;  1BBY A;  3HTS B;  2PNL A;  2O61 A;  2EQR A;  1WJA A;  1OCC H;  3AAF A;  3CJQ B;  3H3Z A;  5HLH A;  2P6T A;  5IT9 Z;  2DU9 A;  4AIM A;  1YG2 A;  2XAF A;  5DYM A;  4YG2 F;  3OV8 A;  1H9T A;  3HL2 A;  3ZPL A;  3H5A A;  4IHT A;  2IES A;  3RJP A;  5JVT A;  1YO5 C;  3JSP A;  3HYI A;  1V3F A;  2ZB9 A;  4MTD A;  5EL9 A;  2K86 A;  3BJO A;  4ZDP A;  3M07 A;  5HNH A;  1ETK A;  2V6E A;  2VLA A;  2DA2 A;  2VQF I;  1BIA A;  1HKQ A;  2D2W A;  4XM3 A;  4RAY A;  2XPU A;  4A0Z A;  3TP0 A;  2AJ4 A;  4IPA A;  2X85 A;  3HTU A;  4ITV A;  4L9V A;  3FM3 A;  4A12 A;  2IRF G;  3MZ8 A;  4JI5 I;  4Y4R A;  1VND A;  2WV1 A;  1Z0W A;  1V55 H;  4X66 I;  3MAJ A;  2V2Z A;  1ZGW A;  1VQ8 I;  3VPR A;  1G3Y A;  2F5F A;  3EPZ A;  4Y52 J;  1U2W A;  4DPX A;  4AQY I;  4JK1 X;  2COB A;  3RYP A;  3HOS A;  1B62 A;  4P9U A;  5C4J J;  1IV8 A;  2W57 A;  4LCG A;  2KIU A;  1R1T A;  2P5K A;  1NH3 A;  4LIT A;  1USS A;  1NK3 P;  4B47 A;  2R92 J;  3ABM H;  3V42 A;  3QP6 A;  4IFD A;  4GKJ I;  1WH5 A;  2EFW A;  2DO7 A;  2I8D A;  3PM1 A;  2P81 A;  2O9L A;  4KUM A;  4RLF A;  3OYF A;  2NNY A;  1J59 A;  2HKJ A;  2RC4 A;  2GXG A;  1G4D A;  3SJM A;  3GTO J;  1A36 A;  2WNR B;  1JGS A;  5F04 A;  4AIK A;  4HX4 A;  3A4C A;  4AM3 A;  2K3P A;  4LLG F;  4RGR A;  3S3M A;  4HNT A;  4XLN F;  2HYF A;  1GHC A;  2QQA A;  1IRG A;  3ZZ0 A;  2HDD A;  4FX4 A;  4DR2 E;  1DP7 P;  3K7A J;  5ICC A;  3HRS A;  2JMW A;  1NG7 A;  4MDT A;  4Y15 A;  5HS7 A;  1LNW A;  1OR7 A;  2E19 A;  3HZJ A;  4BA2 A;  2NN6 E;  3H3U A;  1XNQ I;  1RKT A;  3CP8 A;  2K9S A;  2ECB A;  2MG4 A;  1ZEL A;  3KEY A;  2DEJ A;  2D1H A;  3BRO A;  3W2W A;  3U1K A;  4YY3 I;  4DQ2 A;  1FOX A;  1APL C;  3CUQ A;  2A6H F;  3HSF A;  3PYF A;  4EQQ A;  2UXB I;  4DU8 A;  3ZQC A;  2R7Z J;  2P7V B;  4B48 A;  4UHT A;  4D7M A;  1B8I B;  4P55 A;  2R5Y A;  2V7F A;  1K6Y A;  3M7G A;  2DK5 A;  2KL4 A;  5K5Q A;  4R1F A;  5ELW A;  1SAU A;  1JTX A;  4QIW N;  5JVG F;  4LFB E;  3LSI A;  2EBI A;  5DCM B;  3QT6 A;  4DR1 E;  3SFZ A;  1Y4U A;  3JAM C;  4LCF A;  1JJ6 C;  3TO7 A;  1I1S A;  1YOV B;  1XNQ E;  2PO1 B;  3D5S C;  4E7J A;  3PIO F;  2EJR A;  1Z0V A;  3CJR B;  4X62 I;  4KMF A;  5K36 B;  3GZN B;  2BA1 D;  5FKL A;  1DP3 A;  2F4O B;  3HSR A;  1W4M A;  3ZMD A;  2M3A A;  4FTH A;  4PZJ A;  4B3M E;  5C0X A;  2M4K A;  2IOP A;  4MU4 A;  3DEU A;  4OMY A;  1I27 A;  2ZBK A;  2OJE D;  1A6I A;  2R7V A;  1F9N A;  3LMM A;  2GIV A;  2VES A;  4DV1 E;  1A04 A;  2OZ6 A;  4IZK A;  2O5R A;  3VSK A;  3JR9 A;  4PJJ A;  3BPX A;  1T38 A;  4Y17 A;  1TNT A;  1XSD A;  2Y69 H;  3BTL A;  2DXI A;  1W7P B;  2CQ7 A;  2ME0 A;  4DR5 E;  3GWZ A;  3V4G A;  2O1U A;  3KP4 A;  3J80 C;  2X1C A;  3OOU A;  3SQN A;  4XID A;  1TT0 A;  1ONV A;  2HQR A;  3JRC A;  2EFG A;  1H74 A;  2CS3 A;  1G6N A;  3FX3 A;  1IW7 F;  2R7O A;  1K78 B;  1Z67 A;  2EIK H;  2L9R A;  3NAU A;  4A0Y A;  1MMG A;  2BYV E;  2UWM A;  1D1B A;  1USV A;  4DV5 E;  3FXO A;  3FXQ A;  1VI7 A;  4LF4 I;  2CUZ A;  1H89 C;  1XGO A;  2EWN A;  5H20 A;  3IH4 A;  4HQM A;  5EDN A;  2Z2S B;  2P5L C;  1G59 A;  1VQ6 I;  2VAS A;  2Y30 A;  2X0L A;  4V2F A;  4B3A A;  4UB6 C;  1TC3 C;  2XKO A;  3LFK A;  3WTU C;  1E3H A;  4RB1 A;  3H0D A;  1X3W B;  3F8B A;  3T0Y A;  3LPS A;  1YIJ I;  2P0W A;  3C2G A;  3FM5 A;  3PO3 J;  4MEX F;  3MCZ A;  4JI6 E;  3MN2 A;  2LKX A;  1WPK A;  5D6E A;  2VJI A;  1JUM A;  2W1O A;  3E5Q A;  4DV6 I;  3I54 A;  1T8I A;  3HOX J;  3CC7 I;  3QU6 A;  3CES A;  1B9N A;  2HTS A;  3CDL A;  3JRE A;  1ZRE A;  1MMD A;  3ZP5 A;  1T33 A;  1QHG A;  4IQJ A;  2HXI A;  1YFH A;  1MBK A;  1MSE C;  3QT8 A;  4E7Z A;  2HHH E;  1SFE A;  2IA2 A;  5D8K B;  2XGX A;  4DUZ E;  3B4T A;  1ZKG A;  3OS1 A;  3K4J A;  3ABT A;  2J5P A;  4JG4 A;  1CQT A;  4U3B A;  1R6L A;  4ENN A;  5LHI A;  2X6W A;  1MNM C;  1RUN A;  3AL0 B;  3FIS A;  4JOM A;  2N8G A;  1NTC A;  2ZFW A;  3LST A;  1U5T A;  3AG3 H;  4ED4 A;  1ZAR A;  2EFQ A;  3G1M A;  3VOD A;  2K7L A;  3QPT A;  3DWL E;  3FBI B;  3QPH A;  5DM6 F;  5GTI C;  3U1D A;  3ZQF A;  3QU3 A;  4KDP A;  2OI2 A;  2H8R A;  5J40 A;  2EFN A;  4RGS A;  3G4S I;  1OYW A;  3LSP A;  2O0Y A;  3M7N D;  3E6M A;  2R7X A;  2WNR A;  2CFO A;  2Y75 A;  3JCU C;  4LK0 F;  1OCZ H;  3M1C A;  4YIF A;  1KU7 A;  4CHU A;  1N33 E;  4JI0 I;  4A3G J;  1TL8 A;  4XLP F;  1IRX A;  3CCJ I;  2IER A;  1J7K A;  2NVQ J;  1I5Z A;  4DV7 E;  1I6H J;  3B8H A;  2JA6 J;  3VYS B;  1F1Z A;  4ZDO A;  3L7Z B;  1SD6 A;  1X3Z B;  3IH3 A;  1UJ8 A;  2JA2 A;  1FY7 A;  3GCM A;  4Y13 A;  3B73 A;  1RHY A;  4QSH A;  3J7A O;  5L3J A;  1JUP A;  5GAH J;  4MFE A;  5A2Q K;  1ZQ3 P;  1HC8 A;  1WHU A;  1B6A A;  3PNY A;  1OIS A;  4PJL A;  3O2P E;  2VKD A;  1WJB A;  3ZQI A;  2O1W A;  3H92 A;  5DV5 A;  2PQ8 A;  2ISZ A;  3QPL A;  1LJ9 A;  1OR7 C;  5J4V A;  3JAM Q;  1Z21 A;  3HC7 A;  1WCM J;  4RAF A;  1B8I A;  2V34 A;  1IF1 A;  4U0V A;  1RET A;  1Q1H A;  1R5G A;  1NK2 P;  3S15 J;  4Z2Y A;  1U9O A;  4IL6 C;  3CUQ C;  5DCM A;  1BR2 A;  1S4E A;  2XGE A;  1LEB A;  1BN5 A;  1XB4 A;  2VB6 A;  3T1H E;  1Y4S A;  5JHU A;  2EZH A;  5F0H A;  2LJP A;  1SMY F;  2DA4 A;  1ZM4 A;  2PO1 A;  4AIJ A;  2W84 A;  3CQZ J;  3H0G J;  4I02 A;  3H9Q A;  3M3Y J;  5K36 A;  3LSR A;  2D1V A;  2EZL A;  3L2W A;  1FBQ A;  3A02 A;  3HRU A;  3PUB A;  1JE8 A;  5IT9 Q;  5FLM J;  3FWE A;  5FRN A;  2QKM B;  1P7J A;  2MLG A;  4HLX A;  4HV5 A;  1OLT A;  1ZLJ A;  3CZ6 A;  2NS7 A;  3DQV C;  1TP4 A;  4LCH A;  1H72 C;  4ENK A;  2HZD A;  2BY3 A;  3H5N A;  2DAO A;  3VWB A;  4BHP A;  4U87 A;  3BR0 A;  3SEQ A;  3JRD A;  3IAS 2;  4G6D A;  2XAG A;  2I10 A;  2HI3 A;  4PU9 A;  1W7P A;  2OBP A;  4HW0 A;  4CYC B;  1R49 A;  4S05 A;  1R58 A;  2FNP A;  2HR3 A;  3AG1 H;  3RIR A;  4E7L A;  3OSG A;  4S0H B;  5M3F J;  5C44 J;  4NHJ A;  1N25 A;  2WAQ N;  3H9J A;  2L2O A;  4BYY A;  2XAU A;  5L3F A;  2XHK A;  4IF4 A;  3WGI A;  1K78 A;  3TW7 A;  2JUG A;  2Y0S N;  2CV0 A;  1KIJ A;  4IFD F;  1TWC J;  4XLH A;  5CVJ A;  3VSL A;  5FWK A;  3ASN H;  5GTH C;  2R7F A;  3QQA A;  3GF2 A;  2K3F A;  1X1A A;  4A3I J;  4FW4 A;  3IRR A;  3DBL B;  4EMS A;  4BA1 B;  1G3T A;  2XPW A;  4XSZ F;  1LFU P;  5LMN E;  3BQZ A;  1XNR E;  3OR1 C;  4LGW A;  3EUK L;  1BOA A;  1D0X A;  3V7S A;  1RKW A;  2H6C A;  1W0U A;  2KDZ A;  2VOP A;  3M7N G;  1OYY A;  1ON2 A;  3IKV A;  3BTC A;  3JTG A;  2JA8 J;  3B82 A;  4LF9 E;  4BJ6 C;  1XDU A;  1TTY A;  3M1E A;  1AOY A;  1KU3 A;  3GXO A;  4A3L J;  3GTK J;  4A3M J;  3FZV A;  4F3Q A;  2QF7 A;  1GT0 C;  4DJA A;  2AS5 F;  2W7N A;  2W48 A;  3K4K A;  2G7U A;  4NDL A;  5D5X B;  1KON A;  1XSV A;  3HOY J;  2F4V E;  3IHU A;  3HXL A;  4IHX A;  1FJG I;  5BMZ A;  4KA4 A;  4A2U A;  4NBQ A;  1R4M B;  3N97 A;  2DFI A;  4RB0 A;  1OMI A;  4ENM A;  4DPW A;  5K7Z A;  3FK6 A;  1XMQ I;  2GS8 A;  1TQM A;  2KIF A;  4ANJ A;  1KQ9 A;  1R00 A;  2QCO A;  4D5F A;  5L3E A;  2A3S A;  2L9V A;  3MKL A;  2HOE A;  1CF7 B;  4HY1 A;  1OCT C;  2XRN A;  4BDZ A;  1VIS A;  1QU3 A;  4K2E A;  3HG9 A;  4FX0 A;  1KQ0 A;  3PS2 A;  2DPU A;  3K4L A;  3F0N A;  4X65 E;  1WWX A;  1WJF A;  3B02 A;  3M8J A;  1IN6 A;  1X2N A;  2JPC A;  4FWD A;  4JI3 I;  4HX8 A;  3SEZ A;  1N36 I;  1HW1 A;  2VT2 A;  2CQX A;  4Q47 A;  2PJR B;  2JVH A;  2LR8 A;  1Y6I A;  5FLV A;  3H1C A;  5TJJ A;  5C0X F;  1MMA A;  5FB2 A;  1AU7 A;  4YIR X;  2VE9 A;  4XRS G;  4A3J J;  4NB5 A;  1Y0U A;  5E17 F;  1QNT A;  5D8L B;  3I9V 2;  3C18 A;  4CZC A;  3S1Q J;  2A69 F;  3U21 A;  5L3B A;  4GYG A;  1IN7 A;  2Q2E B;  4EV0 A;  3ASO H;  4P1W A;  3DTK A;  1O3Q A;  1H88 C;  4NXN E;  4XMY A;  5FO5 A;  5CQG A;  3L7Z A;  4N3O A;  3HRM A;  5CJ9 A;  4HOB A;  1X3U A;  2A5Y B;  3PO2 J;  2V1D A;  2HQN A;  4Q4Z F;  1BI3 A;  2F5E A;  4XN3 A;  2ZXJ A;  3BJ6 A;  4K0K E;  2LY1 A;  1ZK8 A;  3OYN A;  4DR7 E;  4PGG A;  1IC8 A;  2OD5 A;  3V2U C;  3LA2 A;  4LF6 E;  2IT0 A;  3M8E A;  4D5C A;  1EH6 A;  3CDJ A;  2HOA A;  2KPM A;  4BE1 A;  5LL6 R;  1HKT A;  1KYZ A;  1D8K A;  5K1Y A;  4JI7 E;  1WJ5 A;  2F5C A;  1YE9 A;  3U2R A;  1F43 A;  4XRS A;  2UZK A;  5FKN A;  4XL9 A;  3GLX A;  3UR3 C;  2QSH X;  3GTG J;  4A3F J;  3IWF A;  1U8B A;  5M5Y J;  4KHP I;  4NNJ A;  3MQ0 A;  4LOM A;  1XMK A;  1ZM2 A;  2FEZ A;  2Z16 A;  3R0J A;  5LMU E;  1ETV A;  3C2H A;  3GME A;  1R23 A;  3EYY A;  3TP3 A;  2VBX A;  5HOO A;  1DPU A;  1PKP A;  3CDH A;  3MD2 A;  3QOP A;  1YRN B;  3IRQ A;  2X48 A;  1KA8 A;  1MKM A;  3ERM A;  2WBM A;  5HLI A;  5GAD J;  3L2R A;  1WJC A;  1HF0 A;  2TCT A;  4YHH E;  5LHH A;  1J9I A;  1Y60 A;  3CCQ I;  3ML6 A;  4B3T I;  3R61 A;  3MFK A;  4OX9 E;  2VIX A;  2UUC E;  2LG4 A;  1N0V C;  2EH3 A;  5JLX A;  3OTO E;  1UHS A;  4CYC A;  3CMA I;  1ZM3 A;  4KIS A;  3RYR A;  2Q0O A;  1KVK A;  3FKJ A;  1HNX I;  5E1Z B;  1POG A;  1TW2 A;  2BE5 F;  3FKI J;  2KKO A;  5BPD A;  4DUY E;  1IRZ A;  2HOT A;  3J7A M;  2IW5 A;  4L18 B;  1I94 I;  5B5E C;  1KU2 A;  3S32 A;  4G6T B;  3MVP A;  4OU0 A;  1MJ9 A;  1O3R A;  3R0A A;  3P06 A;  4M71 A;  1O4X A;  4LFA E;  3ABK H;  2KFD A;  4UTG A;  2AO9 A;  1WUU A;  2GQ0 A;  3OOP A;  4BA1 A;  5ILS A;  2BV6 A;  3S1N J;  1DUX C;  1ZRC A;  4XKC A;  3H9G A;  1Y1V J;  3AFH A;  1RRJ A;  1MGT A;  1ON1 A;  2Y2Z A;  4JYA I;  3HBL A;  2AQE A;  2M87 A;  3F3X A;  4GO1 A;  4PFO A;  4LG0 B;  2PNZ B;  3Q6M A;  3G71 I;  1ZN2 A;  4GYI A;  3COA C;  1SC7 A;  1TQI A;  1LQ1 A;  2WA0 A;  3LSH A;  2BGC A;  1MBF A;  4XRM A;  1LPQ A;  3SDG A;  2BR2 B;  3ROU A;  1K7A A;  3W6V A;  4M6X A;  2UXC E;  2FBK A;  5EKW A;  3K9T A;  4HNV A;  4HSR A;  2RGV A;  3RKX A;  3DEW A;  2JTV A;  4ISA A;  1MX0 A;  4KN7 X;  3TMO A;  1Z0E A;  4IHW A;  5AIP A;  3K1J A;  4EM1 A;  3I4M J;  4L9J A;  4G7O F;  4LD5 A;  1XX5 A;  2DMT A;  2AXT C;  2L9S A;  3ZZT A;  3P7N A;  5LBQ A;  5F0F A;  4E70 A;  3WTZ A;  1O7L A;  2XSJ C;  5F64 A;  5H6R A;  5J6X A;  2ID3 A;  3W2V A;  3IKT A;  1ZAO A;  1ZTR A;  1XN7 A;  1CF7 A;  1ITY A;  4BBR J;  2IBD A;  4L0Z B;  1OFC X;  2YSR A;  3G6E I;  2K02 A;  2VBW A;  1VQP I;  1PUF B;  4HG2 A;  3PUF A;  5FLX Z;  1UG0 A;  5LRS A;  4HAC B;  1P4X A;  5J1Y A;  4FET A;  1Z0B A;  3KP6 A;  3CCU I;  2MBF A;  5K36 F;  1S5L C;  5L3C A;  2A07 F;  4WUB A;  1XGM A;  1R36 A;  2HK2 A;  2ZM6 I;  2ACJ A;  1MH4 A;  2EIJ H;  2PJR A;  2DBB A;  5DRP A;  3FMQ A;  5DRO A;  4JP0 A;  3V7C A;  1SMT A;  1ZGA A;  4IRG A;  5LRR A;  4DIQ A;  4ZYG A;  3J7Z I;  1XGS A;  3WTY C;  1JT0 A;  3PYD A;  2F4I A;  1N0U A;  2LC2 A;  4ASN A;  4G6Q A;  1FI4 A;  4BAC A;  3I3L A;  1ETQ A;  4OO1 B;  5HDG A;  3D4J A;  4J3D A;  5BPI A;  2Q2E A;  2HXO A;  3EDP A;  2XSD C;  3HB9 A;  2DTR A;  4Y7N J;  3E6C C;  5C0X D;  4EM2 A;  4IVN A;  2XEX A;  5EJC A;  1S29 A;  4I99 C;  3W2A A;  3H36 A;  5FRM A;  3NWT A;  1HNZ I;  1XC5 A;  4LF5 E;  1SFO J;  2GOX B;  2HDC A;  1PVG A;  1Z7L A;  2ICW G;  3WG9 A;  3Q6N A;  2JEB A;  3FHN A;  3ZMU A;  3GTM J;  2F6C A;  3FHZ A;  4OIO F;  2JUC A;  4BS9 A;  4CDG A;  3VYT B;  2VXD A;  4HDU A;  4KIT B;  3OYL A;  1LDK B;  1B72 B;  3WTX C;  3K6G A;  3AKZ A;  4UNO A;  3HUL A;  3LSJ A;  4RA2 A;  1UCR A;  5C3E J;  4B3S E;  2FXA A;  2E60 A;  2V2V A;  1XSX A;  3WU3 A;  4MNU A;  4HQE A;  2VF3 A;  1Z0G A;  2KQR A;  3J80 K;  3GO5 A;  2X6X A;  4IFD E;  1UST A;  5BNG A;  2JJ7 A;  1QGP A;  2C38 A;  3CLQ A;  3DKW A;  2OV7 A;  2Z1D A;  1T6S A;  1HNZ E;  1R5H A;  3LSM A;  4UV8 A;  1HNW E;  1BC8 C;  4HST A;  1K4T A;  2Q1Z B;  1SVM A;  3SHF A;  3KE2 A;  4X6A J;  2L0K A;  3WU2 C;  1STZ A;  4PJM A;  1YRN A;  4M3B A;  3GFJ A;  2KJB A;  1W5S A;  5ICG A;  5H6Q A;  3LL7 A;  3CP2 A;  2YPR A;  3DLA A;  5GAE J;  2ZNY A;  4NXM I;  3P3C A;  2ESH A;  3WTV C;  4IJA A;  5IPA A;  4OMZ A;  3WTW C;  1IN4 A;  3QRF F;  4IS9 A;  2Y0M A;  4QNK A;  1DGR M;  2ZJ2 A;  5LEJ A;  3HPG A;  1DPR A;  3OYK A;  2WY7 Q;  3CF5 F;  2L02 A; 
#chains in the Genus database with same CATH homology
 3KRN A;  5JEA D;  4OO1 A;  4BA2 A;  2NN6 E;  1OYR A;  2PO2 A;  3CDJ A;  2BA0 G;  3U1K A;  3B4T A;  4IFD C;  1UDQ A;  3CDI A;  4IFD F;  4AID A;  5K36 C;  1R6L A;  2BA0 D;  5K36 F;  2NN6 A;  1R6M A;  4BA1 B;  5JEA E;  2C37 A;  1UDO A;  2C39 B;  3DD6 A;  2BR2 A;  3M7N G;  3GME A;  2PO0 A;  2JEA B;  5C0X E;  2PO1 B;  4IFD B;  4OO1 B;  2JE6 A;  3M7N D;  2WNR A;  5JEA A;  5K36 B;  4AIM A;  4OO1 C;  5C0X D;  4OO1 F;  3HKM A;  3H36 A;  3GLL A;  5C0X A;  1UDN A;  2WP8 B;  2PNZ A;  4IFD D;  3L7Z B;  4NBQ A;  2JEB A;  3GCM A;  2NN6 C;  2NN6 F;  2BA1 G;  1WHU A;  1UDS A;  4BA2 B;  2PO2 B;  2BA1 D;  3M85 G;  5JEA C;  4IFD E;  4OO1 E;  2C38 A;  4BA1 A;  5JEA F;  3M85 D;  5K36 E;  2C39 A;  2NN6 B;  4OO1 D;  2PNZ B;  5C0X C;  5K36 D;  2JEA A;  3H1C A;  2C37 B;  2JEB B;  5C0X F;  2PO1 A;  4IFD A;  1E3P A;  1E3H A;  1OYP A;  2BR2 B;  5K36 A;  2PO0 B;  2JE6 B;  2NN6 D;  2WNR B;  5JEA B;  4AM3 A;  1OYS A;  2WP8 A;  3L7Z A;  2C38 B;  5C0X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...