4AIDA

Crystal structure of c. crescentus pnpase bound to rnase e recognition peptide
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
616
structure length
573
Chain Sequence
QDPMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKSASDGAKIKAAIDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase/peptide
molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
total genus 166
structure length 573
sequence length 616
chains with identical sequence B, C
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 4aidA02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aidA03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aidA01
2BA0D 2BA1D 2NN6A 2PO2A 5C0XF 3DD6A 2PO0A 4OO1C 3M85D 3H36A 4AIMA 5JEAB 1OYPA 3HKMA 4OO1F 1UDQA 2JE6B 2PO2B 5K36F 1E3PA 2PO0B 3M7ND 2C38B 5JEAE 2JEAB 5JEAA 2WNRB 2PO1A 2PO1B 4IFDF 2JEBB 5K36C 4OO1A 4IFDA 4IFDB 4IFDC 3CDJA 2WP8A 2BA0G 2BA1G 4BA1A 2PNZA 5C0XA 2NN6B 5C0XE 5K36D 4BA2A 4BA2B 1UDNA 1R6MA 2JEAA 3KRNA 3U1KA 3GLLA 2BR2B 1OYSA 1R6LA 2NN6E 5C0XB 1E3HA 2C39A 4IFDD 4OO1E 4NBQA 2C37B 3B4TA 2PNZB 2JE6A 2JEBA 1UDSA 5K36B 4OO1B 3GCMA 2C38A 5JEAC 2NN6D 4AIDA 1WHUA 3M85G 2WNRA 5JEAF 3L7ZA 4AM3A 5C0XD 5K36E 5K36A 4IFDE 5JEAD 2WP8B 1OYRA 4BA1B 4OO1D 3M7NG 3GMEA 5C0XC 2C39B 3CDIA 3H1CA 2C37A 2NN6F 1UDOA 2BR2A 3L7ZB 2NN6C
chains in the Genus database with same CATH superfamily
4RGSA 5H6RA 2KMUA 2ZMEB 2BY3A 3DU5A 4RPFA 3M1CA 5FLMJ 2NVYJ 3DD6A 2E1OA 4HNUA 2DI3A 4M3BA 1RZ4A 1OLTA 4M3GA 4L9NA 2CS3A 1PP8F 2F4VI 4PJMA 4GKJE 3BT9A 1FWLA 2IRFG 2FU4A 1UAAA 1XNRI 3DPLC 4I2OA 1HNZI 2HS5A 2XKOA 3BG3A 4CGZA 4DV4I 2P5LC 4V2GA 3PSFA 1Y8RB 1UFMA 4S0HB 2KIMA 3GXOA 3R0AA 3HC7A 1J5EE 1XNRE 1MNEA 3F22A 1LDKB 2BV6A 2LF7A 3A4CA 1V4RA 2A68F 4JI3I 2EBIA 5C4XJ 3S2HJ 2CV2A 4IZKB 2WV0A 1A04A 1W7PD 5F08A 4EQQA 3ML6A 4QLCU 2K7LA 3D5SC 4EJVA 4LF5E 4FQGA 4BS9A 3CC2I 5K36C 4U0WA 4A0YA 5M3FJ 3ZMVA 3HKZN 4W97A 4XRMA 1K6YA 2M7AA 4E7SA 1GDTA 1STZA 4WUDA 4M3DA 4LG0B 2P6TA 3RDIA 4HW0A 4C3HJ 4D5CA 2DA6A 3CCYA 4DV2E 2VJIA 1V5EA 1YIOA 1Z1DA 2P5KA 4F92B 4X64E 3T1HE 2DOEA 3FXMA 1MBJA 3RPUD 4XQFA 5LMUI 1QPIA 3ZQGA 3WTTC 3BG7A 3ZQLA 1X1AA 2W57A 3KRNA 4DU8A 4NC8A 1Z7LA 3J80Z 1F1ZA 1K47A 1YW8A 2JK3A 5FLXZ 4J01A 2YU9J 5E3LA 2NN6E 3VYUB 4BQNA 4QSHA 3E5QA 4PJLA 1ODDA 2GQQA 5HDGA 4A3EJ 1XMKA 3NARA 2XVCA 2IESA 5L3EA 2XAJA 3U2RA 1LFBA 2KZGA 2HI3A 3RYRA 3MFKA 1ZM9A 4WCGA 1ZREA 2ZSIB 4LFBI 3F9KA 1ZAOA 3BQZA 2Y0MA 3HRTA 4A12A 4KFCA 2DFFA 2GZWA 3QRFF 4LF6I 4NNJA 4UB6C 2WY7Q 1A35A 4U3BA 2UXDE 3LMMA 3A1YA 2K4JA 4LFCE 2VOOA 1UHMA 3Q9VA 1LDDA 2HKOA 2LFBA 5L3DA 1OCTC 3M85G 3ZZ0A 3KLOA 4F55A 1U5TA 4B3RE 1JJ8C 1W0UA 2MH2A 4IX7A 4DV3E 3ZMUA 3BR2A 4HOBA 2IPQX 4UNOA 2CMPA 2E5LI 2ISZA 4P96A 2RQPA 3FDYA 5LFAA 2WP8B 2VIXA 1K83J 1NH3A 4JI8I 4BQQA 1YHCA 3WHBA 1E3OC 2ZO4A 2L4MA 3GTQJ 4LF9E 3T8TA 2QWWA 2PMZN 4FTHA 5LRRA 4A3CJ 2XEXA 1USTA 4LCGA 1U3EM 5EEGA 3VDXA 4DR4I 4JX4A 3JRCA 2O1UA 3LQRA 1W5TA 3I4PA 2M0MA 2F5FA 5DEQA 2IW5A 1XNQI 1HNZE 3SFIA 2W84A 5A2QZ 2CWEA 3JRGA 2CFXA 1I94E 1T0FA 2G0EA 2YPRA 2LKPA 1OCZH 1TT0A 2DBBA 2DOAA 1GUUA 2WAFA 3WTZA 4DV6I 1QNTA 3ZQQA 1FMVA 3OTOI 1YQAA 4HRIA 2KKOA 2V26A 3MD2A 1USVA 2ELKA 3GTMJ 3K69A 2KP6A 1A6QA 3W6VA 2Y48A 2JT2A 3DTEA 2XIGA 2WNRB 3BTJA 3C3WA 3T5XA 4BL0B 4YY3I 2E5NA 2IS6A 2PO1B 2HQRA 3C2BA 1Y39A 3H5RA 2HEOA 4LLNA 4HNVA 2FD5A 3PS3A 4PU9A 3RQIA 3OY9A 3WU0A 3SJMA 4AIJA 4IHSA 2UWMA 4YY3E 4KHPE 5D4RA 1DUXC 3G3ZA 4HYMA 3LSMA 2IGNA 3K2AA 2W24A 3A0HC 1HKSA 3K70C 1FOKA 1UEKA 4O6JA 4CZCA 3ABKH 1N78A 5CVUA 2LD5A 2ECBA 3GWZA 5J6XA 4DYRA 2FJ1A 3PL8A 4X62E 3A01B 3GZNB 3CCLI 4Q5SF 2V2QA 2M3AA 3MVPA 3KPHA 1ZR2A 4FWDA 4OO1E 1LFPA 3K7AJ 2GBYA 5DNXA 2K02A 3RYPA 1F4KA 3S2WA 1X2MA 3FXQA 3OIOA 3V5RA 1HKQA 2GXGA 2R7ZJ 4XLCA 4CCLA 3RTRA 3AKZA 1I1SA 2DLLA 3I4MJ 3W3CA 5KHDA 3BR0A 4P1WA 4NC6A 3O2PE 3LPSA 1TQIA 4RMNA 1YW9A 5LLQA 3FMSA 5IYCJ 3CCJI 1TBXA 3RZOJ 2L4AA 4DV1E 1IXCA 3FIWA 2FOKA 4C3JJ 1JI8A 1Y4SA 2QQAA 5JEAF 3DKYA 1QPMA 4LK0F 3V4GA 3ZMZA 1VISA 1O3RA 2UXXA 1WKMA 1MW7A 3SZGA 4FW5A 4KT6A 4D7NA 2ACJA 5GPCA 1H88C 4KUMA 3TDZC 2HQ5A 4RGRA 1ZRFA 2EZKA 1X2NA 3LSJA 5BMZA 4G7HF 2KQRA 3GO5A 3HKZA 3DEUA 3GTKJ 1GV2A 4JI0E 3FHZA 1ERDA 3NWSA 4N0BA 1LEBA 2M8GX 3IHUA 4JQFA 5KCMA 2KISA 1IRFA 4FWGA 1HLVA 1IBKI 2FEZA 5J40A 1Z6TA 4U7BA 4FX0A 2UZKA 2BXYA 3CWVA 1KIJA 1H8AC 1G3WA 3ABTA 4BY7J 2EV5A 1DPRA 5CVIA 2EIKH 2FX0A 1HXDA 3GEZA 4JX5A 5A2QK 1O3QA 3HKMA 4A69C 1P4XA 4IKFA 2GO4A 1YO5C 3B82A 2VQFI 2PO2B 1QZEA 2MBFA 4LFBE 5K36F 5JFRA 1YOVB 2BV3A 2M2EA 3NWTA 4ZJZA 2QVOA 3FX3A 2DN0A 2XPWA 3HZJA 3IH2A 1T95A 2E5ZA 4XNFA 4DQ2A 3LSRA 4JI6I 1QO0D 3ZPLA 3GBGA 3VYTB 5FRNA 4GQUA 5GMDA 2LKXA 2IXSA 2ME6A 3NZKA 1X4OA 2L9NA 4HX4A 4BQAA 3E3VA 4LFUA 1R1UA 2M34A 3Q9SA 5HVQC 3KETA 3B6CA 1XMQI 4BJ5C 3OSGA 1H73A 1TQMA 3JRBA 3BZKA 5D8KB 1FBSA 4DBRA 3KP6A 2DCEA 2E1RA 3SFZA 3G71I 2EPFA 4DR5I 2J5PA 2H6BA 2ZXHA 1R00A 4DR4E 4B44A 4GXOA 4P9FA 3SEZA 4CZZA 4Z7CA 1S3JA 4C30A 1TW3A 1WZ2A 2EIJH 2JEAA 4XLNF 1R1VA 1XX5A 2A6TA 1Z3XA 1ZXMA 3TKYA 4EATA 4N9IA 4XICA 5IT9K 1OYSA 3K70D 2H27A 4IZZA 2ZMEA 1SMYF 1U5TC 3W6JB 1U9NA 3PM1A 4CICA 1UELB 2V1XA 1WI9A 2ESNA 4Y4RA 2QKMB 1XGSA 4WUBA 3IC7A 1L3LA 2CUEA 1IRZA 4EEFG 3PIPF 3EPZA 4Z2YA 5E18F 4JV5E 2OZ6A 3TOBA 5CJ9A 1PUFB 2MLKA 1WJEA 2JUCA 1REPC 3W2WA 2BY1A 4M3EA 4N9HA 4HLYA 3MZYA 4QNKA 4BE1A 3T0YA 2Q1ZB 2UXBE 4X6AJ 1OKRA 2R42A 3CUQC 4JI4I 5LGUA 3J7AO 1DGWY 3WU5A 1GXQA 4MIMA 5LGNA 1GXPA 1XMQE 2KDZA 2AS5F 1U6GA 3K4MA 1C0WA 1RETA 3LAPA 3GTLJ 3IL2A 1N32I 1FSEA 4GO1A 2XAUA 3A03A 2R7SA 3DWLE 3PNYA 1X4PA 1R4NB 1YS6A 1YX3A 3S17J 3HULA 2P4WA 5EGOA 3J7AM 1FMWA 1J9IA 1G2HA 1Z7UA 1YE9A 3V8JA 3DTIA 1BR2A 2V1UA 2EZLA 2ID6A 4G6DA 3T1YI 4AVPA 2HXIA 2BW3A 1WCMJ 4RGXA 2R7WA 2JA7J 1NHJA 4FE7A 4RAGA 3T8RA 4BH9A 4E4HA 1VQ7I 2BA0D 5IOZA 4WWCA 3SQNA 3F3XA 1FP2A 5C0XF 1FJGE 3GFMA 4AYBA 3BTLA 3RPQA 2PO0A 4XTJA 1P6RA 1I3QJ 1UHWA 1TLHB 2DTZA 2JRTA 5EZHA 3S32A 2A07F 2UUBE 3TO7A 4LG0A 2EINH 2Z99A 3B73A 2WADA 1POGA 1UG2A 2IGOA 2XV4S 2XUBA 2YSRA 2Y9ZA 2JE6B 2JPCA 4DR6I 3FXOA 4II2A 2EA4A 5IYDJ 3ABUA 1PVEA 1XSDA 2KJCA 1YS7A 1Y6ZA 4ZH4F 2DPDA 2VPLA 5JEAE 1MBEA 1O3SA 5GP9A 3U1YA 2BBYA 2RV8A 4E7ZA 5B1AH 2XF6A 3CMYA 1PYVA 1U2WA 1PUFA 1NK2P 1XDUA 1B9MA 1WSUA 1IN6A 5KVRA 1W0TA 5C4JJ 5TRDA 5ED4A 1ZQ3P 1K78A 2PBIA 4X0GA 1IBLE 4JI2E 3E6DA 2NVUB 3O6BB 2LDUA 2B0LA 1Z5BA 1WVRA 2JZYA 3P5JA 1VNDA 3WTUC 4JI0I 4KMFA 2E2IJ 2BEOA 3DBLB 3WGIA 3BQYA 1X58A 3HJEA 2X6WA 3FXUA 5EZGA 4AIHA 1YHQI 3JSOA 1HNWI 4YFKF 1IUFA 4LF7E 4B3SI 2VBYA 2L7KA 5DYMA 3OYNA 4XM3A 1AA7A 1RR9A 3E97A 4AU7A 3OYCA 4LJZF 1DGRM 1E17A 1B8IB 3IH4A 1ZLJA 1HQCA 3EUHA 2Z1DA 4NXME 3HXLA 3DKXA 4BDZA 1TQPA 3GLXA 3GZ5A 2LMDA 2DPUA 1QGPA 3D4JA 1FYMA 1ZTRA 2XPUA 2C38A 2X36A 2A2DA 1B1BA 4IRGA 3ASOH 3DU6A 1VQPI 3BG6A 2DDBA 1FX7A 1Y1VJ 3CJTB 1IAWA 4HSTA 1RI7A 2ISYA 4V2FA 3P7NA 4WX9A 1N0UA 2R7XA 4XSXF 2ZFUA 5IYBJ 4JI7I 4HG2A 4CYCB 5FLXQ 2KIQA 2HTSA 1TWFJ 1S72I 5DRPA 3A01A 3HG9A 3OS1A 2HOTA 2O1TA 4DPWA 3K4JA 5HLTA 4ENJA 3OSFA 1IV6A 4DV3I 4DV0I 1A6IA 3TW6A 3E5XA 5H6QA 1QU3A 5BPIA 5EG0B 5GMEA 3V2UC 4DR1E 1APLC 2W00A 1ETVA 2Z33A 2CQQA 2VBWA 1KYZA 3UHMA 2C37A 4MFEA 4PRVA 4UB8C 3COAC 3EYYA 1ITYA 3ZP5A 2A05A 2WC2A 5GTHC 1S4EA 1H7SA 2CRGA 3R61A 5HLHA 1S9HA 1YG2A 5J47A 4E7LA 1IZ1A 5F64A 2H8WA 2NS8A 1ZKGA 2ZXWH 1Y4UA 4EJUA 3KYCB 5L3GA 3ZMDA 5M3MJ 1DARA 1ZELA 3I59A 2FXAA 2YUSA 4GRIA 2V34A 4DXLA 2DMTA 2F5VA 3QAHA 5BR8E 2Q2EA 3UNGC 4B3ME 4AQYI 3EQLF 1ETQA 2QF7A 2H6CA 3BR3A 4RAFA 3NRVA 4ENKA 1RIOH 1SFKA 3C2HA 1B63A 2OD5A 1T08B 1QHGA 3L09A 1Z9CA 2R3SA 2R92J 3PS1A 2E1MC 4MTDA 3ZKDA 5FKOA 2FQ3A 3L2CA 2ZCWA 4A3LJ 3K1JA 1DPUA 4IZJD 5CVVA 1HW1A 3KZIC 2ZNYA 4HPQA 1FOYA 1ZG5A 1MNMC 1P2FA 4LF5I 4LOCA 4BA1A 4OX9E 5M5WJ 4UV8A 1XB4A 5KAFC 2RQQA 5K36D 1BC8C 2Y30A 3ERMA 1E2XA 3CO7C 3HDDA 3VWBA 1DU6A 2CZ9A 2OBPA 1F36A 3BR5A 2ECCA 2HDWA 3V42A 1H0MA 4DV5E 1Y0NA 4N4OB 2VN2A 3VYSB 4RB3C 1Y5YA 4DYCA 1HDPA 1H72C 3T1HI 4A3MJ 1IN7A 5E3NA 4PJJA 1S7AA 3LSKA 3CCSI 5C0XB 4PFPA 3S16J 1WJCA 3C7JA 4JI1E 1T38A 4JX6A 2EFGA 5J8CA 3HOVJ 1ON1A 4I7HA 5IPAA 4NBQA 3F8FA 2J7KA 1UHSA 2L7FP 2WAEA 2FNAA 3H0DA 1NZ0A 2PX9A 3BROA 3PFIA 4QPQA 1V5FA 4IVNA 1KQ8A 2E34A 1N33E 1IN4A 4ZDLA 3S3OA 1UDSA 2X6OA 4XLHA 3HSEA 3ZOBA 2DA1A 1VF9A 2OQGA 5BPDA 3DEEA 2VLAA 4MTEA 4IHWA 5IT9C 4ISAA 1N36I 2NN6D 3B02A 3O8GA 2JUGA 4DJAA 1W5SA 4EM1A 1BIBA 2X1CA 4IHVA 1IDZA 5K7ZA 3HUGB 3J81Z 4MEXF 2K9QA 3CQZJ 4RAYA 2QQBA 1U0JA 1BI2A 3KX2A 1XMOI 4KHPI 2KLOA 4DNCA 5L3CA 1B8IA 1W7PB 4YFXF 4IFDE 5E3MA 4Y52J 4HY1A 3ZQ7A 4F52A 3BZCA 1YRNA 4RLQA 4QIWN 3JR9A 2FE3A 3CCVI 3ASNH 3H4LA 3F6VA 2DMQA 1R71A 5DD8A 5CPRB 2HDCA 5IOYA 4B3TE 2R93J 4UVAA 1TL8A 3OOPA 1ETKA 3LSGA 2VI6A 4FASD 5DROA 2Y0SN 1O7LA 4CCMA 5EEAA 4L18B 1ORKA 5JI6A 4XR6A 2VESA 2LY2A 2L9RA 3HRSA 2CW8A 4DBQA 1ZK8A 2WAQA 1K79A 1J59A 3MCZA 2DEIA 2O5RA 4FT8A 4S05A 1MSFC 4D7MA 4BACA 2VQEE 2NNNA 1UG0A 3DQVC 4HV6A 3V7SA 2I8DA 4PSXA 1ZRDA 4L5IA 1ZARA 1B4AA 1R49A 2LJPA 1VTNC 4BY1J 4I98B 2BVMA 4JK1X 5KK1A 4ASNA 4ZYGA 2KJBA 2RC4A 3BWGA 4BEHA 1FPQA 2XRNA 1OYIA 1XCBA 4GYIA 3HTSB 1TW2A 2QM3A 2DFHA 2DA2A 2UXBI 2PO1A 1Y8QB 3P9KA 3VYRB 3N4MA 1Z3YA 2EFOA 2JEBB 2PG4A 3PQJA 3P76A 4JI8E 2KIFA 3HB9A 2FOWA 4IFDA 1A6FA 2FBKA 2VODA 1DU0A 3CUOA 2IGMA 1OR7A 3E6BA 1QBJA 1BW5A 4NB5A 5J1UA 3BCAA 4IL6C 5K7HA 3GFIA 2LY1A 2RAEA 3ZQHA 2NN6B 4YHHE 1TWCJ 2EFPA 3JRIA 3VSLA 3WU2C 2DJNA 4ZVIA 2ZB9A 1KU3A 2XPVA 4YIIA 3SZTA 1FBUA 4F7ZA 4X66E 4BA2B 2R5ZA 1X1DA 2D5VA 3PUFA 4DR7I 2ZKZA 4RB0A 2CUZA 4UXNA 4H4KC 3QT5A 3BCBA 2R7DA 1EI1A 2GXBA 4HF0A 5IWAE 2EILH 4OAZA 2RDPA 3OMYA 2JJ7A 2VC0A 4IHTA 5D5XB 3ZXSA 3FKJA 1OCPA 1QVTA 4EGYA 4M73A 3CCEI 5EF6A 2QZ8A 4U0YA 2HQNA 5FO5A 4A6DA 1BI3A 1GVDA 3WU4A 4BDYA 2QCOA 3P3GA 4IS9A 1LDJA 1W1WE 3DTKA 2ME0A 4Y33A 5GAGJ 5BS6A 1N36E 5ICFA 2JT1A 2CGEA 2AO9A 3DLLF 1CF7B 1T56A 2LTPA 2ZXIA 5BR8I 5ELWA 4P9UA 3M4OJ 3ZMTA 1BKNA 3F0CA 3BR1A 3LAJA 1JUSA 1HR0E 2PI0A 3FK7A 1NHIA 2EA2A 2EB7A 2E2JJ 4JI6E 2MFZA 1SFOJ 2L3DA 4IRHA 1OCOH 1SD4A 1MG7A 4MQYA 3H3UA 5CVJA 3BTCA 2W25A 3JCUC 5D5WB 2PNMA 4JI2I 3X2QH 1FZPB 2MG4A 3EUHC 2DYSH 2MLGA 3HRUA 5GADJ 4KNYA 5JHUA 1VQ6I 1G3TA 3LSTA 2AHQA 1IBLI 2QQ8A 2VPRA 1OQYA 5K7FA 2JA8J 1N32E 3A02A 3CO6C 4AUXA 2N8GA 4G6QA 2Z5UA 5JLXA 2ZNZA 3CCMI 3HPHA 4L0ZB 3FHNA 3Q3SA 5HDNA 1H9TA 1R23A 1TWAJ 5EG0A 1S6LA 5HLGA 1RRJA 2XSDC 2R5ZB 4R8HA 2R4GA 2Z5BB 1MH3A 5JEAB 2OAZA 3AG3H 3CC4I 4OO1F 1N33I 1ENHA 2LG4A 4D9JA 1KQ0A 1ELOA 1QQIA 4MEYF 2L02A 4ITVA 5FFXA 4M6XA 2V2ZA 2EJRA 1ZYRF 3D1NI 1JHHA 1Q1VA 2K86A 3G4SI 2HOEA 3DV8A 3BLYA 2VQLA 2JTVA 5DCFA 4E6KG 2Y31A 2E1MB 4LITA 4PUSA 2HFUA 4NXNE 3HL2A 3DPTA 4OX9I 1YX5A 4AVZA 2GOMA 2O03A 4X65E 3ZQCA 4OO1A 2Y0SA 4M6YA 3I53A 5AIPA 5F27A 4AYBN 2BA0G 2VJ4A 1B62A 2Y75A 4XBFA 2G7UA 5LMNE 4KICA 4NDLA 2NOJB 3V8KA 1S7EA 1SD7A 4LF8I 2TDXA 5EL9A 3K4BA 4NUBA 2XB0X 3OYFA 3L2VA 3CCQI 1ZGWA 1IC8A 1ZM3A 3BJAA 2RNJA 2M9HA 4HXZA 1AKHB 1WQ2A 1F5TA 3CMAI 3FF5A 5CQGA 1D5YA 4FX4A 4LPFA 2CU7A 1MDMB 2A69F 1V55H 3L1PA 2GS8A 2NNYA 2VF3A 5FLXC 2KFDA 2RVCA 3I5UA 1N34I 3LSIA 1MJ9A 4XK4A 2FMLA 4XOPA 2L7ZA 4H0EA 3TGNA 4ZZDA 4B3AA 3AL0C 1FWZA 3FMQA 2X4HA 3WGGA 2A5WA 2L9SA 3DCFA 3K1PA 3K4KA 2L2OA 3KP5A 3KYDB 4UUSB 3HHHA 1I6HJ 1FKAE 2GAUA 5IP7J 2E35A 3KZZA 2BM0A 4B09A 2K85A 1H7UA 4WXDA 1NG7A 1ZXNA 1BM9A 1N77A 2ELJA 1LVKA 2ZJRF 1AU7A 1R9TJ 4FE4A 2LYCA 1J75A 2D45A 3I58A 1S7OA 2F6CA 5B66C 5HS8A 5LRSA 4LF9I 4OIRF 5K36A 4HLXA 4P7AA 4BBSJ 5E79C 4DR5E 2HWVA 3T1YE 1VI7A 1ZHFA 4C2MJ 1MU5A 3HPGA 4N3OA 3H3ZA 1FEXA 3JTHA 4B3XA 4BQOA 3G73A 4IHYA 2IOQA 2IS2A 3L2WA 1WWXA 3CJQB 2DQLA 2CW0F 4FWHA 3FZVA 1FOXA 1OISA 1YTYA 2CGPA 3E0JB 2R7TA 3BOQA 2XRLA 3P9CA 5E1WA 3KYLA 2IOPA 4A3FJ 2XKPA 2O7OA 5L3JA 1SVLA 4QWQA 1Z0EA 4AIMA 2WTEA 3DF8A 4GFBA 1WJBA 3WTSC 4UT4A 2BE5F 4BXUA 1MKMA 5E1ZB 5J1YA 4IOAF 2HYJA 2HZTA 2PJRB 2E7XA 2Z5CA 2JA6J 3F8MA 3J81C 2H8RA 1RUNA 1ACIA 1MNDA 1N25A 3BC8A 4ESFA 2P81A 5IT9Z 5JEAA 2R0QC 4B3RI 2BHYA 1FOWA 3PRYA 4MFDA 3UR3C 4K0KE 2KDOA 4HV5A 3BJ6A 4N4NB 2DXIA 5HS9A 3HSRA 4A3BJ 5M5XJ 2PMUA 4CCOA 3DFGA 1Z05A 1GV5A 2RN7A 1LE8A 2JWTA 2V6EA 3I0TA 1RKWA 2BA1G 1SFUA 2LLKA 2GWRA 2VKEA 1S29A 5LL6R 4LB5A 3FK6A 1JGGA 4L9VA 3OYLA 4JG4A 3K0LA 5E8IA 2XF7A 4LFAE 1FLIA 2AXLA 4OKGA 2K4BA 4KN7X 4NQWB 1JE8A 2RKHA 3Q6MA 1KGSA 5F6FA 2VQEI 1XGNA 2MC3A 1XTAA 2V9VA 1MMAA 1VFCA 4RB2C 3OYKA 3PUBA 1PDNC 3CC7I 4R1FA 4PGHA 5JR3A 2VE8A 2IERA 4Y7NJ 2A6EF 3EUKL 4JP0A 1JUMA 1W7PA 4LGWA 5H20A 1HNWE 2EZHA 3KFWX 2QENA 1V3FA 3BG5A 1LEAA 3TDUC 3VFZA 4B8XA 1HCRA 4M3FA 3I9V2 2GM4A 4CHUA 3ZKBA 1Z21A 3QPLA 2X1DA 1J7KA 4B48A 1Y6IA 5K1YA 1D3YA 4A3JJ 4DR3I 2ZJPF 2L0KA 2CO5A 3FXJA 1W36D 4ED4A 3WU1B 2VONA 3M8JA 1MBKA 1BA5A 1HR0I 4DOZA 3GCMA 2O3FA 4K0KI 2HQAA 4A5NA 5FKNA 2COMA 4XKWA 1EH7A 3CMMA 3KEQA 1MDMA 4ZTFA 2OTLI 3OV8A 4IEJA 4DUYI 2UUCE 3CMEI 3E6CC 2A5YB 1VQKI 3L7ZA 5LEKA 1JKQC 3SYTA 1Z77A 5EKWA 4XSZF 3I4NJ 2X51A 4OIQF 3H0GJ 1T33A 2WV1A 3CP2A 4M74A 2BW3B 1YRNB 4MGRA 4QNJA 4OOIA 5FWKA 5LHHA 3B78A 1WJDA 3KP7A 1ZM2A 2C39B 1TWGJ 2NAZA 1JJ6C 2COBA 3ERED 3J7ZI 1FTTA 3CDIA 3FBIB 4FHTA 3G1LA 2GO3A 3I59B 1FTZA 4UVCA 1SD6A 5ICCA 3B8HA 3AL0B 4DV7E 2FF4A 2PJRA 1D0YA 2X0LA 3GFLA 1SVMA 2ESHA 4OO1C 3M85D 1TT5B 3J81Q 4DR2E 1J0RA 1R22A 2R7QA 2Z16A 4HA8A 1UDQA 2OCCH 4MQ9F 4HSRA 4KIBA 2DQRA 2V9PA 2W1OA 3MN2A 2IS4A 1D1CA 3QU3A 2EV0A 3IH3A 4DR2I 4Y15A 3M7ND 3M3YJ 2PMZA 3PIOF 2IA1A 5HS7A 3OIQA 5C3EJ 2UUCI 1JHFA 2GLOA 4CCNA 1OCRH 1VQ8I 5ICGA 1UZCA 1F9NA 4L9TA 5IY5H 2MD0A 1SAXA 3HBLA 4J00A 2K9SA 2PMHA 2ZBKB 4MDTA 2R7UA 4KIFA 4IFDF 2HXOA 2QYOA 2V1NA 2YS9A 4MLOA 2K9LA 4WK8F 4IFDB 1ETXA 2KL4A 4ZC3A 1D8KA 4XOTA 4JYAE 2LKSA 2XASA 3L2UA 3RQ4A 1FT9A 4CUGA 5KNLA 4BE2A 1ETWA 2W4SA 5DM7F 4LF7I 2O6GE 2HK2A 2FRHA 2DK5A 2K40A 2R7VA 4K2EA 3TP3A 2HPIA 3M9AA 3KCCA 1FBQA 3PYDA 4KQVA 5KAIC 3S15J 3U1KA 1RNLA 3GLLA 2L7MP 3U9GA 4L5JA 3WGHA 1IGNA 3ZQIA 4RM2A 4HZFA 3AG4H 2R5YB 3P9IA 2A6HF 2HU9A 4G8XA 1M1EB 1IV8A 2DT6A 3I54A 2K9MA 2E1CA 1WRJA 4Q4ZF 3H5NA 1FP1D 4LMYA 3QODA 4KMUX 2V8PA 5FD6A 3LA2A 3M8FA 2D1HA 2JE6A 4UV9A 1BR1A 2QLZA 2MD5A 4XLEA 4Z6YA 1HOMA 3BZ6A 4GCVA 2JEBA 1LFUP 1G4DA 5K36B 2BXZA 3HTUA 4OIPF 2BHZA 2E2HJ 2BZTA 2LY9A 3LNUA 4FW7A 2JA5J 4P55A 3PNVA 2DMUA 1BW6A 2E1NA 2XSJC 4BYYA 3PYEA 2JA2A 2DO7A 1OPCA 2ZC2A 1WJ5A 2XROA 2R7RA 1U8BA 3WHCA 1YJ9I 1WFXA 5CYVA 3AG1H 1XXEA 3QWLA 4Q47A 3M7NG 2XF5A 4LOMA 3G2BA 1U9OA 4XRSG 4ZYHA 3IRQA 1O3TA 2AJ4A 1XD7A 3MWMA 2P8TA 3RJPA 1EA3A 4XLAA 5LHIA 3C18A 1JKOC 1VQLI 2DYRH 3VB2A 1EH8A 1RKTA 2KT0A 3S93A 2GQ0A 2UXCI 1ETYA 1R4MB 2DT5A 4JOMA 5FGMA 3TMOA 1G8XA 4QTRA 3L2RA 4C2UA 2BR2A 1MBFA 4F91B 2CYYA 5DS9A 2PO2A 4FETA 1R7JA 1IUYA 1R5ID 5ILVA 3OIPA 5J8FA 1DP3A 1SMTA 3NAUA 3CJNA 2MA3A 1P9QC 4BKXA 3TP0A 1KA8A 3WTWC 1J5EI 2IT0A 1BOBA 2XGEA 2CG9A 3BG9A 4BHBA 5C44J 1U5TB 1EF4A 5HOOA 2VUMJ 1JGSA 1NHAA 3IP4B 4RB1A 3PYFA 2GIZA 2DW4A 1U8RA 4LF6E 2ID3A 2O8XA 5FLXK 2EFWA 3TO9A 4BXFA 1XN7A 2DA5A 2WB1A 2OF7A 2NVQJ 3GUDA 4IF4A 4D0PA 5DDGA 2VKDA 1USSA 1HW5A 2DTRA 1ZM4A 3GX4X 4ZTJA 1O7FA 1UMQA 4EJTA 1BR4A 3W2AA 3A0BC 3KP4A 4E7JA 4I6ZA 1CQTA 2OZUA 1P7JA 5DV5A 3LSHA 3TQNA 4KYWA 3EUAA 2F4IA 4X65I 5C0XA 2R5YA 4UUTA 2QGUA 3IKTA 3SHFA 1HA8A 5C0XE 2M1BA 3TEDA 3FBNB 5J4VA 3HEFA 5DUKA 2O1VA 4BA2A 3K17A 3RPUA 5J1RA 1JXSA 2EK5A 3PO3J 3F8NA 2RREA 3FMRA 3J81K 4EMSA 1XSVA 4FN5A 3O8HA 1FI4A 4X66I 1ZGJA 2NXNB 4DUZI 3RSNA 1IBKE 4PFOA 2AE8A 4MNUA 1GT0C 2J65A 3JREA 4BAYA 5J3LA 1I94I 4M1KA 2XGCA 3MKYB 1MMDA 1IBMI 3DPUA 3L2QA 1PP7U 2HHHE 4LFCI 4JI1I 4DV1I 2VASA 4DPXA 4DV6E 3JAMK 4A3GJ 1O4XA 3LQQA 4LLGF 5CKTA 2K3PA 3PO2J 3MEXA 2XHKA 2KZVA 2QA4I 4I09A 2XDVA 4AM3A 1KU2A 4MQVA 3G1OA 1GVJA 3B6AA 4ZDPA 2LR8A 4CXFA 3E6MA 1IJWC 2IBDA 4G12A 1BBYA 4HX8A 4MO7A 5K36E 2GOXB 4FW6A 1RREA 2LRDA 2B7EA 3QT7A 4LB6B 1MH4A 1K61A 3ROUA 1B6AA 1OYRA 3Q6NA 4BA1B 4UVBA 1IDYA 2ZITA 4M72A 4BHCA 2HNHA 2K5CA 3KP3A 2K9NA 5LEJA 2W85A 2LREA 3OYMA 3KLNA 4WXHA 2WAQN 3SZPA 4FW9A 5IT3A 2G9WA 3JSPA 2VBXA 5A2QQ 2Z3YA 2NN6F 3IWFA 2OCEA 4I76A 4BEHB 3QQAA 4Y13A 4GKJI 1GHCA 1N34E 3J80Q 5D5VB 3JRFA 1R36A 3N05A 2NN6C 4YHHI 4UUSA 1BI0A 4YIRX 2FNPA 2DFIA 2VJ5A 1TWHJ 5H2FC 3DLAA 5DRRA 4BE0A 2VQFE 3H92A 1DQUA 1VI0A 1KQ9A 4FW3A 4G6TB 2YX7A 3TBIA 4NXMI 1I6XA 3VPRA 4LG3A 1YYVA 1W5CC 2FBIA 4WUCA 1Z0BA 3GTGJ 3KP2A 1G3SA 4B43A 3UKGA 3U1DA 3A2KA 5AIQA 4I0BA 2HKJA 4A2UA 4GKKI 3OYJA 1DP7P 2V1DA 1SEUA 3MKLA 1HSTA 3SDGA 1X3UA 2L54A 2MH9A 5GTIC 3JW4A 4YELA 4D5FA 4V19K 4HNTA 2NYXA 1BJAA 1RPWA 5JHFA 2LH9A 2P6SA 3HGGA 4G94A 2M7BA 4PZJA 3R60A 3QPSA 3C1DA 2NVTJ 4E70A 2BOLA 2B63J 3WG7H 2HKXA 4EJWA 2WY8Q 5DTDA 3VOEA 5B3SH 3E7LA 3D0SA 1HNXE 2HDDA 3J7AY 2PNZA 1USUA 2F5DA 1K4TA 4OIOF 2GA1A 2LBFB 3I56I 2PEXA 2IA2A 3C2GA 2P0WA 5EJCA 2GA2A 3SEQA 2OV7A 4BU2A 4AD9A 1O57A 1GLNA 2VXDA 2LC2A 5B5EC 2QQ9A 4XONA 2XAGA 3L7WA 4YEJA 1KZHA 4QPOA 4O5VA 4EV0A 2JSPA 4IFDD 2F2EA 5CLSA 5DRQA 1N75A 3OYEA 3W6KB 3TL4X 1FC3A 5CQEA 3QP6A 3MKZA 1WJFA 5GPAA 3RKXA 2C37B 1XHKA 4OMZA 3ZQFA 1Y1WJ 1UCRA 2PN6A 3ESWB 1XMAA 2UUBI 2PQ8A 2CVEA 4BHPA 1BC7C 3RI4A 3EETA 2I10A 5D5UB 4JI4E 1TTYA 2NVXJ 1ZG1A 3BPXA 4IHXA 2IJLA 1X1BA 4DGWB 3K9TA 1MGTA 3GZ6A 4AIDA 4HDVA 2NS0A 3HOXJ 2PLYA 3GONA 1WI3A 3JAMZ 2KRCA 4O3MA 1WH7A 5EEHA 5LHGA 3PSIA 1T8IA 3S14J 4BJTA 4PDKA 1Z0GA 4M9XA 1JUPA 5E8GA 3HOUJ 2JVHA 4GDFA 4URLA 3MQ0A 2OA4A 4A3IJ 4Y3OA 1IO2A 2XAHA 4C2TA 3F23A 1XMOE 4F3QA 2C6YA 2DFEA 1MJAA 5A2QC 4II3A 2E7WA 3S8PA 2Q8KA 4ZYAA 1IG7A 4PCQA 2CG4A 1U78A 3R6SA 1NK3P 4M9ZA 4HX7A 4LF4I 3PFYA 4UY8I 2E60A 4DR7E 1NG6A 3GTOJ 3FM3A 3M1EA 2ELHA 2X9DA 1HKTA 2X7IA 3JAMQ 1Z0XA 3CF5F 1YFHA 2CV1A 2E71A 2O61A 1Z0WA 2CUJA 1HF0A 3OOUA 4JI5E 2WA0A 5JVTA 1EA6A 3REOA 3RCOA 2HYGD 5F1JA 1KVKA 1QA6A 2AXTC 1T39A 2LK2A 1IF1A 3TO6A 3K4CA 2HTJA 4CYDA 2QSGX 3ULQB 2E19A 3CDHA 4C3IJ 4YRVA 5FB2A 2HFSA 4CDGA 1BN5A 5EGOB 3IAM2 4PSWA 4J3DA 2KIUA 2OU2A 3KZYA 2VOPA 4MU1A 4ENMA 3JRAA 3CDJA 1EKEA 3V7CA 3ZM7A 2W7NA 3J80K 4MYUA 3OYDA 2NPFA 1X3ZB 3F6OA 3Q0WA 1XSXA 3WODF 1X1PA 5LGTA 3M8EA 4OWRB 1PUEE 4XLFA 1HC8A 2PNLA 2HKEA 2CUFA 3J80C 3K4LA 4WXCA 4DR1I 4BJ6C 4USKA 3DBHB 4RLFA 1SAUA 4IO9F 2BY2A 4PJNA 1Z0CA 2E36A 2STWA 4IZKA 4DPYA 2IAIA 4RM3A 4IQJA 3GW2A 2IVMA 1KYWA 3P3EA 2VKHA 4JV5I 1IN5A 5L3FA 3F21A 3GYHX 4OMYA 3AAFA 2WWYA 1I5ZA 1MZBA 3JRDA 2QKLB 3CLQA 4DUZE 2HVQA 2VBZA 1R6RA 3CJRB 2ZJQF 3PJRA 1PKPA 1Z0VA 1Z59A 3HJCA 4L5EA 2GXAA 1FYLA 1XC5A 2OTJI 1ON2A 5EDNA 1P4WA 4WF2A 1WPKA 2EFNA 3IWZA 4JI3E 2CQXA 4OU0A 3WTXC 3OS0A 2QEXI 3S3MA 1MMSA 5DM6F 2UU9E 4BBRJ 1MMNA 2F5CA 4E7IA 2WNRA 1Z0TA 2HVSA 3CLOA 4UUVA 3Q0UA 2EQRA 4DV0E 3CP8A 4KN4X 5L3BA 2Z5BA 2EWNA 4A6EA 3ISPA 3V8LA 1TZLA 1OR7C 4B1RA 4J19A 4KDPA 5F0FA 3NQOA 3PQKA 2HGCA 4OO1D 1KU9A 4I99C 4LIUA 2VT3A 1Y0UA 3BR6A 4RBOA 1T6SA 2EFQA 3S1MJ 2UUZA 2DU9A 4XN0A 1RC9A 4LF8E 4MHGA 1QVUA 4RDUA 2P7CB 3H1CA 1A36A 1I1GA 2Z5EA 1MX0A 5HNHA 3HYIA 1LQ1A 3LOCA 4DZPA 3L7ZB 1XGOA 2BA1D 4XKVA 3LNQA 4GGGA 3ZR8X 3P3CA 2BYVE 3ELKA 3RIRA 3FM5A 3DEWA 4X1EA 2OUMA 3T1BA 2IS1A 1R5GA 1Z91A 2WW4A 3QP5A 1IW7F 1J5YA 2VC1A 4LD5A 3BJOA 1V5GA 4RS8A 1UB9A 4I3HA 2AQEA 4XKCA 4DIQA 2KRFA 3QYFA 4OAYA 2K3FA 2KHMA 4DR6E 2CH0A 2UXNA 6PAXA 5DCMA 2CJJA 3QPTA 3F0NA 1SD5A 2JPBA 3MAJA 2F4MB 4M9SA 3QT6A 2HYFA 2I5UA 4KA4A 2XGXA 2V9KA 4DW6A 4ZZLA 5F0CA 3AG2H 4DV5I 2KPMA 4EM0B 5IP9J 2QSHX 1YLFA 1FNMA 3HHGA 2GIVA 1W36C 2HPMA 5ERIA 3WE2A 4EMDA 3QT8A 3M6AA 1HK7A 4Q48A 4AC0A 1HW2A 3CDLA 2UXCE 4PK4A 2MYSA 1S5LC 1XMXA 4XN3A 2R3VA 1OYWA 1ZH5A 1Y60A 4HEA2 1YJNI 2DDAA 3H9JA 1MMGA 2RNGA 2UUAI 2X6YA 2D1VA 4NC7A 1BI1A 2L5QA 4XRSA 1CF7A 2MABA 5BQTA 2DODA 2JSCA 4ON0A 4A3DJ 3BP8A 2H09A 3OL3A 5D8LB 2XC7A 1YI2I 3Q5FA 1D1AA 4PJ0C 1OFCX 1QZYA 4AQYE 1T98A 4I02A 2M45A 1IRXA 4IQ4A 2M8EA 3SDBA 4BUPA 3HOSA 2NRAC 5FJ8J 1OJ4A 1QZRA 4EVIA 1LNWA 1IN8A 4ENNA 2CW7A 2LSOA 3KE2A 3M07A 4XRFA 4Y17A 5IP6A 5JEAC 2LNBA 2CFOA 2H94A 5FROA 3U21A 1WHUA 3N97A 1RR7A 1Z67A 2ZSHB 2DEJA 3F8CA 1P92A 3P06A 3BY6A 4KJZA 1G59A 3JTGA 2Y69H 2A3SA 1NTCA 1R58A 3FXLA 2L9VA 2X6XA 5E17F 1I50J 1FY7A 1MBHA 2MGQA 4RAZA 4P5OA 3L00A 4ZYDA 1IRGA 1P42A 4XKBA 3HUGA 3WU3A 3QPHA 3K85A 3LL7A 1VQOI 3WE3A 4HQEA 2OPTA 1AHDP 4YIFA 1OMIA 3E5UA 5AONA 2UUAE 3HOWJ 1WGXA 2H1KA 2A61A 4HYEA 4U0VA 1RUOA 1FSHA 3GTPJ 4KISA 3ZRGA 2JRMA 1A5JA 2YR2A 2ZMEC 4FISA 3S1QJ 4M6VA 4CA0A 4AIKA 4R1HA 3OWTA 4G7OF 1AKHA 4DPUA 2VQGA 2IP2A 2Q0OA 3TOAA 3F8BA 1PJRA 2HK3A 4DV7I 4IJAA 1A31A 5IT9Q 4IOCF 4HACB 2VE9A 2VQHA 2MSYA 5M5YJ 2HR3A 4IZJB 1W4MA 2CQNA 2WBMA 1TC3C 2WB1N 1XPXA 4DUYE 3D5LA 1LVAA 4U7DA 2R7OA 3CTAA 1YITI 4M71A 3NEUA 1XCVA 1EH6A 1R1TA 1V54H 4YFNF 1SVOA 1EJ9A 5HODA 1ONVA 1ZG3A 2CQKA 2OC6A 2PFBA 1AWCA 3EYIA 3HSFA 2V7FA 2K27A 1T0FC 3BDDA 3GTJJ 1VQNI 1XDSA 1ZLKA 2DMNA 1LJ9A 1XS9A 3SXYA 2V4JC 1CGPA 4RGUA 2ZM6E 3CCRI 4LCFA 2HOAA 2JQ7A 2YX4A 1G6NA 2ICWG 2VXZA 2DK8A 3LFKA 5JLWA 3F72A 1XNQE 2YU3A 1FNNA 2BGCA 5BOXA 1KTVA 1N0VC 3LA7A 1OCCH 2FMYA 1R6LA 3LWFA 4LFAI 3OL4A 1T2KA 2AQFA 2X48A 4G7ZF 3RKQA 3QYBA 1D1BA 4ZYEA 2JN6A 5IWAI 4ESJA 2UV1A 4JYKA 3V7RA 3GF2A 3HOTA 2OI2A 1KONA 5EYRA 4BXXJ 3WTVC 3DBRB 2H1LA 2MW8A 3OYAA 4JI5I 1QHHD 2RGVA 1J2XA 3S1RJ 3G6EI 1E0EA 3I71A 2M0CA 1X3WB 3VEPA 4DR3E 1YW7A 4LCHA 3CUQA 1EV7A 4I01A 3IAS2 3H9GA 3GFJA 2Z9OA 1YH8A 3ONQA 4IXAA 1VQ5I 2W48A 1MJBA 5HLIA 1VQ9I 3BPVA 1TNSA 3ZMSA 4CYCA 2BM1A 1MD0A 1TNTA 5TISC 5JEAD 1ZGAA 2BVLA 2V79A 5BNGA 1D0XA 4LIVA 1ETOA 4HQMA 3S2DJ 4CCJA 4W1UA 2HFHA 5LD2C 2V2VA 1H74A 1LKXA 2VT2A 3PNTA 1DDNA 4HDUA 3DXJF 5FD5A 5TJJA 1J09A 2QSFX 3O3KA 4X62I 1LPQA 2DA7A 2DA3A 2VQCA 3IKVA 2FSWA 3ZZUA 2CSOA 1JT6A 1S8NA 3EDPA 4EM2A 2OQRA 1KU7A 3K10A 3KEOA 1MSEC 1UDOA 2LP0A 3CD6I 3ABMH 3H5AA 4MYTA 2D2WA 2CV0A 5ILUA 4B3SE 5FKLA 4DV4E 4OZEA 2R7FA 2DOFA 4UTGA 3HOYJ 2HHHI 2P5VA 1QRYA 2IEKA 3S3NA 4JBAA 2M5WA 4MU0A 4I0AA 1D5VA 4IRIA 2XB5A 2F1DA 3OR2C 3IRRA 3RKYA 2Z5CB 1L0OC 4ETSA 4XMYA 5ICEA 5HNFA 1F43A 2NOGA 3WU6A 3J7AG 2FUG2 3HOZJ 4U3DA 3R4KA 4P52A 2C38B 3DP7A 4KIGA 2JEAB 4ZDOA 2STTA 2L01A 2FBHA 5D6EA 4L0YB 1SFXA 3ECHA 3K6GA 2ZBKA 3OYGA 2Y9YA 2TCTA 2DJIA 3HRMA 5DNLA 4USMA 5LMNI 2EIMH 2ZJ2A 1H89C 1LE8B 4YG2F 4IFDC 2CQ7A 4NXNI 2WP8A 1XG1A 3CUQB 1I39A 3CCUI 4MU4A 3R0JA 1JKPC 2HZDA 1X1CA 3H9QA 3RKWA 4EJOA 3OS2A 2X85A 5D6FA 3ECOA 3ZGKA 3MKWB 1R6MA 5GAEJ 2DAOA 1BJZA 5F1RA 1Q1HA 3H35A 4XORA 4LK1F 1ULYA 4D1QA 1FIPA 2BR2B 4FW4A 3QOPA 4A0XA 1ZR4A 2XAFA 4LLLA 3LFUA 3OYHA 4OINF 2O8KA 2O1WA 3FXKA 1I27A 4EGZA 5B1BH 4NHJA 2ZFWA 4RA2A 1BIAA 1K78B 4BNCA 2A2CA 3K2ZA 3E1SA 2PNZB 4B3MI 4HAMA 2LVSA 1K6OA 1ZRCA 2DMPA 4XLPF 1UJ8A 2P7VB 2Y2ZA 1D8JA 4OO1B 3OYIA 3OR1C 4U88A 5FKMA 1TP4A 3JAMC 4IPAA 4KT5C 4C9YA 4A0ZA 4S04A 1YJWI 1SFEA 2XAQA 2KRHA 5HDKA 5C0XD 1PVGA 3HGYA 5K5RA 5E3OA 3OYBA 3LTOA 2NS7A 2QUFA 2LF8A 2ZM6I 3MMYB 1R5HA 3KIOA 1JT0A 1MIJA 3QYEA 2FA5A 3GMEA 4CCKA 1D0ZA 1ZN2A 1K7AA 2PJPA 1FWKA 4JYAI 2V6CA 1FYKA 4PRXA 3Q1QA 1HNXI 2LBFA 2ZXJA 2DA4A 3D5RC 2VJJA 4IZJA 2JMWA 3G1MA 4B4CA 2DT7B 3IV5A 3K1MA 2EV6A 4UHTA 4KITB 5LMUE 4CSWA 2IA0A 2VB6A 3FKIJ 3FWEA 1OJLA 5DUIA 4DZJA 3WTYC 2NN6A 2EH3A 3LSPA 5ILSA 3VODA 5FLVA 1JTXA 2O9LA 3BTIA 3ZN0A 2F5EA 3I3LA 3HM5A 4LF4E 2J5OA 1Z6RA 1Z5AA 3H36A 1WH5A 3H3VK 4NQWA 1D6TA 1B72B 1I3AA 5JVGF 4GKKE 5CVRA 1OYPA 3PS2A 4BGDA 3Q0VA 1QZZA 1MBGA 3CZ6A 5FFZA 1Y56A 4XL9A 1E3PA 3K4NA 2PO0B 4GYGA 3WG9A 2W82A 1P7IA 3KEYA 4A93J 2EZIA 2BY0A 5F0HA 2QBYB 5LBQA 3W2VA 2Z2SB 5GAHJ 4JI7E 2F48A 1KKHA 2M30A 1IXRC 3JRHA 1WJAA 4DV2I 1S16A 3CESA 1BL0A 1HBXG 2TRTA 3DKWA 3TW7A 2O3ZA 2FQ4A 2IGKA 1K4SA 1VQMI 1XGMA 1VQ4I 1RESA 3ZCOA 1LUJB 4B3TI 3ZN1A 1P4AA 4A3KJ 4HF2A 4E7KA 3K1NA 2F4OB 4TV7A 3MZHA 3FXRA 3QU6A 1UDNA 5K5OA 1HSJA 1B72A 2ADUA 3ABLH 1Z5CA 1G3YA 5DCMB 2VKVA 2OJED 3M7GA 4XIDA 1E3HA 1U2RA 1IXSB 1B59A 4CH7A 3PYGA 2C39A 4DPTA 4L9JA 4A5MA 1YIJI 3IUOA 5DD4A 5TGTA 3S1NJ 1FIAA 1FJGI 3I55I 4G9YA 4ANJA 3B4TA 4CO8A 1AOYA 1PIEA 2XGDA 4B47A 2QBYA 2HOSA 5E20A 2X1EA 3QOEA 5K5QA 2UU9I 3J7YJ 4FCYA 1JTYA 1SANA 1VZ0A 3I64A 1B9NA 5E1XA 4ABZA 3OTOE 4MU3A 4DYQA 3ZZTA 1IBME 3GVAA 2ETHA 4F93B 4HF1A 3HIFA 2G7HA 1RR8C 2E5LE 3LA3A 3MZ8A 1LB2A 9ANTA 4PGGA 1NHHA 4R79A 2M4KA 2UXDI 2JVGA 4Z7YA 5J4YA 5F04A 1RHYA 4DU7A 1X19A 4ESBA 2O0YA 5FKKA 4U87A 1BOAA 1H9GA 2B9SA 1WUUA 2LOOA 3AFHA 4HACA 4X64I 1FJLA 5C0XC 4AWXB 4E7HA 2M87A 1OYYA 3RZDJ 2Q2EB 2M4GA 3CF2A 3VSKA 5FRMA 3L9FA 2HVRA 1JKRC 3FISA 4HBLA 2F4VE 5D4SA 1SC7A 1HDDC 2VL8A 2MC4A
chains in the Genus database with same CATH topology
2BA0D 2BA1D 2NN6A 2PO2A 5C0XF 3DD6A 2PO0A 4OO1C 3M85D 3H36A 4AIMA 5JEAB 1OYPA 3HKMA 4OO1F 1UDQA 2JE6B 2PO2B 5K36F 1E3PA 2PO0B 3M7ND 2C38B 5JEAE 2JEAB 5JEAA 2WNRB 2PO1A 2PO1B 4IFDF 2JEBB 5K36C 4OO1A 4IFDA 4IFDB 4IFDC 3CDJA 2WP8A 2BA0G 2BA1G 4BA1A 2PNZA 5C0XA 2NN6B 5C0XE 5K36D 4BA2A 4BA2B 1UDNA 1R6MA 2JEAA 3KRNA 3U1KA 3GLLA 2BR2B 1OYSA 1R6LA 2NN6E 5C0XB 1E3HA 2C39A 4IFDD 4OO1E 4NBQA 2C37B 3B4TA 2PNZB 2JE6A 2JEBA 1UDSA 5K36B 4OO1B 3GCMA 2C38A 5JEAC 2NN6D 4AIDA 1WHUA 3M85G 2WNRA 5JEAF 3L7ZA 4AM3A 5C0XD 5K36E 5K36A 4IFDE 5JEAD 2WP8B 1OYRA 4BA1B 4OO1D 3M7NG 3GMEA 5C0XC 2C39B 3CDIA 3H1CA 2C37A 2NN6F 1UDOA 2BR2A 3L7ZB 2NN6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA0 D;  2BA1 D;  2NN6 A;  2PO2 A;  5C0X F;  3DD6 A;  2PO0 A;  4OO1 C;  3M85 D;  3H36 A;  4AIM A;  5JEA B;  1OYP A;  3HKM A;  4OO1 F;  1UDQ A;  2JE6 B;  2PO2 B;  5K36 F;  1E3P A;  2PO0 B;  3M7N D;  2C38 B;  5JEA E;  2JEA B;  5JEA A;  2WNR B;  2PO1 A;  2PO1 B;  4IFD F;  2JEB B;  5K36 C;  4OO1 A;  4IFD A;  4IFD B;  4IFD C;  3CDJ A;  2WP8 A;  2BA0 G;  2BA1 G;  4BA1 A;  2PNZ A;  5C0X A;  2NN6 B;  5C0X E;  5K36 D;  4BA2 A;  4BA2 B;  1UDN A;  1R6M A;  2JEA A;  3KRN A;  3U1K A;  3GLL A;  2BR2 B;  1OYS A;  1R6L A;  2NN6 E;  5C0X B;  1E3H A;  2C39 A;  4IFD D;  4OO1 E;  4NBQ A;  2C37 B;  3B4T A;  2PNZ B;  2JE6 A;  2JEB A;  1UDS A;  5K36 B;  4OO1 B;  3GCM A;  2C38 A;  5JEA C;  2NN6 D;  4AID A;  1WHU A;  3M85 G;  2WNR A;  5JEA F;  3L7Z A;  4AM3 A;  5C0X D;  5K36 E;  5K36 A;  4IFD E;  5JEA D;  2WP8 B;  1OYR A;  4BA1 B;  4OO1 D;  3M7N G;  3GME A;  5C0X C;  2C39 B;  3CDI A;  3H1C A;  2C37 A;  2NN6 F;  1UDO A;  2BR2 A;  3L7Z B;  2NN6 C; 
#chains in the Genus database with same CATH topology
 4RGS A;  5H6R A;  2KMU A;  2ZME B;  2BY3 A;  3DU5 A;  4RPF A;  3M1C A;  5FLM J;  2NVY J;  3DD6 A;  2E1O A;  4HNU A;  2DI3 A;  4M3B A;  1RZ4 A;  1OLT A;  4M3G A;  4L9N A;  2CS3 A;  1PP8 F;  2F4V I;  4PJM A;  4GKJ E;  3BT9 A;  1FWL A;  2IRF G;  2FU4 A;  1UAA A;  1XNR I;  3DPL C;  4I2O A;  1HNZ I;  2HS5 A;  2XKO A;  3BG3 A;  4CGZ A;  4DV4 I;  2P5L C;  4V2G A;  3PSF A;  1Y8R B;  1UFM A;  4S0H B;  2KIM A;  3GXO A;  3R0A A;  3HC7 A;  1J5E E;  1XNR E;  1MNE A;  3F22 A;  1LDK B;  2BV6 A;  2LF7 A;  3A4C A;  1V4R A;  2A68 F;  4JI3 I;  2EBI A;  5C4X J;  3S2H J;  2CV2 A;  4IZK B;  2WV0 A;  1A04 A;  1W7P D;  5F08 A;  4EQQ A;  3ML6 A;  4QLC U;  2K7L A;  3D5S C;  4EJV A;  4LF5 E;  4FQG A;  4BS9 A;  3CC2 I;  5K36 C;  4U0W A;  4A0Y A;  5M3F J;  3ZMV A;  3HKZ N;  4W97 A;  4XRM A;  1K6Y A;  2M7A A;  4E7S A;  1GDT A;  1STZ A;  4WUD A;  4M3D A;  4LG0 B;  2P6T A;  3RDI A;  4HW0 A;  4C3H J;  4D5C A;  2DA6 A;  3CCY A;  4DV2 E;  2VJI A;  1V5E A;  1YIO A;  1Z1D A;  2P5K A;  4F92 B;  4X64 E;  3T1H E;  2DOE A;  3FXM A;  1MBJ A;  3RPU D;  4XQF A;  5LMU I;  1QPI A;  3ZQG A;  3WTT C;  3BG7 A;  3ZQL A;  1X1A A;  2W57 A;  3KRN A;  4DU8 A;  4NC8 A;  1Z7L A;  3J80 Z;  1F1Z A;  1K47 A;  1YW8 A;  2JK3 A;  5FLX Z;  4J01 A;  2YU9 J;  5E3L A;  2NN6 E;  3VYU B;  4BQN A;  4QSH A;  3E5Q A;  4PJL A;  1ODD A;  2GQQ A;  5HDG A;  4A3E J;  1XMK A;  3NAR A;  2XVC A;  2IES A;  5L3E A;  2XAJ A;  3U2R A;  1LFB A;  2KZG A;  2HI3 A;  3RYR A;  3MFK A;  1ZM9 A;  4WCG A;  1ZRE A;  2ZSI B;  4LFB I;  3F9K A;  1ZAO A;  3BQZ A;  2Y0M A;  3HRT A;  4A12 A;  4KFC A;  2DFF A;  2GZW A;  3QRF F;  4LF6 I;  4NNJ A;  4UB6 C;  2WY7 Q;  1A35 A;  4U3B A;  2UXD E;  3LMM A;  3A1Y A;  2K4J A;  4LFC E;  2VOO A;  1UHM A;  3Q9V A;  1LDD A;  2HKO A;  2LFB A;  5L3D A;  1OCT C;  3M85 G;  3ZZ0 A;  3KLO A;  4F55 A;  1U5T A;  4B3R E;  1JJ8 C;  1W0U A;  2MH2 A;  4IX7 A;  4DV3 E;  3ZMU A;  3BR2 A;  4HOB A;  2IPQ X;  4UNO A;  2CMP A;  2E5L I;  2ISZ A;  4P96 A;  2RQP A;  3FDY A;  5LFA A;  2WP8 B;  2VIX A;  1K83 J;  1NH3 A;  4JI8 I;  4BQQ A;  1YHC A;  3WHB A;  1E3O C;  2ZO4 A;  2L4M A;  3GTQ J;  4LF9 E;  3T8T A;  2QWW A;  2PMZ N;  4FTH A;  5LRR A;  4A3C J;  2XEX A;  1UST A;  4LCG A;  1U3E M;  5EEG A;  3VDX A;  4DR4 I;  4JX4 A;  3JRC A;  2O1U A;  3LQR A;  1W5T A;  3I4P A;  2M0M A;  2F5F A;  5DEQ A;  2IW5 A;  1XNQ I;  1HNZ E;  3SFI A;  2W84 A;  5A2Q Z;  2CWE A;  3JRG A;  2CFX A;  1I94 E;  1T0F A;  2G0E A;  2YPR A;  2LKP A;  1OCZ H;  1TT0 A;  2DBB A;  2DOA A;  1GUU A;  2WAF A;  3WTZ A;  4DV6 I;  1QNT A;  3ZQQ A;  1FMV A;  3OTO I;  1YQA A;  4HRI A;  2KKO A;  2V26 A;  3MD2 A;  1USV A;  2ELK A;  3GTM J;  3K69 A;  2KP6 A;  1A6Q A;  3W6V A;  2Y48 A;  2JT2 A;  3DTE A;  2XIG A;  2WNR B;  3BTJ A;  3C3W A;  3T5X A;  4BL0 B;  4YY3 I;  2E5N A;  2IS6 A;  2PO1 B;  2HQR A;  3C2B A;  1Y39 A;  3H5R A;  2HEO A;  4LLN A;  4HNV A;  2FD5 A;  3PS3 A;  4PU9 A;  3RQI A;  3OY9 A;  3WU0 A;  3SJM A;  4AIJ A;  4IHS A;  2UWM A;  4YY3 E;  4KHP E;  5D4R A;  1DUX C;  3G3Z A;  4HYM A;  3LSM A;  2IGN A;  3K2A A;  2W24 A;  3A0H C;  1HKS A;  3K70 C;  1FOK A;  1UEK A;  4O6J A;  4CZC A;  3ABK H;  1N78 A;  5CVU A;  2LD5 A;  2ECB A;  3GWZ A;  5J6X A;  4DYR A;  2FJ1 A;  3PL8 A;  4X62 E;  3A01 B;  3GZN B;  3CCL I;  4Q5S F;  2V2Q A;  2M3A A;  3MVP A;  3KPH A;  1ZR2 A;  4FWD A;  4OO1 E;  1LFP A;  3K7A J;  2GBY A;  5DNX A;  2K02 A;  3RYP A;  1F4K A;  3S2W A;  1X2M A;  3FXQ A;  3OIO A;  3V5R A;  1HKQ A;  2GXG A;  2R7Z J;  4XLC A;  4CCL A;  3RTR A;  3AKZ A;  1I1S A;  2DLL A;  3I4M J;  3W3C A;  5KHD A;  3BR0 A;  4P1W A;  4NC6 A;  3O2P E;  3LPS A;  1TQI A;  4RMN A;  1YW9 A;  5LLQ A;  3FMS A;  5IYC J;  3CCJ I;  1TBX A;  3RZO J;  2L4A A;  4DV1 E;  1IXC A;  3FIW A;  2FOK A;  4C3J J;  1JI8 A;  1Y4S A;  2QQA A;  5JEA F;  3DKY A;  1QPM A;  4LK0 F;  3V4G A;  3ZMZ A;  1VIS A;  1O3R A;  2UXX A;  1WKM A;  1MW7 A;  3SZG A;  4FW5 A;  4KT6 A;  4D7N A;  2ACJ A;  5GPC A;  1H88 C;  4KUM A;  3TDZ C;  2HQ5 A;  4RGR A;  1ZRF A;  2EZK A;  1X2N A;  3LSJ A;  5BMZ A;  4G7H F;  2KQR A;  3GO5 A;  3HKZ A;  3DEU A;  3GTK J;  1GV2 A;  4JI0 E;  3FHZ A;  1ERD A;  3NWS A;  4N0B A;  1LEB A;  2M8G X;  3IHU A;  4JQF A;  5KCM A;  2KIS A;  1IRF A;  4FWG A;  1HLV A;  1IBK I;  2FEZ A;  5J40 A;  1Z6T A;  4U7B A;  4FX0 A;  2UZK A;  2BXY A;  3CWV A;  1KIJ A;  1H8A C;  1G3W A;  3ABT A;  4BY7 J;  2EV5 A;  1DPR A;  5CVI A;  2EIK H;  2FX0 A;  1HXD A;  3GEZ A;  4JX5 A;  5A2Q K;  1O3Q A;  3HKM A;  4A69 C;  1P4X A;  4IKF A;  2GO4 A;  1YO5 C;  3B82 A;  2VQF I;  2PO2 B;  1QZE A;  2MBF A;  4LFB E;  5K36 F;  5JFR A;  1YOV B;  2BV3 A;  2M2E A;  3NWT A;  4ZJZ A;  2QVO A;  3FX3 A;  2DN0 A;  2XPW A;  3HZJ A;  3IH2 A;  1T95 A;  2E5Z A;  4XNF A;  4DQ2 A;  3LSR A;  4JI6 I;  1QO0 D;  3ZPL A;  3GBG A;  3VYT B;  5FRN A;  4GQU A;  5GMD A;  2LKX A;  2IXS A;  2ME6 A;  3NZK A;  1X4O A;  2L9N A;  4HX4 A;  4BQA A;  3E3V A;  4LFU A;  1R1U A;  2M34 A;  3Q9S A;  5HVQ C;  3KET A;  3B6C A;  1XMQ I;  4BJ5 C;  3OSG A;  1H73 A;  1TQM A;  3JRB A;  3BZK A;  5D8K B;  1FBS A;  4DBR A;  3KP6 A;  2DCE A;  2E1R A;  3SFZ A;  3G71 I;  2EPF A;  4DR5 I;  2J5P A;  2H6B A;  2ZXH A;  1R00 A;  4DR4 E;  4B44 A;  4GXO A;  4P9F A;  3SEZ A;  4CZZ A;  4Z7C A;  1S3J A;  4C30 A;  1TW3 A;  1WZ2 A;  2EIJ H;  2JEA A;  4XLN F;  1R1V A;  1XX5 A;  2A6T A;  1Z3X A;  1ZXM A;  3TKY A;  4EAT A;  4N9I A;  4XIC A;  5IT9 K;  1OYS A;  3K70 D;  2H27 A;  4IZZ A;  2ZME A;  1SMY F;  1U5T C;  3W6J B;  1U9N A;  3PM1 A;  4CIC A;  1UEL B;  2V1X A;  1WI9 A;  2ESN A;  4Y4R A;  2QKM B;  1XGS A;  4WUB A;  3IC7 A;  1L3L A;  2CUE A;  1IRZ A;  4EEF G;  3PIP F;  3EPZ A;  4Z2Y A;  5E18 F;  4JV5 E;  2OZ6 A;  3TOB A;  5CJ9 A;  1PUF B;  2MLK A;  1WJE A;  2JUC A;  1REP C;  3W2W A;  2BY1 A;  4M3E A;  4N9H A;  4HLY A;  3MZY A;  4QNK A;  4BE1 A;  3T0Y A;  2Q1Z B;  2UXB E;  4X6A J;  1OKR A;  2R42 A;  3CUQ C;  4JI4 I;  5LGU A;  3J7A O;  1DGW Y;  3WU5 A;  1GXQ A;  4MIM A;  5LGN A;  1GXP A;  1XMQ E;  2KDZ A;  2AS5 F;  1U6G A;  3K4M A;  1C0W A;  1RET A;  3LAP A;  3GTL J;  3IL2 A;  1N32 I;  1FSE A;  4GO1 A;  2XAU A;  3A03 A;  2R7S A;  3DWL E;  3PNY A;  1X4P A;  1R4N B;  1YS6 A;  1YX3 A;  3S17 J;  3HUL A;  2P4W A;  5EGO A;  3J7A M;  1FMW A;  1J9I A;  1G2H A;  1Z7U A;  1YE9 A;  3V8J A;  3DTI A;  1BR2 A;  2V1U A;  2EZL A;  2ID6 A;  4G6D A;  3T1Y I;  4AVP A;  2HXI A;  2BW3 A;  1WCM J;  4RGX A;  2R7W A;  2JA7 J;  1NHJ A;  4FE7 A;  4RAG A;  3T8R A;  4BH9 A;  4E4H A;  1VQ7 I;  2BA0 D;  5IOZ A;  4WWC A;  3SQN A;  3F3X A;  1FP2 A;  5C0X F;  1FJG E;  3GFM A;  4AYB A;  3BTL A;  3RPQ A;  2PO0 A;  4XTJ A;  1P6R A;  1I3Q J;  1UHW A;  1TLH B;  2DTZ A;  2JRT A;  5EZH A;  3S32 A;  2A07 F;  2UUB E;  3TO7 A;  4LG0 A;  2EIN H;  2Z99 A;  3B73 A;  2WAD A;  1POG A;  1UG2 A;  2IGO A;  2XV4 S;  2XUB A;  2YSR A;  2Y9Z A;  2JE6 B;  2JPC A;  4DR6 I;  3FXO A;  4II2 A;  2EA4 A;  5IYD J;  3ABU A;  1PVE A;  1XSD A;  2KJC A;  1YS7 A;  1Y6Z A;  4ZH4 F;  2DPD A;  2VPL A;  5JEA E;  1MBE A;  1O3S A;  5GP9 A;  3U1Y A;  2BBY A;  2RV8 A;  4E7Z A;  5B1A H;  2XF6 A;  3CMY A;  1PYV A;  1U2W A;  1PUF A;  1NK2 P;  1XDU A;  1B9M A;  1WSU A;  1IN6 A;  5KVR A;  1W0T A;  5C4J J;  5TRD A;  5ED4 A;  1ZQ3 P;  1K78 A;  2PBI A;  4X0G A;  1IBL E;  4JI2 E;  3E6D A;  2NVU B;  3O6B B;  2LDU A;  2B0L A;  1Z5B A;  1WVR A;  2JZY A;  3P5J A;  1VND A;  3WTU C;  4JI0 I;  4KMF A;  2E2I J;  2BEO A;  3DBL B;  3WGI A;  3BQY A;  1X58 A;  3HJE A;  2X6W A;  3FXU A;  5EZG A;  4AIH A;  1YHQ I;  3JSO A;  1HNW I;  4YFK F;  1IUF A;  4LF7 E;  4B3S I;  2VBY A;  2L7K A;  5DYM A;  3OYN A;  4XM3 A;  1AA7 A;  1RR9 A;  3E97 A;  4AU7 A;  3OYC A;  4LJZ F;  1DGR M;  1E17 A;  1B8I B;  3IH4 A;  1ZLJ A;  1HQC A;  3EUH A;  2Z1D A;  4NXM E;  3HXL A;  3DKX A;  4BDZ A;  1TQP A;  3GLX A;  3GZ5 A;  2LMD A;  2DPU A;  1QGP A;  3D4J A;  1FYM A;  1ZTR A;  2XPU A;  2C38 A;  2X36 A;  2A2D A;  1B1B A;  4IRG A;  3ASO H;  3DU6 A;  1VQP I;  3BG6 A;  2DDB A;  1FX7 A;  1Y1V J;  3CJT B;  1IAW A;  4HST A;  1RI7 A;  2ISY A;  4V2F A;  3P7N A;  4WX9 A;  1N0U A;  2R7X A;  4XSX F;  2ZFU A;  5IYB J;  4JI7 I;  4HG2 A;  4CYC B;  5FLX Q;  2KIQ A;  2HTS A;  1TWF J;  1S72 I;  5DRP A;  3A01 A;  3HG9 A;  3OS1 A;  2HOT A;  2O1T A;  4DPW A;  3K4J A;  5HLT A;  4ENJ A;  3OSF A;  1IV6 A;  4DV3 I;  4DV0 I;  1A6I A;  3TW6 A;  3E5X A;  5H6Q A;  1QU3 A;  5BPI A;  5EG0 B;  5GME A;  3V2U C;  4DR1 E;  1APL C;  2W00 A;  1ETV A;  2Z33 A;  2CQQ A;  2VBW A;  1KYZ A;  3UHM A;  2C37 A;  4MFE A;  4PRV A;  4UB8 C;  3COA C;  3EYY A;  1ITY A;  3ZP5 A;  2A05 A;  2WC2 A;  5GTH C;  1S4E A;  1H7S A;  2CRG A;  3R61 A;  5HLH A;  1S9H A;  1YG2 A;  5J47 A;  4E7L A;  1IZ1 A;  5F64 A;  2H8W A;  2NS8 A;  1ZKG A;  2ZXW H;  1Y4U A;  4EJU A;  3KYC B;  5L3G A;  3ZMD A;  5M3M J;  1DAR A;  1ZEL A;  3I59 A;  2FXA A;  2YUS A;  4GRI A;  2V34 A;  4DXL A;  2DMT A;  2F5V A;  3QAH A;  5BR8 E;  2Q2E A;  3UNG C;  4B3M E;  4AQY I;  3EQL F;  1ETQ A;  2QF7 A;  2H6C A;  3BR3 A;  4RAF A;  3NRV A;  4ENK A;  1RIO H;  1SFK A;  3C2H A;  1B63 A;  2OD5 A;  1T08 B;  1QHG A;  3L09 A;  1Z9C A;  2R3S A;  2R92 J;  3PS1 A;  2E1M C;  4MTD A;  3ZKD A;  5FKO A;  2FQ3 A;  3L2C A;  2ZCW A;  4A3L J;  3K1J A;  1DPU A;  4IZJ D;  5CVV A;  1HW1 A;  3KZI C;  2ZNY A;  4HPQ A;  1FOY A;  1ZG5 A;  1MNM C;  1P2F A;  4LF5 I;  4LOC A;  4BA1 A;  4OX9 E;  5M5W J;  4UV8 A;  1XB4 A;  5KAF C;  2RQQ A;  5K36 D;  1BC8 C;  2Y30 A;  3ERM A;  1E2X A;  3CO7 C;  3HDD A;  3VWB A;  1DU6 A;  2CZ9 A;  2OBP A;  1F36 A;  3BR5 A;  2ECC A;  2HDW A;  3V42 A;  1H0M A;  4DV5 E;  1Y0N A;  4N4O B;  2VN2 A;  3VYS B;  4RB3 C;  1Y5Y A;  4DYC A;  1HDP A;  1H72 C;  3T1H I;  4A3M J;  1IN7 A;  5E3N A;  4PJJ A;  1S7A A;  3LSK A;  3CCS I;  5C0X B;  4PFP A;  3S16 J;  1WJC A;  3C7J A;  4JI1 E;  1T38 A;  4JX6 A;  2EFG A;  5J8C A;  3HOV J;  1ON1 A;  4I7H A;  5IPA A;  4NBQ A;  3F8F A;  2J7K A;  1UHS A;  2L7F P;  2WAE A;  2FNA A;  3H0D A;  1NZ0 A;  2PX9 A;  3BRO A;  3PFI A;  4QPQ A;  1V5F A;  4IVN A;  1KQ8 A;  2E34 A;  1N33 E;  1IN4 A;  4ZDL A;  3S3O A;  1UDS A;  2X6O A;  4XLH A;  3HSE A;  3ZOB A;  2DA1 A;  1VF9 A;  2OQG A;  5BPD A;  3DEE A;  2VLA A;  4MTE A;  4IHW A;  5IT9 C;  4ISA A;  1N36 I;  2NN6 D;  3B02 A;  3O8G A;  2JUG A;  4DJA A;  1W5S A;  4EM1 A;  1BIB A;  2X1C A;  4IHV A;  1IDZ A;  5K7Z A;  3HUG B;  3J81 Z;  4MEX F;  2K9Q A;  3CQZ J;  4RAY A;  2QQB A;  1U0J A;  1BI2 A;  3KX2 A;  1XMO I;  4KHP I;  2KLO A;  4DNC A;  5L3C A;  1B8I A;  1W7P B;  4YFX F;  4IFD E;  5E3M A;  4Y52 J;  4HY1 A;  3ZQ7 A;  4F52 A;  3BZC A;  1YRN A;  4RLQ A;  4QIW N;  3JR9 A;  2FE3 A;  3CCV I;  3ASN H;  3H4L A;  3F6V A;  2DMQ A;  1R71 A;  5DD8 A;  5CPR B;  2HDC A;  5IOY A;  4B3T E;  2R93 J;  4UVA A;  1TL8 A;  3OOP A;  1ETK A;  3LSG A;  2VI6 A;  4FAS D;  5DRO A;  2Y0S N;  1O7L A;  4CCM A;  5EEA A;  4L18 B;  1ORK A;  5JI6 A;  4XR6 A;  2VES A;  2LY2 A;  2L9R A;  3HRS A;  2CW8 A;  4DBQ A;  1ZK8 A;  2WAQ A;  1K79 A;  1J59 A;  3MCZ A;  2DEI A;  2O5R A;  4FT8 A;  4S05 A;  1MSF C;  4D7M A;  4BAC A;  2VQE E;  2NNN A;  1UG0 A;  3DQV C;  4HV6 A;  3V7S A;  2I8D A;  4PSX A;  1ZRD A;  4L5I A;  1ZAR A;  1B4A A;  1R49 A;  2LJP A;  1VTN C;  4BY1 J;  4I98 B;  2BVM A;  4JK1 X;  5KK1 A;  4ASN A;  4ZYG A;  2KJB A;  2RC4 A;  3BWG A;  4BEH A;  1FPQ A;  2XRN A;  1OYI A;  1XCB A;  4GYI A;  3HTS B;  1TW2 A;  2QM3 A;  2DFH A;  2DA2 A;  2UXB I;  2PO1 A;  1Y8Q B;  3P9K A;  3VYR B;  3N4M A;  1Z3Y A;  2EFO A;  2JEB B;  2PG4 A;  3PQJ A;  3P76 A;  4JI8 E;  2KIF A;  3HB9 A;  2FOW A;  4IFD A;  1A6F A;  2FBK A;  2VOD A;  1DU0 A;  3CUO A;  2IGM A;  1OR7 A;  3E6B A;  1QBJ A;  1BW5 A;  4NB5 A;  5J1U A;  3BCA A;  4IL6 C;  5K7H A;  3GFI A;  2LY1 A;  2RAE A;  3ZQH A;  2NN6 B;  4YHH E;  1TWC J;  2EFP A;  3JRI A;  3VSL A;  3WU2 C;  2DJN A;  4ZVI A;  2ZB9 A;  1KU3 A;  2XPV A;  4YII A;  3SZT A;  1FBU A;  4F7Z A;  4X66 E;  4BA2 B;  2R5Z A;  1X1D A;  2D5V A;  3PUF A;  4DR7 I;  2ZKZ A;  4RB0 A;  2CUZ A;  4UXN A;  4H4K C;  3QT5 A;  3BCB A;  2R7D A;  1EI1 A;  2GXB A;  4HF0 A;  5IWA E;  2EIL H;  4OAZ A;  2RDP A;  3OMY A;  2JJ7 A;  2VC0 A;  4IHT A;  5D5X B;  3ZXS A;  3FKJ A;  1OCP A;  1QVT A;  4EGY A;  4M73 A;  3CCE I;  5EF6 A;  2QZ8 A;  4U0Y A;  2HQN A;  5FO5 A;  4A6D A;  1BI3 A;  1GVD A;  3WU4 A;  4BDY A;  2QCO A;  3P3G A;  4IS9 A;  1LDJ A;  1W1W E;  3DTK A;  2ME0 A;  4Y33 A;  5GAG J;  5BS6 A;  1N36 E;  5ICF A;  2JT1 A;  2CGE A;  2AO9 A;  3DLL F;  1CF7 B;  1T56 A;  2LTP A;  2ZXI A;  5BR8 I;  5ELW A;  4P9U A;  3M4O J;  3ZMT A;  1BKN A;  3F0C A;  3BR1 A;  3LAJ A;  1JUS A;  1HR0 E;  2PI0 A;  3FK7 A;  1NHI A;  2EA2 A;  2EB7 A;  2E2J J;  4JI6 E;  2MFZ A;  1SFO J;  2L3D A;  4IRH A;  1OCO H;  1SD4 A;  1MG7 A;  4MQY A;  3H3U A;  5CVJ A;  3BTC A;  2W25 A;  3JCU C;  5D5W B;  2PNM A;  4JI2 I;  3X2Q H;  1FZP B;  2MG4 A;  3EUH C;  2DYS H;  2MLG A;  3HRU A;  5GAD J;  4KNY A;  5JHU A;  1VQ6 I;  1G3T A;  3LST A;  2AHQ A;  1IBL I;  2QQ8 A;  2VPR A;  1OQY A;  5K7F A;  2JA8 J;  1N32 E;  3A02 A;  3CO6 C;  4AUX A;  2N8G A;  4G6Q A;  2Z5U A;  5JLX A;  2ZNZ A;  3CCM I;  3HPH A;  4L0Z B;  3FHN A;  3Q3S A;  5HDN A;  1H9T A;  1R23 A;  1TWA J;  5EG0 A;  1S6L A;  5HLG A;  1RRJ A;  2XSD C;  2R5Z B;  4R8H A;  2R4G A;  2Z5B B;  1MH3 A;  5JEA B;  2OAZ A;  3AG3 H;  3CC4 I;  4OO1 F;  1N33 I;  1ENH A;  2LG4 A;  4D9J A;  1KQ0 A;  1ELO A;  1QQI A;  4MEY F;  2L02 A;  4ITV A;  5FFX A;  4M6X A;  2V2Z A;  2EJR A;  1ZYR F;  3D1N I;  1JHH A;  1Q1V A;  2K86 A;  3G4S I;  2HOE A;  3DV8 A;  3BLY A;  2VQL A;  2JTV A;  5DCF A;  4E6K G;  2Y31 A;  2E1M B;  4LIT A;  4PUS A;  2HFU A;  4NXN E;  3HL2 A;  3DPT A;  4OX9 I;  1YX5 A;  4AVZ A;  2GOM A;  2O03 A;  4X65 E;  3ZQC A;  4OO1 A;  2Y0S A;  4M6Y A;  3I53 A;  5AIP A;  5F27 A;  4AYB N;  2BA0 G;  2VJ4 A;  1B62 A;  2Y75 A;  4XBF A;  2G7U A;  5LMN E;  4KIC A;  4NDL A;  2NOJ B;  3V8K A;  1S7E A;  1SD7 A;  4LF8 I;  2TDX A;  5EL9 A;  3K4B A;  4NUB A;  2XB0 X;  3OYF A;  3L2V A;  3CCQ I;  1ZGW A;  1IC8 A;  1ZM3 A;  3BJA A;  2RNJ A;  2M9H A;  4HXZ A;  1AKH B;  1WQ2 A;  1F5T A;  3CMA I;  3FF5 A;  5CQG A;  1D5Y A;  4FX4 A;  4LPF A;  2CU7 A;  1MDM B;  2A69 F;  1V55 H;  3L1P A;  2GS8 A;  2NNY A;  2VF3 A;  5FLX C;  2KFD A;  2RVC A;  3I5U A;  1N34 I;  3LSI A;  1MJ9 A;  4XK4 A;  2FML A;  4XOP A;  2L7Z A;  4H0E A;  3TGN A;  4ZZD A;  4B3A A;  3AL0 C;  1FWZ A;  3FMQ A;  2X4H A;  3WGG A;  2A5W A;  2L9S A;  3DCF A;  3K1P A;  3K4K A;  2L2O A;  3KP5 A;  3KYD B;  4UUS B;  3HHH A;  1I6H J;  1FKA E;  2GAU A;  5IP7 J;  2E35 A;  3KZZ A;  2BM0 A;  4B09 A;  2K85 A;  1H7U A;  4WXD A;  1NG7 A;  1ZXN A;  1BM9 A;  1N77 A;  2ELJ A;  1LVK A;  2ZJR F;  1AU7 A;  1R9T J;  4FE4 A;  2LYC A;  1J75 A;  2D45 A;  3I58 A;  1S7O A;  2F6C A;  5B66 C;  5HS8 A;  5LRS A;  4LF9 I;  4OIR F;  5K36 A;  4HLX A;  4P7A A;  4BBS J;  5E79 C;  4DR5 E;  2HWV A;  3T1Y E;  1VI7 A;  1ZHF A;  4C2M J;  1MU5 A;  3HPG A;  4N3O A;  3H3Z A;  1FEX A;  3JTH A;  4B3X A;  4BQO A;  3G73 A;  4IHY A;  2IOQ A;  2IS2 A;  3L2W A;  1WWX A;  3CJQ B;  2DQL A;  2CW0 F;  4FWH A;  3FZV A;  1FOX A;  1OIS A;  1YTY A;  2CGP A;  3E0J B;  2R7T A;  3BOQ A;  2XRL A;  3P9C A;  5E1W A;  3KYL A;  2IOP A;  4A3F J;  2XKP A;  2O7O A;  5L3J A;  1SVL A;  4QWQ A;  1Z0E A;  4AIM A;  2WTE A;  3DF8 A;  4GFB A;  1WJB A;  3WTS C;  4UT4 A;  2BE5 F;  4BXU A;  1MKM A;  5E1Z B;  5J1Y A;  4IOA F;  2HYJ A;  2HZT A;  2PJR B;  2E7X A;  2Z5C A;  2JA6 J;  3F8M A;  3J81 C;  2H8R A;  1RUN A;  1ACI A;  1MND A;  1N25 A;  3BC8 A;  4ESF A;  2P81 A;  5IT9 Z;  5JEA A;  2R0Q C;  4B3R I;  2BHY A;  1FOW A;  3PRY A;  4MFD A;  3UR3 C;  4K0K E;  2KDO A;  4HV5 A;  3BJ6 A;  4N4N B;  2DXI A;  5HS9 A;  3HSR A;  4A3B J;  5M5X J;  2PMU A;  4CCO A;  3DFG A;  1Z05 A;  1GV5 A;  2RN7 A;  1LE8 A;  2JWT A;  2V6E A;  3I0T A;  1RKW A;  2BA1 G;  1SFU A;  2LLK A;  2GWR A;  2VKE A;  1S29 A;  5LL6 R;  4LB5 A;  3FK6 A;  1JGG A;  4L9V A;  3OYL A;  4JG4 A;  3K0L A;  5E8I A;  2XF7 A;  4LFA E;  1FLI A;  2AXL A;  4OKG A;  2K4B A;  4KN7 X;  4NQW B;  1JE8 A;  2RKH A;  3Q6M A;  1KGS A;  5F6F A;  2VQE I;  1XGN A;  2MC3 A;  1XTA A;  2V9V A;  1MMA A;  1VFC A;  4RB2 C;  3OYK A;  3PUB A;  1PDN C;  3CC7 I;  4R1F A;  4PGH A;  5JR3 A;  2VE8 A;  2IER A;  4Y7N J;  2A6E F;  3EUK L;  4JP0 A;  1JUM A;  1W7P A;  4LGW A;  5H20 A;  1HNW E;  2EZH A;  3KFW X;  2QEN A;  1V3F A;  3BG5 A;  1LEA A;  3TDU C;  3VFZ A;  4B8X A;  1HCR A;  4M3F A;  3I9V 2;  2GM4 A;  4CHU A;  3ZKB A;  1Z21 A;  3QPL A;  2X1D A;  1J7K A;  4B48 A;  1Y6I A;  5K1Y A;  1D3Y A;  4A3J J;  4DR3 I;  2ZJP F;  2L0K A;  2CO5 A;  3FXJ A;  1W36 D;  4ED4 A;  3WU1 B;  2VON A;  3M8J A;  1MBK A;  1BA5 A;  1HR0 I;  4DOZ A;  3GCM A;  2O3F A;  4K0K I;  2HQA A;  4A5N A;  5FKN A;  2COM A;  4XKW A;  1EH7 A;  3CMM A;  3KEQ A;  1MDM A;  4ZTF A;  2OTL I;  3OV8 A;  4IEJ A;  4DUY I;  2UUC E;  3CME I;  3E6C C;  2A5Y B;  1VQK I;  3L7Z A;  5LEK A;  1JKQ C;  3SYT A;  1Z77 A;  5EKW A;  4XSZ F;  3I4N J;  2X51 A;  4OIQ F;  3H0G J;  1T33 A;  2WV1 A;  3CP2 A;  4M74 A;  2BW3 B;  1YRN B;  4MGR A;  4QNJ A;  4OOI A;  5FWK A;  5LHH A;  3B78 A;  1WJD A;  3KP7 A;  1ZM2 A;  2C39 B;  1TWG J;  2NAZ A;  1JJ6 C;  2COB A;  3ERE D;  3J7Z I;  1FTT A;  3CDI A;  3FBI B;  4FHT A;  3G1L A;  2GO3 A;  3I59 B;  1FTZ A;  4UVC A;  1SD6 A;  5ICC A;  3B8H A;  3AL0 B;  4DV7 E;  2FF4 A;  2PJR A;  1D0Y A;  2X0L A;  3GFL A;  1SVM A;  2ESH A;  4OO1 C;  3M85 D;  1TT5 B;  3J81 Q;  4DR2 E;  1J0R A;  1R22 A;  2R7Q A;  2Z16 A;  4HA8 A;  1UDQ A;  2OCC H;  4MQ9 F;  4HSR A;  4KIB A;  2DQR A;  2V9P A;  2W1O A;  3MN2 A;  2IS4 A;  1D1C A;  3QU3 A;  2EV0 A;  3IH3 A;  4DR2 I;  4Y15 A;  3M7N D;  3M3Y J;  2PMZ A;  3PIO F;  2IA1 A;  5HS7 A;  3OIQ A;  5C3E J;  2UUC I;  1JHF A;  2GLO A;  4CCN A;  1OCR H;  1VQ8 I;  5ICG A;  1UZC A;  1F9N A;  4L9T A;  5IY5 H;  2MD0 A;  1SAX A;  3HBL A;  4J00 A;  2K9S A;  2PMH A;  2ZBK B;  4MDT A;  2R7U A;  4KIF A;  4IFD F;  2HXO A;  2QYO A;  2V1N A;  2YS9 A;  4MLO A;  2K9L A;  4WK8 F;  4IFD B;  1ETX A;  2KL4 A;  4ZC3 A;  1D8K A;  4XOT A;  4JYA E;  2LKS A;  2XAS A;  3L2U A;  3RQ4 A;  1FT9 A;  4CUG A;  5KNL A;  4BE2 A;  1ETW A;  2W4S A;  5DM7 F;  4LF7 I;  2O6G E;  2HK2 A;  2FRH A;  2DK5 A;  2K40 A;  2R7V A;  4K2E A;  3TP3 A;  2HPI A;  3M9A A;  3KCC A;  1FBQ A;  3PYD A;  4KQV A;  5KAI C;  3S15 J;  3U1K A;  1RNL A;  3GLL A;  2L7M P;  3U9G A;  4L5J A;  3WGH A;  1IGN A;  3ZQI A;  4RM2 A;  4HZF A;  3AG4 H;  2R5Y B;  3P9I A;  2A6H F;  2HU9 A;  4G8X A;  1M1E B;  1IV8 A;  2DT6 A;  3I54 A;  2K9M A;  2E1C A;  1WRJ A;  4Q4Z F;  3H5N A;  1FP1 D;  4LMY A;  3QOD A;  4KMU X;  2V8P A;  5FD6 A;  3LA2 A;  3M8F A;  2D1H A;  2JE6 A;  4UV9 A;  1BR1 A;  2QLZ A;  2MD5 A;  4XLE A;  4Z6Y A;  1HOM A;  3BZ6 A;  4GCV A;  2JEB A;  1LFU P;  1G4D A;  5K36 B;  2BXZ A;  3HTU A;  4OIP F;  2BHZ A;  2E2H J;  2BZT A;  2LY9 A;  3LNU A;  4FW7 A;  2JA5 J;  4P55 A;  3PNV A;  2DMU A;  1BW6 A;  2E1N A;  2XSJ C;  4BYY A;  3PYE A;  2JA2 A;  2DO7 A;  1OPC A;  2ZC2 A;  1WJ5 A;  2XRO A;  2R7R A;  1U8B A;  3WHC A;  1YJ9 I;  1WFX A;  5CYV A;  3AG1 H;  1XXE A;  3QWL A;  4Q47 A;  3M7N G;  2XF5 A;  4LOM A;  3G2B A;  1U9O A;  4XRS G;  4ZYH A;  3IRQ A;  1O3T A;  2AJ4 A;  1XD7 A;  3MWM A;  2P8T A;  3RJP A;  1EA3 A;  4XLA A;  5LHI A;  3C18 A;  1JKO C;  1VQL I;  2DYR H;  3VB2 A;  1EH8 A;  1RKT A;  2KT0 A;  3S93 A;  2GQ0 A;  2UXC I;  1ETY A;  1R4M B;  2DT5 A;  4JOM A;  5FGM A;  3TMO A;  1G8X A;  4QTR A;  3L2R A;  4C2U A;  2BR2 A;  1MBF A;  4F91 B;  2CYY A;  5DS9 A;  2PO2 A;  4FET A;  1R7J A;  1IUY A;  1R5I D;  5ILV A;  3OIP A;  5J8F A;  1DP3 A;  1SMT A;  3NAU A;  3CJN A;  2MA3 A;  1P9Q C;  4BKX A;  3TP0 A;  1KA8 A;  3WTW C;  1J5E I;  2IT0 A;  1BOB A;  2XGE A;  2CG9 A;  3BG9 A;  4BHB A;  5C44 J;  1U5T B;  1EF4 A;  5HOO A;  2VUM J;  1JGS A;  1NHA A;  3IP4 B;  4RB1 A;  3PYF A;  2GIZ A;  2DW4 A;  1U8R A;  4LF6 E;  2ID3 A;  2O8X A;  5FLX K;  2EFW A;  3TO9 A;  4BXF A;  1XN7 A;  2DA5 A;  2WB1 A;  2OF7 A;  2NVQ J;  3GUD A;  4IF4 A;  4D0P A;  5DDG A;  2VKD A;  1USS A;  1HW5 A;  2DTR A;  1ZM4 A;  3GX4 X;  4ZTJ A;  1O7F A;  1UMQ A;  4EJT A;  1BR4 A;  3W2A A;  3A0B C;  3KP4 A;  4E7J A;  4I6Z A;  1CQT A;  2OZU A;  1P7J A;  5DV5 A;  3LSH A;  3TQN A;  4KYW A;  3EUA A;  2F4I A;  4X65 I;  5C0X A;  2R5Y A;  4UUT A;  2QGU A;  3IKT A;  3SHF A;  1HA8 A;  5C0X E;  2M1B A;  3TED A;  3FBN B;  5J4V A;  3HEF A;  5DUK A;  2O1V A;  4BA2 A;  3K17 A;  3RPU A;  5J1R A;  1JXS A;  2EK5 A;  3PO3 J;  3F8N A;  2RRE A;  3FMR A;  3J81 K;  4EMS A;  1XSV A;  4FN5 A;  3O8H A;  1FI4 A;  4X66 I;  1ZGJ A;  2NXN B;  4DUZ I;  3RSN A;  1IBK E;  4PFO A;  2AE8 A;  4MNU A;  1GT0 C;  2J65 A;  3JRE A;  4BAY A;  5J3L A;  1I94 I;  4M1K A;  2XGC A;  3MKY B;  1MMD A;  1IBM I;  3DPU A;  3L2Q A;  1PP7 U;  2HHH E;  4LFC I;  4JI1 I;  4DV1 I;  2VAS A;  4DPX A;  4DV6 E;  3JAM K;  4A3G J;  1O4X A;  3LQQ A;  4LLG F;  5CKT A;  2K3P A;  3PO2 J;  3MEX A;  2XHK A;  2KZV A;  2QA4 I;  4I09 A;  2XDV A;  4AM3 A;  1KU2 A;  4MQV A;  3G1O A;  1GVJ A;  3B6A A;  4ZDP A;  2LR8 A;  4CXF A;  3E6M A;  1IJW C;  2IBD A;  4G12 A;  1BBY A;  4HX8 A;  4MO7 A;  5K36 E;  2GOX B;  4FW6 A;  1RRE A;  2LRD A;  2B7E A;  3QT7 A;  4LB6 B;  1MH4 A;  1K61 A;  3ROU A;  1B6A A;  1OYR A;  3Q6N A;  4BA1 B;  4UVB A;  1IDY A;  2ZIT A;  4M72 A;  4BHC A;  2HNH A;  2K5C A;  3KP3 A;  2K9N A;  5LEJ A;  2W85 A;  2LRE A;  3OYM A;  3KLN A;  4WXH A;  2WAQ N;  3SZP A;  4FW9 A;  5IT3 A;  2G9W A;  3JSP A;  2VBX A;  5A2Q Q;  2Z3Y A;  2NN6 F;  3IWF A;  2OCE A;  4I76 A;  4BEH B;  3QQA A;  4Y13 A;  4GKJ I;  1GHC A;  1N34 E;  3J80 Q;  5D5V B;  3JRF A;  1R36 A;  3N05 A;  2NN6 C;  4YHH I;  4UUS A;  1BI0 A;  4YIR X;  2FNP A;  2DFI A;  2VJ5 A;  1TWH J;  5H2F C;  3DLA A;  5DRR A;  4BE0 A;  2VQF E;  3H92 A;  1DQU A;  1VI0 A;  1KQ9 A;  4FW3 A;  4G6T B;  2YX7 A;  3TBI A;  4NXM I;  1I6X A;  3VPR A;  4LG3 A;  1YYV A;  1W5C C;  2FBI A;  4WUC A;  1Z0B A;  3GTG J;  3KP2 A;  1G3S A;  4B43 A;  3UKG A;  3U1D A;  3A2K A;  5AIQ A;  4I0B A;  2HKJ A;  4A2U A;  4GKK I;  3OYJ A;  1DP7 P;  2V1D A;  1SEU A;  3MKL A;  1HST A;  3SDG A;  1X3U A;  2L54 A;  2MH9 A;  5GTI C;  3JW4 A;  4YEL A;  4D5F A;  4V19 K;  4HNT A;  2NYX A;  1BJA A;  1RPW A;  5JHF A;  2LH9 A;  2P6S A;  3HGG A;  4G94 A;  2M7B A;  4PZJ A;  3R60 A;  3QPS A;  3C1D A;  2NVT J;  4E70 A;  2BOL A;  2B63 J;  3WG7 H;  2HKX A;  4EJW A;  2WY8 Q;  5DTD A;  3VOE A;  5B3S H;  3E7L A;  3D0S A;  1HNX E;  2HDD A;  3J7A Y;  2PNZ A;  1USU A;  2F5D A;  1K4T A;  4OIO F;  2GA1 A;  2LBF B;  3I56 I;  2PEX A;  2IA2 A;  3C2G A;  2P0W A;  5EJC A;  2GA2 A;  3SEQ A;  2OV7 A;  4BU2 A;  4AD9 A;  1O57 A;  1GLN A;  2VXD A;  2LC2 A;  5B5E C;  2QQ9 A;  4XON A;  2XAG A;  3L7W A;  4YEJ A;  1KZH A;  4QPO A;  4O5V A;  4EV0 A;  2JSP A;  4IFD D;  2F2E A;  5CLS A;  5DRQ A;  1N75 A;  3OYE A;  3W6K B;  3TL4 X;  1FC3 A;  5CQE A;  3QP6 A;  3MKZ A;  1WJF A;  5GPA A;  3RKX A;  2C37 B;  1XHK A;  4OMZ A;  3ZQF A;  1Y1W J;  1UCR A;  2PN6 A;  3ESW B;  1XMA A;  2UUB I;  2PQ8 A;  2CVE A;  4BHP A;  1BC7 C;  3RI4 A;  3EET A;  2I10 A;  5D5U B;  4JI4 E;  1TTY A;  2NVX J;  1ZG1 A;  3BPX A;  4IHX A;  2IJL A;  1X1B A;  4DGW B;  3K9T A;  1MGT A;  3GZ6 A;  4AID A;  4HDV A;  2NS0 A;  3HOX J;  2PLY A;  3GON A;  1WI3 A;  3JAM Z;  2KRC A;  4O3M A;  1WH7 A;  5EEH A;  5LHG A;  3PSI A;  1T8I A;  3S14 J;  4BJT A;  4PDK A;  1Z0G A;  4M9X A;  1JUP A;  5E8G A;  3HOU J;  2JVH A;  4GDF A;  4URL A;  3MQ0 A;  2OA4 A;  4A3I J;  4Y3O A;  1IO2 A;  2XAH A;  4C2T A;  3F23 A;  1XMO E;  4F3Q A;  2C6Y A;  2DFE A;  1MJA A;  5A2Q C;  4II3 A;  2E7W A;  3S8P A;  2Q8K A;  4ZYA A;  1IG7 A;  4PCQ A;  2CG4 A;  1U78 A;  3R6S A;  1NK3 P;  4M9Z A;  4HX7 A;  4LF4 I;  3PFY A;  4UY8 I;  2E60 A;  4DR7 E;  1NG6 A;  3GTO J;  3FM3 A;  3M1E A;  2ELH A;  2X9D A;  1HKT A;  2X7I A;  3JAM Q;  1Z0X A;  3CF5 F;  1YFH A;  2CV1 A;  2E71 A;  2O61 A;  1Z0W A;  2CUJ A;  1HF0 A;  3OOU A;  4JI5 E;  2WA0 A;  5JVT A;  1EA6 A;  3REO A;  3RCO A;  2HYG D;  5F1J A;  1KVK A;  1QA6 A;  2AXT C;  1T39 A;  2LK2 A;  1IF1 A;  3TO6 A;  3K4C A;  2HTJ A;  4CYD A;  2QSG X;  3ULQ B;  2E19 A;  3CDH A;  4C3I J;  4YRV A;  5FB2 A;  2HFS A;  4CDG A;  1BN5 A;  5EGO B;  3IAM 2;  4PSW A;  4J3D A;  2KIU A;  2OU2 A;  3KZY A;  2VOP A;  4MU1 A;  4ENM A;  3JRA A;  3CDJ A;  1EKE A;  3V7C A;  3ZM7 A;  2W7N A;  3J80 K;  4MYU A;  3OYD A;  2NPF A;  1X3Z B;  3F6O A;  3Q0W A;  1XSX A;  3WOD F;  1X1P A;  5LGT A;  3M8E A;  4OWR B;  1PUE E;  4XLF A;  1HC8 A;  2PNL A;  2HKE A;  2CUF A;  3J80 C;  3K4L A;  4WXC A;  4DR1 I;  4BJ6 C;  4USK A;  3DBH B;  4RLF A;  1SAU A;  4IO9 F;  2BY2 A;  4PJN A;  1Z0C A;  2E36 A;  2STW A;  4IZK A;  4DPY A;  2IAI A;  4RM3 A;  4IQJ A;  3GW2 A;  2IVM A;  1KYW A;  3P3E A;  2VKH A;  4JV5 I;  1IN5 A;  5L3F A;  3F21 A;  3GYH X;  4OMY A;  3AAF A;  2WWY A;  1I5Z A;  1MZB A;  3JRD A;  2QKL B;  3CLQ A;  4DUZ E;  2HVQ A;  2VBZ A;  1R6R A;  3CJR B;  2ZJQ F;  3PJR A;  1PKP A;  1Z0V A;  1Z59 A;  3HJC A;  4L5E A;  2GXA A;  1FYL A;  1XC5 A;  2OTJ I;  1ON2 A;  5EDN A;  1P4W A;  4WF2 A;  1WPK A;  2EFN A;  3IWZ A;  4JI3 E;  2CQX A;  4OU0 A;  3WTX C;  3OS0 A;  2QEX I;  3S3M A;  1MMS A;  5DM6 F;  2UU9 E;  4BBR J;  1MMN A;  2F5C A;  4E7I A;  2WNR A;  1Z0T A;  2HVS A;  3CLO A;  4UUV A;  3Q0U A;  2EQR A;  4DV0 E;  3CP8 A;  4KN4 X;  5L3B A;  2Z5B A;  2EWN A;  4A6E A;  3ISP A;  3V8L A;  1TZL A;  1OR7 C;  4B1R A;  4J19 A;  4KDP A;  5F0F A;  3NQO A;  3PQK A;  2HGC A;  4OO1 D;  1KU9 A;  4I99 C;  4LIU A;  2VT3 A;  1Y0U A;  3BR6 A;  4RBO A;  1T6S A;  2EFQ A;  3S1M J;  2UUZ A;  2DU9 A;  4XN0 A;  1RC9 A;  4LF8 E;  4MHG A;  1QVU A;  4RDU A;  2P7C B;  3H1C A;  1A36 A;  1I1G A;  2Z5E A;  1MX0 A;  5HNH A;  3HYI A;  1LQ1 A;  3LOC A;  4DZP A;  3L7Z B;  1XGO A;  2BA1 D;  4XKV A;  3LNQ A;  4GGG A;  3ZR8 X;  3P3C A;  2BYV E;  3ELK A;  3RIR A;  3FM5 A;  3DEW A;  4X1E A;  2OUM A;  3T1B A;  2IS1 A;  1R5G A;  1Z91 A;  2WW4 A;  3QP5 A;  1IW7 F;  1J5Y A;  2VC1 A;  4LD5 A;  3BJO A;  1V5G A;  4RS8 A;  1UB9 A;  4I3H A;  2AQE A;  4XKC A;  4DIQ A;  2KRF A;  3QYF A;  4OAY A;  2K3F A;  2KHM A;  4DR6 E;  2CH0 A;  2UXN A;  6PAX A;  5DCM A;  2CJJ A;  3QPT A;  3F0N A;  1SD5 A;  2JPB A;  3MAJ A;  2F4M B;  4M9S A;  3QT6 A;  2HYF A;  2I5U A;  4KA4 A;  2XGX A;  2V9K A;  4DW6 A;  4ZZL A;  5F0C A;  3AG2 H;  4DV5 I;  2KPM A;  4EM0 B;  5IP9 J;  2QSH X;  1YLF A;  1FNM A;  3HHG A;  2GIV A;  1W36 C;  2HPM A;  5ERI A;  3WE2 A;  4EMD A;  3QT8 A;  3M6A A;  1HK7 A;  4Q48 A;  4AC0 A;  1HW2 A;  3CDL A;  2UXC E;  4PK4 A;  2MYS A;  1S5L C;  1XMX A;  4XN3 A;  2R3V A;  1OYW A;  1ZH5 A;  1Y60 A;  4HEA 2;  1YJN I;  2DDA A;  3H9J A;  1MMG A;  2RNG A;  2UUA I;  2X6Y A;  2D1V A;  4NC7 A;  1BI1 A;  2L5Q A;  4XRS A;  1CF7 A;  2MAB A;  5BQT A;  2DOD A;  2JSC A;  4ON0 A;  4A3D J;  3BP8 A;  2H09 A;  3OL3 A;  5D8L B;  2XC7 A;  1YI2 I;  3Q5F A;  1D1A A;  4PJ0 C;  1OFC X;  1QZY A;  4AQY E;  1T98 A;  4I02 A;  2M45 A;  1IRX A;  4IQ4 A;  2M8E A;  3SDB A;  4BUP A;  3HOS A;  2NRA C;  5FJ8 J;  1OJ4 A;  1QZR A;  4EVI A;  1LNW A;  1IN8 A;  4ENN A;  2CW7 A;  2LSO A;  3KE2 A;  3M07 A;  4XRF A;  4Y17 A;  5IP6 A;  5JEA C;  2LNB A;  2CFO A;  2H94 A;  5FRO A;  3U21 A;  1WHU A;  3N97 A;  1RR7 A;  1Z67 A;  2ZSH B;  2DEJ A;  3F8C A;  1P92 A;  3P06 A;  3BY6 A;  4KJZ A;  1G59 A;  3JTG A;  2Y69 H;  2A3S A;  1NTC A;  1R58 A;  3FXL A;  2L9V A;  2X6X A;  5E17 F;  1I50 J;  1FY7 A;  1MBH A;  2MGQ A;  4RAZ A;  4P5O A;  3L00 A;  4ZYD A;  1IRG A;  1P42 A;  4XKB A;  3HUG A;  3WU3 A;  3QPH A;  3K85 A;  3LL7 A;  1VQO I;  3WE3 A;  4HQE A;  2OPT A;  1AHD P;  4YIF A;  1OMI A;  3E5U A;  5AON A;  2UUA E;  3HOW J;  1WGX A;  2H1K A;  2A61 A;  4HYE A;  4U0V A;  1RUO A;  1FSH A;  3GTP J;  4KIS A;  3ZRG A;  2JRM A;  1A5J A;  2YR2 A;  2ZME C;  4FIS A;  3S1Q J;  4M6V A;  4CA0 A;  4AIK A;  4R1H A;  3OWT A;  4G7O F;  1AKH A;  4DPU A;  2VQG A;  2IP2 A;  2Q0O A;  3TOA A;  3F8B A;  1PJR A;  2HK3 A;  4DV7 I;  4IJA A;  1A31 A;  5IT9 Q;  4IOC F;  4HAC B;  2VE9 A;  2VQH A;  2MSY A;  5M5Y J;  2HR3 A;  4IZJ B;  1W4M A;  2CQN A;  2WBM A;  1TC3 C;  2WB1 N;  1XPX A;  4DUY E;  3D5L A;  1LVA A;  4U7D A;  2R7O A;  3CTA A;  1YIT I;  4M71 A;  3NEU A;  1XCV A;  1EH6 A;  1R1T A;  1V54 H;  4YFN F;  1SVO A;  1EJ9 A;  5HOD A;  1ONV A;  1ZG3 A;  2CQK A;  2OC6 A;  2PFB A;  1AWC A;  3EYI A;  3HSF A;  2V7F A;  2K27 A;  1T0F C;  3BDD A;  3GTJ J;  1VQN I;  1XDS A;  1ZLK A;  2DMN A;  1LJ9 A;  1XS9 A;  3SXY A;  2V4J C;  1CGP A;  4RGU A;  2ZM6 E;  3CCR I;  4LCF A;  2HOA A;  2JQ7 A;  2YX4 A;  1G6N A;  2ICW G;  2VXZ A;  2DK8 A;  3LFK A;  5JLW A;  3F72 A;  1XNQ E;  2YU3 A;  1FNN A;  2BGC A;  5BOX A;  1KTV A;  1N0V C;  3LA7 A;  1OCC H;  2FMY A;  1R6L A;  3LWF A;  4LFA I;  3OL4 A;  1T2K A;  2AQF A;  2X48 A;  4G7Z F;  3RKQ A;  3QYB A;  1D1B A;  4ZYE A;  2JN6 A;  5IWA I;  4ESJ A;  2UV1 A;  4JYK A;  3V7R A;  3GF2 A;  3HOT A;  2OI2 A;  1KON A;  5EYR A;  4BXX J;  3WTV C;  3DBR B;  2H1L A;  2MW8 A;  3OYA A;  4JI5 I;  1QHH D;  2RGV A;  1J2X A;  3S1R J;  3G6E I;  1E0E A;  3I71 A;  2M0C A;  1X3W B;  3VEP A;  4DR3 E;  1YW7 A;  4LCH A;  3CUQ A;  1EV7 A;  4I01 A;  3IAS 2;  3H9G A;  3GFJ A;  2Z9O A;  1YH8 A;  3ONQ A;  4IXA A;  1VQ5 I;  2W48 A;  1MJB A;  5HLI A;  1VQ9 I;  3BPV A;  1TNS A;  3ZMS A;  4CYC A;  2BM1 A;  1MD0 A;  1TNT A;  5TIS C;  5JEA D;  1ZGA A;  2BVL A;  2V79 A;  5BNG A;  1D0X A;  4LIV A;  1ETO A;  4HQM A;  3S2D J;  4CCJ A;  4W1U A;  2HFH A;  5LD2 C;  2V2V A;  1H74 A;  1LKX A;  2VT2 A;  3PNT A;  1DDN A;  4HDU A;  3DXJ F;  5FD5 A;  5TJJ A;  1J09 A;  2QSF X;  3O3K A;  4X62 I;  1LPQ A;  2DA7 A;  2DA3 A;  2VQC A;  3IKV A;  2FSW A;  3ZZU A;  2CSO A;  1JT6 A;  1S8N A;  3EDP A;  4EM2 A;  2OQR A;  1KU7 A;  3K10 A;  3KEO A;  1MSE C;  1UDO A;  2LP0 A;  3CD6 I;  3ABM H;  3H5A A;  4MYT A;  2D2W A;  2CV0 A;  5ILU A;  4B3S E;  5FKL A;  4DV4 E;  4OZE A;  2R7F A;  2DOF A;  4UTG A;  3HOY J;  2HHH I;  2P5V A;  1QRY A;  2IEK A;  3S3N A;  4JBA A;  2M5W A;  4MU0 A;  4I0A A;  1D5V A;  4IRI A;  2XB5 A;  2F1D A;  3OR2 C;  3IRR A;  3RKY A;  2Z5C B;  1L0O C;  4ETS A;  4XMY A;  5ICE A;  5HNF A;  1F43 A;  2NOG A;  3WU6 A;  3J7A G;  2FUG 2;  3HOZ J;  4U3D A;  3R4K A;  4P52 A;  2C38 B;  3DP7 A;  4KIG A;  2JEA B;  4ZDO A;  2STT A;  2L01 A;  2FBH A;  5D6E A;  4L0Y B;  1SFX A;  3ECH A;  3K6G A;  2ZBK A;  3OYG A;  2Y9Y A;  2TCT A;  2DJI A;  3HRM A;  5DNL A;  4USM A;  5LMN I;  2EIM H;  2ZJ2 A;  1H89 C;  1LE8 B;  4YG2 F;  4IFD C;  2CQ7 A;  4NXN I;  2WP8 A;  1XG1 A;  3CUQ B;  1I39 A;  3CCU I;  4MU4 A;  3R0J A;  1JKP C;  2HZD A;  1X1C A;  3H9Q A;  3RKW A;  4EJO A;  3OS2 A;  2X85 A;  5D6F A;  3ECO A;  3ZGK A;  3MKW B;  1R6M A;  5GAE J;  2DAO A;  1BJZ A;  5F1R A;  1Q1H A;  3H35 A;  4XOR A;  4LK1 F;  1ULY A;  4D1Q A;  1FIP A;  2BR2 B;  4FW4 A;  3QOP A;  4A0X A;  1ZR4 A;  2XAF A;  4LLL A;  3LFU A;  3OYH A;  4OIN F;  2O8K A;  2O1W A;  3FXK A;  1I27 A;  4EGZ A;  5B1B H;  4NHJ A;  2ZFW A;  4RA2 A;  1BIA A;  1K78 B;  4BNC A;  2A2C A;  3K2Z A;  3E1S A;  2PNZ B;  4B3M I;  4HAM A;  2LVS A;  1K6O A;  1ZRC A;  2DMP A;  4XLP F;  1UJ8 A;  2P7V B;  2Y2Z A;  1D8J A;  4OO1 B;  3OYI A;  3OR1 C;  4U88 A;  5FKM A;  1TP4 A;  3JAM C;  4IPA A;  4KT5 C;  4C9Y A;  4A0Z A;  4S04 A;  1YJW I;  1SFE A;  2XAQ A;  2KRH A;  5HDK A;  5C0X D;  1PVG A;  3HGY A;  5K5R A;  5E3O A;  3OYB A;  3LTO A;  2NS7 A;  2QUF A;  2LF8 A;  2ZM6 I;  3MMY B;  1R5H A;  3KIO A;  1JT0 A;  1MIJ A;  3QYE A;  2FA5 A;  3GME A;  4CCK A;  1D0Z A;  1ZN2 A;  1K7A A;  2PJP A;  1FWK A;  4JYA I;  2V6C A;  1FYK A;  4PRX A;  3Q1Q A;  1HNX I;  2LBF A;  2ZXJ A;  2DA4 A;  3D5R C;  2VJJ A;  4IZJ A;  2JMW A;  3G1M A;  4B4C A;  2DT7 B;  3IV5 A;  3K1M A;  2EV6 A;  4UHT A;  4KIT B;  5LMU E;  4CSW A;  2IA0 A;  2VB6 A;  3FKI J;  3FWE A;  1OJL A;  5DUI A;  4DZJ A;  3WTY C;  2NN6 A;  2EH3 A;  3LSP A;  5ILS A;  3VOD A;  5FLV A;  1JTX A;  2O9L A;  3BTI A;  3ZN0 A;  2F5E A;  3I3L A;  3HM5 A;  4LF4 E;  2J5O A;  1Z6R A;  1Z5A A;  3H36 A;  1WH5 A;  3H3V K;  4NQW A;  1D6T A;  1B72 B;  1I3A A;  5JVG F;  4GKK E;  5CVR A;  1OYP A;  3PS2 A;  4BGD A;  3Q0V A;  1QZZ A;  1MBG A;  3CZ6 A;  5FFZ A;  1Y56 A;  4XL9 A;  1E3P A;  3K4N A;  2PO0 B;  4GYG A;  3WG9 A;  2W82 A;  1P7I A;  3KEY A;  4A93 J;  2EZI A;  2BY0 A;  5F0H A;  2QBY B;  5LBQ A;  3W2V A;  2Z2S B;  5GAH J;  4JI7 E;  2F48 A;  1KKH A;  2M30 A;  1IXR C;  3JRH A;  1WJA A;  4DV2 I;  1S16 A;  3CES A;  1BL0 A;  1HBX G;  2TRT A;  3DKW A;  3TW7 A;  2O3Z A;  2FQ4 A;  2IGK A;  1K4S A;  1VQM I;  1XGM A;  1VQ4 I;  1RES A;  3ZCO A;  1LUJ B;  4B3T I;  3ZN1 A;  1P4A A;  4A3K J;  4HF2 A;  4E7K A;  3K1N A;  2F4O B;  4TV7 A;  3MZH A;  3FXR A;  3QU6 A;  1UDN A;  5K5O A;  1HSJ A;  1B72 A;  2ADU A;  3ABL H;  1Z5C A;  1G3Y A;  5DCM B;  2VKV A;  2OJE D;  3M7G A;  4XID A;  1E3H A;  1U2R A;  1IXS B;  1B59 A;  4CH7 A;  3PYG A;  2C39 A;  4DPT A;  4L9J A;  4A5M A;  1YIJ I;  3IUO A;  5DD4 A;  5TGT A;  3S1N J;  1FIA A;  1FJG I;  3I55 I;  4G9Y A;  4ANJ A;  3B4T A;  4CO8 A;  1AOY A;  1PIE A;  2XGD A;  4B47 A;  2QBY A;  2HOS A;  5E20 A;  2X1E A;  3QOE A;  5K5Q A;  2UU9 I;  3J7Y J;  4FCY A;  1JTY A;  1SAN A;  1VZ0 A;  3I64 A;  1B9N A;  5E1X A;  4ABZ A;  3OTO E;  4MU3 A;  4DYQ A;  3ZZT A;  1IBM E;  3GVA A;  2ETH A;  4F93 B;  4HF1 A;  3HIF A;  2G7H A;  1RR8 C;  2E5L E;  3LA3 A;  3MZ8 A;  1LB2 A;  9ANT A;  4PGG A;  1NHH A;  4R79 A;  2M4K A;  2UXD I;  2JVG A;  4Z7Y A;  5J4Y A;  5F04 A;  1RHY A;  4DU7 A;  1X19 A;  4ESB A;  2O0Y A;  5FKK A;  4U87 A;  1BOA A;  1H9G A;  2B9S A;  1WUU A;  2LOO A;  3AFH A;  4HAC A;  4X64 I;  1FJL A;  5C0X C;  4AWX B;  4E7H A;  2M87 A;  1OYY A;  3RZD J;  2Q2E B;  2M4G A;  3CF2 A;  3VSK A;  5FRM A;  3L9F A;  2HVR A;  1JKR C;  3FIS A;  4HBL A;  2F4V E;  5D4S A;  1SC7 A;  1HDD C;  2VL8 A;  2MC4 A; 
#chains in the Genus database with same CATH homology
 2BA0 D;  2BA1 D;  2NN6 A;  2PO2 A;  5C0X F;  3DD6 A;  2PO0 A;  4OO1 C;  3M85 D;  3H36 A;  4AIM A;  5JEA B;  1OYP A;  3HKM A;  4OO1 F;  1UDQ A;  2JE6 B;  2PO2 B;  5K36 F;  1E3P A;  2PO0 B;  3M7N D;  2C38 B;  5JEA E;  2JEA B;  5JEA A;  2WNR B;  2PO1 A;  2PO1 B;  4IFD F;  2JEB B;  5K36 C;  4OO1 A;  4IFD A;  4IFD B;  4IFD C;  3CDJ A;  2WP8 A;  2BA0 G;  2BA1 G;  4BA1 A;  2PNZ A;  5C0X A;  2NN6 B;  5C0X E;  5K36 D;  4BA2 A;  4BA2 B;  1UDN A;  1R6M A;  2JEA A;  3KRN A;  3U1K A;  3GLL A;  2BR2 B;  1OYS A;  1R6L A;  2NN6 E;  5C0X B;  1E3H A;  2C39 A;  4IFD D;  4OO1 E;  4NBQ A;  2C37 B;  3B4T A;  2PNZ B;  2JE6 A;  2JEB A;  1UDS A;  5K36 B;  4OO1 B;  3GCM A;  2C38 A;  5JEA C;  2NN6 D;  4AID A;  1WHU A;  3M85 G;  2WNR A;  5JEA F;  3L7Z A;  4AM3 A;  5C0X D;  5K36 E;  5K36 A;  4IFD E;  5JEA D;  2WP8 B;  1OYR A;  4BA1 B;  4OO1 D;  3M7N G;  3GME A;  5C0X C;  2C39 B;  3CDI A;  3H1C A;  2C37 A;  2NN6 F;  1UDO A;  2BR2 A;  3L7Z B;  2NN6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...