4AIHA

Crystal structure of rova from yersinia in its free form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
142
structure length
139
Chain Sequence
ESTLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transcription
total genus 50
structure length 139
sequence length 142
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aihA00
3KP4A 1XGNA 1DPUA 1D5VA 3BPXA 2COMA 1FZPB 2EFNA 3TDZC 3DV8A 2FQ3A 3RKYA 1P2FA 1K79A 2C6YA 4OIOF 4XLPF 3Q9VA 3D5LA 3WTVC 3F6OA 1BJAA 2A07F 1ZYRF 1ZG5A 4AIHA 3DP7A 1U6GA 4G94A 2HGCA 2W57A 3U2RA 1J0RA 3FMSA 1Z7UA 3F3XA 1IXRC 1GXPA 1KU2A 3J81K 1IZ1A 2UWMA 1G4DA 1ZHFA 2KRFA 3I5UA 2CW0F 4I7HA 2M87A 1ON1A 1S8NA 2OQRA 3MEXA 1X3UA 4CYDA 2PJPA 1W4MA 4EJTA 4EGYA 3RJPA 4HZFA 4MHGA 1IN6A 3TQNA 5HLHA 2Q0OA 1JGSA 3HYIA 4GGGA 2Y75A 5DV5A 4CXFA 2VBZA 2PQ8A 4P5OA 3GX4X 5L3DA 1K78A 4WK8F 4RGUA 3T0YA 3SQNA 1PDNC 4EQQA 2CYYA 2ZO4A 1KGSA 1SMTA 2XAGA 3F8NA 3TO7A 5DUKA 1S7OA 2HS5A 2QVOA 2DO7A 2LNBA 3BJAA 4TV7A 2EB7A 3B73A 4PCQA 3ELKA 2CO5A 2FXAA 1KU7A 1LEBA 1MDMB 1T38A 5HLIA 3F23A 2GQQA 1FOKA 2W25A 3DXJF 1R1UA 2W24A 1ULYA 2ZFWA 4PDKA 5L3FA 2FMLA 1F4KA 2E7XA 1LDDA 3E5XA 1DP7P 2JPCA 2LSOA 1KU3A 3LFKA 3IRRA 1YLFA 5JI6A 4LGWA 2ZCWA 1B4AA 1V3FA 3LQQA 2M30A 3KP3A 2BBYA 5DCMA 2DPDA 2FA5A 4BYYA 2MBFA 3K1NA 3WU0A 5LGNA 4XSZF 2R3SA 1F1ZA 1FWZA 3HSRA 1TNTA 2JSCA 4U7BA 3JAMK 1HBXG 1U5TA 2XVCA 1FY7A 4IF4A 2JPBA 2V1XA 2OD5A 4I0BA 1RZ4A 2IPQX 2ZMEB 2Z5UA 1XGOA 4NHJA 2D2WA 2WV0A 3CUQA 5FFXA 3RYRA 2ISYA 3HUGA 4MEXF 4UVCA 4XSXF 1YQAA 4M71A 4KNYA 2Y48A 4HA8A 4MTDA 1LQ1A 3F22A 4HF2A 4L9TA 3TO6A 1F9NA 3GZ6A 2OU2A 2VC0A 2P7VB 3J81Z 2FMYA 3J80Z 3B02A 3HRTA 1YTYA 4IXAA 3D0SA 3BJOA 1Z9CA 3WTTC 3GYHX 3WE3A 3K1MA 1LNWA 4MQ9F 2DQLA 1ZRCA 1ZG3A 1T2KA 3V7SA 2A6EF 4YG2F 4HAMA 2R7FA 2H27A 3GEZA 2IVMA 4PZJA 4CICA 1Z6TA 3BP8A 5L3CA 1AOYA 2Z3YA 1G3TA 2NYXA 3KEQA 3N4MA 2GAUA 3AAFA 2VOPA 1PP7U 3E5QA 2XIGA 1IN8A 3WG9A 1GXQA 4IHTA 5ERIA 3N97A 4KIGA 4L0YB 5D8KB 2ETHA 4MEYF 3KP5A 1R22A 1ZG1A 3O2PE 5E8GA 1KU9A 1KQ0A 3KFWX 2VT3A 4ZH4F 5D6FA 2KJBA 4RGRA 2K02A 2XKPA 2XUBA 1DUXC 3M8EA 3L7WA 1FYMA 1DDNA 3I0TA 1T98A 1FYLA 2M45A 3HHGA 2VOOA 2EFQA 3I59B 2RC4A 4AIKA 2P5LC 2XAQA 3ML6A 1YIOA 2LF7A 2CG4A 1IN5A 3JW4A 4RB1A 1ZARA 4HDVA 4LLNA 5ILSA 2HQNA 1ZH5A 3M9AA 1LEAA 3ISPA 1UB9A 3E6DA 4E70A 4YFNF 4GO1A 5HS8A 3VOEA 2J5PA 2V79A 4ETSA 2YX7A 2LKPA 2V1DA 1QPMA 1R58A 4L9VA 3WODF 3HTSB 1MJBA 1WKMA 5IT9Z 5HOOA 1I1GA 4M6XA 2K4JA 1WRJA 2NNNA 2GA2A 3V4GA 4P55A 2KIUA 1STZA 4Q4ZF 3IRQA 2ZJ2A 5D5UB 3L09A 4R8HA 1XD7A 3C18A 2QENA 1FPQA 4HW0A 1K7AA 4LLLA 2JZYA 2PBIA 2IP2A 2LDUA 3KP7A 3KEOA 2V6CA 1OYWA 4G7OF 2PMHA 4GCVA 2DAOA 1FP2A 1I6XA 2RQPA 4I02A 3T8TA 1TLHB 4HDUA 3QU6A 1BI1A 4QLCU 2Q2EA 1T39A 4HV6A 3F8BA 1HXDA 3FMRA 1MD0A 3MFKA 1RI7A 1P4XA 5BMZA 4AD9A 4M9ZA 2E1NA 1J9IA 4RAZA 3HRSA 4KIBA 4LB6B 1BBYA 2O0YA 1KYWA 1XDSA 3RIRA 3EYIA 1ZGJA 2RGVA 2RV8A 3ZQ7A 2ZNYA 3WE2A 1HW1A 4KT5C 4UHTA 3BWGA 2QBYA 3IKVA 1ZN2A 1I5ZA 1IUYA 1T0FA 3C7JA 2MLKA 3V8KA 2ZKZA 4ZZLA 5K5QA 3BJ6A 3TDUC 2IJLA 3T5XA 1HQCA 1BIAA 3F21A 4L9NA 3C3WA 5LLQA 1U2WA 3I54A 3FXUA 4LG0B 4A5NA 2F5FA 1O3SA 3I4PA 2EA2A 3LA7A 3K2ZA 1FX7A 2HYFA 2FBKA 3SZTA 4M9SA 1FSHA 3HIFA 2YX4A 4HX8A 4KMUX 2P5KA 2RNJA 4YFKF 4CHUA 1WWXA 2A61A 2EFPA 2J5OA 1BC7C 4EJWA 1ZRDA 1D8KA 4KIFA 3TOBA 2B0LA 2XKOA 2RDPA 1ONVA 4LMYA 4BHCA 4UUVA 3JTGA 1SFUA 1RIOH 1LVAA 4N9IA 2HTSA 1J7KA 1T6SA 3MQ0A 3KLNA 1JXSA 2PN6A 4MNUA 3WTUC 3HRUA 4L0ZB 1OYYA 1U5TC 1XGSA 5KK1A 3NRVA 4BHPA 3LA2A 4I2OA 4HF1A 1EV7A 4IRIA 2DK8A 5DYMA 1H9TA 4F7ZA 3FF5A 5ICEA 1R1VA 3IWZA 5F1RA 3CUQC 2XAHA 5H6RA 3GW2A 2O61A 1W7PD 2JT1A 3I64A 3ABUA 3ZN1A 4PGGA 5LHHA 1SD7A 2NRAC 3ZMSA 1I1SA 5FLXK 1H9GA 3LAPA 4G8XA 2O6GE 2QZ8A 4BQAA 1SMYF 2EWNA 1O3RA 2OAZA 1YYVA 4FT8A 3J80K 5E1XA 4XLNF 1LDJA 3WTXC 3L2CA 4CO8A 2RKHA 5DEQA 3LQRA 5F64A 1BI3A 1W7PA 4UXNA 3CO7C 2K27A 4A0ZA 1REPC 4GYGA 2ZBKA 1QZZA 4ZZDA 4M74A 3BOQA 1CF7A 5CVJA 1HKSA 3MAJA 5LHIA 3F8CA 3K1PA 2GA1A 5CVUA 2HFHA 2ADUA 4DNCA 3J7AO 1J5YA 1QNTA 1TNSA 3DPLC 1XSXA 4UV9A 1D8JA 2YPRA 3PQKA 5LRSA 2XAJA 3GFLA 2XROA 3VEPA 3OOPA 1UCRA 2ZNZA 3KLOA 4EM2A 1KQ9A 2IT0A 3GZ5A 1YS7A 4ON0A 5D8LB 5D5WB 2V9VA 1SAXA 4LJZF 3E6MA 2HZTA 3P7NA 3JTHA 4Z2YA 3K9TA 3I59A 3I71A 3L00A 4MTEA 4FX0A 1JE8A 4UV8A 2G9WA 2QLZA 4M6YA 2KKOA 5FD5A 2CGPA 3FZVA 2YSRA 2DBBA 3TOAA 1ZAOA 5H6QA 3K0LA 3OV8A 3DEUA 2KIMA 2DI3A 1USTA 4RGXA 1O3TA 3R0JA 3QRFF 4ZYDA 4XBFA 5F6FA 3ZMUA 4OMYA 4U0YA 1TQMA 4QWQA 4O3MA 3H3ZA 4EM0B 2QQ9A 5IT9K 5E18F 1BIBA 2K86A 1B6AA 1O7LA 1O3QA 1WI9A 3GXOA 2P6SA 3L9FA 1HKTA 4D0PA 5CVRA 1A04A 4ENKA 3QP5A 4XRFA 3SFZA 5AONA 2ESHA 3BDDA 5HS7A 3GFJA 3P9IA 2A69F 1QQIA 3WTZA 3KP6A 4I0AA 3Q9SA 3WGHA 4JBAA 3FXRA 2M5WA 3MWMA 5FLXZ 3V8LA 1ON2A 4WXCA 2L4AA 5LEKA 1SFEA 4LFUA 1OPCA 1SFXA 3QPHA 1IN4A 2P4WA 2YR2A 4HBLA 2DK5A 1VTNC 3CO6C 3SXYA 4EGZA 4HYEA 2A3SA 5JVTA 3QAHA 4OINF 3RDIA 5AIQA 3R0AA 3W6KB 5HDNA 3NEUA 2DT5A 3EDPA 4WXHA 4L18B 2VBYA 2MH9A 2XASA 1B59A 4IRHA 4CZZA 3ZMTA 1MJAA 3R6SA 3HHHA 3JSPA 4RAYA 4N0BA 1RUNA 3QPTA 5A2QK 1FLIA 2MH2A 3DF8A 2A6HF 1TQPA 3F8FA 2KIFA 5FD6A 1KA8A 1EH8A 4A0YA 3IL2A 4BAYA 3CDHA 3I53A 5IT3A 4KICA 3GF2A 2ELHA 2OBPA 2VODA 1YW9A 3R60A 5BPDA 3REOA 4BHBA 1K78B 1FBSA 3RPUA 1FBQA 4YIFA 1Z91A 2PFBA 2P7CB 2BV6A 3QP6A 1BM9A 3PQJA 3ZN0A 5EEHA 1ZGAA 4EJUA 4O5VA 1PP8F 3VODA 2QYOA 4Q48A 2IW5A 2WTEA 1IXSB 3LA3A 2DFIA 1YG2A 3RI4A 4S05A 3E6CC 2CQKA 2G7UA 4FX4A 1V4RA 4IPAA 3WTYC 3CLOA 5ICCA 5HDGA 1BN5A 3SZPA 4PGHA 2GIVA 4R79A 1BC8C 4HV5A 3ULQB 2HWVA 3GO5A 5EEGA 4UVBA 4OIPF 5K1YA 4HLXA 1DPRA 4WX9A 2STWA 4EVIA 2FBHA 5TRDA 5ILUA 2LF8A 2OA4A 4ESFA 4P9UA 4ZYGA 4G6QA 3EQLF 3R4KA 2FU4A 3S2WA 1MJ9A 3GFMA 1U5TB 3IHUA 5L3EA 4KFCA 3V7CA 4ZYEA 4OMZA 1Z05A 1U8RA 3CJNA 4B8XA 4EJVA 5L3GA 3CUQB 2F5CA 2D1HA 3PFIA 4RB0A 1XCBA 1OYIA 4KN4X 3LAJA 1BI0A 1Y0UA 2HEOA 2VE8A 2GXBA 5K5OA 3WTSC 2A5YB 4JQFA 1YW8A 5DD8A 1XMKA 5DDGA 1TTYA 2XGXA 3IKTA 1R23A 3FXQA 4IHSA 1FBUA 1Z1DA 3TO9A 5BPIA 3G3ZA 5D4RA 2FSWA 5E17F 2NS0A 2VN2A 1I27A 3FMQA 4ENMA 2HQRA 1B9MA 1S3JA 3MZYA 4A6DA 2DW4A 5A2QZ 1XDUA 4KMFA 1OKRA 4GXOA 1S7AA 4M72A 2BYVE 1IAWA 1XSDA 5HLGA 2L3DA 3U1DA 3F6VA 4GYIA 2VONA 1MDMA 4CDGA 3GFIA 2BEOA 2OZ6A 4LLGF 4EMSA 4AVPA 1MZBA 3CUOA 4G6DA 2BE5F 3EYYA 3T1BA 2AS5F 5FB2A 2IRFG 2WC2A 3HRMA 2EV0A 5CVIA 3ZMDA 2O8XA 3MCZA 3RYPA 1B9NA 5K5RA 4LD5A 4OU0A 2F5DA 5CJ9A 4BNCA 1ZRFA 2AXLA 1H0MA 2ZMEA 2Z99A 4ENJA 3KP2A 1QGPA 1FYKA 2O3FA 4ZYHA 1LJ9A 5CLSA 1MKMA 5H20A 2H6CA 5HDKA 3NQOA 2P6TA 4K2EA 3T8RA 2HR3A 1O7FA 1XB4A 4I01A 5BS6A 1GHCA 4G9YA 1HW2A 4OIQF 2QUFA 3DKWA 1S29A 4NQWA 1P6RA 2JRTA 2O03A 2VBXA 4G7ZF 4U0VA 2FNPA 4U88A 4DQ2A 3BPVA 2OZUA 4UNOA 3ABTA 5BOXA 1B1BA 3EUHA 1S6LA 2VBWA 2Z33A 5CYVA 1G3SA 2CFXA 1P92A 2DU9A 5ICGA 4I98B 1BOAA 2DQRA 5LHGA 2ESNA 2HOEA 4H0EA 5E1WA 1ZLKA 2W85A 4L9JA 5FO5A 2IA2A 5DUIA 4YFXF 4A6EA 3F8MA 1U78A 3ROUA 2CWEA 2OQGA 4A0XA 2PI0A 1UFMA 3FM5A 3GUDA 5DD4A 3BZ6A 2ACJA 3WGGA 1YFHA 4LK0F 1YS6A 3C1DA 5D6EA 2TDXA 2Z9OA 1P4AA 1IN7A 5L3BA 4IVNA 3CTAA 4NB5A 1R36A 3Q5FA 2QBYB 2GWRA 4Y17A 4CGZA 1XMAA 5J6XA 4KDPA 5J8FA 3ZMZA 1RUOA 1MGTA 4OIRF 1F5TA 3E5UA 1TW3A 2H6BA 1EH7A 1G3WA 4LK1F 1SD6A 1R5HA 2NAZA 1UHWA 2HKXA 1J59A 5D4SA 5E8IA 2F5EA 2HKOA 2L54A 2MC3A 5ED4A 2IA0A 4P9FA 4U7DA 3GLXA 6PAXA 2GXGA 2PMUA 1C0WA 4O6JA 1FC3A 2VC1A 3KE2A 2JTVA 3IWFA 2H09A 2XV4S 2E7WA 1G3YA 5JR3A 1JHFA 2A68F 4ENNA 4RB3C 4HX7A 5DCFA 1ZREA 4KUMA 3ERED 2VXZA 4RGSA 2UZKA 3O3KA 2K4BA 3RPQA 1J75A 2FOKA 2GZWA 4L5JA 5FGMA 1HSTA 1HKQA 1IW7F 5LRRA 1CGPA 2RN7A 1FP1D 1IRGA 2MA3A 1JHHA 3HOTA 2M1BA 1OR7A 3SHFA 3V7RA 2EFWA 3WU1B 1USSA 5JFRA 1R1TA 4AWXB 2PG4A 1ZLJA 1XN7A 4B09A 3BY6A 4WWCA 4FHTA 4A5MA 4YIIA 5AIPA 4G7HF 3LSTA 3QU3A 5E1ZB 4ESJA 2QWWA 1WSUA 2PLYA 4N9HA 3P9KA 2VT2A 2L4MA 4HQMA 1O57A 1HW5A 4ESBA 3DQVC 2XRNA 4LG0A 1W7PB 4IJAA 4EM1A 2NNYA 5LGTA 4LB5A 1KYZA 5KVRA 4Y15A 4HQEA 1CF7B 3M8FA 3E3VA 4EV0A 1XCVA 3FHZA 4RB2C 4R1HA 1BI2A 1IF1A 4MGRA 3RKXA 2BGCA 1OMIA 4IRGA 2DTRA 4JK1X 3V8JA 2YU3A 3GVAA 2EFOA 1W5SA 2FRHA 2STTA 1L0OC 1P4WA 3RTRA 5TJJA 2VE9A 3I58A 2G7HA 1XSVA 3M1EA 1U3EM 1SD5A 2ZXJA 3O6BB 3ZPLA 1FT9A 4Q47A 1E2XA 1QZYA 2KJCA 3H3UA 4I09A 2P8TA 2V1UA 2W84A 3ZMVA 2M8EA 1GVJA 1XGMA 1E17A 1FNNA 4L5IA 5LEJA 3W6JB 2F2EA 4KN7X 4OOIA 1IRFA 3JSOA 5FFZA 4RS8A 2XHKA 1LDKB 5DCMB 4UVAA 1EH6A 2X4HA 1FSEA 3HSEA 3FX3A 3HSFA 3HOSA 3E97A 3RKWA 3KZZA 3JAMZ 4WCGA 1KQ8A 2P5VA 3ZP5A 1D3YA 3VFZA 5J8CA 2E1CA 1YO5C 2HDCA 3MZHA 2EV6A 2IA1A 1TQIA 4Y13A 1SD4A 3LWFA 1IXCA 3DFGA 2PEXA 2X0LA 4KYWA 3WTWC 5BQTA 2QM3A 3H92A 1QO0D 4A12A 1NHAA 2RVCA 3G73A 3DPTA 5ICFA 2K7LA 2UXNA 2HTJA 4HF0A 2QQAA 2FNAA 3IC7A 3QOPA 1YW7A 4P96A 3KZYA 4AIJA 2FF4A 4MQVA 3BROA 1R5GA 2L02A 3EETA 2UXXA 3R61A 3VB2A 2QQBA 3COAC 3FM3A 1L3LA 3TGNA 5LGUA 1R00A 3ECHA 3WGIA 1R7JA 1AWCA 2D1VA 4BXUA 2WWYA 4M73A 4Q5SF 3KETA 4BH9A 4HOBA 3K69A 4WXDA 2ISZA 4M9XA 4WF2A 1QBJA 2DPUA 5E20A 2MD5A 1UHMA 3TKYA 4ASNA 1TBXA 1WQ2A 1PUEE 2EK5A 1HSJA 5CVVA 5D5VB 5HS9A 3GWZA 3P9CA 4U0WA 2EJRA 2H94A 3HTUA 2MLGA 1TW2A 2HYGD 1J2XA 4HX4A 5HVQC 5JHUA 2Y0MA 1G6NA 3ECOA 1K6OA 4EJOA 3FWEA 1Z6RA 2Q8KA 2D45A 2EV5A 1LB2A 2R7DA 4HLYA 1Q1HA 5ILVA 3KCCA 3M7GA 4KA4A 1ODDA 3F72A 2DLLA 2FBIA 2FE3A 1W5TA 3E6BA 2XAFA 3U9GA 5LBQA 4A2UA 2L01A 2CSOA 2FEZA 2EA4A 1RNLA 5D5XB 4S04A
chains in the Genus database with same CATH superfamily
3MZ8A 1PYVA 2EZLA 3KP4A 4BEHB 1XGNA 1DPUA 1MH4A 4XKWA 1D5VA 1Z77A 3BPXA 2COMA 3O8HA 1FZPB 2EFNA 3TDZC 3DV8A 2FQ3A 2BY2A 4IOCF 1GV5A 2OF7A 2R0QC 3RKYA 1P2FA 3AKZA 1K79A 4XLCA 3QOEA 3ABKH 2VJJA 2C6YA 3A03A 4OIOF 2X1EA 1T8IA 4XLPF 5H2FC 4AU7A 3Q9VA 1OR7C 3H5RA 4MFEA 1UELB 3D5LA 3WTVC 4KT6A 3F6OA 1BJAA 3DPUA 4DYRA 2A07F 1ZYRF 1ZG5A 2DMNA 5CKTA 4AIHA 3DP7A 1U6GA 1JGGA 4FE4A 4G94A 2LTPA 2HGCA 2W57A 3S32A 3U2RA 4BQQA 4BE1A 1J0RA 3KPHA 1RC9A 3FMSA 4BE2A 1Z7UA 2OTJI 2M2EA 3F3XA 1IXRC 1GXPA 3LMMA 2Y0SA 4NNJA 1KU2A 3J81K 4QTRA 2R5YB 1IZ1A 1MBEA 1JKPC 1G4DA 2UWMA 5B1BH 3IV5A 1R9TJ 3K10A 1ZHFA 2KRFA 3I5UA 3A0HC 4G12A 1LUJB 2CW0F 4I7HA 3K6GA 1YIJI 2M87A 1ON1A 1S8NA 2OQRA 3MEXA 3CMYA 5CPRB 1X3UA 4CYDA 4XQFA 4A93J 2PJPA 1IRXA 4A3GJ 1W4MA 1MH3A 2V7FA 4EJTA 2LBFB 4EGYA 3RJPA 3A01B 1ENHA 2CV1A 2AQEA 4HZFA 4MHGA 4PUSA 1IN6A 1IV6A 2LC2A 4X6AJ 3TQNA 1WVRA 2MABA 5HLHA 4YRVA 2Q0OA 3BG9A 4ZTFA 1JGSA 3HYIA 3ZQGA 1MNDA 4GGGA 2VPLA 2Y75A 5DV5A 1YI2I 1F36A 1X1DA 4CXFA 1VQOI 1RKTA 3B6CA 2VBZA 2PQ8A 4P5OA 2EIMH 1WH5A 3GX4X 4C2MJ 5L3DA 2UV1A 1K78A 4WK8F 2ZSIB 4RGUA 3T0YA 1W36C 1RKWA 3SQNA 1PDNC 2OCCH 1XX5A 4EQQA 2ID6A 2CYYA 1M1EB 2G0EA 3BQZA 2ZO4A 1KGSA 1SMTA 3PIOF 3ONQA 5IOYA 1YJWI 2XAGA 3F8NA 2QQ8A 3OY9A 3TO7A 5DUKA 1S7OA 2HS5A 3ABMH 4I76A 5J4YA 2Y31A 2QVOA 4HG2A 2DO7A 4XRSA 2LNBA 3ZQQA 5LD2C 4A3BJ 5IYDJ 2WV1A 3UNGC 3LSHA 3H3VK 3BJAA 4KISA 3S2DJ 4BUPA 5KHDA 4TV7A 1VQPI 2EB7A 3GTKJ 2LD5A 5LFAA 3B73A 4HNTA 3ZRGA 3OYGA 3PO3J 2H1KA 5K7FA 4PCQA 3ELKA 2CO5A 3CDLA 4BQOA 4XR6A 4XLFA 4NC8A 4V19K 2RAEA 2FXAA 1KU7A 4QPQA 5FJ8J 1Y8QB 1LEBA 1MDMB 4I6ZA 1T38A 2XPWA 4CYCB 3CP8A 5HLIA 1BA5A 1U9OA 4RAFA 3F23A 2GQQA 1FOKA 2ZSHB 2W25A 3DXJF 3U21A 3ZCOA 1R1UA 2W24A 1ULYA 4CSWA 2ZFWA 4PDKA 5TGTA 5L3FA 4F91B 2FMLA 4A69C 1F4KA 2E7XA 1LDDA 3E5XA 4EATA 1DP7P 4GFBA 2JPCA 2LSOA 1KU3A 3LFKA 5KAIC 3BZKA 3IRRA 3CCJI 1IC8A 1YLFA 5JI6A 4LGWA 2ZCWA 1B4AA 2E2IJ 5GPAA 2X6XA 4IL6C 1V3FA 3LQQA 2IS2A 3JRGA 2M30A 3CLQA 3KP3A 2BBYA 5DCMA 1VQ6I 3IH3A 2DPDA 1RETA 2FA5A 3S1NJ 4BYYA 2MBFA 3K1NA 5FKMA 3WU0A 5LGNA 1X2MA 2W7NA 4XSZF 2R3SA 4DBRA 2BHZA 3RSNA 1F1ZA 1FWZA 4BL0B 2DA4A 3HSRA 2DMQA 1X3ZB 3KEYA 1TNTA 2JSCA 3ZOBA 5IYBJ 2CJJA 1E3PA 3JAMK 4U7BA 2QA4I 1HBXG 1U5TA 2XVCA 3AG1H 2NOJB 3CZ6A 2XGDA 1FY7A 4IF4A 5JLXA 2JPBA 4FCYA 2V1XA 4CCKA 2OD5A 4I0BA 3ZQLA 1RZ4A 2L9SA 2IPQX 2ZMEB 2Z5UA 4NC7A 1XGOA 4NHJA 2D2WA 2WV0A 3C2HA 1I39A 5F0CA 3CUQA 4RBOA 5M3FJ 2DT7B 2XPUA 5FFXA 2ISYA 3RYRA 4BJ5C 4D5CA 2IGNA 3HC7A 3VDXA 3HUGA 2DMPA 4HSTA 4MEXF 4XLEA 2DA6A 3QWLA 4UVCA 4XSXF 2JVGA 1WJEA 4M3EA 2IS4A 1YQAA 4M71A 4KNYA 4IHWA 3HKZA 1MSEC 2Y48A 4HA8A 4MTDA 3BZCA 4XNFA 3FXJA 3HZJA 3MKYB 2L9VA 1JT6A 2E2JJ 1D0ZA 4Y4RA 1TC3C 1S9HA 1LQ1A 3QYEA 3F22A 1I6HJ 4HF2A 3AG2H 4L9TA 4J19A 2IGKA 4XKBA 3TO6A 1F9NA 3CC2I 4A3LJ 4NQWB 4F92B 2X48A 4CH7A 3FDYA 3GZ6A 2OU2A 4DOZA 2VC0A 2R92J 2P7VB 3J81Z 1YX3A 2FMYA 3J80Z 3B02A 3HRTA 3J7ZI 1YTYA 4IXAA 3D0SA 4IHYA 3BJOA 2GLOA 1JUPA 1Z9CA 3WTTC 3GYHX 3C2BA 3K1MA 3WE3A 1OCCH 1LNWA 2OTLI 4C3IJ 4MQ9F 2DQLA 1ZRCA 5HLTA 5DS9A 1ZG3A 4PJMA 1T2KA 3OS1A 2KFDA 2WA0A 1W0UA 3V7SA 2A6EF 4YG2F 4HAMA 2EIKH 2R7FA 4Y52J 2H27A 2DOAA 3JRHA 3GEZA 1IDYA 2JUGA 2IVMA 4PZJA 4CICA 3G4SI 1NG7A 1SFOJ 4Y33A 2X6WA 1Z6TA 3BP8A 5L3CA 3FBNB 2DMUA 4E7SA 2NVXJ 3S8PA 2WB1A 1AOYA 2Z3YA 1G3TA 2NYXA 3KEQA 3K70D 2GAUA 3CCEI 3N4MA 3AAFA 2VOPA 2M7AA 2ZJQF 5E3MA 1PP7U 3E5QA 1PVEA 2XIGA 1IN8A 1LE8B 3WG9A 1GXQA 4B4CA 3L2QA 1WFXA 2LY2A 1MMAA 4FE7A 4IHTA 4XL9A 5ERIA 5IY5H 3N97A 4KIGA 2BXYA 1K61A 1X1CA 4L0YB 1JKOC 2KMUA 1POGA 5D8KB 2ETHA 4MEYF 3GTOJ 3KP5A 1R22A 4A3JJ 1ZG1A 3PO2J 3O2PE 5E8GA 1JJ8C 1QHGA 2ECCA 4AYBN 1KU9A 1KQ0A 1QRYA 3KFWX 5GAHJ 3S2HJ 2VT3A 4ZH4F 5D6FA 1QVUA 2KJBA 2Y69H 3DKYA 4RGRA 2K02A 2XKPA 3H0GJ 4CA0A 1CQTA 2JA5J 2XUBA 1DUXC 1FMWA 3M8EA 3L7WA 5EZGA 1FYMA 1NK3P 2WY8Q 1DDNA 4BE0A 3I0TA 4MIMA 3JR9A 1T98A 1FYLA 2M45A 2K9NA 3HHGA 2VOOA 2OJED 2EFQA 4BJTA 3I59B 4B48A 2RC4A 4AIKA 2ZFUA 2P5LC 1E0EA 2XAQA 3ML6A 1YIOA 2LF7A 2CG4A 1IN5A 3JW4A 4RB1A 2VQLA 2X9DA 3DBRB 2VLAA 1ZARA 4BJ6C 4HDVA 4LLNA 5ILSA 2HQNA 1D1CA 3M9AA 1ZH5A 4ZC3A 1LEAA 3ISPA 1UB9A 3E6DA 4E70A 4YFNF 1IG7A 2CQNA 5KNLA 3U1KA 4GO1A 3Q0VA 5HS8A 3VOEA 2J5PA 2V79A 2EZHA 4ETSA 1ZK8A 3DTKA 2YX7A 3ESWB 2QSFX 2F6CA 3MD2A 1RR8C 2LKPA 2V1DA 1WCMJ 2E1MB 1QPMA 1R58A 5C3EJ 4IHVA 4L9VA 3WODF 3HTSB 1MJBA 1K4TA 3LFUA 4UUTA 1WKMA 5IT9Z 5HOOA 5JHFA 1I1GA 4M6XA 2K4JA 1WRJA 2NNNA 2GA2A 3V4GA 1R49A 4P55A 2MFZA 2B9SA 1TWGJ 2QSGX 2KIUA 4NC6A 1STZA 2CQXA 3HXLA 4Q4ZF 3IRQA 2ZJ2A 5D5UB 3L09A 4R8HA 4QSHA 5CQEA 1JTYA 1XD7A 3C18A 2QENA 1FPQA 1D0YA 1MMGA 4HW0A 1K7AA 3VWBA 2XF6A 3S16J 4LLLA 4PSWA 3W6VA 2JZYA 2KQRA 2PBIA 2WY7Q 2VUMJ 2IP2A 2LDUA 3C2GA 3KP7A 3I4MJ 5HODA 3KEOA 3BLYA 2V6CA 3CDIA 4XONA 1W5CC 3ZQHA 3GZNB 1OYWA 3F0CA 2O7OA 3QQAA 4G7OF 2PMHA 1ZR4A 2VQCA 3EUAA 2A05A 4GCVA 5K7ZA 2DAOA 4GDFA 3FIWA 1FP2A 2XGCA 1I6XA 2FX0A 3PL8A 2RQPA 2DCEA 4I02A 1IJWC 1RRJA 3T8TA 1YRNA 1TLHB 3RZOJ 1VQ9I 3K4MA 4HDUA 3QU6A 1BI1A 4QLCU 3FXKA 4V2GA 2Q2EA 1T39A 4HV6A 2B7EA 1Y1WJ 3F8BA 1HXDA 3FMRA 3HGYA 1MD0A 5EDNA 4HEA2 3MFKA 4BXFA 1RI7A 3E0JB 3SZGA 1P4XA 2ZJRF 5BMZA 4AD9A 4M9ZA 2E1NA 3H1CA 3BQYA 4RAZA 1J9IA 3HRSA 4KIBA 3IAS2 1BBYA 1ETYA 2O0YA 4LB6B 2NVQJ 4D7NA 1KYWA 1XDSA 2L9NA 3RIRA 3EYIA 1ZGJA 2RGVA 2RV8A 3ZXSA 2XB5A 2K3PA 3TL4X 3ZQ7A 1PUFB 4JP0A 2WBMA 2QEXI 2ZNYA 3WE2A 1VQ8I 1HW1A 4KT5C 4UHTA 3BG7A 3BWGA 3IKVA 2IEKA 5J4VA 1ZN2A 2QBYA 1UG2A 1I5ZA 1IUYA 1K83J 1T0FA 2MLKA 2YS9A 3C7JA 3V8KA 1VQNI 2ZKZA 4ZZLA 5K5QA 1D0XA 1RPWA 3BJ6A 5EJCA 3TDUC 2IJLA 2E5ZA 3DEWA 3T5XA 2XF7A 1HQCA 1BIAA 2DMTA 4BY1J 3ERMA 4L9NA 3F21A 3C3WA 5LLQA 1U2WA 3DU5A 2HOSA 3HBLA 1EA3A 3FXUA 3I54A 3DTIA 4LG0B 2QF7A 1Q1VA 2DA1A 2DA5A 2F5FA 4A5NA 1O3SA 2DJNA 3I4PA 2EA2A 3LA7A 5F08A 3K2ZA 1FX7A 2HYFA 1IO2A 2IGMA 3X2QH 5M5XJ 2FBKA 3SZTA 4E6KG 3DU6A 4M9SA 1FSHA 4DZJA 5M3MJ 3HIFA 1Z0XA 2YX4A 4HX8A 4D7MA 2CUJA 4KMUX 2P5KA 2RNJA 5B1AH 4YFKF 4CHUA 3N05A 4YEJA 1A31A 1WWXA 2A61A 1S5LC 2EFPA 5J1RA 3ABLH 2J5OA 4DBQA 1VNDA 1BC7C 1V5FA 2RNGA 4BDZA 4EJWA 1JKQC 3F9KA 4IZZA 1DU0A 3VYRB 3H9GA 4I99C 1ZRDA 1D8KA 2E60A 4KIFA 3TOBA 2B0LA 4X0GA 2AQFA 1APLC 2XKOA 2RDPA 1ONVA 4LMYA 4BHCA 2KL4A 2BVLA 2ECBA 3S14J 4IO9F 4MFDA 1BL0A 4UUVA 5FRMA 2O5RA 2I10A 3JTGA 1SFUA 3PJRA 5B5EC 2XPVA 4PJJA 2OC6A 1X3WB 3HM5A 1RIOH 1GLNA 1LVAA 4N9IA 2HTSA 1J7KA 1T6SA 3MQ0A 3KLNA 1JXSA 2PN6A 4MNUA 1DQUA 3CJTB 2K40A 3WTUC 3L2RA 3HRUA 4L0ZB 5GPCA 5EG0A 1OYYA 2L2OA 1U5TC 1XGSA 2MC4A 5KK1A 1TT5B 1I3QJ 3NRVA 4BHPA 3FXOA 4ZDPA 2VJ5A 3LA2A 4I2OA 3IH4A 1WJCA 2AHQA 4HF1A 1EV7A 1WJ5A 2DK8A 4IRIA 5DYMA 1H9TA 4F7ZA 3FF5A 5ICEA 1R1VA 4RLFA 3IWZA 5F1RA 5J47A 3RQ4A 3CUQC 2XAHA 2KIQA 5H6RA 1DP3A 3WG7H 4UUSB 2COBA 1YITI 3GW2A 2DXIA 1OFCX 2DDAA 3KYCB 2O61A 1W7PD 2JT1A 3I64A 3ABUA 2RQQA 4E4HA 1OCTC 3ZN1A 2NVTJ 4PGGA 5LHHA 5C4JJ 1SD7A 2R7UA 1YE9A 2WAQN 2NRAC 3ZMSA 1I1SA 5FLXK 3BTLA 1H9GA 2GXAA 3LAPA 2EILH 4G8XA 2O6GE 2QZ8A 1MNEA 1B72A 2R7VA 4BQAA 2HYJA 2HXIA 1T95A 4KITB 1SMYF 2EWNA 4XLHA 2PJRB 1O3RA 1MBHA 2VASA 4E7KA 2OAZA 3Q0WA 1VI0A 1YYVA 4FT8A 1QVTA 1LFPA 3J80K 1NK2P 5E1XA 3S3OA 4XLNF 4RLQA 1LDJA 3WTXC 3L2CA 3TEDA 4CO8A 2PMZN 2RKHA 1LPQA 4BQNA 1J09A 1R4MB 5DEQA 3QPLA 1HF0A 3LQRA 3OYDA 1R6RA 5F64A 1BI3A 1W7PA 4UXNA 2K27A 4A0ZA 3CO7C 4B3XA 1REPC 4GYGA 3S93A 2HVRA 2CQQA 2ZBKA 1QZZA 4ZZDA 4M74A 3RQIA 3K7AJ 1ZELA 3NWTA 2CQ7A 3BOQA 1SEUA 1CF7A 2K9QA 1WJAA 1SVMA 5CVJA 1HKSA 2QCOA 4UY8I 2CW8A 3OS2A 1MBJA 3MAJA 4BY7J 3CCUI 5LHIA 4LIUA 3CCVI 3F8CA 3K1PA 2GA1A 5CVUA 2HFHA 2ADUA 4J00A 3OSGA 4DNCA 5C44J 3J7AO 1QU3A 1J5YA 1QNTA 2K9MA 1BW5A 1TNSA 3DPLC 1XSXA 4UV9A 2EQRA 1D8JA 5F0HA 3HGGA 4DYQA 2YPRA 3PQKA 2Y9YA 1OCRH 5LRSA 5J1UA 2XAJA 1DGWY 2AO9A 2IXSA 3CP2A 3D1NI 3GFLA 2XROA 3GTLJ 3VEPA 3OOPA 1UCRA 2ZNZA 3KLOA 4EM2A 1KQ9A 2IT0A 3K70C 1W1WE 1YS7A 3GZ5A 4ON0A 2GBYA 5D8LB 1GT0C 5D5WB 1ACIA 2V9VA 5DM7F 4LJZF 2K3FA 1SAXA 2I8DA 3E6MA 2HZTA 1D1AA 2VKDA 2VJIA 3P7NA 3S3NA 4XOTA 3JTHA 2CMPA 4Z2YA 3CCMI 3K9TA 1XC5A 3DLLF 3I59A 4YIRX 4A3CJ 3I71A 3SDGA 3L00A 2VKVA 4MTEA 1P9QC 4FX0A 1JE8A 4UV8A 2G9WA 2QLZA 2IGOA 1A6QA 4M6YA 4CCLA 2KKOA 5FD5A 2CGPA 3FZVA 2YSRA 2DBBA 3TOAA 1AKHB 1ZAOA 5H6QA 3CCYA 3K0LA 3OV8A 3DEUA 2KIMA 1Z3XA 2WADA 2DI3A 1USTA 2KZVA 3AFHA 4RGXA 5FKOA 1O3TA 3R0JA 3QRFF 3CC7I 4BU2A 4ZYDA 4XBFA 3FKIJ 5F6FA 3ZMUA 4OWRB 4AUXA 3CC4I 5B3SH 4OMYA 3A0BC 4B44A 5IOZA 4U0YA 4RAGA 1TQMA 4QWQA 4HNUA 4O3MA 2CUZA 3H3ZA 4EM0B 2QQ9A 4FQGA 5E18F 5IT9K 1BIBA 5EGOA 2K86A 1B6AA 1MSFC 1O7LA 1Y39A 1O3QA 4BDYA 1WI9A 3GXOA 2P6SA 4B43A 5FLVA 3L9FA 3CJQB 1HKTA 4D0PA 1XG1A 1OQYA 5CVRA 1E3HA 1A04A 4ENKA 3OYCA 1GVDA 3UR3C 1R71A 3FK7A 5TISC 3QP5A 1B8IA 4XRFA 3SFZA 5AONA 2ESHA 3BDDA 2EIJH 1MBKA 2L7MP 3GMEA 1A35A 4CUGA 5HS7A 1FOXA 5F1JA 4DW6A 3GTQJ 3GFJA 1OLTA 3P9IA 3UKGA 2A69F 1QQIA 3DBLB 3WTZA 3KP6A 4I0AA 4E7IA 2EZIA 3J7AY 4N4OB 3Q9SA 3K4BA 3WGHA 4JBAA 2Z1DA 3FXRA 2M5WA 1F43A 3MWMA 4E7HA 5FLXZ 4ZDLA 3V8LA 1ON2A 4WXCA 2L4AA 2ME0A 3S15J 1OCOH 3DEEA 2E1OA 4A3KJ 4F52A 2MGQA 5LEKA 5IYCJ 3JREA 1Y0NA 5D5XB 3ZQFA 1SFEA 2GIZA 3HOXJ 3K4LA 4LFUA 1R5ID 1HOMA 1OPCA 3G1OA 2MYSA 1SFXA 3QPHA 1IN4A 2P4WA 2YR2A 4HBLA 4AM3A 2HDWA 3WHBA 2VXDA 2DK5A 1VTNC 3CO6C 5FROA 3SXYA 3BT9A 4EGZA 4HYEA 2A3SA 5JVTA 1TWAJ 3QAHA 4OINF 3TW7A 2R5ZA 1BOBA 3A02A 3RDIA 3WU2C 2P81A 4XKCA 5AIQA 3R0AA 1X1AA 1PUFA 2CUEA 3W6KB 5HDNA 1EF4A 3NEUA 2DT5A 2XSJC 3EDPA 3RPUD 4P1WA 1T0FC 4WXHA 4L18B 2VBYA 1K4SA 2H1LA 2MH9A 4D5FA 2XASA 1B59A 4IRHA 5K7HA 4CZZA 3ZMTA 1Y1VJ 2LRDA 4A3IJ 1MJAA 3R6SA 4LITA 3HHHA 5E79C 3JSPA 4RAYA 4N0BA 1RUNA 4A3EJ 3QPTA 4C3JJ 2KRHA 3AL0C 1A6IA 5A2QK 4F3QA 1FLIA 2JMWA 4BACA 3GCMA 2IAIA 2F5VA 2X6YA 2W4SA 2MH2A 2BZTA 2JVHA 2A6HF 1ETQA 1TQPA 2KIFA 3DF8A 3F8FA 5FD6A 3CESA 2NXNB 1U9NA 1KA8A 1EH8A 4A0YA 3IL2A 1WJFA 4BAYA 3FXLA 3CDHA 2BY1A 2DODA 3I53A 3VSKA 5IT3A 4KICA 3CF2A 3GF2A 2ELHA 2ELKA 2I5UA 2OBPA 2VODA 3ZQIA 1NG6A 2M0MA 4DGWB 1NH3A 1YW9A 4C30A 4ANJA 3R60A 1UAAA 5BPDA 3REOA 4BHBA 2Y0SN 1K78B 3SJMA 1FBSA 3MKLA 3RPUA 1FBQA 3H9JA 4YIFA 1Z91A 2XF5A 2LKSA 2M7BA 2PFBA 3L1PA 2P7CB 2BV6A 3QP6A 1BM9A 5EZHA 3PQJA 2R7QA 3HG9A 4DZPA 3ZN0A 4RA2A 2KLOA 2NOGA 1ZGAA 5EEHA 4EJUA 2H8WA 1FTTA 1G2HA 2P0WA 4O5VA 1PP8F 3HL2A 5HNHA 3VODA 1BR4A 2QYOA 4Q48A 2IW5A 2WTEA 3RZDJ 1IXSB 3LA3A 2DFIA 1YG2A 3BCBA 5GTHC 3RI4A 1EJ9A 1Z67A 4S05A 2TCTA 3E6CC 4XN0A 2CQKA 2G7UA 4FX4A 1JUMA 4LOCA 3ZR8X 1V4RA 1KZHA 1JUSA 2E5NA 4IPAA 3WTYC 2JN6A 1H89C 2BW3A 3CLOA 2DTZA 3BR6A 3I9V2 2R4GA 5ICCA 2VKHA 5HDGA 1BN5A 3SZPA 2BVMA 4C2TA 3BG5A 1WI3A 4DYCA 5GAEJ 4PGHA 2GIVA 4R79A 1BC8C 2LKXA 2PMZA 4HV5A 3ULQB 4BEHA 4JYKA 1AHDP 2HWVA 3GO5A 5EEGA 3OYEA 1GDTA 2DN0A 4UVBA 1Z21A 4OIPF 3O8GA 5K1YA 3BR2A 3LSJA 4HLXA 2LY9A 2UUZA 1SAUA 1P7IA 1Y56A 2HQ5A 2LREA 3HEFA 1DPRA 4WX9A 1X1BA 1HDPA 4JX5A 5GP9A 2STWA 4EVIA 2FBHA 2L0KA 5TRDA 2GOMA 5ILUA 4E7JA 2LF8A 2OA4A 3J7YJ 4ESFA 5M5WJ 3CF5F 4P9UA 4ZYGA 2LFBA 4G6QA 3EQLF 2LG4A 2X1CA 3OIPA 3R4KA 2FU4A 3S2WA 3BR0A 1MJ9A 1OCPA 3GFMA 1U5TB 1V55H 2MG4A 2R5YA 2BXZA 2DOFA 3IHUA 5L3EA 2V1NA 4KFCA 3V7CA 4ZTJA 1WJBA 4BKXA 4ZYEA 4OMZA 1Z05A 2ZXWH 1U8RA 3CJNA 4B8XA 4EJVA 2E36A 5L3GA 3CUQB 4OAYA 3DLAA 4M3BA 3LSGA 2XAUA 4CCMA 2F5CA 2D1HA 3PFIA 1WJDA 1DGRM 4RB0A 1XCBA 3HUGB 2LBFA 3ASNH 3AG4H 2XSDC 3A01A 3G1MA 4LIVA 1OYIA 4KN4X 3LAJA 1BI0A 1LVKA 1Y0UA 2ZXIA 2VE8A 2HEOA 2GXBA 2HNHA 5K5OA 3WTSC 2LH9A 2OPTA 1O4XA 4Z6YA 3LSRA 2A5YB 1I50J 4G6TB 4JQFA 1YW8A 5DD8A 1XMKA 5DDGA 4BXXJ 3BR1A 4H4KC 1TTYA 2XGXA 3IKTA 1R23A 3PNYA 3VYTB 2W48A 3WHCA 4XIDA 1X19A 3DTEA 1IGNA 3FXQA 2LK2A 4IHSA 1FBUA 1Z1DA 3TO9A 4IQJA 5BPIA 1QHHD 5C4XJ 3G3ZA 3Q3SA 1X4PA 1AA7A 3OYJA 2R7RA 5D4RA 2FSWA 1D1BA 2NVYJ 5E17F 3SEQA 3M1CA 2NS0A 2VN2A 3BG3A 3CCLI 1TWCJ 3S1RJ 1I27A 3K4KA 3FMQA 3OMYA 1IUFA 4ENMA 2HQRA 1B9MA 1S3JA 3MZYA 1BR1A 4A6DA 4XRSG 2DW4A 5A2QZ 2R7SA 1XDUA 4KMFA 5BNGA 2A5WA 2F4IA 4ZJZA 1OKRA 2K85A 2JA7J 4GXOA 1SC7A 3MMYB 4XRMA 2KZGA 3HKZN 3GTPJ 5E3NA 1S7AA 4M72A 4A3MJ 2BYVE 1YOVB 3BTIA 5HLGA 4E7ZA 1XSDA 1IAWA 2GM4A 2L3DA 3OL4A 1GV2A 3U1DA 3F6VA 2ZXHA 4GYIA 3CCQI 2VONA 2V4JC 3D5RC 1MDMA 1FEXA 4CDGA 2MD0A 3GFIA 4MLOA 3QYBA 4CYCA 2JA6J 2BEOA 2DOEA 1FTZA 2OZ6A 4LLGF 4EMSA 4AVPA 1MZBA 3CUOA 5B66C 3KZIC 3A4CA 4G6DA 1YJNI 2K5CA 2YU9J 2E34A 1MIJA 3PUFA 2LYCA 2BE5F 3EYYA 2DT6A 3T1BA 1N78A 5IPAA 2KISA 4UB8C 2AS5F 1FOYA 1UJ8A 5FB2A 2IRFG 2NVUB 2DA2A 2EBIA 2WC2A 3HRMA 5F0FA 3TBIA 3G71I 2HPMA 2EV0A 3JRIA 5CVIA 3PSIA 3OSFA 2E19A 2M8GX 3ZMDA 2WB1N 2O8XA 4E7LA 2D5VA 3MCZA 3QODA 3QYFA 1B9NA 3RYPA 1H8AC 3HDDA 5K5RA 3JCUC 4LD5A 4N4NB 4OU0A 2F5DA 5J3LA 2OCEA 4BNCA 3QPSA 1K6YA 4C3HJ 1ZRFA 3VPRA 2ELJA 2HQAA 4L5EA 2KDZA 2M4KA 2AXLA 1H0MA 2ZMEA 2Z99A 4XLAA 3KP2A 4XOPA 4ENJA 2QGUA 5EEAA 1QGPA 4IOAF 3EPZA 2DA7A 1FYKA 2O3FA 2V9PA 4ZYHA 3NWSA 1LJ9A 5CLSA 1MKMA 5H20A 2XDVA 2Y9ZA 2O9LA 2H6CA 3LSMA 5HDKA 3NQOA 2P6TA 4K2EA 3T8RA 2HR3A 1O7FA 2LMDA 3GLLA 1XB4A 4I01A 5BS6A 3TP0A 1GHCA 5JVGF 1TWFJ 1V54H 4HNVA 4M3FA 1S72I 2KT0A 4G9YA 1HW2A 1MMDA 4OIQF 2QUFA 3DKWA 4FTHA 4PK4A 2ZC2A 3BG6A 3CMMA 1S29A 4NQWA 2R7XA 1P6RA 2JRTA 2O03A 4Y3OA 2VBXA 1TWHJ 4G7ZF 4U0VA 2FNPA 4U88A 3BCAA 2X6OA 4DQ2A 3BPVA 2OZUA 1N77A 1P7JA 3LOCA 1YHQI 1WGXA 4UNOA 2OV7A 2KDOA 3ABTA 5BOXA 1VQLI 1B1BA 2IS1A 3EUHA 4ZYAA 1UG0A 1S6LA 2VBWA 2Z33A 5CYVA 2M9HA 1G3SA 2CFXA 2HPIA 1P92A 4AYBA 2CU7A 2DU9A 1TT0A 3PFYA 1EKEA 5ICGA 1RR7A 4I98B 2XB0X 1BOAA 1IV8A 3FK6A 4FETA 1U0JA 2DQRA 5LHGA 4DJAA 2ESNA 2HOEA 2H8RA 3H35A 4H0EA 5E1WA 1ZLKA 4AVZA 1HC8A 4ITVA 2W85A 3MN2A 4L9JA 5FO5A 2IA2A 1LE8A 1YRNB 2CW7A 5DUIA 1Z7LA 4YFXF 5FKNA 4A6EA 3F8MA 1U78A 1V5GA 3ROUA 2CWEA 3H5NA 2OQGA 4A0XA 2XC7A 2PI0A 1UFMA 3FM5A 3GUDA 5DD4A 2Q2EB 3BZ6A 3V42A 2ACJA 3WGGA 2KHMA 1YFHA 3S17J 2RREA 1VQMI 3OYFA 4LK0F 1YS6A 3C1DA 2ICWG 5D6EA 2TDXA 5DM6F 2Z9OA 2QKLB 4OAZA 4CCJA 2W00A 1P4AA 2EPFA 4F55A 1IN7A 4QPOA 5J40A 5L3BA 2R7OA 3BR5A 1UZCA 5FKKA 4IVNA 4FASD 3M8JA 3GTMJ 1T56A 2YUSA 3CTAA 1KONA 1R36A 4NB5A 4XN3A 3Q5FA 4KJZA 1ZR2A 2CV2A 4JX6A 2QBYB 2GWRA 4EEFG 4Y17A 4CGZA 2JA8J 4XM3A 1TP4A 1XMAA 5J6XA 1SVLA 4KDPA 1BW6A 4PFPA 4M3DA 5J8FA 1Y8RB 2DYSH 2IBDA 3ZMZA 2PX9A 2JWTA 1RUOA 1N25A 2DDBA 1MGTA 4OIRF 1A36A 5DTDA 3OYLA 1ETVA 2CV0A 5FRNA 2NS7A 1F5TA 3E5UA 4M6VA 1TW3A 5GTIC 2H6BA 3AL0B 1EH7A 1G3WA 4XKVA 3OOUA 3IH2A 4LK1F 3SDBA 4B3AA 3D5SC 1SD6A 1R5HA 2NAZA 1QZEA 1UHWA 2HKXA 4RM2A 1J59A 2LY1A 5D4SA 5E8IA 1S7EA 2HI3A 2F5EA 1TL8A 2HKOA 2L54A 1MNMC 2V9KA 2MC3A 1A5JA 2DFFA 5ED4A 3L2WA 2IA0A 1V5EA 4P9FA 4U7DA 3HOVJ 2BHYA 3GLXA 1FIAA 4IKFA 1I3AA 4X1EA 3JRCA 6PAXA 2GXGA 2PMUA 1C0WA 3JRFA 4O6JA 1FC3A 1MMSA 4BBSJ 2VC1A 3KE2A 3KIOA 4B47A 2JTVA 3JRAA 3IWFA 2H09A 3I55I 5CQGA 1Z3YA 2XV4S 4ABZA 3RCOA 2E7WA 3OYHA 2CS3A 2Q1ZB 3OYIA 1G3YA 5JR3A 2E35A 1JHFA 3W2AA 3ASOH 2A68F 4ENNA 4RB3C 3FBIB 4HX7A 2JRMA 3TMOA 1N75A 2NS8A 5DCFA 4RDUA 1G59A 1X58A 1ZREA 1WZ2A 2KRCA 4KUMA 3ERED 2VXZA 1H88C 4RGSA 3E7LA 4W97A 2UZKA 2E2HJ 1IDZA 5F04A 3O3KA 3PUBA 2DJIA 4JOMA 3M4OJ 4GRIA 2FQ4A 2HZDA 5EG0B 3I56I 3W3CA 4HPQA 2K4BA 2HU9A 4RM3A 3RPQA 3P5JA 3OYKA 1J75A 3W2VA 2TRTA 3TW6A 4J01A 2FOKA 2GZWA 4L5JA 3M07A 5FGMA 1HSTA 1HKQA 2LVSA 1IW7F 1UMQA 5LRRA 3HOYJ 1ETOA 2VQGA 1FMVA 1VQ7I 4QIWN 1CGPA 2RN7A 3VYSB 1FP1D 3L2VA 1ZKGA 4V2FA 2LOOA 3HJEA 2ZB9A 1IRGA 3H5AA 2A6TA 2R7TA 2MA3A 4S0HB 1HDDC 2O8KA 1ZTRA 1JI8A 4HSRA 5J1YA 1JHHA 2DYRH 3HOTA 3LSIA 3OR1C 1YJ9I 2M1BA 1JT0A 1OR7A 3SHFA 3V7RA 3BC8A 2MSYA 4JX4A 3KYLA 2EFWA 2FJ1A 3DKXA 4IHXA 3WU1B 1USSA 5JFRA 9ANTA 3KX2A 1B72B 4F93B 1R1TA 5IP7J 4AWXB 2PG4A 5M5YJ 1ZLJA 4C9YA 1XN7A 4B09A 2M4GA 3BY6A 4WWCA 2VKEA 4FHTA 1W36D 2R93J 4A5MA 4YIIA 3OYNA 3LSPA 3OIQA 5AIPA 4FISA 3OYAA 3LSTA 3QU3A 4G7HF 5E1ZB 4CZCA 1MMNA 4ESJA 2QWWA 4W1UA 3Q0UA 1VQ5I 1WSUA 2PLYA 4N9HA 1WPKA 3P9KA 4BBRJ 1MW7A 2WAEA 2VT2A 2L4MA 4HQMA 3VSLA 4NBQA 1O57A 4A3FJ 1HW5A 4ESBA 1Y6IA 2F4MB 2FD5A 2XRNA 3DQVC 3AG3H 5EYRA 5IP6A 1W0TA 4LG0A 1W7PB 4IJAA 4EM1A 2NNYA 1BR2A 1G8XA 5LGTA 4D9JA 4LB5A 4IQ4A 2ZJPF 1KYZA 1FJLA 1D5YA 5GADJ 5KVRA 1ORKA 1ZQ3P 2DFHA 1LFUP 3OR2C 4Y15A 4HQEA 1CF7B 3M8FA 2EZKA 3E3VA 2V6EA 4EV0A 2BY0A 2OUMA 1XCVA 3MKWB 3FHZA 4RB2C 4R1HA 1BI2A 5GAGJ 1IF1A 5IP9J 5JLWA 4MGRA 3RKXA 2BGCA 1HCRA 1OMIA 1FIPA 3W2WA 3RKQA 3EUKL 4IRGA 1IRZA 1XMXA 2DTRA 3G6EI 3CMAI 2M3AA 4JK1X 4XORA 1VF9A 3IAM2 3V8JA 2YU3A 3GVAA 2EFOA 1W5SA 3LNQA 2FRHA 2STTA 3KYDB 3BTJA 1JTXA 3JRDA 5FKLA 2BOLA 1L0OC 1P4WA 1XS9A 3M3YJ 3RTRA 2VB6A 5TJJA 2L7FP 2JUCA 2WAQA 2VE9A 3I58A 2G7HA 4PJ0C 1OCZH 1T33A 2F48A 2QSHX 1JJ6C 2F4OB 1XSVA 3M1EA 1U3EM 1SD5A 2JK3A 4AC0A 1MBGA 2ZXJA 4IX7A 3I4NJ 1NTCA 3O6BB 3BR3A 1RESA 3ZPLA 2Y30A 1U8BA 1HLVA 1FT9A 1LFBA 1ETKA 2CFOA 1DU6A 4Q47A 1E2XA 1QZYA 1X1PA 2KJCA 3H3UA 4I09A 2P8TA 4NUBA 2V1UA 2W84A 3ZMVA 2M8EA 3MVPA 3OIOA 3IP4B 2R7ZJ 2ZMEC 1GVJA 3CQZJ 1XGMA 2EINH 1E17A 1FNNA 4IEJA 5HNFA 4L5IA 2V26A 3GTJJ 5LEJA 5FLMJ 4YELA 4UUSA 3W6JB 2F2EA 4C2UA 1VFCA 3ZQCA 3FHNA 4CCNA 4XK4A 3HOWJ 3H36A 2WAFA 4KN7X 1XPXA 3I3LA 1E3OC 2GOXB 2CRGA 4OOIA 1IRFA 3JSOA 4II3A 5FFZA 4RS8A 2L7KA 2XHKA 1LDKB 2Y2ZA 5DCMB 4UVAA 1EH6A 3E1SA 2X4HA 2CH0A 4A3DJ 2CUFA 1FSEA 1GUUA 2KP6A 3S1MJ 3S1QJ 4HRIA 3A2KA 3HSEA 5EGOB 3FX3A 2XRLA 3NAUA 3HSFA 3HOSA 1SFKA 2M0CA 3E97A 3FXMA 2L9RA 1ERDA 3RKWA 3KZZA 4BS9A 3JAMZ 2PJRA 4WCGA 1KQ8A 4BGDA 2P5VA 3TP3A 3ZP5A 2HOAA 1D3YA 2JA2A 2Z16A 1WH7A 3VFZA 5J8CA 2E1CA 4XMYA 1B8IB 3HOZJ 3GTGJ 1BJZA 3EUHC 1YO5C 2HDCA 3MZHA 1JKRC 2LLKA 2EV6A 2FOWA 1TQIA 2IA1A 4Y13A 1QPIA 3A1YA 1LKXA 1SD4A 3LWFA 3PM1A 2R7WA 3G1LA 2W82A 1MBFA 2LR8A 1IXCA 3H0DA 1WHUA 2VQHA 3DFGA 3JRBA 2X85A 1R4NB 1XTAA 2HVSA 2PEXA 4U87A 5F27A 2X0LA 3PNTA 2HXOA 4KYWA 2MW8A 3WTWC 2ID3A 5BQTA 2K9LA 2QM3A 3DBHB 3H92A 1QO0D 4A12A 1HA8A 1NHAA 2VIXA 2JQ7A 2RVCA 3PIPF 3G73A 3DPTA 3HPGA 2VI6A 5ICFA 2K7LA 2HDDA 2UXNA 2Z2SB 3G2BA 3PSFA 1VQKI 1FOWA 2HTJA 4PSXA 4HF0A 2K9SA 4II2A 1PJRA 2QQAA 2X51A 4CCOA 1OISA 2FNAA 4Y7NJ 3IC7A 3QOPA 3ZGKA 1YW7A 3HB9A 4P96A 3KZYA 5E3LA 3SYTA 2R5ZB 2L5QA 4DIQA 4AIJA 2FF4A 4MQVA 3BROA 1R5GA 1X2NA 3HOUJ 2L02A 1SVOA 3GBGA 1ETWA 3EETA 3LSKA 2UXXA 3R61A 3VB2A 2QQBA 3COAC 3FM3A 1L3LA 2X1DA 3TGNA 5LGUA 1R00A 3ECHA 3WGIA 3LL7A 1R7JA 1AWCA 3B6AA 2D1VA 3CD6I 3K2AA 3NARA 1ZGWA 4BXUA 2WWYA 4M73A 4Q5SF 3KETA 4BH9A 4LG3A 4HOBA 3K4JA 2N8GA 3PNVA 4PFOA 1ITYA 3K69A 3FISA 3K4NA 4WXDA 3FKJA 2ISZA 4M9XA 4WF2A 1QBJA 2DPUA 2E71A 3CJRB 5E20A 2MD5A 1UHSA 4AIDA 1UHMA 3TKYA 4ASNA 3CMEI 2FUG2 4RMNA 3CCSI 1TBXA 3SFIA 1T08B 1SANA 1WQ2A 3MKZA 1AKHA 1PUEE 4B1RA 3DCFA 1ETXA 5KCMA 2EK5A 2VJ4A 2JJ7A 1AU7A 1HSJA 2DA3A 3IUOA 2QKMB 4ZDOA 5CVVA 5D5VB 5HS9A 3HPHA 3GWZA 2DFEA 3P9CA 4U0WA 2EJRA 4NDLA 2E1MC 2H94A 3HTUA 2EH3A 3OWTA 2MLGA 1VZ0A 3OL3A 1TW2A 2HYGD 4MO7A 3VYUB 1YX5A 2ME6A 1J2XA 1VQ4I 3SEZA 4HX4A 5HVQC 2BY3A 4UB6C 4M3GA 5KAFC 5JHUA 2Y0MA 2HVQA 1G6NA 3ECOA 1K6OA 2IS6A 2AXTC 4EJOA 3FWEA 1Z6RA 3OS0A 3CCRI 3DWLE 2Q8KA 2D45A 2VL8A 3K4CA 2EV5A 3OYBA 3L2UA 2KPMA 2JSPA 1LB2A 5E3OA 1X4OA 2R7DA 4XICA 2B63J 4HLYA 1Q1HA 5ILVA 3KCCA 3M7GA 2LP0A 4KA4A 1ODDA 4PJLA 3S3MA 2HOTA 4D1QA 2BW3B 3F72A 2DLLA 1TZLA 2FBIA 4PJNA 2FE3A 3BTCA 1W5TA 2VPRA 3E6BA 1QA6A 1OJLA 2L7ZA 2XGEA 2XAFA 3U9GA 5LBQA 3OYMA 4A2UA 2L01A 2W1OA 5EF6A 2CSOA 3H9QA 2FEZA 2EA4A 2M34A 1RNLA 5CJ9A 4S04A
chains in the Genus database with same CATH topology
3KP4A 1XGNA 1DPUA 1D5VA 3BPXA 2COMA 1FZPB 2EFNA 3TDZC 3DV8A 2FQ3A 3RKYA 1P2FA 1K79A 2C6YA 4OIOF 4XLPF 3Q9VA 3D5LA 3WTVC 3F6OA 1BJAA 2A07F 1ZYRF 1ZG5A 4AIHA 3DP7A 1U6GA 4G94A 2HGCA 2W57A 3U2RA 1J0RA 3FMSA 1Z7UA 3F3XA 1IXRC 1GXPA 1KU2A 3J81K 1IZ1A 2UWMA 1G4DA 1ZHFA 2KRFA 3I5UA 2CW0F 4I7HA 2M87A 1ON1A 1S8NA 2OQRA 3MEXA 1X3UA 4CYDA 2PJPA 1W4MA 4EJTA 4EGYA 3RJPA 4HZFA 4MHGA 1IN6A 3TQNA 5HLHA 2Q0OA 1JGSA 3HYIA 4GGGA 2Y75A 5DV5A 4CXFA 2VBZA 2PQ8A 4P5OA 3GX4X 5L3DA 1K78A 4WK8F 4RGUA 3T0YA 3SQNA 1PDNC 4EQQA 2CYYA 2ZO4A 1KGSA 1SMTA 2XAGA 3F8NA 3TO7A 5DUKA 1S7OA 2HS5A 2QVOA 2DO7A 2LNBA 3BJAA 4TV7A 2EB7A 3B73A 4PCQA 3ELKA 2CO5A 2FXAA 1KU7A 1LEBA 1MDMB 1T38A 5HLIA 3F23A 2GQQA 1FOKA 2W25A 3DXJF 1R1UA 2W24A 1ULYA 2ZFWA 4PDKA 5L3FA 2FMLA 1F4KA 2E7XA 1LDDA 3E5XA 1DP7P 2JPCA 2LSOA 1KU3A 3LFKA 3IRRA 1YLFA 5JI6A 4LGWA 2ZCWA 1B4AA 1V3FA 3LQQA 2M30A 3KP3A 2BBYA 5DCMA 2DPDA 2FA5A 4BYYA 2MBFA 3K1NA 3WU0A 5LGNA 4XSZF 2R3SA 1F1ZA 1FWZA 3HSRA 1TNTA 2JSCA 4U7BA 3JAMK 1HBXG 1U5TA 2XVCA 1FY7A 4IF4A 2JPBA 2V1XA 2OD5A 4I0BA 1RZ4A 2IPQX 2ZMEB 2Z5UA 1XGOA 4NHJA 2D2WA 2WV0A 3CUQA 5FFXA 3RYRA 2ISYA 3HUGA 4MEXF 4UVCA 4XSXF 1YQAA 4M71A 4KNYA 2Y48A 4HA8A 4MTDA 1LQ1A 3F22A 4HF2A 4L9TA 3TO6A 1F9NA 3GZ6A 2OU2A 2VC0A 2P7VB 3J81Z 2FMYA 3J80Z 3B02A 3HRTA 1YTYA 4IXAA 3D0SA 3BJOA 1Z9CA 3WTTC 3GYHX 3WE3A 3K1MA 1LNWA 4MQ9F 2DQLA 1ZRCA 1ZG3A 1T2KA 3V7SA 2A6EF 4YG2F 4HAMA 2R7FA 2H27A 3GEZA 2IVMA 4PZJA 4CICA 1Z6TA 3BP8A 5L3CA 1AOYA 2Z3YA 1G3TA 2NYXA 3KEQA 3N4MA 2GAUA 3AAFA 2VOPA 1PP7U 3E5QA 2XIGA 1IN8A 3WG9A 1GXQA 4IHTA 5ERIA 3N97A 4KIGA 4L0YB 5D8KB 2ETHA 4MEYF 3KP5A 1R22A 1ZG1A 3O2PE 5E8GA 1KU9A 1KQ0A 3KFWX 2VT3A 4ZH4F 5D6FA 2KJBA 4RGRA 2K02A 2XKPA 2XUBA 1DUXC 3M8EA 3L7WA 1FYMA 1DDNA 3I0TA 1T98A 1FYLA 2M45A 3HHGA 2VOOA 2EFQA 3I59B 2RC4A 4AIKA 2P5LC 2XAQA 3ML6A 1YIOA 2LF7A 2CG4A 1IN5A 3JW4A 4RB1A 1ZARA 4HDVA 4LLNA 5ILSA 2HQNA 1ZH5A 3M9AA 1LEAA 3ISPA 1UB9A 3E6DA 4E70A 4YFNF 4GO1A 5HS8A 3VOEA 2J5PA 2V79A 4ETSA 2YX7A 2LKPA 2V1DA 1QPMA 1R58A 4L9VA 3WODF 3HTSB 1MJBA 1WKMA 5IT9Z 5HOOA 1I1GA 4M6XA 2K4JA 1WRJA 2NNNA 2GA2A 3V4GA 4P55A 2KIUA 1STZA 4Q4ZF 3IRQA 2ZJ2A 5D5UB 3L09A 4R8HA 1XD7A 3C18A 2QENA 1FPQA 4HW0A 1K7AA 4LLLA 2JZYA 2PBIA 2IP2A 2LDUA 3KP7A 3KEOA 2V6CA 1OYWA 4G7OF 2PMHA 4GCVA 2DAOA 1FP2A 1I6XA 2RQPA 4I02A 3T8TA 1TLHB 4HDUA 3QU6A 1BI1A 4QLCU 2Q2EA 1T39A 4HV6A 3F8BA 1HXDA 3FMRA 1MD0A 3MFKA 1RI7A 1P4XA 5BMZA 4AD9A 4M9ZA 2E1NA 1J9IA 4RAZA 3HRSA 4KIBA 4LB6B 1BBYA 2O0YA 1KYWA 1XDSA 3RIRA 3EYIA 1ZGJA 2RGVA 2RV8A 3ZQ7A 2ZNYA 3WE2A 1HW1A 4KT5C 4UHTA 3BWGA 2QBYA 3IKVA 1ZN2A 1I5ZA 1IUYA 1T0FA 3C7JA 2MLKA 3V8KA 2ZKZA 4ZZLA 5K5QA 3BJ6A 3TDUC 2IJLA 3T5XA 1HQCA 1BIAA 3F21A 4L9NA 3C3WA 5LLQA 1U2WA 3I54A 3FXUA 4LG0B 4A5NA 2F5FA 1O3SA 3I4PA 2EA2A 3LA7A 3K2ZA 1FX7A 2HYFA 2FBKA 3SZTA 4M9SA 1FSHA 3HIFA 2YX4A 4HX8A 4KMUX 2P5KA 2RNJA 4YFKF 4CHUA 1WWXA 2A61A 2EFPA 2J5OA 1BC7C 4EJWA 1ZRDA 1D8KA 4KIFA 3TOBA 2B0LA 2XKOA 2RDPA 1ONVA 4LMYA 4BHCA 4UUVA 3JTGA 1SFUA 1RIOH 1LVAA 4N9IA 2HTSA 1J7KA 1T6SA 3MQ0A 3KLNA 1JXSA 2PN6A 4MNUA 3WTUC 3HRUA 4L0ZB 1OYYA 1U5TC 1XGSA 5KK1A 3NRVA 4BHPA 3LA2A 4I2OA 4HF1A 1EV7A 4IRIA 2DK8A 5DYMA 1H9TA 4F7ZA 3FF5A 5ICEA 1R1VA 3IWZA 5F1RA 3CUQC 2XAHA 5H6RA 3GW2A 2O61A 1W7PD 2JT1A 3I64A 3ABUA 3ZN1A 4PGGA 5LHHA 1SD7A 2NRAC 3ZMSA 1I1SA 5FLXK 1H9GA 3LAPA 4G8XA 2O6GE 2QZ8A 4BQAA 1SMYF 2EWNA 1O3RA 2OAZA 1YYVA 4FT8A 3J80K 5E1XA 4XLNF 1LDJA 3WTXC 3L2CA 4CO8A 2RKHA 5DEQA 3LQRA 5F64A 1BI3A 1W7PA 4UXNA 3CO7C 2K27A 4A0ZA 1REPC 4GYGA 2ZBKA 1QZZA 4ZZDA 4M74A 3BOQA 1CF7A 5CVJA 1HKSA 3MAJA 5LHIA 3F8CA 3K1PA 2GA1A 5CVUA 2HFHA 2ADUA 4DNCA 3J7AO 1J5YA 1QNTA 1TNSA 3DPLC 1XSXA 4UV9A 1D8JA 2YPRA 3PQKA 5LRSA 2XAJA 3GFLA 2XROA 3VEPA 3OOPA 1UCRA 2ZNZA 3KLOA 4EM2A 1KQ9A 2IT0A 3GZ5A 1YS7A 4ON0A 5D8LB 5D5WB 2V9VA 1SAXA 4LJZF 3E6MA 2HZTA 3P7NA 3JTHA 4Z2YA 3K9TA 3I59A 3I71A 3L00A 4MTEA 4FX0A 1JE8A 4UV8A 2G9WA 2QLZA 4M6YA 2KKOA 5FD5A 2CGPA 3FZVA 2YSRA 2DBBA 3TOAA 1ZAOA 5H6QA 3K0LA 3OV8A 3DEUA 2KIMA 2DI3A 1USTA 4RGXA 1O3TA 3R0JA 3QRFF 4ZYDA 4XBFA 5F6FA 3ZMUA 4OMYA 4U0YA 1TQMA 4QWQA 4O3MA 3H3ZA 4EM0B 2QQ9A 5IT9K 5E18F 1BIBA 2K86A 1B6AA 1O7LA 1O3QA 1WI9A 3GXOA 2P6SA 3L9FA 1HKTA 4D0PA 5CVRA 1A04A 4ENKA 3QP5A 4XRFA 3SFZA 5AONA 2ESHA 3BDDA 5HS7A 3GFJA 3P9IA 2A69F 1QQIA 3WTZA 3KP6A 4I0AA 3Q9SA 3WGHA 4JBAA 3FXRA 2M5WA 3MWMA 5FLXZ 3V8LA 1ON2A 4WXCA 2L4AA 5LEKA 1SFEA 4LFUA 1OPCA 1SFXA 3QPHA 1IN4A 2P4WA 2YR2A 4HBLA 2DK5A 1VTNC 3CO6C 3SXYA 4EGZA 4HYEA 2A3SA 5JVTA 3QAHA 4OINF 3RDIA 5AIQA 3R0AA 3W6KB 5HDNA 3NEUA 2DT5A 3EDPA 4WXHA 4L18B 2VBYA 2MH9A 2XASA 1B59A 4IRHA 4CZZA 3ZMTA 1MJAA 3R6SA 3HHHA 3JSPA 4RAYA 4N0BA 1RUNA 3QPTA 5A2QK 1FLIA 2MH2A 3DF8A 2A6HF 1TQPA 3F8FA 2KIFA 5FD6A 1KA8A 1EH8A 4A0YA 3IL2A 4BAYA 3CDHA 3I53A 5IT3A 4KICA 3GF2A 2ELHA 2OBPA 2VODA 1YW9A 3R60A 5BPDA 3REOA 4BHBA 1K78B 1FBSA 3RPUA 1FBQA 4YIFA 1Z91A 2PFBA 2P7CB 2BV6A 3QP6A 1BM9A 3PQJA 3ZN0A 5EEHA 1ZGAA 4EJUA 4O5VA 1PP8F 3VODA 2QYOA 4Q48A 2IW5A 2WTEA 1IXSB 3LA3A 2DFIA 1YG2A 3RI4A 4S05A 3E6CC 2CQKA 2G7UA 4FX4A 1V4RA 4IPAA 3WTYC 3CLOA 5ICCA 5HDGA 1BN5A 3SZPA 4PGHA 2GIVA 4R79A 1BC8C 4HV5A 3ULQB 2HWVA 3GO5A 5EEGA 4UVBA 4OIPF 5K1YA 4HLXA 1DPRA 4WX9A 2STWA 4EVIA 2FBHA 5TRDA 5ILUA 2LF8A 2OA4A 4ESFA 4P9UA 4ZYGA 4G6QA 3EQLF 3R4KA 2FU4A 3S2WA 1MJ9A 3GFMA 1U5TB 3IHUA 5L3EA 4KFCA 3V7CA 4ZYEA 4OMZA 1Z05A 1U8RA 3CJNA 4B8XA 4EJVA 5L3GA 3CUQB 2F5CA 2D1HA 3PFIA 4RB0A 1XCBA 1OYIA 4KN4X 3LAJA 1BI0A 1Y0UA 2HEOA 2VE8A 2GXBA 5K5OA 3WTSC 2A5YB 4JQFA 1YW8A 5DD8A 1XMKA 5DDGA 1TTYA 2XGXA 3IKTA 1R23A 3FXQA 4IHSA 1FBUA 1Z1DA 3TO9A 5BPIA 3G3ZA 5D4RA 2FSWA 5E17F 2NS0A 2VN2A 1I27A 3FMQA 4ENMA 2HQRA 1B9MA 1S3JA 3MZYA 4A6DA 2DW4A 5A2QZ 1XDUA 4KMFA 1OKRA 4GXOA 1S7AA 4M72A 2BYVE 1IAWA 1XSDA 5HLGA 2L3DA 3U1DA 3F6VA 4GYIA 2VONA 1MDMA 4CDGA 3GFIA 2BEOA 2OZ6A 4LLGF 4EMSA 4AVPA 1MZBA 3CUOA 4G6DA 2BE5F 3EYYA 3T1BA 2AS5F 5FB2A 2IRFG 2WC2A 3HRMA 2EV0A 5CVIA 3ZMDA 2O8XA 3MCZA 3RYPA 1B9NA 5K5RA 4LD5A 4OU0A 2F5DA 5CJ9A 4BNCA 1ZRFA 2AXLA 1H0MA 2ZMEA 2Z99A 4ENJA 3KP2A 1QGPA 1FYKA 2O3FA 4ZYHA 1LJ9A 5CLSA 1MKMA 5H20A 2H6CA 5HDKA 3NQOA 2P6TA 4K2EA 3T8RA 2HR3A 1O7FA 1XB4A 4I01A 5BS6A 1GHCA 4G9YA 1HW2A 4OIQF 2QUFA 3DKWA 1S29A 4NQWA 1P6RA 2JRTA 2O03A 2VBXA 4G7ZF 4U0VA 2FNPA 4U88A 4DQ2A 3BPVA 2OZUA 4UNOA 3ABTA 5BOXA 1B1BA 3EUHA 1S6LA 2VBWA 2Z33A 5CYVA 1G3SA 2CFXA 1P92A 2DU9A 5ICGA 4I98B 1BOAA 2DQRA 5LHGA 2ESNA 2HOEA 4H0EA 5E1WA 1ZLKA 2W85A 4L9JA 5FO5A 2IA2A 5DUIA 4YFXF 4A6EA 3F8MA 1U78A 3ROUA 2CWEA 2OQGA 4A0XA 2PI0A 1UFMA 3FM5A 3GUDA 5DD4A 3BZ6A 2ACJA 3WGGA 1YFHA 4LK0F 1YS6A 3C1DA 5D6EA 2TDXA 2Z9OA 1P4AA 1IN7A 5L3BA 4IVNA 3CTAA 4NB5A 1R36A 3Q5FA 2QBYB 2GWRA 4Y17A 4CGZA 1XMAA 5J6XA 4KDPA 5J8FA 3ZMZA 1RUOA 1MGTA 4OIRF 1F5TA 3E5UA 1TW3A 2H6BA 1EH7A 1G3WA 4LK1F 1SD6A 1R5HA 2NAZA 1UHWA 2HKXA 1J59A 5D4SA 5E8IA 2F5EA 2HKOA 2L54A 2MC3A 5ED4A 2IA0A 4P9FA 4U7DA 3GLXA 6PAXA 2GXGA 2PMUA 1C0WA 4O6JA 1FC3A 2VC1A 3KE2A 2JTVA 3IWFA 2H09A 2XV4S 2E7WA 1G3YA 5JR3A 1JHFA 2A68F 4ENNA 4RB3C 4HX7A 5DCFA 1ZREA 4KUMA 3ERED 2VXZA 4RGSA 2UZKA 3O3KA 2K4BA 3RPQA 1J75A 2FOKA 2GZWA 4L5JA 5FGMA 1HSTA 1HKQA 1IW7F 5LRRA 1CGPA 2RN7A 1FP1D 1IRGA 2MA3A 1JHHA 3HOTA 2M1BA 1OR7A 3SHFA 3V7RA 2EFWA 3WU1B 1USSA 5JFRA 1R1TA 4AWXB 2PG4A 1ZLJA 1XN7A 4B09A 3BY6A 4WWCA 4FHTA 4A5MA 4YIIA 5AIPA 4G7HF 3LSTA 3QU3A 5E1ZB 4ESJA 2QWWA 1WSUA 2PLYA 4N9HA 3P9KA 2VT2A 2L4MA 4HQMA 1O57A 1HW5A 4ESBA 3DQVC 2XRNA 4LG0A 1W7PB 4IJAA 4EM1A 2NNYA 5LGTA 4LB5A 1KYZA 5KVRA 4Y15A 4HQEA 1CF7B 3M8FA 3E3VA 4EV0A 1XCVA 3FHZA 4RB2C 4R1HA 1BI2A 1IF1A 4MGRA 3RKXA 2BGCA 1OMIA 4IRGA 2DTRA 4JK1X 3V8JA 2YU3A 3GVAA 2EFOA 1W5SA 2FRHA 2STTA 1L0OC 1P4WA 3RTRA 5TJJA 2VE9A 3I58A 2G7HA 1XSVA 3M1EA 1U3EM 1SD5A 2ZXJA 3O6BB 3ZPLA 1FT9A 4Q47A 1E2XA 1QZYA 2KJCA 3H3UA 4I09A 2P8TA 2V1UA 2W84A 3ZMVA 2M8EA 1GVJA 1XGMA 1E17A 1FNNA 4L5IA 5LEJA 3W6JB 2F2EA 4KN7X 4OOIA 1IRFA 3JSOA 5FFZA 4RS8A 2XHKA 1LDKB 5DCMB 4UVAA 1EH6A 2X4HA 1FSEA 3HSEA 3FX3A 3HSFA 3HOSA 3E97A 3RKWA 3KZZA 3JAMZ 4WCGA 1KQ8A 2P5VA 3ZP5A 1D3YA 3VFZA 5J8CA 2E1CA 1YO5C 2HDCA 3MZHA 2EV6A 2IA1A 1TQIA 4Y13A 1SD4A 3LWFA 1IXCA 3DFGA 2PEXA 2X0LA 4KYWA 3WTWC 5BQTA 2QM3A 3H92A 1QO0D 4A12A 1NHAA 2RVCA 3G73A 3DPTA 5ICFA 2K7LA 2UXNA 2HTJA 4HF0A 2QQAA 2FNAA 3IC7A 3QOPA 1YW7A 4P96A 3KZYA 4AIJA 2FF4A 4MQVA 3BROA 1R5GA 2L02A 3EETA 2UXXA 3R61A 3VB2A 2QQBA 3COAC 3FM3A 1L3LA 3TGNA 5LGUA 1R00A 3ECHA 3WGIA 1R7JA 1AWCA 2D1VA 4BXUA 2WWYA 4M73A 4Q5SF 3KETA 4BH9A 4HOBA 3K69A 4WXDA 2ISZA 4M9XA 4WF2A 1QBJA 2DPUA 5E20A 2MD5A 1UHMA 3TKYA 4ASNA 1TBXA 1WQ2A 1PUEE 2EK5A 1HSJA 5CVVA 5D5VB 5HS9A 3GWZA 3P9CA 4U0WA 2EJRA 2H94A 3HTUA 2MLGA 1TW2A 2HYGD 1J2XA 4HX4A 5HVQC 5JHUA 2Y0MA 1G6NA 3ECOA 1K6OA 4EJOA 3FWEA 1Z6RA 2Q8KA 2D45A 2EV5A 1LB2A 2R7DA 4HLYA 1Q1HA 5ILVA 3KCCA 3M7GA 4KA4A 1ODDA 3F72A 2DLLA 2FBIA 2FE3A 1W5TA 3E6BA 2XAFA 3U9GA 5LBQA 4A2UA 2L01A 2CSOA 2FEZA 2EA4A 1RNLA 5D5XB 4S04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP4 A;  1XGN A;  1DPU A;  1D5V A;  3BPX A;  2COM A;  1FZP B;  2EFN A;  3TDZ C;  3DV8 A;  2FQ3 A;  3RKY A;  1P2F A;  1K79 A;  2C6Y A;  4OIO F;  4XLP F;  3Q9V A;  3D5L A;  3WTV C;  3F6O A;  1BJA A;  2A07 F;  1ZYR F;  1ZG5 A;  4AIH A;  3DP7 A;  1U6G A;  4G94 A;  2HGC A;  2W57 A;  3U2R A;  1J0R A;  3FMS A;  1Z7U A;  3F3X A;  1IXR C;  1GXP A;  1KU2 A;  3J81 K;  1IZ1 A;  2UWM A;  1G4D A;  1ZHF A;  2KRF A;  3I5U A;  2CW0 F;  4I7H A;  2M87 A;  1ON1 A;  1S8N A;  2OQR A;  3MEX A;  1X3U A;  4CYD A;  2PJP A;  1W4M A;  4EJT A;  4EGY A;  3RJP A;  4HZF A;  4MHG A;  1IN6 A;  3TQN A;  5HLH A;  2Q0O A;  1JGS A;  3HYI A;  4GGG A;  2Y75 A;  5DV5 A;  4CXF A;  2VBZ A;  2PQ8 A;  4P5O A;  3GX4 X;  5L3D A;  1K78 A;  4WK8 F;  4RGU A;  3T0Y A;  3SQN A;  1PDN C;  4EQQ A;  2CYY A;  2ZO4 A;  1KGS A;  1SMT A;  2XAG A;  3F8N A;  3TO7 A;  5DUK A;  1S7O A;  2HS5 A;  2QVO A;  2DO7 A;  2LNB A;  3BJA A;  4TV7 A;  2EB7 A;  3B73 A;  4PCQ A;  3ELK A;  2CO5 A;  2FXA A;  1KU7 A;  1LEB A;  1MDM B;  1T38 A;  5HLI A;  3F23 A;  2GQQ A;  1FOK A;  2W25 A;  3DXJ F;  1R1U A;  2W24 A;  1ULY A;  2ZFW A;  4PDK A;  5L3F A;  2FML A;  1F4K A;  2E7X A;  1LDD A;  3E5X A;  1DP7 P;  2JPC A;  2LSO A;  1KU3 A;  3LFK A;  3IRR A;  1YLF A;  5JI6 A;  4LGW A;  2ZCW A;  1B4A A;  1V3F A;  3LQQ A;  2M30 A;  3KP3 A;  2BBY A;  5DCM A;  2DPD A;  2FA5 A;  4BYY A;  2MBF A;  3K1N A;  3WU0 A;  5LGN A;  4XSZ F;  2R3S A;  1F1Z A;  1FWZ A;  3HSR A;  1TNT A;  2JSC A;  4U7B A;  3JAM K;  1HBX G;  1U5T A;  2XVC A;  1FY7 A;  4IF4 A;  2JPB A;  2V1X A;  2OD5 A;  4I0B A;  1RZ4 A;  2IPQ X;  2ZME B;  2Z5U A;  1XGO A;  4NHJ A;  2D2W A;  2WV0 A;  3CUQ A;  5FFX A;  3RYR A;  2ISY A;  3HUG A;  4MEX F;  4UVC A;  4XSX F;  1YQA A;  4M71 A;  4KNY A;  2Y48 A;  4HA8 A;  4MTD A;  1LQ1 A;  3F22 A;  4HF2 A;  4L9T A;  3TO6 A;  1F9N A;  3GZ6 A;  2OU2 A;  2VC0 A;  2P7V B;  3J81 Z;  2FMY A;  3J80 Z;  3B02 A;  3HRT A;  1YTY A;  4IXA A;  3D0S A;  3BJO A;  1Z9C A;  3WTT C;  3GYH X;  3WE3 A;  3K1M A;  1LNW A;  4MQ9 F;  2DQL A;  1ZRC A;  1ZG3 A;  1T2K A;  3V7S A;  2A6E F;  4YG2 F;  4HAM A;  2R7F A;  2H27 A;  3GEZ A;  2IVM A;  4PZJ A;  4CIC A;  1Z6T A;  3BP8 A;  5L3C A;  1AOY A;  2Z3Y A;  1G3T A;  2NYX A;  3KEQ A;  3N4M A;  2GAU A;  3AAF A;  2VOP A;  1PP7 U;  3E5Q A;  2XIG A;  1IN8 A;  3WG9 A;  1GXQ A;  4IHT A;  5ERI A;  3N97 A;  4KIG A;  4L0Y B;  5D8K B;  2ETH A;  4MEY F;  3KP5 A;  1R22 A;  1ZG1 A;  3O2P E;  5E8G A;  1KU9 A;  1KQ0 A;  3KFW X;  2VT3 A;  4ZH4 F;  5D6F A;  2KJB A;  4RGR A;  2K02 A;  2XKP A;  2XUB A;  1DUX C;  3M8E A;  3L7W A;  1FYM A;  1DDN A;  3I0T A;  1T98 A;  1FYL A;  2M45 A;  3HHG A;  2VOO A;  2EFQ A;  3I59 B;  2RC4 A;  4AIK A;  2P5L C;  2XAQ A;  3ML6 A;  1YIO A;  2LF7 A;  2CG4 A;  1IN5 A;  3JW4 A;  4RB1 A;  1ZAR A;  4HDV A;  4LLN A;  5ILS A;  2HQN A;  1ZH5 A;  3M9A A;  1LEA A;  3ISP A;  1UB9 A;  3E6D A;  4E70 A;  4YFN F;  4GO1 A;  5HS8 A;  3VOE A;  2J5P A;  2V79 A;  4ETS A;  2YX7 A;  2LKP A;  2V1D A;  1QPM A;  1R58 A;  4L9V A;  3WOD F;  3HTS B;  1MJB A;  1WKM A;  5IT9 Z;  5HOO A;  1I1G A;  4M6X A;  2K4J A;  1WRJ A;  2NNN A;  2GA2 A;  3V4G A;  4P55 A;  2KIU A;  1STZ A;  4Q4Z F;  3IRQ A;  2ZJ2 A;  5D5U B;  3L09 A;  4R8H A;  1XD7 A;  3C18 A;  2QEN A;  1FPQ A;  4HW0 A;  1K7A A;  4LLL A;  2JZY A;  2PBI A;  2IP2 A;  2LDU A;  3KP7 A;  3KEO A;  2V6C A;  1OYW A;  4G7O F;  2PMH A;  4GCV A;  2DAO A;  1FP2 A;  1I6X A;  2RQP A;  4I02 A;  3T8T A;  1TLH B;  4HDU A;  3QU6 A;  1BI1 A;  4QLC U;  2Q2E A;  1T39 A;  4HV6 A;  3F8B A;  1HXD A;  3FMR A;  1MD0 A;  3MFK A;  1RI7 A;  1P4X A;  5BMZ A;  4AD9 A;  4M9Z A;  2E1N A;  1J9I A;  4RAZ A;  3HRS A;  4KIB A;  4LB6 B;  1BBY A;  2O0Y A;  1KYW A;  1XDS A;  3RIR A;  3EYI A;  1ZGJ A;  2RGV A;  2RV8 A;  3ZQ7 A;  2ZNY A;  3WE2 A;  1HW1 A;  4KT5 C;  4UHT A;  3BWG A;  2QBY A;  3IKV A;  1ZN2 A;  1I5Z A;  1IUY A;  1T0F A;  3C7J A;  2MLK A;  3V8K A;  2ZKZ A;  4ZZL A;  5K5Q A;  3BJ6 A;  3TDU C;  2IJL A;  3T5X A;  1HQC A;  1BIA A;  3F21 A;  4L9N A;  3C3W A;  5LLQ A;  1U2W A;  3I54 A;  3FXU A;  4LG0 B;  4A5N A;  2F5F A;  1O3S A;  3I4P A;  2EA2 A;  3LA7 A;  3K2Z A;  1FX7 A;  2HYF A;  2FBK A;  3SZT A;  4M9S A;  1FSH A;  3HIF A;  2YX4 A;  4HX8 A;  4KMU X;  2P5K A;  2RNJ A;  4YFK F;  4CHU A;  1WWX A;  2A61 A;  2EFP A;  2J5O A;  1BC7 C;  4EJW A;  1ZRD A;  1D8K A;  4KIF A;  3TOB A;  2B0L A;  2XKO A;  2RDP A;  1ONV A;  4LMY A;  4BHC A;  4UUV A;  3JTG A;  1SFU A;  1RIO H;  1LVA A;  4N9I A;  2HTS A;  1J7K A;  1T6S A;  3MQ0 A;  3KLN A;  1JXS A;  2PN6 A;  4MNU A;  3WTU C;  3HRU A;  4L0Z B;  1OYY A;  1U5T C;  1XGS A;  5KK1 A;  3NRV A;  4BHP A;  3LA2 A;  4I2O A;  4HF1 A;  1EV7 A;  4IRI A;  2DK8 A;  5DYM A;  1H9T A;  4F7Z A;  3FF5 A;  5ICE A;  1R1V A;  3IWZ A;  5F1R A;  3CUQ C;  2XAH A;  5H6R A;  3GW2 A;  2O61 A;  1W7P D;  2JT1 A;  3I64 A;  3ABU A;  3ZN1 A;  4PGG A;  5LHH A;  1SD7 A;  2NRA C;  3ZMS A;  1I1S A;  5FLX K;  1H9G A;  3LAP A;  4G8X A;  2O6G E;  2QZ8 A;  4BQA A;  1SMY F;  2EWN A;  1O3R A;  2OAZ A;  1YYV A;  4FT8 A;  3J80 K;  5E1X A;  4XLN F;  1LDJ A;  3WTX C;  3L2C A;  4CO8 A;  2RKH A;  5DEQ A;  3LQR A;  5F64 A;  1BI3 A;  1W7P A;  4UXN A;  3CO7 C;  2K27 A;  4A0Z A;  1REP C;  4GYG A;  2ZBK A;  1QZZ A;  4ZZD A;  4M74 A;  3BOQ A;  1CF7 A;  5CVJ A;  1HKS A;  3MAJ A;  5LHI A;  3F8C A;  3K1P A;  2GA1 A;  5CVU A;  2HFH A;  2ADU A;  4DNC A;  3J7A O;  1J5Y A;  1QNT A;  1TNS A;  3DPL C;  1XSX A;  4UV9 A;  1D8J A;  2YPR A;  3PQK A;  5LRS A;  2XAJ A;  3GFL A;  2XRO A;  3VEP A;  3OOP A;  1UCR A;  2ZNZ A;  3KLO A;  4EM2 A;  1KQ9 A;  2IT0 A;  3GZ5 A;  1YS7 A;  4ON0 A;  5D8L B;  5D5W B;  2V9V A;  1SAX A;  4LJZ F;  3E6M A;  2HZT A;  3P7N A;  3JTH A;  4Z2Y A;  3K9T A;  3I59 A;  3I71 A;  3L00 A;  4MTE A;  4FX0 A;  1JE8 A;  4UV8 A;  2G9W A;  2QLZ A;  4M6Y A;  2KKO A;  5FD5 A;  2CGP A;  3FZV A;  2YSR A;  2DBB A;  3TOA A;  1ZAO A;  5H6Q A;  3K0L A;  3OV8 A;  3DEU A;  2KIM A;  2DI3 A;  1UST A;  4RGX A;  1O3T A;  3R0J A;  3QRF F;  4ZYD A;  4XBF A;  5F6F A;  3ZMU A;  4OMY A;  4U0Y A;  1TQM A;  4QWQ A;  4O3M A;  3H3Z A;  4EM0 B;  2QQ9 A;  5IT9 K;  5E18 F;  1BIB A;  2K86 A;  1B6A A;  1O7L A;  1O3Q A;  1WI9 A;  3GXO A;  2P6S A;  3L9F A;  1HKT A;  4D0P A;  5CVR A;  1A04 A;  4ENK A;  3QP5 A;  4XRF A;  3SFZ A;  5AON A;  2ESH A;  3BDD A;  5HS7 A;  3GFJ A;  3P9I A;  2A69 F;  1QQI A;  3WTZ A;  3KP6 A;  4I0A A;  3Q9S A;  3WGH A;  4JBA A;  3FXR A;  2M5W A;  3MWM A;  5FLX Z;  3V8L A;  1ON2 A;  4WXC A;  2L4A A;  5LEK A;  1SFE A;  4LFU A;  1OPC A;  1SFX A;  3QPH A;  1IN4 A;  2P4W A;  2YR2 A;  4HBL A;  2DK5 A;  1VTN C;  3CO6 C;  3SXY A;  4EGZ A;  4HYE A;  2A3S A;  5JVT A;  3QAH A;  4OIN F;  3RDI A;  5AIQ A;  3R0A A;  3W6K B;  5HDN A;  3NEU A;  2DT5 A;  3EDP A;  4WXH A;  4L18 B;  2VBY A;  2MH9 A;  2XAS A;  1B59 A;  4IRH A;  4CZZ A;  3ZMT A;  1MJA A;  3R6S A;  3HHH A;  3JSP A;  4RAY A;  4N0B A;  1RUN A;  3QPT A;  5A2Q K;  1FLI A;  2MH2 A;  3DF8 A;  2A6H F;  1TQP A;  3F8F A;  2KIF A;  5FD6 A;  1KA8 A;  1EH8 A;  4A0Y A;  3IL2 A;  4BAY A;  3CDH A;  3I53 A;  5IT3 A;  4KIC A;  3GF2 A;  2ELH A;  2OBP A;  2VOD A;  1YW9 A;  3R60 A;  5BPD A;  3REO A;  4BHB A;  1K78 B;  1FBS A;  3RPU A;  1FBQ A;  4YIF A;  1Z91 A;  2PFB A;  2P7C B;  2BV6 A;  3QP6 A;  1BM9 A;  3PQJ A;  3ZN0 A;  5EEH A;  1ZGA A;  4EJU A;  4O5V A;  1PP8 F;  3VOD A;  2QYO A;  4Q48 A;  2IW5 A;  2WTE A;  1IXS B;  3LA3 A;  2DFI A;  1YG2 A;  3RI4 A;  4S05 A;  3E6C C;  2CQK A;  2G7U A;  4FX4 A;  1V4R A;  4IPA A;  3WTY C;  3CLO A;  5ICC A;  5HDG A;  1BN5 A;  3SZP A;  4PGH A;  2GIV A;  4R79 A;  1BC8 C;  4HV5 A;  3ULQ B;  2HWV A;  3GO5 A;  5EEG A;  4UVB A;  4OIP F;  5K1Y A;  4HLX A;  1DPR A;  4WX9 A;  2STW A;  4EVI A;  2FBH A;  5TRD A;  5ILU A;  2LF8 A;  2OA4 A;  4ESF A;  4P9U A;  4ZYG A;  4G6Q A;  3EQL F;  3R4K A;  2FU4 A;  3S2W A;  1MJ9 A;  3GFM A;  1U5T B;  3IHU A;  5L3E A;  4KFC A;  3V7C A;  4ZYE A;  4OMZ A;  1Z05 A;  1U8R A;  3CJN A;  4B8X A;  4EJV A;  5L3G A;  3CUQ B;  2F5C A;  2D1H A;  3PFI A;  4RB0 A;  1XCB A;  1OYI A;  4KN4 X;  3LAJ A;  1BI0 A;  1Y0U A;  2HEO A;  2VE8 A;  2GXB A;  5K5O A;  3WTS C;  2A5Y B;  4JQF A;  1YW8 A;  5DD8 A;  1XMK A;  5DDG A;  1TTY A;  2XGX A;  3IKT A;  1R23 A;  3FXQ A;  4IHS A;  1FBU A;  1Z1D A;  3TO9 A;  5BPI A;  3G3Z A;  5D4R A;  2FSW A;  5E17 F;  2NS0 A;  2VN2 A;  1I27 A;  3FMQ A;  4ENM A;  2HQR A;  1B9M A;  1S3J A;  3MZY A;  4A6D A;  2DW4 A;  5A2Q Z;  1XDU A;  4KMF A;  1OKR A;  4GXO A;  1S7A A;  4M72 A;  2BYV E;  1IAW A;  1XSD A;  5HLG A;  2L3D A;  3U1D A;  3F6V A;  4GYI A;  2VON A;  1MDM A;  4CDG A;  3GFI A;  2BEO A;  2OZ6 A;  4LLG F;  4EMS A;  4AVP A;  1MZB A;  3CUO A;  4G6D A;  2BE5 F;  3EYY A;  3T1B A;  2AS5 F;  5FB2 A;  2IRF G;  2WC2 A;  3HRM A;  2EV0 A;  5CVI A;  3ZMD A;  2O8X A;  3MCZ A;  3RYP A;  1B9N A;  5K5R A;  4LD5 A;  4OU0 A;  2F5D A;  5CJ9 A;  4BNC A;  1ZRF A;  2AXL A;  1H0M A;  2ZME A;  2Z99 A;  4ENJ A;  3KP2 A;  1QGP A;  1FYK A;  2O3F A;  4ZYH A;  1LJ9 A;  5CLS A;  1MKM A;  5H20 A;  2H6C A;  5HDK A;  3NQO A;  2P6T A;  4K2E A;  3T8R A;  2HR3 A;  1O7F A;  1XB4 A;  4I01 A;  5BS6 A;  1GHC A;  4G9Y A;  1HW2 A;  4OIQ F;  2QUF A;  3DKW A;  1S29 A;  4NQW A;  1P6R A;  2JRT A;  2O03 A;  2VBX A;  4G7Z F;  4U0V A;  2FNP A;  4U88 A;  4DQ2 A;  3BPV A;  2OZU A;  4UNO A;  3ABT A;  5BOX A;  1B1B A;  3EUH A;  1S6L A;  2VBW A;  2Z33 A;  5CYV A;  1G3S A;  2CFX A;  1P92 A;  2DU9 A;  5ICG A;  4I98 B;  1BOA A;  2DQR A;  5LHG A;  2ESN A;  2HOE A;  4H0E A;  5E1W A;  1ZLK A;  2W85 A;  4L9J A;  5FO5 A;  2IA2 A;  5DUI A;  4YFX F;  4A6E A;  3F8M A;  1U78 A;  3ROU A;  2CWE A;  2OQG A;  4A0X A;  2PI0 A;  1UFM A;  3FM5 A;  3GUD A;  5DD4 A;  3BZ6 A;  2ACJ A;  3WGG A;  1YFH A;  4LK0 F;  1YS6 A;  3C1D A;  5D6E A;  2TDX A;  2Z9O A;  1P4A A;  1IN7 A;  5L3B A;  4IVN A;  3CTA A;  4NB5 A;  1R36 A;  3Q5F A;  2QBY B;  2GWR A;  4Y17 A;  4CGZ A;  1XMA A;  5J6X A;  4KDP A;  5J8F A;  3ZMZ A;  1RUO A;  1MGT A;  4OIR F;  1F5T A;  3E5U A;  1TW3 A;  2H6B A;  1EH7 A;  1G3W A;  4LK1 F;  1SD6 A;  1R5H A;  2NAZ A;  1UHW A;  2HKX A;  1J59 A;  5D4S A;  5E8I A;  2F5E A;  2HKO A;  2L54 A;  2MC3 A;  5ED4 A;  2IA0 A;  4P9F A;  4U7D A;  3GLX A;  6PAX A;  2GXG A;  2PMU A;  1C0W A;  4O6J A;  1FC3 A;  2VC1 A;  3KE2 A;  2JTV A;  3IWF A;  2H09 A;  2XV4 S;  2E7W A;  1G3Y A;  5JR3 A;  1JHF A;  2A68 F;  4ENN A;  4RB3 C;  4HX7 A;  5DCF A;  1ZRE A;  4KUM A;  3ERE D;  2VXZ A;  4RGS A;  2UZK A;  3O3K A;  2K4B A;  3RPQ A;  1J75 A;  2FOK A;  2GZW A;  4L5J A;  5FGM A;  1HST A;  1HKQ A;  1IW7 F;  5LRR A;  1CGP A;  2RN7 A;  1FP1 D;  1IRG A;  2MA3 A;  1JHH A;  3HOT A;  2M1B A;  1OR7 A;  3SHF A;  3V7R A;  2EFW A;  3WU1 B;  1USS A;  5JFR A;  1R1T A;  4AWX B;  2PG4 A;  1ZLJ A;  1XN7 A;  4B09 A;  3BY6 A;  4WWC A;  4FHT A;  4A5M A;  4YII A;  5AIP A;  4G7H F;  3LST A;  3QU3 A;  5E1Z B;  4ESJ A;  2QWW A;  1WSU A;  2PLY A;  4N9H A;  3P9K A;  2VT2 A;  2L4M A;  4HQM A;  1O57 A;  1HW5 A;  4ESB A;  3DQV C;  2XRN A;  4LG0 A;  1W7P B;  4IJA A;  4EM1 A;  2NNY A;  5LGT A;  4LB5 A;  1KYZ A;  5KVR A;  4Y15 A;  4HQE A;  1CF7 B;  3M8F A;  3E3V A;  4EV0 A;  1XCV A;  3FHZ A;  4RB2 C;  4R1H A;  1BI2 A;  1IF1 A;  4MGR A;  3RKX A;  2BGC A;  1OMI A;  4IRG A;  2DTR A;  4JK1 X;  3V8J A;  2YU3 A;  3GVA A;  2EFO A;  1W5S A;  2FRH A;  2STT A;  1L0O C;  1P4W A;  3RTR A;  5TJJ A;  2VE9 A;  3I58 A;  2G7H A;  1XSV A;  3M1E A;  1U3E M;  1SD5 A;  2ZXJ A;  3O6B B;  3ZPL A;  1FT9 A;  4Q47 A;  1E2X A;  1QZY A;  2KJC A;  3H3U A;  4I09 A;  2P8T A;  2V1U A;  2W84 A;  3ZMV A;  2M8E A;  1GVJ A;  1XGM A;  1E17 A;  1FNN A;  4L5I A;  5LEJ A;  3W6J B;  2F2E A;  4KN7 X;  4OOI A;  1IRF A;  3JSO A;  5FFZ A;  4RS8 A;  2XHK A;  1LDK B;  5DCM B;  4UVA A;  1EH6 A;  2X4H A;  1FSE A;  3HSE A;  3FX3 A;  3HSF A;  3HOS A;  3E97 A;  3RKW A;  3KZZ A;  3JAM Z;  4WCG A;  1KQ8 A;  2P5V A;  3ZP5 A;  1D3Y A;  3VFZ A;  5J8C A;  2E1C A;  1YO5 C;  2HDC A;  3MZH A;  2EV6 A;  2IA1 A;  1TQI A;  4Y13 A;  1SD4 A;  3LWF A;  1IXC A;  3DFG A;  2PEX A;  2X0L A;  4KYW A;  3WTW C;  5BQT A;  2QM3 A;  3H92 A;  1QO0 D;  4A12 A;  1NHA A;  2RVC A;  3G73 A;  3DPT A;  5ICF A;  2K7L A;  2UXN A;  2HTJ A;  4HF0 A;  2QQA A;  2FNA A;  3IC7 A;  3QOP A;  1YW7 A;  4P96 A;  3KZY A;  4AIJ A;  2FF4 A;  4MQV A;  3BRO A;  1R5G A;  2L02 A;  3EET A;  2UXX A;  3R61 A;  3VB2 A;  2QQB A;  3COA C;  3FM3 A;  1L3L A;  3TGN A;  5LGU A;  1R00 A;  3ECH A;  3WGI A;  1R7J A;  1AWC A;  2D1V A;  4BXU A;  2WWY A;  4M73 A;  4Q5S F;  3KET A;  4BH9 A;  4HOB A;  3K69 A;  4WXD A;  2ISZ A;  4M9X A;  4WF2 A;  1QBJ A;  2DPU A;  5E20 A;  2MD5 A;  1UHM A;  3TKY A;  4ASN A;  1TBX A;  1WQ2 A;  1PUE E;  2EK5 A;  1HSJ A;  5CVV A;  5D5V B;  5HS9 A;  3GWZ A;  3P9C A;  4U0W A;  2EJR A;  2H94 A;  3HTU A;  2MLG A;  1TW2 A;  2HYG D;  1J2X A;  4HX4 A;  5HVQ C;  5JHU A;  2Y0M A;  1G6N A;  3ECO A;  1K6O A;  4EJO A;  3FWE A;  1Z6R A;  2Q8K A;  2D45 A;  2EV5 A;  1LB2 A;  2R7D A;  4HLY A;  1Q1H A;  5ILV A;  3KCC A;  3M7G A;  4KA4 A;  1ODD A;  3F72 A;  2DLL A;  2FBI A;  2FE3 A;  1W5T A;  3E6B A;  2XAF A;  3U9G A;  5LBQ A;  4A2U A;  2L01 A;  2CSO A;  2FEZ A;  2EA4 A;  1RNL A;  5D5X B;  4S04 A; 
#chains in the Genus database with same CATH topology
 3MZ8 A;  1PYV A;  2EZL A;  3KP4 A;  4BEH B;  1XGN A;  1DPU A;  1MH4 A;  4XKW A;  1D5V A;  1Z77 A;  3BPX A;  2COM A;  3O8H A;  1FZP B;  2EFN A;  3TDZ C;  3DV8 A;  2FQ3 A;  2BY2 A;  4IOC F;  1GV5 A;  2OF7 A;  2R0Q C;  3RKY A;  1P2F A;  3AKZ A;  1K79 A;  4XLC A;  3QOE A;  3ABK H;  2VJJ A;  2C6Y A;  3A03 A;  4OIO F;  2X1E A;  1T8I A;  4XLP F;  5H2F C;  4AU7 A;  3Q9V A;  1OR7 C;  3H5R A;  4MFE A;  1UEL B;  3D5L A;  3WTV C;  4KT6 A;  3F6O A;  1BJA A;  3DPU A;  4DYR A;  2A07 F;  1ZYR F;  1ZG5 A;  2DMN A;  5CKT A;  4AIH A;  3DP7 A;  1U6G A;  1JGG A;  4FE4 A;  4G94 A;  2LTP A;  2HGC A;  2W57 A;  3S32 A;  3U2R A;  4BQQ A;  4BE1 A;  1J0R A;  3KPH A;  1RC9 A;  3FMS A;  4BE2 A;  1Z7U A;  2OTJ I;  2M2E A;  3F3X A;  1IXR C;  1GXP A;  3LMM A;  2Y0S A;  4NNJ A;  1KU2 A;  3J81 K;  4QTR A;  2R5Y B;  1IZ1 A;  1MBE A;  1JKP C;  1G4D A;  2UWM A;  5B1B H;  3IV5 A;  1R9T J;  3K10 A;  1ZHF A;  2KRF A;  3I5U A;  3A0H C;  4G12 A;  1LUJ B;  2CW0 F;  4I7H A;  3K6G A;  1YIJ I;  2M87 A;  1ON1 A;  1S8N A;  2OQR A;  3MEX A;  3CMY A;  5CPR B;  1X3U A;  4CYD A;  4XQF A;  4A93 J;  2PJP A;  1IRX A;  4A3G J;  1W4M A;  1MH3 A;  2V7F A;  4EJT A;  2LBF B;  4EGY A;  3RJP A;  3A01 B;  1ENH A;  2CV1 A;  2AQE A;  4HZF A;  4MHG A;  4PUS A;  1IN6 A;  1IV6 A;  2LC2 A;  4X6A J;  3TQN A;  1WVR A;  2MAB A;  5HLH A;  4YRV A;  2Q0O A;  3BG9 A;  4ZTF A;  1JGS A;  3HYI A;  3ZQG A;  1MND A;  4GGG A;  2VPL A;  2Y75 A;  5DV5 A;  1YI2 I;  1F36 A;  1X1D A;  4CXF A;  1VQO I;  1RKT A;  3B6C A;  2VBZ A;  2PQ8 A;  4P5O A;  2EIM H;  1WH5 A;  3GX4 X;  4C2M J;  5L3D A;  2UV1 A;  1K78 A;  4WK8 F;  2ZSI B;  4RGU A;  3T0Y A;  1W36 C;  1RKW A;  3SQN A;  1PDN C;  2OCC H;  1XX5 A;  4EQQ A;  2ID6 A;  2CYY A;  1M1E B;  2G0E A;  3BQZ A;  2ZO4 A;  1KGS A;  1SMT A;  3PIO F;  3ONQ A;  5IOY A;  1YJW I;  2XAG A;  3F8N A;  2QQ8 A;  3OY9 A;  3TO7 A;  5DUK A;  1S7O A;  2HS5 A;  3ABM H;  4I76 A;  5J4Y A;  2Y31 A;  2QVO A;  4HG2 A;  2DO7 A;  4XRS A;  2LNB A;  3ZQQ A;  5LD2 C;  4A3B J;  5IYD J;  2WV1 A;  3UNG C;  3LSH A;  3H3V K;  3BJA A;  4KIS A;  3S2D J;  4BUP A;  5KHD A;  4TV7 A;  1VQP I;  2EB7 A;  3GTK J;  2LD5 A;  5LFA A;  3B73 A;  4HNT A;  3ZRG A;  3OYG A;  3PO3 J;  2H1K A;  5K7F A;  4PCQ A;  3ELK A;  2CO5 A;  3CDL A;  4BQO A;  4XR6 A;  4XLF A;  4NC8 A;  4V19 K;  2RAE A;  2FXA A;  1KU7 A;  4QPQ A;  5FJ8 J;  1Y8Q B;  1LEB A;  1MDM B;  4I6Z A;  1T38 A;  2XPW A;  4CYC B;  3CP8 A;  5HLI A;  1BA5 A;  1U9O A;  4RAF A;  3F23 A;  2GQQ A;  1FOK A;  2ZSH B;  2W25 A;  3DXJ F;  3U21 A;  3ZCO A;  1R1U A;  2W24 A;  1ULY A;  4CSW A;  2ZFW A;  4PDK A;  5TGT A;  5L3F A;  4F91 B;  2FML A;  4A69 C;  1F4K A;  2E7X A;  1LDD A;  3E5X A;  4EAT A;  1DP7 P;  4GFB A;  2JPC A;  2LSO A;  1KU3 A;  3LFK A;  5KAI C;  3BZK A;  3IRR A;  3CCJ I;  1IC8 A;  1YLF A;  5JI6 A;  4LGW A;  2ZCW A;  1B4A A;  2E2I J;  5GPA A;  2X6X A;  4IL6 C;  1V3F A;  3LQQ A;  2IS2 A;  3JRG A;  2M30 A;  3CLQ A;  3KP3 A;  2BBY A;  5DCM A;  1VQ6 I;  3IH3 A;  2DPD A;  1RET A;  2FA5 A;  3S1N J;  4BYY A;  2MBF A;  3K1N A;  5FKM A;  3WU0 A;  5LGN A;  1X2M A;  2W7N A;  4XSZ F;  2R3S A;  4DBR A;  2BHZ A;  3RSN A;  1F1Z A;  1FWZ A;  4BL0 B;  2DA4 A;  3HSR A;  2DMQ A;  1X3Z B;  3KEY A;  1TNT A;  2JSC A;  3ZOB A;  5IYB J;  2CJJ A;  1E3P A;  3JAM K;  4U7B A;  2QA4 I;  1HBX G;  1U5T A;  2XVC A;  3AG1 H;  2NOJ B;  3CZ6 A;  2XGD A;  1FY7 A;  4IF4 A;  5JLX A;  2JPB A;  4FCY A;  2V1X A;  4CCK A;  2OD5 A;  4I0B A;  3ZQL A;  1RZ4 A;  2L9S A;  2IPQ X;  2ZME B;  2Z5U A;  4NC7 A;  1XGO A;  4NHJ A;  2D2W A;  2WV0 A;  3C2H A;  1I39 A;  5F0C A;  3CUQ A;  4RBO A;  5M3F J;  2DT7 B;  2XPU A;  5FFX A;  2ISY A;  3RYR A;  4BJ5 C;  4D5C A;  2IGN A;  3HC7 A;  3VDX A;  3HUG A;  2DMP A;  4HST A;  4MEX F;  4XLE A;  2DA6 A;  3QWL A;  4UVC A;  4XSX F;  2JVG A;  1WJE A;  4M3E A;  2IS4 A;  1YQA A;  4M71 A;  4KNY A;  4IHW A;  3HKZ A;  1MSE C;  2Y48 A;  4HA8 A;  4MTD A;  3BZC A;  4XNF A;  3FXJ A;  3HZJ A;  3MKY B;  2L9V A;  1JT6 A;  2E2J J;  1D0Z A;  4Y4R A;  1TC3 C;  1S9H A;  1LQ1 A;  3QYE A;  3F22 A;  1I6H J;  4HF2 A;  3AG2 H;  4L9T A;  4J19 A;  2IGK A;  4XKB A;  3TO6 A;  1F9N A;  3CC2 I;  4A3L J;  4NQW B;  4F92 B;  2X48 A;  4CH7 A;  3FDY A;  3GZ6 A;  2OU2 A;  4DOZ A;  2VC0 A;  2R92 J;  2P7V B;  3J81 Z;  1YX3 A;  2FMY A;  3J80 Z;  3B02 A;  3HRT A;  3J7Z I;  1YTY A;  4IXA A;  3D0S A;  4IHY A;  3BJO A;  2GLO A;  1JUP A;  1Z9C A;  3WTT C;  3GYH X;  3C2B A;  3K1M A;  3WE3 A;  1OCC H;  1LNW A;  2OTL I;  4C3I J;  4MQ9 F;  2DQL A;  1ZRC A;  5HLT A;  5DS9 A;  1ZG3 A;  4PJM A;  1T2K A;  3OS1 A;  2KFD A;  2WA0 A;  1W0U A;  3V7S A;  2A6E F;  4YG2 F;  4HAM A;  2EIK H;  2R7F A;  4Y52 J;  2H27 A;  2DOA A;  3JRH A;  3GEZ A;  1IDY A;  2JUG A;  2IVM A;  4PZJ A;  4CIC A;  3G4S I;  1NG7 A;  1SFO J;  4Y33 A;  2X6W A;  1Z6T A;  3BP8 A;  5L3C A;  3FBN B;  2DMU A;  4E7S A;  2NVX J;  3S8P A;  2WB1 A;  1AOY A;  2Z3Y A;  1G3T A;  2NYX A;  3KEQ A;  3K70 D;  2GAU A;  3CCE I;  3N4M A;  3AAF A;  2VOP A;  2M7A A;  2ZJQ F;  5E3M A;  1PP7 U;  3E5Q A;  1PVE A;  2XIG A;  1IN8 A;  1LE8 B;  3WG9 A;  1GXQ A;  4B4C A;  3L2Q A;  1WFX A;  2LY2 A;  1MMA A;  4FE7 A;  4IHT A;  4XL9 A;  5ERI A;  5IY5 H;  3N97 A;  4KIG A;  2BXY A;  1K61 A;  1X1C A;  4L0Y B;  1JKO C;  2KMU A;  1POG A;  5D8K B;  2ETH A;  4MEY F;  3GTO J;  3KP5 A;  1R22 A;  4A3J J;  1ZG1 A;  3PO2 J;  3O2P E;  5E8G A;  1JJ8 C;  1QHG A;  2ECC A;  4AYB N;  1KU9 A;  1KQ0 A;  1QRY A;  3KFW X;  5GAH J;  3S2H J;  2VT3 A;  4ZH4 F;  5D6F A;  1QVU A;  2KJB A;  2Y69 H;  3DKY A;  4RGR A;  2K02 A;  2XKP A;  3H0G J;  4CA0 A;  1CQT A;  2JA5 J;  2XUB A;  1DUX C;  1FMW A;  3M8E A;  3L7W A;  5EZG A;  1FYM A;  1NK3 P;  2WY8 Q;  1DDN A;  4BE0 A;  3I0T A;  4MIM A;  3JR9 A;  1T98 A;  1FYL A;  2M45 A;  2K9N A;  3HHG A;  2VOO A;  2OJE D;  2EFQ A;  4BJT A;  3I59 B;  4B48 A;  2RC4 A;  4AIK A;  2ZFU A;  2P5L C;  1E0E A;  2XAQ A;  3ML6 A;  1YIO A;  2LF7 A;  2CG4 A;  1IN5 A;  3JW4 A;  4RB1 A;  2VQL A;  2X9D A;  3DBR B;  2VLA A;  1ZAR A;  4BJ6 C;  4HDV A;  4LLN A;  5ILS A;  2HQN A;  1D1C A;  3M9A A;  1ZH5 A;  4ZC3 A;  1LEA A;  3ISP A;  1UB9 A;  3E6D A;  4E70 A;  4YFN F;  1IG7 A;  2CQN A;  5KNL A;  3U1K A;  4GO1 A;  3Q0V A;  5HS8 A;  3VOE A;  2J5P A;  2V79 A;  2EZH A;  4ETS A;  1ZK8 A;  3DTK A;  2YX7 A;  3ESW B;  2QSF X;  2F6C A;  3MD2 A;  1RR8 C;  2LKP A;  2V1D A;  1WCM J;  2E1M B;  1QPM A;  1R58 A;  5C3E J;  4IHV A;  4L9V A;  3WOD F;  3HTS B;  1MJB A;  1K4T A;  3LFU A;  4UUT A;  1WKM A;  5IT9 Z;  5HOO A;  5JHF A;  1I1G A;  4M6X A;  2K4J A;  1WRJ A;  2NNN A;  2GA2 A;  3V4G A;  1R49 A;  4P55 A;  2MFZ A;  2B9S A;  1TWG J;  2QSG X;  2KIU A;  4NC6 A;  1STZ A;  2CQX A;  3HXL A;  4Q4Z F;  3IRQ A;  2ZJ2 A;  5D5U B;  3L09 A;  4R8H A;  4QSH A;  5CQE A;  1JTY A;  1XD7 A;  3C18 A;  2QEN A;  1FPQ A;  1D0Y A;  1MMG A;  4HW0 A;  1K7A A;  3VWB A;  2XF6 A;  3S16 J;  4LLL A;  4PSW A;  3W6V A;  2JZY A;  2KQR A;  2PBI A;  2WY7 Q;  2VUM J;  2IP2 A;  2LDU A;  3C2G A;  3KP7 A;  3I4M J;  5HOD A;  3KEO A;  3BLY A;  2V6C A;  3CDI A;  4XON A;  1W5C C;  3ZQH A;  3GZN B;  1OYW A;  3F0C A;  2O7O A;  3QQA A;  4G7O F;  2PMH A;  1ZR4 A;  2VQC A;  3EUA A;  2A05 A;  4GCV A;  5K7Z A;  2DAO A;  4GDF A;  3FIW A;  1FP2 A;  2XGC A;  1I6X A;  2FX0 A;  3PL8 A;  2RQP A;  2DCE A;  4I02 A;  1IJW C;  1RRJ A;  3T8T A;  1YRN A;  1TLH B;  3RZO J;  1VQ9 I;  3K4M A;  4HDU A;  3QU6 A;  1BI1 A;  4QLC U;  3FXK A;  4V2G A;  2Q2E A;  1T39 A;  4HV6 A;  2B7E A;  1Y1W J;  3F8B A;  1HXD A;  3FMR A;  3HGY A;  1MD0 A;  5EDN A;  4HEA 2;  3MFK A;  4BXF A;  1RI7 A;  3E0J B;  3SZG A;  1P4X A;  2ZJR F;  5BMZ A;  4AD9 A;  4M9Z A;  2E1N A;  3H1C A;  3BQY A;  4RAZ A;  1J9I A;  3HRS A;  4KIB A;  3IAS 2;  1BBY A;  1ETY A;  2O0Y A;  4LB6 B;  2NVQ J;  4D7N A;  1KYW A;  1XDS A;  2L9N A;  3RIR A;  3EYI A;  1ZGJ A;  2RGV A;  2RV8 A;  3ZXS A;  2XB5 A;  2K3P A;  3TL4 X;  3ZQ7 A;  1PUF B;  4JP0 A;  2WBM A;  2QEX I;  2ZNY A;  3WE2 A;  1VQ8 I;  1HW1 A;  4KT5 C;  4UHT A;  3BG7 A;  3BWG A;  3IKV A;  2IEK A;  5J4V A;  1ZN2 A;  2QBY A;  1UG2 A;  1I5Z A;  1IUY A;  1K83 J;  1T0F A;  2MLK A;  2YS9 A;  3C7J A;  3V8K A;  1VQN I;  2ZKZ A;  4ZZL A;  5K5Q A;  1D0X A;  1RPW A;  3BJ6 A;  5EJC A;  3TDU C;  2IJL A;  2E5Z A;  3DEW A;  3T5X A;  2XF7 A;  1HQC A;  1BIA A;  2DMT A;  4BY1 J;  3ERM A;  4L9N A;  3F21 A;  3C3W A;  5LLQ A;  1U2W A;  3DU5 A;  2HOS A;  3HBL A;  1EA3 A;  3FXU A;  3I54 A;  3DTI A;  4LG0 B;  2QF7 A;  1Q1V A;  2DA1 A;  2DA5 A;  2F5F A;  4A5N A;  1O3S A;  2DJN A;  3I4P A;  2EA2 A;  3LA7 A;  5F08 A;  3K2Z A;  1FX7 A;  2HYF A;  1IO2 A;  2IGM A;  3X2Q H;  5M5X J;  2FBK A;  3SZT A;  4E6K G;  3DU6 A;  4M9S A;  1FSH A;  4DZJ A;  5M3M J;  3HIF A;  1Z0X A;  2YX4 A;  4HX8 A;  4D7M A;  2CUJ A;  4KMU X;  2P5K A;  2RNJ A;  5B1A H;  4YFK F;  4CHU A;  3N05 A;  4YEJ A;  1A31 A;  1WWX A;  2A61 A;  1S5L C;  2EFP A;  5J1R A;  3ABL H;  2J5O A;  4DBQ A;  1VND A;  1BC7 C;  1V5F A;  2RNG A;  4BDZ A;  4EJW A;  1JKQ C;  3F9K A;  4IZZ A;  1DU0 A;  3VYR B;  3H9G A;  4I99 C;  1ZRD A;  1D8K A;  2E60 A;  4KIF A;  3TOB A;  2B0L A;  4X0G A;  2AQF A;  1APL C;  2XKO A;  2RDP A;  1ONV A;  4LMY A;  4BHC A;  2KL4 A;  2BVL A;  2ECB A;  3S14 J;  4IO9 F;  4MFD A;  1BL0 A;  4UUV A;  5FRM A;  2O5R A;  2I10 A;  3JTG A;  1SFU A;  3PJR A;  5B5E C;  2XPV A;  4PJJ A;  2OC6 A;  1X3W B;  3HM5 A;  1RIO H;  1GLN A;  1LVA A;  4N9I A;  2HTS A;  1J7K A;  1T6S A;  3MQ0 A;  3KLN A;  1JXS A;  2PN6 A;  4MNU A;  1DQU A;  3CJT B;  2K40 A;  3WTU C;  3L2R A;  3HRU A;  4L0Z B;  5GPC A;  5EG0 A;  1OYY A;  2L2O A;  1U5T C;  1XGS A;  2MC4 A;  5KK1 A;  1TT5 B;  1I3Q J;  3NRV A;  4BHP A;  3FXO A;  4ZDP A;  2VJ5 A;  3LA2 A;  4I2O A;  3IH4 A;  1WJC A;  2AHQ A;  4HF1 A;  1EV7 A;  1WJ5 A;  2DK8 A;  4IRI A;  5DYM A;  1H9T A;  4F7Z A;  3FF5 A;  5ICE A;  1R1V A;  4RLF A;  3IWZ A;  5F1R A;  5J47 A;  3RQ4 A;  3CUQ C;  2XAH A;  2KIQ A;  5H6R A;  1DP3 A;  3WG7 H;  4UUS B;  2COB A;  1YIT I;  3GW2 A;  2DXI A;  1OFC X;  2DDA A;  3KYC B;  2O61 A;  1W7P D;  2JT1 A;  3I64 A;  3ABU A;  2RQQ A;  4E4H A;  1OCT C;  3ZN1 A;  2NVT J;  4PGG A;  5LHH A;  5C4J J;  1SD7 A;  2R7U A;  1YE9 A;  2WAQ N;  2NRA C;  3ZMS A;  1I1S A;  5FLX K;  3BTL A;  1H9G A;  2GXA A;  3LAP A;  2EIL H;  4G8X A;  2O6G E;  2QZ8 A;  1MNE A;  1B72 A;  2R7V A;  4BQA A;  2HYJ A;  2HXI A;  1T95 A;  4KIT B;  1SMY F;  2EWN A;  4XLH A;  2PJR B;  1O3R A;  1MBH A;  2VAS A;  4E7K A;  2OAZ A;  3Q0W A;  1VI0 A;  1YYV A;  4FT8 A;  1QVT A;  1LFP A;  3J80 K;  1NK2 P;  5E1X A;  3S3O A;  4XLN F;  4RLQ A;  1LDJ A;  3WTX C;  3L2C A;  3TED A;  4CO8 A;  2PMZ N;  2RKH A;  1LPQ A;  4BQN A;  1J09 A;  1R4M B;  5DEQ A;  3QPL A;  1HF0 A;  3LQR A;  3OYD A;  1R6R A;  5F64 A;  1BI3 A;  1W7P A;  4UXN A;  2K27 A;  4A0Z A;  3CO7 C;  4B3X A;  1REP C;  4GYG A;  3S93 A;  2HVR A;  2CQQ A;  2ZBK A;  1QZZ A;  4ZZD A;  4M74 A;  3RQI A;  3K7A J;  1ZEL A;  3NWT A;  2CQ7 A;  3BOQ A;  1SEU A;  1CF7 A;  2K9Q A;  1WJA A;  1SVM A;  5CVJ A;  1HKS A;  2QCO A;  4UY8 I;  2CW8 A;  3OS2 A;  1MBJ A;  3MAJ A;  4BY7 J;  3CCU I;  5LHI A;  4LIU A;  3CCV I;  3F8C A;  3K1P A;  2GA1 A;  5CVU A;  2HFH A;  2ADU A;  4J00 A;  3OSG A;  4DNC A;  5C44 J;  3J7A O;  1QU3 A;  1J5Y A;  1QNT A;  2K9M A;  1BW5 A;  1TNS A;  3DPL C;  1XSX A;  4UV9 A;  2EQR A;  1D8J A;  5F0H A;  3HGG A;  4DYQ A;  2YPR A;  3PQK A;  2Y9Y A;  1OCR H;  5LRS A;  5J1U A;  2XAJ A;  1DGW Y;  2AO9 A;  2IXS A;  3CP2 A;  3D1N I;  3GFL A;  2XRO A;  3GTL J;  3VEP A;  3OOP A;  1UCR A;  2ZNZ A;  3KLO A;  4EM2 A;  1KQ9 A;  2IT0 A;  3K70 C;  1W1W E;  1YS7 A;  3GZ5 A;  4ON0 A;  2GBY A;  5D8L B;  1GT0 C;  5D5W B;  1ACI A;  2V9V A;  5DM7 F;  4LJZ F;  2K3F A;  1SAX A;  2I8D A;  3E6M A;  2HZT A;  1D1A A;  2VKD A;  2VJI A;  3P7N A;  3S3N A;  4XOT A;  3JTH A;  2CMP A;  4Z2Y A;  3CCM I;  3K9T A;  1XC5 A;  3DLL F;  3I59 A;  4YIR X;  4A3C J;  3I71 A;  3SDG A;  3L00 A;  2VKV A;  4MTE A;  1P9Q C;  4FX0 A;  1JE8 A;  4UV8 A;  2G9W A;  2QLZ A;  2IGO A;  1A6Q A;  4M6Y A;  4CCL A;  2KKO A;  5FD5 A;  2CGP A;  3FZV A;  2YSR A;  2DBB A;  3TOA A;  1AKH B;  1ZAO A;  5H6Q A;  3CCY A;  3K0L A;  3OV8 A;  3DEU A;  2KIM A;  1Z3X A;  2WAD A;  2DI3 A;  1UST A;  2KZV A;  3AFH A;  4RGX A;  5FKO A;  1O3T A;  3R0J A;  3QRF F;  3CC7 I;  4BU2 A;  4ZYD A;  4XBF A;  3FKI J;  5F6F A;  3ZMU A;  4OWR B;  4AUX A;  3CC4 I;  5B3S H;  4OMY A;  3A0B C;  4B44 A;  5IOZ A;  4U0Y A;  4RAG A;  1TQM A;  4QWQ A;  4HNU A;  4O3M A;  2CUZ A;  3H3Z A;  4EM0 B;  2QQ9 A;  4FQG A;  5E18 F;  5IT9 K;  1BIB A;  5EGO A;  2K86 A;  1B6A A;  1MSF C;  1O7L A;  1Y39 A;  1O3Q A;  4BDY A;  1WI9 A;  3GXO A;  2P6S A;  4B43 A;  5FLV A;  3L9F A;  3CJQ B;  1HKT A;  4D0P A;  1XG1 A;  1OQY A;  5CVR A;  1E3H A;  1A04 A;  4ENK A;  3OYC A;  1GVD A;  3UR3 C;  1R71 A;  3FK7 A;  5TIS C;  3QP5 A;  1B8I A;  4XRF A;  3SFZ A;  5AON A;  2ESH A;  3BDD A;  2EIJ H;  1MBK A;  2L7M P;  3GME A;  1A35 A;  4CUG A;  5HS7 A;  1FOX A;  5F1J A;  4DW6 A;  3GTQ J;  3GFJ A;  1OLT A;  3P9I A;  3UKG A;  2A69 F;  1QQI A;  3DBL B;  3WTZ A;  3KP6 A;  4I0A A;  4E7I A;  2EZI A;  3J7A Y;  4N4O B;  3Q9S A;  3K4B A;  3WGH A;  4JBA A;  2Z1D A;  3FXR A;  2M5W A;  1F43 A;  3MWM A;  4E7H A;  5FLX Z;  4ZDL A;  3V8L A;  1ON2 A;  4WXC A;  2L4A A;  2ME0 A;  3S15 J;  1OCO H;  3DEE A;  2E1O A;  4A3K J;  4F52 A;  2MGQ A;  5LEK A;  5IYC J;  3JRE A;  1Y0N A;  5D5X B;  3ZQF A;  1SFE A;  2GIZ A;  3HOX J;  3K4L A;  4LFU A;  1R5I D;  1HOM A;  1OPC A;  3G1O A;  2MYS A;  1SFX A;  3QPH A;  1IN4 A;  2P4W A;  2YR2 A;  4HBL A;  4AM3 A;  2HDW A;  3WHB A;  2VXD A;  2DK5 A;  1VTN C;  3CO6 C;  5FRO A;  3SXY A;  3BT9 A;  4EGZ A;  4HYE A;  2A3S A;  5JVT A;  1TWA J;  3QAH A;  4OIN F;  3TW7 A;  2R5Z A;  1BOB A;  3A02 A;  3RDI A;  3WU2 C;  2P81 A;  4XKC A;  5AIQ A;  3R0A A;  1X1A A;  1PUF A;  2CUE A;  3W6K B;  5HDN A;  1EF4 A;  3NEU A;  2DT5 A;  2XSJ C;  3EDP A;  3RPU D;  4P1W A;  1T0F C;  4WXH A;  4L18 B;  2VBY A;  1K4S A;  2H1L A;  2MH9 A;  4D5F A;  2XAS A;  1B59 A;  4IRH A;  5K7H A;  4CZZ A;  3ZMT A;  1Y1V J;  2LRD A;  4A3I J;  1MJA A;  3R6S A;  4LIT A;  3HHH A;  5E79 C;  3JSP A;  4RAY A;  4N0B A;  1RUN A;  4A3E J;  3QPT A;  4C3J J;  2KRH A;  3AL0 C;  1A6I A;  5A2Q K;  4F3Q A;  1FLI A;  2JMW A;  4BAC A;  3GCM A;  2IAI A;  2F5V A;  2X6Y A;  2W4S A;  2MH2 A;  2BZT A;  2JVH A;  2A6H F;  1ETQ A;  1TQP A;  2KIF A;  3DF8 A;  3F8F A;  5FD6 A;  3CES A;  2NXN B;  1U9N A;  1KA8 A;  1EH8 A;  4A0Y A;  3IL2 A;  1WJF A;  4BAY A;  3FXL A;  3CDH A;  2BY1 A;  2DOD A;  3I53 A;  3VSK A;  5IT3 A;  4KIC A;  3CF2 A;  3GF2 A;  2ELH A;  2ELK A;  2I5U A;  2OBP A;  2VOD A;  3ZQI A;  1NG6 A;  2M0M A;  4DGW B;  1NH3 A;  1YW9 A;  4C30 A;  4ANJ A;  3R60 A;  1UAA A;  5BPD A;  3REO A;  4BHB A;  2Y0S N;  1K78 B;  3SJM A;  1FBS A;  3MKL A;  3RPU A;  1FBQ A;  3H9J A;  4YIF A;  1Z91 A;  2XF5 A;  2LKS A;  2M7B A;  2PFB A;  3L1P A;  2P7C B;  2BV6 A;  3QP6 A;  1BM9 A;  5EZH A;  3PQJ A;  2R7Q A;  3HG9 A;  4DZP A;  3ZN0 A;  4RA2 A;  2KLO A;  2NOG A;  1ZGA A;  5EEH A;  4EJU A;  2H8W A;  1FTT A;  1G2H A;  2P0W A;  4O5V A;  1PP8 F;  3HL2 A;  5HNH A;  3VOD A;  1BR4 A;  2QYO A;  4Q48 A;  2IW5 A;  2WTE A;  3RZD J;  1IXS B;  3LA3 A;  2DFI A;  1YG2 A;  3BCB A;  5GTH C;  3RI4 A;  1EJ9 A;  1Z67 A;  4S05 A;  2TCT A;  3E6C C;  4XN0 A;  2CQK A;  2G7U A;  4FX4 A;  1JUM A;  4LOC A;  3ZR8 X;  1V4R A;  1KZH A;  1JUS A;  2E5N A;  4IPA A;  3WTY C;  2JN6 A;  1H89 C;  2BW3 A;  3CLO A;  2DTZ A;  3BR6 A;  3I9V 2;  2R4G A;  5ICC A;  2VKH A;  5HDG A;  1BN5 A;  3SZP A;  2BVM A;  4C2T A;  3BG5 A;  1WI3 A;  4DYC A;  5GAE J;  4PGH A;  2GIV A;  4R79 A;  1BC8 C;  2LKX A;  2PMZ A;  4HV5 A;  3ULQ B;  4BEH A;  4JYK A;  1AHD P;  2HWV A;  3GO5 A;  5EEG A;  3OYE A;  1GDT A;  2DN0 A;  4UVB A;  1Z21 A;  4OIP F;  3O8G A;  5K1Y A;  3BR2 A;  3LSJ A;  4HLX A;  2LY9 A;  2UUZ A;  1SAU A;  1P7I A;  1Y56 A;  2HQ5 A;  2LRE A;  3HEF A;  1DPR A;  4WX9 A;  1X1B A;  1HDP A;  4JX5 A;  5GP9 A;  2STW A;  4EVI A;  2FBH A;  2L0K A;  5TRD A;  2GOM A;  5ILU A;  4E7J A;  2LF8 A;  2OA4 A;  3J7Y J;  4ESF A;  5M5W J;  3CF5 F;  4P9U A;  4ZYG A;  2LFB A;  4G6Q A;  3EQL F;  2LG4 A;  2X1C A;  3OIP A;  3R4K A;  2FU4 A;  3S2W A;  3BR0 A;  1MJ9 A;  1OCP A;  3GFM A;  1U5T B;  1V55 H;  2MG4 A;  2R5Y A;  2BXZ A;  2DOF A;  3IHU A;  5L3E A;  2V1N A;  4KFC A;  3V7C A;  4ZTJ A;  1WJB A;  4BKX A;  4ZYE A;  4OMZ A;  1Z05 A;  2ZXW H;  1U8R A;  3CJN A;  4B8X A;  4EJV A;  2E36 A;  5L3G A;  3CUQ B;  4OAY A;  3DLA A;  4M3B A;  3LSG A;  2XAU A;  4CCM A;  2F5C A;  2D1H A;  3PFI A;  1WJD A;  1DGR M;  4RB0 A;  1XCB A;  3HUG B;  2LBF A;  3ASN H;  3AG4 H;  2XSD C;  3A01 A;  3G1M A;  4LIV A;  1OYI A;  4KN4 X;  3LAJ A;  1BI0 A;  1LVK A;  1Y0U A;  2ZXI A;  2VE8 A;  2HEO A;  2GXB A;  2HNH A;  5K5O A;  3WTS C;  2LH9 A;  2OPT A;  1O4X A;  4Z6Y A;  3LSR A;  2A5Y B;  1I50 J;  4G6T B;  4JQF A;  1YW8 A;  5DD8 A;  1XMK A;  5DDG A;  4BXX J;  3BR1 A;  4H4K C;  1TTY A;  2XGX A;  3IKT A;  1R23 A;  3PNY A;  3VYT B;  2W48 A;  3WHC A;  4XID A;  1X19 A;  3DTE A;  1IGN A;  3FXQ A;  2LK2 A;  4IHS A;  1FBU A;  1Z1D A;  3TO9 A;  4IQJ A;  5BPI A;  1QHH D;  5C4X J;  3G3Z A;  3Q3S A;  1X4P A;  1AA7 A;  3OYJ A;  2R7R A;  5D4R A;  2FSW A;  1D1B A;  2NVY J;  5E17 F;  3SEQ A;  3M1C A;  2NS0 A;  2VN2 A;  3BG3 A;  3CCL I;  1TWC J;  3S1R J;  1I27 A;  3K4K A;  3FMQ A;  3OMY A;  1IUF A;  4ENM A;  2HQR A;  1B9M A;  1S3J A;  3MZY A;  1BR1 A;  4A6D A;  4XRS G;  2DW4 A;  5A2Q Z;  2R7S A;  1XDU A;  4KMF A;  5BNG A;  2A5W A;  2F4I A;  4ZJZ A;  1OKR A;  2K85 A;  2JA7 J;  4GXO A;  1SC7 A;  3MMY B;  4XRM A;  2KZG A;  3HKZ N;  3GTP J;  5E3N A;  1S7A A;  4M72 A;  4A3M J;  2BYV E;  1YOV B;  3BTI A;  5HLG A;  4E7Z A;  1XSD A;  1IAW A;  2GM4 A;  2L3D A;  3OL4 A;  1GV2 A;  3U1D A;  3F6V A;  2ZXH A;  4GYI A;  3CCQ I;  2VON A;  2V4J C;  3D5R C;  1MDM A;  1FEX A;  4CDG A;  2MD0 A;  3GFI A;  4MLO A;  3QYB A;  4CYC A;  2JA6 J;  2BEO A;  2DOE A;  1FTZ A;  2OZ6 A;  4LLG F;  4EMS A;  4AVP A;  1MZB A;  3CUO A;  5B66 C;  3KZI C;  3A4C A;  4G6D A;  1YJN I;  2K5C A;  2YU9 J;  2E34 A;  1MIJ A;  3PUF A;  2LYC A;  2BE5 F;  3EYY A;  2DT6 A;  3T1B A;  1N78 A;  5IPA A;  2KIS A;  4UB8 C;  2AS5 F;  1FOY A;  1UJ8 A;  5FB2 A;  2IRF G;  2NVU B;  2DA2 A;  2EBI A;  2WC2 A;  3HRM A;  5F0F A;  3TBI A;  3G71 I;  2HPM A;  2EV0 A;  3JRI A;  5CVI A;  3PSI A;  3OSF A;  2E19 A;  2M8G X;  3ZMD A;  2WB1 N;  2O8X A;  4E7L A;  2D5V A;  3MCZ A;  3QOD A;  3QYF A;  1B9N A;  3RYP A;  1H8A C;  3HDD A;  5K5R A;  3JCU C;  4LD5 A;  4N4N B;  4OU0 A;  2F5D A;  5J3L A;  2OCE A;  4BNC A;  3QPS A;  1K6Y A;  4C3H J;  1ZRF A;  3VPR A;  2ELJ A;  2HQA A;  4L5E A;  2KDZ A;  2M4K A;  2AXL A;  1H0M A;  2ZME A;  2Z99 A;  4XLA A;  3KP2 A;  4XOP A;  4ENJ A;  2QGU A;  5EEA A;  1QGP A;  4IOA F;  3EPZ A;  2DA7 A;  1FYK A;  2O3F A;  2V9P A;  4ZYH A;  3NWS A;  1LJ9 A;  5CLS A;  1MKM A;  5H20 A;  2XDV A;  2Y9Z A;  2O9L A;  2H6C A;  3LSM A;  5HDK A;  3NQO A;  2P6T A;  4K2E A;  3T8R A;  2HR3 A;  1O7F A;  2LMD A;  3GLL A;  1XB4 A;  4I01 A;  5BS6 A;  3TP0 A;  1GHC A;  5JVG F;  1TWF J;  1V54 H;  4HNV A;  4M3F A;  1S72 I;  2KT0 A;  4G9Y A;  1HW2 A;  1MMD A;  4OIQ F;  2QUF A;  3DKW A;  4FTH A;  4PK4 A;  2ZC2 A;  3BG6 A;  3CMM A;  1S29 A;  4NQW A;  2R7X A;  1P6R A;  2JRT A;  2O03 A;  4Y3O A;  2VBX A;  1TWH J;  4G7Z F;  4U0V A;  2FNP A;  4U88 A;  3BCA A;  2X6O A;  4DQ2 A;  3BPV A;  2OZU A;  1N77 A;  1P7J A;  3LOC A;  1YHQ I;  1WGX A;  4UNO A;  2OV7 A;  2KDO A;  3ABT A;  5BOX A;  1VQL I;  1B1B A;  2IS1 A;  3EUH A;  4ZYA A;  1UG0 A;  1S6L A;  2VBW A;  2Z33 A;  5CYV A;  2M9H A;  1G3S A;  2CFX A;  2HPI A;  1P92 A;  4AYB A;  2CU7 A;  2DU9 A;  1TT0 A;  3PFY A;  1EKE A;  5ICG A;  1RR7 A;  4I98 B;  2XB0 X;  1BOA A;  1IV8 A;  3FK6 A;  4FET A;  1U0J A;  2DQR A;  5LHG A;  4DJA A;  2ESN A;  2HOE A;  2H8R A;  3H35 A;  4H0E A;  5E1W A;  1ZLK A;  4AVZ A;  1HC8 A;  4ITV A;  2W85 A;  3MN2 A;  4L9J A;  5FO5 A;  2IA2 A;  1LE8 A;  1YRN B;  2CW7 A;  5DUI A;  1Z7L A;  4YFX F;  5FKN A;  4A6E A;  3F8M A;  1U78 A;  1V5G A;  3ROU A;  2CWE A;  3H5N A;  2OQG A;  4A0X A;  2XC7 A;  2PI0 A;  1UFM A;  3FM5 A;  3GUD A;  5DD4 A;  2Q2E B;  3BZ6 A;  3V42 A;  2ACJ A;  3WGG A;  2KHM A;  1YFH A;  3S17 J;  2RRE A;  1VQM I;  3OYF A;  4LK0 F;  1YS6 A;  3C1D A;  2ICW G;  5D6E A;  2TDX A;  5DM6 F;  2Z9O A;  2QKL B;  4OAZ A;  4CCJ A;  2W00 A;  1P4A A;  2EPF A;  4F55 A;  1IN7 A;  4QPO A;  5J40 A;  5L3B A;  2R7O A;  3BR5 A;  1UZC A;  5FKK A;  4IVN A;  4FAS D;  3M8J A;  3GTM J;  1T56 A;  2YUS A;  3CTA A;  1KON A;  1R36 A;  4NB5 A;  4XN3 A;  3Q5F A;  4KJZ A;  1ZR2 A;  2CV2 A;  4JX6 A;  2QBY B;  2GWR A;  4EEF G;  4Y17 A;  4CGZ A;  2JA8 J;  4XM3 A;  1TP4 A;  1XMA A;  5J6X A;  1SVL A;  4KDP A;  1BW6 A;  4PFP A;  4M3D A;  5J8F A;  1Y8R B;  2DYS H;  2IBD A;  3ZMZ A;  2PX9 A;  2JWT A;  1RUO A;  1N25 A;  2DDB A;  1MGT A;  4OIR F;  1A36 A;  5DTD A;  3OYL A;  1ETV A;  2CV0 A;  5FRN A;  2NS7 A;  1F5T A;  3E5U A;  4M6V A;  1TW3 A;  5GTI C;  2H6B A;  3AL0 B;  1EH7 A;  1G3W A;  4XKV A;  3OOU A;  3IH2 A;  4LK1 F;  3SDB A;  4B3A A;  3D5S C;  1SD6 A;  1R5H A;  2NAZ A;  1QZE A;  1UHW A;  2HKX A;  4RM2 A;  1J59 A;  2LY1 A;  5D4S A;  5E8I A;  1S7E A;  2HI3 A;  2F5E A;  1TL8 A;  2HKO A;  2L54 A;  1MNM C;  2V9K A;  2MC3 A;  1A5J A;  2DFF A;  5ED4 A;  3L2W A;  2IA0 A;  1V5E A;  4P9F A;  4U7D A;  3HOV J;  2BHY A;  3GLX A;  1FIA A;  4IKF A;  1I3A A;  4X1E A;  3JRC A;  6PAX A;  2GXG A;  2PMU A;  1C0W A;  3JRF A;  4O6J A;  1FC3 A;  1MMS A;  4BBS J;  2VC1 A;  3KE2 A;  3KIO A;  4B47 A;  2JTV A;  3JRA A;  3IWF A;  2H09 A;  3I55 I;  5CQG A;  1Z3Y A;  2XV4 S;  4ABZ A;  3RCO A;  2E7W A;  3OYH A;  2CS3 A;  2Q1Z B;  3OYI A;  1G3Y A;  5JR3 A;  2E35 A;  1JHF A;  3W2A A;  3ASO H;  2A68 F;  4ENN A;  4RB3 C;  3FBI B;  4HX7 A;  2JRM A;  3TMO A;  1N75 A;  2NS8 A;  5DCF A;  4RDU A;  1G59 A;  1X58 A;  1ZRE A;  1WZ2 A;  2KRC A;  4KUM A;  3ERE D;  2VXZ A;  1H88 C;  4RGS A;  3E7L A;  4W97 A;  2UZK A;  2E2H J;  1IDZ A;  5F04 A;  3O3K A;  3PUB A;  2DJI A;  4JOM A;  3M4O J;  4GRI A;  2FQ4 A;  2HZD A;  5EG0 B;  3I56 I;  3W3C A;  4HPQ A;  2K4B A;  2HU9 A;  4RM3 A;  3RPQ A;  3P5J A;  3OYK A;  1J75 A;  3W2V A;  2TRT A;  3TW6 A;  4J01 A;  2FOK A;  2GZW A;  4L5J A;  3M07 A;  5FGM A;  1HST A;  1HKQ A;  2LVS A;  1IW7 F;  1UMQ A;  5LRR A;  3HOY J;  1ETO A;  2VQG A;  1FMV A;  1VQ7 I;  4QIW N;  1CGP A;  2RN7 A;  3VYS B;  1FP1 D;  3L2V A;  1ZKG A;  4V2F A;  2LOO A;  3HJE A;  2ZB9 A;  1IRG A;  3H5A A;  2A6T A;  2R7T A;  2MA3 A;  4S0H B;  1HDD C;  2O8K A;  1ZTR A;  1JI8 A;  4HSR A;  5J1Y A;  1JHH A;  2DYR H;  3HOT A;  3LSI A;  3OR1 C;  1YJ9 I;  2M1B A;  1JT0 A;  1OR7 A;  3SHF A;  3V7R A;  3BC8 A;  2MSY A;  4JX4 A;  3KYL A;  2EFW A;  2FJ1 A;  3DKX A;  4IHX A;  3WU1 B;  1USS A;  5JFR A;  9ANT A;  3KX2 A;  1B72 B;  4F93 B;  1R1T A;  5IP7 J;  4AWX B;  2PG4 A;  5M5Y J;  1ZLJ A;  4C9Y A;  1XN7 A;  4B09 A;  2M4G A;  3BY6 A;  4WWC A;  2VKE A;  4FHT A;  1W36 D;  2R93 J;  4A5M A;  4YII A;  3OYN A;  3LSP A;  3OIQ A;  5AIP A;  4FIS A;  3OYA A;  3LST A;  3QU3 A;  4G7H F;  5E1Z B;  4CZC A;  1MMN A;  4ESJ A;  2QWW A;  4W1U A;  3Q0U A;  1VQ5 I;  1WSU A;  2PLY A;  4N9H A;  1WPK A;  3P9K A;  4BBR J;  1MW7 A;  2WAE A;  2VT2 A;  2L4M A;  4HQM A;  3VSL A;  4NBQ A;  1O57 A;  4A3F J;  1HW5 A;  4ESB A;  1Y6I A;  2F4M B;  2FD5 A;  2XRN A;  3DQV C;  3AG3 H;  5EYR A;  5IP6 A;  1W0T A;  4LG0 A;  1W7P B;  4IJA A;  4EM1 A;  2NNY A;  1BR2 A;  1G8X A;  5LGT A;  4D9J A;  4LB5 A;  4IQ4 A;  2ZJP F;  1KYZ A;  1FJL A;  1D5Y A;  5GAD J;  5KVR A;  1ORK A;  1ZQ3 P;  2DFH A;  1LFU P;  3OR2 C;  4Y15 A;  4HQE A;  1CF7 B;  3M8F A;  2EZK A;  3E3V A;  2V6E A;  4EV0 A;  2BY0 A;  2OUM A;  1XCV A;  3MKW B;  3FHZ A;  4RB2 C;  4R1H A;  1BI2 A;  5GAG J;  1IF1 A;  5IP9 J;  5JLW A;  4MGR A;  3RKX A;  2BGC A;  1HCR A;  1OMI A;  1FIP A;  3W2W A;  3RKQ A;  3EUK L;  4IRG A;  1IRZ A;  1XMX A;  2DTR A;  3G6E I;  3CMA I;  2M3A A;  4JK1 X;  4XOR A;  1VF9 A;  3IAM 2;  3V8J A;  2YU3 A;  3GVA A;  2EFO A;  1W5S A;  3LNQ A;  2FRH A;  2STT A;  3KYD B;  3BTJ A;  1JTX A;  3JRD A;  5FKL A;  2BOL A;  1L0O C;  1P4W A;  1XS9 A;  3M3Y J;  3RTR A;  2VB6 A;  5TJJ A;  2L7F P;  2JUC A;  2WAQ A;  2VE9 A;  3I58 A;  2G7H A;  4PJ0 C;  1OCZ H;  1T33 A;  2F48 A;  2QSH X;  1JJ6 C;  2F4O B;  1XSV A;  3M1E A;  1U3E M;  1SD5 A;  2JK3 A;  4AC0 A;  1MBG A;  2ZXJ A;  4IX7 A;  3I4N J;  1NTC A;  3O6B B;  3BR3 A;  1RES A;  3ZPL A;  2Y30 A;  1U8B A;  1HLV A;  1FT9 A;  1LFB A;  1ETK A;  2CFO A;  1DU6 A;  4Q47 A;  1E2X A;  1QZY A;  1X1P A;  2KJC A;  3H3U A;  4I09 A;  2P8T A;  4NUB A;  2V1U A;  2W84 A;  3ZMV A;  2M8E A;  3MVP A;  3OIO A;  3IP4 B;  2R7Z J;  2ZME C;  1GVJ A;  3CQZ J;  1XGM A;  2EIN H;  1E17 A;  1FNN A;  4IEJ A;  5HNF A;  4L5I A;  2V26 A;  3GTJ J;  5LEJ A;  5FLM J;  4YEL A;  4UUS A;  3W6J B;  2F2E A;  4C2U A;  1VFC A;  3ZQC A;  3FHN A;  4CCN A;  4XK4 A;  3HOW J;  3H36 A;  2WAF A;  4KN7 X;  1XPX A;  3I3L A;  1E3O C;  2GOX B;  2CRG A;  4OOI A;  1IRF A;  3JSO A;  4II3 A;  5FFZ A;  4RS8 A;  2L7K A;  2XHK A;  1LDK B;  2Y2Z A;  5DCM B;  4UVA A;  1EH6 A;  3E1S A;  2X4H A;  2CH0 A;  4A3D J;  2CUF A;  1FSE A;  1GUU A;  2KP6 A;  3S1M J;  3S1Q J;  4HRI A;  3A2K A;  3HSE A;  5EGO B;  3FX3 A;  2XRL A;  3NAU A;  3HSF A;  3HOS A;  1SFK A;  2M0C A;  3E97 A;  3FXM A;  2L9R A;  1ERD A;  3RKW A;  3KZZ A;  4BS9 A;  3JAM Z;  2PJR A;  4WCG A;  1KQ8 A;  4BGD A;  2P5V A;  3TP3 A;  3ZP5 A;  2HOA A;  1D3Y A;  2JA2 A;  2Z16 A;  1WH7 A;  3VFZ A;  5J8C A;  2E1C A;  4XMY A;  1B8I B;  3HOZ J;  3GTG J;  1BJZ A;  3EUH C;  1YO5 C;  2HDC A;  3MZH A;  1JKR C;  2LLK A;  2EV6 A;  2FOW A;  1TQI A;  2IA1 A;  4Y13 A;  1QPI A;  3A1Y A;  1LKX A;  1SD4 A;  3LWF A;  3PM1 A;  2R7W A;  3G1L A;  2W82 A;  1MBF A;  2LR8 A;  1IXC A;  3H0D A;  1WHU A;  2VQH A;  3DFG A;  3JRB A;  2X85 A;  1R4N B;  1XTA A;  2HVS A;  2PEX A;  4U87 A;  5F27 A;  2X0L A;  3PNT A;  2HXO A;  4KYW A;  2MW8 A;  3WTW C;  2ID3 A;  5BQT A;  2K9L A;  2QM3 A;  3DBH B;  3H92 A;  1QO0 D;  4A12 A;  1HA8 A;  1NHA A;  2VIX A;  2JQ7 A;  2RVC A;  3PIP F;  3G73 A;  3DPT A;  3HPG A;  2VI6 A;  5ICF A;  2K7L A;  2HDD A;  2UXN A;  2Z2S B;  3G2B A;  3PSF A;  1VQK I;  1FOW A;  2HTJ A;  4PSX A;  4HF0 A;  2K9S A;  4II2 A;  1PJR A;  2QQA A;  2X51 A;  4CCO A;  1OIS A;  2FNA A;  4Y7N J;  3IC7 A;  3QOP A;  3ZGK A;  1YW7 A;  3HB9 A;  4P96 A;  3KZY A;  5E3L A;  3SYT A;  2R5Z B;  2L5Q A;  4DIQ A;  4AIJ A;  2FF4 A;  4MQV A;  3BRO A;  1R5G A;  1X2N A;  3HOU J;  2L02 A;  1SVO A;  3GBG A;  1ETW A;  3EET A;  3LSK A;  2UXX A;  3R61 A;  3VB2 A;  2QQB A;  3COA C;  3FM3 A;  1L3L A;  2X1D A;  3TGN A;  5LGU A;  1R00 A;  3ECH A;  3WGI A;  3LL7 A;  1R7J A;  1AWC A;  3B6A A;  2D1V A;  3CD6 I;  3K2A A;  3NAR A;  1ZGW A;  4BXU A;  2WWY A;  4M73 A;  4Q5S F;  3KET A;  4BH9 A;  4LG3 A;  4HOB A;  3K4J A;  2N8G A;  3PNV A;  4PFO A;  1ITY A;  3K69 A;  3FIS A;  3K4N A;  4WXD A;  3FKJ A;  2ISZ A;  4M9X A;  4WF2 A;  1QBJ A;  2DPU A;  2E71 A;  3CJR B;  5E20 A;  2MD5 A;  1UHS A;  4AID A;  1UHM A;  3TKY A;  4ASN A;  3CME I;  2FUG 2;  4RMN A;  3CCS I;  1TBX A;  3SFI A;  1T08 B;  1SAN A;  1WQ2 A;  3MKZ A;  1AKH A;  1PUE E;  4B1R A;  3DCF A;  1ETX A;  5KCM A;  2EK5 A;  2VJ4 A;  2JJ7 A;  1AU7 A;  1HSJ A;  2DA3 A;  3IUO A;  2QKM B;  4ZDO A;  5CVV A;  5D5V B;  5HS9 A;  3HPH A;  3GWZ A;  2DFE A;  3P9C A;  4U0W A;  2EJR A;  4NDL A;  2E1M C;  2H94 A;  3HTU A;  2EH3 A;  3OWT A;  2MLG A;  1VZ0 A;  3OL3 A;  1TW2 A;  2HYG D;  4MO7 A;  3VYU B;  1YX5 A;  2ME6 A;  1J2X A;  1VQ4 I;  3SEZ A;  4HX4 A;  5HVQ C;  2BY3 A;  4UB6 C;  4M3G A;  5KAF C;  5JHU A;  2Y0M A;  2HVQ A;  1G6N A;  3ECO A;  1K6O A;  2IS6 A;  2AXT C;  4EJO A;  3FWE A;  1Z6R A;  3OS0 A;  3CCR I;  3DWL E;  2Q8K A;  2D45 A;  2VL8 A;  3K4C A;  2EV5 A;  3OYB A;  3L2U A;  2KPM A;  2JSP A;  1LB2 A;  5E3O A;  1X4O A;  2R7D A;  4XIC A;  2B63 J;  4HLY A;  1Q1H A;  5ILV A;  3KCC A;  3M7G A;  2LP0 A;  4KA4 A;  1ODD A;  4PJL A;  3S3M A;  2HOT A;  4D1Q A;  2BW3 B;  3F72 A;  2DLL A;  1TZL A;  2FBI A;  4PJN A;  2FE3 A;  3BTC A;  1W5T A;  2VPR A;  3E6B A;  1QA6 A;  1OJL A;  2L7Z A;  2XGE A;  2XAF A;  3U9G A;  5LBQ A;  3OYM A;  4A2U A;  2L01 A;  2W1O A;  5EF6 A;  2CSO A;  3H9Q A;  2FEZ A;  2EA4 A;  2M34 A;  1RNL A;  5CJ9 A;  4S04 A; 
#chains in the Genus database with same CATH homology
 3KP4 A;  1XGN A;  1DPU A;  1D5V A;  3BPX A;  2COM A;  1FZP B;  2EFN A;  3TDZ C;  3DV8 A;  2FQ3 A;  3RKY A;  1P2F A;  1K79 A;  2C6Y A;  4OIO F;  4XLP F;  3Q9V A;  3D5L A;  3WTV C;  3F6O A;  1BJA A;  2A07 F;  1ZYR F;  1ZG5 A;  4AIH A;  3DP7 A;  1U6G A;  4G94 A;  2HGC A;  2W57 A;  3U2R A;  1J0R A;  3FMS A;  1Z7U A;  3F3X A;  1IXR C;  1GXP A;  1KU2 A;  3J81 K;  1IZ1 A;  2UWM A;  1G4D A;  1ZHF A;  2KRF A;  3I5U A;  2CW0 F;  4I7H A;  2M87 A;  1ON1 A;  1S8N A;  2OQR A;  3MEX A;  1X3U A;  4CYD A;  2PJP A;  1W4M A;  4EJT A;  4EGY A;  3RJP A;  4HZF A;  4MHG A;  1IN6 A;  3TQN A;  5HLH A;  2Q0O A;  1JGS A;  3HYI A;  4GGG A;  2Y75 A;  5DV5 A;  4CXF A;  2VBZ A;  2PQ8 A;  4P5O A;  3GX4 X;  5L3D A;  1K78 A;  4WK8 F;  4RGU A;  3T0Y A;  3SQN A;  1PDN C;  4EQQ A;  2CYY A;  2ZO4 A;  1KGS A;  1SMT A;  2XAG A;  3F8N A;  3TO7 A;  5DUK A;  1S7O A;  2HS5 A;  2QVO A;  2DO7 A;  2LNB A;  3BJA A;  4TV7 A;  2EB7 A;  3B73 A;  4PCQ A;  3ELK A;  2CO5 A;  2FXA A;  1KU7 A;  1LEB A;  1MDM B;  1T38 A;  5HLI A;  3F23 A;  2GQQ A;  1FOK A;  2W25 A;  3DXJ F;  1R1U A;  2W24 A;  1ULY A;  2ZFW A;  4PDK A;  5L3F A;  2FML A;  1F4K A;  2E7X A;  1LDD A;  3E5X A;  1DP7 P;  2JPC A;  2LSO A;  1KU3 A;  3LFK A;  3IRR A;  1YLF A;  5JI6 A;  4LGW A;  2ZCW A;  1B4A A;  1V3F A;  3LQQ A;  2M30 A;  3KP3 A;  2BBY A;  5DCM A;  2DPD A;  2FA5 A;  4BYY A;  2MBF A;  3K1N A;  3WU0 A;  5LGN A;  4XSZ F;  2R3S A;  1F1Z A;  1FWZ A;  3HSR A;  1TNT A;  2JSC A;  4U7B A;  3JAM K;  1HBX G;  1U5T A;  2XVC A;  1FY7 A;  4IF4 A;  2JPB A;  2V1X A;  2OD5 A;  4I0B A;  1RZ4 A;  2IPQ X;  2ZME B;  2Z5U A;  1XGO A;  4NHJ A;  2D2W A;  2WV0 A;  3CUQ A;  5FFX A;  3RYR A;  2ISY A;  3HUG A;  4MEX F;  4UVC A;  4XSX F;  1YQA A;  4M71 A;  4KNY A;  2Y48 A;  4HA8 A;  4MTD A;  1LQ1 A;  3F22 A;  4HF2 A;  4L9T A;  3TO6 A;  1F9N A;  3GZ6 A;  2OU2 A;  2VC0 A;  2P7V B;  3J81 Z;  2FMY A;  3J80 Z;  3B02 A;  3HRT A;  1YTY A;  4IXA A;  3D0S A;  3BJO A;  1Z9C A;  3WTT C;  3GYH X;  3WE3 A;  3K1M A;  1LNW A;  4MQ9 F;  2DQL A;  1ZRC A;  1ZG3 A;  1T2K A;  3V7S A;  2A6E F;  4YG2 F;  4HAM A;  2R7F A;  2H27 A;  3GEZ A;  2IVM A;  4PZJ A;  4CIC A;  1Z6T A;  3BP8 A;  5L3C A;  1AOY A;  2Z3Y A;  1G3T A;  2NYX A;  3KEQ A;  3N4M A;  2GAU A;  3AAF A;  2VOP A;  1PP7 U;  3E5Q A;  2XIG A;  1IN8 A;  3WG9 A;  1GXQ A;  4IHT A;  5ERI A;  3N97 A;  4KIG A;  4L0Y B;  5D8K B;  2ETH A;  4MEY F;  3KP5 A;  1R22 A;  1ZG1 A;  3O2P E;  5E8G A;  1KU9 A;  1KQ0 A;  3KFW X;  2VT3 A;  4ZH4 F;  5D6F A;  2KJB A;  4RGR A;  2K02 A;  2XKP A;  2XUB A;  1DUX C;  3M8E A;  3L7W A;  1FYM A;  1DDN A;  3I0T A;  1T98 A;  1FYL A;  2M45 A;  3HHG A;  2VOO A;  2EFQ A;  3I59 B;  2RC4 A;  4AIK A;  2P5L C;  2XAQ A;  3ML6 A;  1YIO A;  2LF7 A;  2CG4 A;  1IN5 A;  3JW4 A;  4RB1 A;  1ZAR A;  4HDV A;  4LLN A;  5ILS A;  2HQN A;  1ZH5 A;  3M9A A;  1LEA A;  3ISP A;  1UB9 A;  3E6D A;  4E70 A;  4YFN F;  4GO1 A;  5HS8 A;  3VOE A;  2J5P A;  2V79 A;  4ETS A;  2YX7 A;  2LKP A;  2V1D A;  1QPM A;  1R58 A;  4L9V A;  3WOD F;  3HTS B;  1MJB A;  1WKM A;  5IT9 Z;  5HOO A;  1I1G A;  4M6X A;  2K4J A;  1WRJ A;  2NNN A;  2GA2 A;  3V4G A;  4P55 A;  2KIU A;  1STZ A;  4Q4Z F;  3IRQ A;  2ZJ2 A;  5D5U B;  3L09 A;  4R8H A;  1XD7 A;  3C18 A;  2QEN A;  1FPQ A;  4HW0 A;  1K7A A;  4LLL A;  2JZY A;  2PBI A;  2IP2 A;  2LDU A;  3KP7 A;  3KEO A;  2V6C A;  1OYW A;  4G7O F;  2PMH A;  4GCV A;  2DAO A;  1FP2 A;  1I6X A;  2RQP A;  4I02 A;  3T8T A;  1TLH B;  4HDU A;  3QU6 A;  1BI1 A;  4QLC U;  2Q2E A;  1T39 A;  4HV6 A;  3F8B A;  1HXD A;  3FMR A;  1MD0 A;  3MFK A;  1RI7 A;  1P4X A;  5BMZ A;  4AD9 A;  4M9Z A;  2E1N A;  1J9I A;  4RAZ A;  3HRS A;  4KIB A;  4LB6 B;  1BBY A;  2O0Y A;  1KYW A;  1XDS A;  3RIR A;  3EYI A;  1ZGJ A;  2RGV A;  2RV8 A;  3ZQ7 A;  2ZNY A;  3WE2 A;  1HW1 A;  4KT5 C;  4UHT A;  3BWG A;  2QBY A;  3IKV A;  1ZN2 A;  1I5Z A;  1IUY A;  1T0F A;  3C7J A;  2MLK A;  3V8K A;  2ZKZ A;  4ZZL A;  5K5Q A;  3BJ6 A;  3TDU C;  2IJL A;  3T5X A;  1HQC A;  1BIA A;  3F21 A;  4L9N A;  3C3W A;  5LLQ A;  1U2W A;  3I54 A;  3FXU A;  4LG0 B;  4A5N A;  2F5F A;  1O3S A;  3I4P A;  2EA2 A;  3LA7 A;  3K2Z A;  1FX7 A;  2HYF A;  2FBK A;  3SZT A;  4M9S A;  1FSH A;  3HIF A;  2YX4 A;  4HX8 A;  4KMU X;  2P5K A;  2RNJ A;  4YFK F;  4CHU A;  1WWX A;  2A61 A;  2EFP A;  2J5O A;  1BC7 C;  4EJW A;  1ZRD A;  1D8K A;  4KIF A;  3TOB A;  2B0L A;  2XKO A;  2RDP A;  1ONV A;  4LMY A;  4BHC A;  4UUV A;  3JTG A;  1SFU A;  1RIO H;  1LVA A;  4N9I A;  2HTS A;  1J7K A;  1T6S A;  3MQ0 A;  3KLN A;  1JXS A;  2PN6 A;  4MNU A;  3WTU C;  3HRU A;  4L0Z B;  1OYY A;  1U5T C;  1XGS A;  5KK1 A;  3NRV A;  4BHP A;  3LA2 A;  4I2O A;  4HF1 A;  1EV7 A;  4IRI A;  2DK8 A;  5DYM A;  1H9T A;  4F7Z A;  3FF5 A;  5ICE A;  1R1V A;  3IWZ A;  5F1R A;  3CUQ C;  2XAH A;  5H6R A;  3GW2 A;  2O61 A;  1W7P D;  2JT1 A;  3I64 A;  3ABU A;  3ZN1 A;  4PGG A;  5LHH A;  1SD7 A;  2NRA C;  3ZMS A;  1I1S A;  5FLX K;  1H9G A;  3LAP A;  4G8X A;  2O6G E;  2QZ8 A;  4BQA A;  1SMY F;  2EWN A;  1O3R A;  2OAZ A;  1YYV A;  4FT8 A;  3J80 K;  5E1X A;  4XLN F;  1LDJ A;  3WTX C;  3L2C A;  4CO8 A;  2RKH A;  5DEQ A;  3LQR A;  5F64 A;  1BI3 A;  1W7P A;  4UXN A;  3CO7 C;  2K27 A;  4A0Z A;  1REP C;  4GYG A;  2ZBK A;  1QZZ A;  4ZZD A;  4M74 A;  3BOQ A;  1CF7 A;  5CVJ A;  1HKS A;  3MAJ A;  5LHI A;  3F8C A;  3K1P A;  2GA1 A;  5CVU A;  2HFH A;  2ADU A;  4DNC A;  3J7A O;  1J5Y A;  1QNT A;  1TNS A;  3DPL C;  1XSX A;  4UV9 A;  1D8J A;  2YPR A;  3PQK A;  5LRS A;  2XAJ A;  3GFL A;  2XRO A;  3VEP A;  3OOP A;  1UCR A;  2ZNZ A;  3KLO A;  4EM2 A;  1KQ9 A;  2IT0 A;  3GZ5 A;  1YS7 A;  4ON0 A;  5D8L B;  5D5W B;  2V9V A;  1SAX A;  4LJZ F;  3E6M A;  2HZT A;  3P7N A;  3JTH A;  4Z2Y A;  3K9T A;  3I59 A;  3I71 A;  3L00 A;  4MTE A;  4FX0 A;  1JE8 A;  4UV8 A;  2G9W A;  2QLZ A;  4M6Y A;  2KKO A;  5FD5 A;  2CGP A;  3FZV A;  2YSR A;  2DBB A;  3TOA A;  1ZAO A;  5H6Q A;  3K0L A;  3OV8 A;  3DEU A;  2KIM A;  2DI3 A;  1UST A;  4RGX A;  1O3T A;  3R0J A;  3QRF F;  4ZYD A;  4XBF A;  5F6F A;  3ZMU A;  4OMY A;  4U0Y A;  1TQM A;  4QWQ A;  4O3M A;  3H3Z A;  4EM0 B;  2QQ9 A;  5IT9 K;  5E18 F;  1BIB A;  2K86 A;  1B6A A;  1O7L A;  1O3Q A;  1WI9 A;  3GXO A;  2P6S A;  3L9F A;  1HKT A;  4D0P A;  5CVR A;  1A04 A;  4ENK A;  3QP5 A;  4XRF A;  3SFZ A;  5AON A;  2ESH A;  3BDD A;  5HS7 A;  3GFJ A;  3P9I A;  2A69 F;  1QQI A;  3WTZ A;  3KP6 A;  4I0A A;  3Q9S A;  3WGH A;  4JBA A;  3FXR A;  2M5W A;  3MWM A;  5FLX Z;  3V8L A;  1ON2 A;  4WXC A;  2L4A A;  5LEK A;  1SFE A;  4LFU A;  1OPC A;  1SFX A;  3QPH A;  1IN4 A;  2P4W A;  2YR2 A;  4HBL A;  2DK5 A;  1VTN C;  3CO6 C;  3SXY A;  4EGZ A;  4HYE A;  2A3S A;  5JVT A;  3QAH A;  4OIN F;  3RDI A;  5AIQ A;  3R0A A;  3W6K B;  5HDN A;  3NEU A;  2DT5 A;  3EDP A;  4WXH A;  4L18 B;  2VBY A;  2MH9 A;  2XAS A;  1B59 A;  4IRH A;  4CZZ A;  3ZMT A;  1MJA A;  3R6S A;  3HHH A;  3JSP A;  4RAY A;  4N0B A;  1RUN A;  3QPT A;  5A2Q K;  1FLI A;  2MH2 A;  3DF8 A;  2A6H F;  1TQP A;  3F8F A;  2KIF A;  5FD6 A;  1KA8 A;  1EH8 A;  4A0Y A;  3IL2 A;  4BAY A;  3CDH A;  3I53 A;  5IT3 A;  4KIC A;  3GF2 A;  2ELH A;  2OBP A;  2VOD A;  1YW9 A;  3R60 A;  5BPD A;  3REO A;  4BHB A;  1K78 B;  1FBS A;  3RPU A;  1FBQ A;  4YIF A;  1Z91 A;  2PFB A;  2P7C B;  2BV6 A;  3QP6 A;  1BM9 A;  3PQJ A;  3ZN0 A;  5EEH A;  1ZGA A;  4EJU A;  4O5V A;  1PP8 F;  3VOD A;  2QYO A;  4Q48 A;  2IW5 A;  2WTE A;  1IXS B;  3LA3 A;  2DFI A;  1YG2 A;  3RI4 A;  4S05 A;  3E6C C;  2CQK A;  2G7U A;  4FX4 A;  1V4R A;  4IPA A;  3WTY C;  3CLO A;  5ICC A;  5HDG A;  1BN5 A;  3SZP A;  4PGH A;  2GIV A;  4R79 A;  1BC8 C;  4HV5 A;  3ULQ B;  2HWV A;  3GO5 A;  5EEG A;  4UVB A;  4OIP F;  5K1Y A;  4HLX A;  1DPR A;  4WX9 A;  2STW A;  4EVI A;  2FBH A;  5TRD A;  5ILU A;  2LF8 A;  2OA4 A;  4ESF A;  4P9U A;  4ZYG A;  4G6Q A;  3EQL F;  3R4K A;  2FU4 A;  3S2W A;  1MJ9 A;  3GFM A;  1U5T B;  3IHU A;  5L3E A;  4KFC A;  3V7C A;  4ZYE A;  4OMZ A;  1Z05 A;  1U8R A;  3CJN A;  4B8X A;  4EJV A;  5L3G A;  3CUQ B;  2F5C A;  2D1H A;  3PFI A;  4RB0 A;  1XCB A;  1OYI A;  4KN4 X;  3LAJ A;  1BI0 A;  1Y0U A;  2HEO A;  2VE8 A;  2GXB A;  5K5O A;  3WTS C;  2A5Y B;  4JQF A;  1YW8 A;  5DD8 A;  1XMK A;  5DDG A;  1TTY A;  2XGX A;  3IKT A;  1R23 A;  3FXQ A;  4IHS A;  1FBU A;  1Z1D A;  3TO9 A;  5BPI A;  3G3Z A;  5D4R A;  2FSW A;  5E17 F;  2NS0 A;  2VN2 A;  1I27 A;  3FMQ A;  4ENM A;  2HQR A;  1B9M A;  1S3J A;  3MZY A;  4A6D A;  2DW4 A;  5A2Q Z;  1XDU A;  4KMF A;  1OKR A;  4GXO A;  1S7A A;  4M72 A;  2BYV E;  1IAW A;  1XSD A;  5HLG A;  2L3D A;  3U1D A;  3F6V A;  4GYI A;  2VON A;  1MDM A;  4CDG A;  3GFI A;  2BEO A;  2OZ6 A;  4LLG F;  4EMS A;  4AVP A;  1MZB A;  3CUO A;  4G6D A;  2BE5 F;  3EYY A;  3T1B A;  2AS5 F;  5FB2 A;  2IRF G;  2WC2 A;  3HRM A;  2EV0 A;  5CVI A;  3ZMD A;  2O8X A;  3MCZ A;  3RYP A;  1B9N A;  5K5R A;  4LD5 A;  4OU0 A;  2F5D A;  5CJ9 A;  4BNC A;  1ZRF A;  2AXL A;  1H0M A;  2ZME A;  2Z99 A;  4ENJ A;  3KP2 A;  1QGP A;  1FYK A;  2O3F A;  4ZYH A;  1LJ9 A;  5CLS A;  1MKM A;  5H20 A;  2H6C A;  5HDK A;  3NQO A;  2P6T A;  4K2E A;  3T8R A;  2HR3 A;  1O7F A;  1XB4 A;  4I01 A;  5BS6 A;  1GHC A;  4G9Y A;  1HW2 A;  4OIQ F;  2QUF A;  3DKW A;  1S29 A;  4NQW A;  1P6R A;  2JRT A;  2O03 A;  2VBX A;  4G7Z F;  4U0V A;  2FNP A;  4U88 A;  4DQ2 A;  3BPV A;  2OZU A;  4UNO A;  3ABT A;  5BOX A;  1B1B A;  3EUH A;  1S6L A;  2VBW A;  2Z33 A;  5CYV A;  1G3S A;  2CFX A;  1P92 A;  2DU9 A;  5ICG A;  4I98 B;  1BOA A;  2DQR A;  5LHG A;  2ESN A;  2HOE A;  4H0E A;  5E1W A;  1ZLK A;  2W85 A;  4L9J A;  5FO5 A;  2IA2 A;  5DUI A;  4YFX F;  4A6E A;  3F8M A;  1U78 A;  3ROU A;  2CWE A;  2OQG A;  4A0X A;  2PI0 A;  1UFM A;  3FM5 A;  3GUD A;  5DD4 A;  3BZ6 A;  2ACJ A;  3WGG A;  1YFH A;  4LK0 F;  1YS6 A;  3C1D A;  5D6E A;  2TDX A;  2Z9O A;  1P4A A;  1IN7 A;  5L3B A;  4IVN A;  3CTA A;  4NB5 A;  1R36 A;  3Q5F A;  2QBY B;  2GWR A;  4Y17 A;  4CGZ A;  1XMA A;  5J6X A;  4KDP A;  5J8F A;  3ZMZ A;  1RUO A;  1MGT A;  4OIR F;  1F5T A;  3E5U A;  1TW3 A;  2H6B A;  1EH7 A;  1G3W A;  4LK1 F;  1SD6 A;  1R5H A;  2NAZ A;  1UHW A;  2HKX A;  1J59 A;  5D4S A;  5E8I A;  2F5E A;  2HKO A;  2L54 A;  2MC3 A;  5ED4 A;  2IA0 A;  4P9F A;  4U7D A;  3GLX A;  6PAX A;  2GXG A;  2PMU A;  1C0W A;  4O6J A;  1FC3 A;  2VC1 A;  3KE2 A;  2JTV A;  3IWF A;  2H09 A;  2XV4 S;  2E7W A;  1G3Y A;  5JR3 A;  1JHF A;  2A68 F;  4ENN A;  4RB3 C;  4HX7 A;  5DCF A;  1ZRE A;  4KUM A;  3ERE D;  2VXZ A;  4RGS A;  2UZK A;  3O3K A;  2K4B A;  3RPQ A;  1J75 A;  2FOK A;  2GZW A;  4L5J A;  5FGM A;  1HST A;  1HKQ A;  1IW7 F;  5LRR A;  1CGP A;  2RN7 A;  1FP1 D;  1IRG A;  2MA3 A;  1JHH A;  3HOT A;  2M1B A;  1OR7 A;  3SHF A;  3V7R A;  2EFW A;  3WU1 B;  1USS A;  5JFR A;  1R1T A;  4AWX B;  2PG4 A;  1ZLJ A;  1XN7 A;  4B09 A;  3BY6 A;  4WWC A;  4FHT A;  4A5M A;  4YII A;  5AIP A;  4G7H F;  3LST A;  3QU3 A;  5E1Z B;  4ESJ A;  2QWW A;  1WSU A;  2PLY A;  4N9H A;  3P9K A;  2VT2 A;  2L4M A;  4HQM A;  1O57 A;  1HW5 A;  4ESB A;  3DQV C;  2XRN A;  4LG0 A;  1W7P B;  4IJA A;  4EM1 A;  2NNY A;  5LGT A;  4LB5 A;  1KYZ A;  5KVR A;  4Y15 A;  4HQE A;  1CF7 B;  3M8F A;  3E3V A;  4EV0 A;  1XCV A;  3FHZ A;  4RB2 C;  4R1H A;  1BI2 A;  1IF1 A;  4MGR A;  3RKX A;  2BGC A;  1OMI A;  4IRG A;  2DTR A;  4JK1 X;  3V8J A;  2YU3 A;  3GVA A;  2EFO A;  1W5S A;  2FRH A;  2STT A;  1L0O C;  1P4W A;  3RTR A;  5TJJ A;  2VE9 A;  3I58 A;  2G7H A;  1XSV A;  3M1E A;  1U3E M;  1SD5 A;  2ZXJ A;  3O6B B;  3ZPL A;  1FT9 A;  4Q47 A;  1E2X A;  1QZY A;  2KJC A;  3H3U A;  4I09 A;  2P8T A;  2V1U A;  2W84 A;  3ZMV A;  2M8E A;  1GVJ A;  1XGM A;  1E17 A;  1FNN A;  4L5I A;  5LEJ A;  3W6J B;  2F2E A;  4KN7 X;  4OOI A;  1IRF A;  3JSO A;  5FFZ A;  4RS8 A;  2XHK A;  1LDK B;  5DCM B;  4UVA A;  1EH6 A;  2X4H A;  1FSE A;  3HSE A;  3FX3 A;  3HSF A;  3HOS A;  3E97 A;  3RKW A;  3KZZ A;  3JAM Z;  4WCG A;  1KQ8 A;  2P5V A;  3ZP5 A;  1D3Y A;  3VFZ A;  5J8C A;  2E1C A;  1YO5 C;  2HDC A;  3MZH A;  2EV6 A;  2IA1 A;  1TQI A;  4Y13 A;  1SD4 A;  3LWF A;  1IXC A;  3DFG A;  2PEX A;  2X0L A;  4KYW A;  3WTW C;  5BQT A;  2QM3 A;  3H92 A;  1QO0 D;  4A12 A;  1NHA A;  2RVC A;  3G73 A;  3DPT A;  5ICF A;  2K7L A;  2UXN A;  2HTJ A;  4HF0 A;  2QQA A;  2FNA A;  3IC7 A;  3QOP A;  1YW7 A;  4P96 A;  3KZY A;  4AIJ A;  2FF4 A;  4MQV A;  3BRO A;  1R5G A;  2L02 A;  3EET A;  2UXX A;  3R61 A;  3VB2 A;  2QQB A;  3COA C;  3FM3 A;  1L3L A;  3TGN A;  5LGU A;  1R00 A;  3ECH A;  3WGI A;  1R7J A;  1AWC A;  2D1V A;  4BXU A;  2WWY A;  4M73 A;  4Q5S F;  3KET A;  4BH9 A;  4HOB A;  3K69 A;  4WXD A;  2ISZ A;  4M9X A;  4WF2 A;  1QBJ A;  2DPU A;  5E20 A;  2MD5 A;  1UHM A;  3TKY A;  4ASN A;  1TBX A;  1WQ2 A;  1PUE E;  2EK5 A;  1HSJ A;  5CVV A;  5D5V B;  5HS9 A;  3GWZ A;  3P9C A;  4U0W A;  2EJR A;  2H94 A;  3HTU A;  2MLG A;  1TW2 A;  2HYG D;  1J2X A;  4HX4 A;  5HVQ C;  5JHU A;  2Y0M A;  1G6N A;  3ECO A;  1K6O A;  4EJO A;  3FWE A;  1Z6R A;  2Q8K A;  2D45 A;  2EV5 A;  1LB2 A;  2R7D A;  4HLY A;  1Q1H A;  5ILV A;  3KCC A;  3M7G A;  4KA4 A;  1ODD A;  3F72 A;  2DLL A;  2FBI A;  2FE3 A;  1W5T A;  3E6B A;  2XAF A;  3U9G A;  5LBQ A;  4A2U A;  2L01 A;  2CSO A;  2FEZ A;  2EA4 A;  1RNL A;  5D5X B;  4S04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...