4AIHA

Crystal structure of rova from yersinia in its free form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
142
structure length
139
Chain Sequence
b'ESTLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transcription
total genus 50
structure length 139
sequence length 142
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aihA00
4OIOF 1ZHFA 2TDXA 2PQ8A 1IRGA 3CUOA 2A69F 2DU9A 5A2QK 4M6YA 1XGSA 5L3DA 1RIOH 5AONA 1S3JA 2EV6A 2O8XA 2V1XA 2NNYA 2G7HA 3K1MA 4BYYA 2GA2A 1K6OA 3RKYA 1T2KA 5DCFA 3V7CA 3QOPA 1L0OC 3SQNA 4XSZF 4EGYA 1YIOA 3J80K 4O6JA 4AIJA 1FC3A 2JT1A 1ON2A 3T5XA 3E6BA 4ZYGA 3K69A 4P5OA 2BGCA 2RN7A 3GZ6A 2R3SA 4KDPA 4P96A 2K86A 1TNSA 2EV5A 1BJAA 1BI0A 2XAHA 3GEZA 4EJTA 2EA2A 1U8RA 1WKMA 4GCVA 2KKOA 2W84A 4UNOA 1SFXA 2HQNA 4E70A 4ESBA 3U9GA 1KQ8A 3TQNA 3RTRA 2JRTA 1CF7A 3CUQC 4MTDA 2KRFA 2NRAC 1USSA 1K78B 2EJRA 5FLXZ 3K0LA 5D6EA 3R6SA 4RAZA 1XDSA 1IUYA 3LFKA 2E7WA 3GWZA 2G9WA 1UCRA 3V8JA 4PGHA 3GX4X 3I4PA 4XSXF 1ON1A 2QZ8A 3ELKA 2LKPA 5E18F 2P4WA 4ESJA 5H20A 5D5UB 4I0AA 2UWMA 3RDIA 1O3TA 1S29A 4WXDA 3GZ5A 3E6DA 2VXZA 2CSOA 3EYIA 1D8JA 4L0YB 4BH9A 2F2EA 2FA5A 3F8NA 1T98A 5ICCA 1HXDA 1KYWA 4L5IA 5ICGA 3OV8A 4Y15A 2M87A 2QQAA 3SZPA 1IW7F 3T8RA 4KIBA 5LRRA 1FSHA 4QWQA 3ML6A 2DLLA 1GVJA 3KETA 3LWFA 2XV4S 5LHGA 1HQCA 4M6XA 3KLOA 1VTNC 4GO1A 1IXRC 1FZPB 3QRFF 5TRDA 3MFKA 4QLCU 1FX7A 5FD5A 1UHWA 4ON0A 1HKQA 1KGSA 4HDVA 4L0ZB 3QAHA 4LG0B 4RB2C 3NEUA 1IRFA 1SAXA 4OIQF 3REOA 5IT9Z 2EFNA 2K02A 2GA1A 3G73A 3QP5A 4EQQA 4RGXA 3KZYA 1QNTA 3VFZA 5HOOA 3Q9SA 3J7AO 4ENJA 1YW7A 4UVAA 1G6NA 4MNUA 1W7PA 1R58A 2ADUA 2Y48A 2FMYA 1HBXG 2RQPA 3ZMZA 5E17F 1Z9CA 2RGVA 4KN4X 3TKYA 1CF7B 3IWFA 5D4RA 1QO0D 3RPQA 4A0XA 4MEXF 2UZKA 4UVCA 5FD6A 4N0BA 1J59A 5D8LB 3HHGA 3C7JA 6PAXA 1KQ0A 2OD5A 1IN5A 5FO5A 4Q47A 3C18A 1YQAA 5AIQA 2CG4A 1LEAA 5LBQA 1DPUA 1G3WA 1NHAA 5CLSA 3L00A 1ONVA 2ISYA 4EJOA 3SZTA 3HRMA 1I5ZA 4M74A 3ZMTA 5ILVA 3OOPA 2V1DA 3GXOA 5E1WA 2ELHA 5DUIA 3N97A 2VT2A 5L3FA 4RB0A 1OKRA 4MGRA 3BPVA 2A5YB 1YLFA 2X4HA 1GXPA 4PGGA 4LB5A 5FB2A 4K2EA 1XCBA 3J81K 1F4KA 4M71A 3WGGA 3WTZA 4TV7A 2J5OA 4ENKA 2IA0A 2QUFA 1XGMA 4DNCA 3DV8A 3P9IA 4HX7A 1FSEA 1QQIA 3HRTA 4HQEA 2KJBA 4XBFA 1HW2A 3C1DA 1T0FA 5HS9A 1HW1A 2PN6A 2XRNA 3I5UA 3WTUC 2ACJA 3FMQA 3P7NA 1HW5A 2NYXA 1P6RA 5LRSA 1O7FA 1R23A 3O6BB 2KIUA 5TJJA 1Y0UA 4LK0F 2ZKZA 2EA4A 3V7RA 2ZMEB 1XDUA 4CXFA 5KVRA 1PP8F 1YW8A 4EGZA 2MC3A 2FE3A 1TNTA 3WTTC 4U88A 4KN7X 1PDNC 2PG4A 1MJBA 1XD7A 2YSRA 1O57A 3I54A 3P9CA 4MEYF 1QBJA 2DT5A 4MQ9F 4LK1F 2QQ9A 3EDPA 3F3XA 3DEUA 5HLIA 1DDNA 5L3CA 1LDJA 4A5MA 4AD9A 4RGUA 4KYWA 3FHZA 2A61A 2FF4A 2MD5A 4JK1X 2XUBA 3F72A 3ECHA 3BROA 1ULYA 3LQRA 5E8IA 4YFXF 2LF8A 4L9TA 2EB7A 1OYIA 2NAZA 3MZYA 4Y13A 2D1HA 5ICEA 4RS8A 1Z6TA 2EWNA 1SFEA 4S04A 4L18B 4M73A 3FXQA 2QM3A 2NNNA 3FMRA 2K4BA 3KZZA 2W25A 4HAMA 1IXCA 1B6AA 2BEOA 1BIAA 3E5XA 2STWA 3FM5A 5FFXA 1F5TA 1BC7C 1FOKA 2WC2A 3VODA 3ZQ7A 1S6LA 4HOBA 4YFNF 4OMYA 3WU0A 4IRHA 1LQ1A 3BOQA 5LEJA 2IA1A 2MH9A 3K1NA 1ZH5A 1WI9A 2O6GE 4O3MA 1FBUA 1YW9A 1ZLKA 3EQLF 4L9VA 1R1VA 1P4AA 2PEXA 2P8TA 2UXXA 4FX4A 2AXLA 2ESNA 1I6XA 1U5TA 2E1CA 4G8XA 1W4MA 3U2RA 4LB6B 1UB9A 1SMTA 2P5LC 1FYMA 2F5DA 3J80Z 3SFZA 1LB2A 2YR2A 1O3RA 3QPHA 2JZYA 2DPDA 3FWEA 3ABTA 1Q1HA 2HQRA 1W5TA 4YFKF 5DCMA 1XMAA 4FHTA 1GHCA 4WXHA 5DEQA 3TO6A 4GXOA 2FXAA 5F64A 1P2FA 4EJWA 5F1RA 2D2WA 1KU7A 2RV8A 3F8FA 4LLGF 2WWYA 2XAGA 2K4JA 2V6CA 3DPTA 4MTEA 5CJ9A 3HIFA 5LGTA 1OPCA 2FBKA 4HYEA 1BI3A 5HLGA 5JFRA 2Z3YA 3GVAA 1ZG1A 1R22A 2R7FA 2W24A 3GF2A 4EJVA 4RGRA 3IKTA 1BM9A 2DPUA 1RUOA 1YYVA 3DPLC 2P5VA 2L4AA 4HF1A 1U5TC 1U2WA 3TDZC 2FEZA 2HS5A 2IP2A 2YX4A 4A12A 3NQOA 2COMA 4UVBA 4ZYHA 5ED4A 2XVCA 4KUMA 4XRFA 1B59A 1IF1A 1HSJA 3PFIA 5JR3A 1B1BA 3I0TA 3TO9A 5D5WB 3VOEA 2H6CA 4IVNA 2HGCA 4BHCA 4KIFA 4P9FA 2O61A 3FMSA 3WE3A 4WX9A 5BQTA 4HQMA 3VB2A 1UFMA 3RI4A 3I58A 1V4RA 1Z6RA 2IRFG 1AWCA 2QBYB 4GGGA 1ZRCA 5E8GA 3ECOA 2M45A 4KFCA 1P4XA 1KYZA 2OAZA 3SHFA 4HX4A 2YPRA 5CVUA 2CFXA 1OMIA 4LJZF 2IVMA 1T38A 3F8BA 2QENA 3CUQB 1H9TA 5BS6A 5D6FA 3FM3A 1KU3A 1IZ1A 1BI1A 2ZNYA 3S2WA 2GWRA 3COAC 4BHBA 3HRSA 3EETA 5DCMB 4IPAA 1RZ4A 2EFPA 1MJAA 4HF0A 2F5EA 1S7OA 4BHPA 2VODA 4I09A 3BY6A 4GYIA 1D5VA 3KLNA 3ZN0A 3CTAA 2HKOA 2FRHA 5BPIA 1FPQA 5DDGA 2XGXA 2VN2A 3ZPLA 2LNBA 3F8MA 2EV0A 3RPUA 3CO7C 2STTA 2DBBA 2Z33A 2PBIA 3HTUA 3KP7A 2KIFA 3KP3A 3I53A 2L01A 2OQGA 4XLPF 3MQ0A 2JSCA 4UXNA 4P55A 3W6KB 1JHHA 1LJ9A 4CICA 3L09A 2GXBA 1XMKA 4XLNF 2YU3A 2QLZA 3DQVC 2XROA 3B02A 5CVRA 2EFQA 2B0LA 3ZP5A 4ZYDA 5DD4A 3F22A 3IRRA 3KP5A 3KCCA 1HKTA 3BP8A 1FWZA 4Y17A 1UHMA 2FOKA 3IHUA 4OIPF 4CYDA 1FT9A 4EV0A 2DO7A 3LSTA 3J81Z 1USTA 1MDMA 1K7AA 3KEOA 3TOBA 1IN7A 1RI7A 1SD4A 3RYRA 1IXSB 1I1GA 4A5NA 1XSVA 2LF7A 1RUNA 3I59A 3M1EA 3FXUA 3JAMK 3GUDA 3VEPA 5JI6A 4AIKA 2PMUA 1B9NA 3WTVC 5JVTA 4I0BA 4G94A 2IJLA 1TLHB 5BMZA 2KJCA 3KP6A 4R8HA 4CZZA 4LD5A 2P7VB 3WU1B 4B8XA 1J2XA 2DFIA 1XSXA 1ZRFA 5EEHA 3WGHA 1H9GA 2ZJ2A 2OBPA 1FYLA 3GFJA 1P4WA 4BXUA 2V1UA 2QWWA 3ISPA 4UUVA 2RNJA 3HHHA 2HEOA 1Z7UA 2HDCA 4G7ZF 2XASA 1KU9A 1R36A 4HZFA 1DUXC 5HS7A 2OU2A 3Q5FA 2VC0A 5LHIA 5CVIA 3GYHX 1RNLA 4A0ZA 3M8FA 3O2PE 3QP6A 4WXCA 1Z05A 3ZMSA 4LGWA 4KT5C 2MH2A 5EEGA 5H6QA 4L5JA 2FNAA 4I2OA 1SFUA 3KFWX 3BJAA 3MEXA 1Z1DA 2M8EA 4HF2A 1G4DA 4O5VA 1YFHA 5ILSA 2HFHA 2VE9A 4AVPA 1W7PB 3BWGA 3KEQA 3ULQB 3ZMVA 1O3SA 4EMSA 3IRQA 2L54A 4N9IA 3V8KA 3L7WA 1JGSA 3MCZA 2OZUA 1IN6A 4HV6A 5J6XA 3RKWA 3WTSC 1STZA 2YX7A 3ZN1A 1TW3A 2ZO4A 2VT3A 3L9FA 3FZVA 1O3QA 3RIRA 1C0WA 2A6HF 4IHTA 4IF4A 2HTJA 4U0WA 1IN8A 4OOIA 4KICA 3H3ZA 1J75A 4HBLA 1EH6A 2IPQX 1LEBA 4M72A 3KP2A 1U6GA 3WG9A 1QZZA 2HYFA 2IW5A 4EM2A 3N4MA 4KIGA 2P6SA 3IC7A 2PI0A 5K5OA 1TQIA 3W6JB 2Y75A 2OA4A 3BPXA 2NS0A 1WQ2A 3RJPA 1OYWA 2E7XA 2VOOA 2Y0MA 1LNWA 2X0LA 2PFBA 2R7DA 2VOPA 2VC1A 1WWXA 3HYIA 4LLNA 5E1ZB 2O03A 1ZREA 4G7HF 1XCVA 1ZARA 2ZFWA 2KIMA 2BE5F 1K78A 2L4MA 4HA8A 1G3SA 4R1HA 3GFMA 2MBFA 2WTEA 2HYGD 5A2QZ 4NQWA 1H0MA 3TDUC 3E5UA 3WE2A 1JHFA 2P7CB 2PLYA 3T8TA 4WK8F 2P6TA 2BYVE 2XIGA 2H94A 3C3WA 4PCQA 1KU2A 2RC4A 1FYKA 1ZG3A 2L02A 2QVOA 5JHUA 1ZLJA 3G3ZA 1TQPA 5HS8A 1DP7P 1LVAA 3HSEA 1XGOA 3HUGA 3JSOA 1TQMA 1PP7U 1J0RA 1W5SA 3LAJA 2V9VA 2IA2A 4PDKA 4ZZLA 2BV6A 3HSRA 4LMYA 1R1UA 2JPCA 4ZH4F 4OINF 2H27A 1MJ9A 2A68F 1YS7A 5D4SA 2D45A 4BNCA 2K7LA 2GQQA 4WF2A 2ZXJA 3FXRA 3E6MA 4ASNA 1GXQA 1WSUA 4IRGA 1F9NA 5DV5A 1U78A 2OQRA 2Z9OA 2Z5UA 4I98B 1J7KA 4UV8A 3GFLA 1FLIA 2F5FA 1YS6A 4G6QA 3PQKA 2ISZA 2XAFA 1KA8A 3FF5A 4IJAA 3T0YA 4KA4A 4YG2F 1ZG5A 3IWZA 1R00A 2LDUA 4U7BA 4LG0A 4A0YA 5E1XA 3B73A 1W7PD 2DTRA 5H6RA 1YO5C 3JTGA 3R61A 3V8LA 4FT8A 1A04A 2M1BA 1BN5A 1E2XA 5L3GA 5D5VB 4ZYEA 2HOEA 2GIVA 3E5QA 1FY7A 4HV5A 4ETSA 1O7LA 1HSTA 5K5QA 2DK8A 1E17A 3T1BA 3HTSB 3JTHA 1IAWA 5K5RA 2XHKA 2DW4A 4OIRF 2Q8KA 5LGUA 2PJPA 2M30A 3I71A 1BI2A 1G3TA 1EH8A 1U5TB 3MWMA 2DI3A 3ZMUA 1K79A 4I02A 3NRVA 5DYMA 1QGPA 1R5HA 5CVVA 5AIPA 1JXSA 1R7JA 3WTYC 4CDGA 4H0EA 3ERED 3CO6C 5ERIA 1T39A 1X3UA 1YTYA 5LEKA 3HOSA 4CHUA 2VBZA 1R1TA 4EJUA 1ODDA 2CO5A 3HRUA 1I27A 5DUKA 1G3YA 2EK5A 5FLXK 2K27A 5F6FA 2VBWA 2GXGA 4NHJA 1BOAA 4U7DA 3F23A 4HW0A 1HKSA 4GYGA 4PZJA 2CW0F 2EFOA 3GW2A 1BBYA 2O0YA 2W85A 4UHTA 4Q4ZF 4KNYA 3BDDA 2OZ6A 4AIHA 4RGSA 4A6DA 2F5CA 3KE2A 2XAJA 5ICFA 3H3UA 2A3SA 3V7SA 3DFGA 3WGIA 4YIFA 5HLHA 4WCGA 2CWEA 2VONA 4RB1A 1BC8C 4JQFA 2RKHA 2FBHA 2G7UA 1B9MA 2ZMEA 2FMLA 2DQRA 5L3BA 4ENNA 2HR3A 2CYYA 5D8KB 3HSFA 4EVIA 3GLXA 3V4GA 1L3LA 1JE8A 1J9IA 2A6EF 3QU3A 3JAMZ 3O3KA 3E6CC 1FP1D 4I7HA 3LA7A 4MQVA 4BAYA 1ZN2A 1TW2A 1CGPA 4I01A 2ZNZA 3ZMDA 2D1VA 2P5KA 4MHGA 3WODF 5IT9K 1SD7A 3D0SA 3EUHA 5IT3A 4CO8A 3DP7A 1J5YA 1EV7A 1SD5A 1P92A 2VBYA 2A07F 1KQ9A 2RDPA 2O3FA 3DKWA 4G6DA 4B09A 3BZ6A 4P9UA 4S05A 2FU4A 1DPRA 1S7AA 4G9YA 2FQ3A 4N9HA 4G7OF 1OYYA 5HDGA 1PUEE 4DQ2A 3JW4A 3IKVA 4L9JA 3HOTA 5E20A 5J8CA 2HZTA 1ZGJA 5CYVA 3MZHA 1T6SA 1MZBA 3ABUA 5CVJA 5ILUA 5FGMA 5BPDA 4BQAA 1TTYA 4OU0A 2HKXA 3K2ZA 2H6BA 4IHSA 1R5GA 4OMZA 2EFWA 4EM0B 1IN4A 1AOYA 3RYPA 3WTXC 2W57A 2ZBKA 4D0PA 3LQQA 1U3EM 3D5LA 2M5WA 1YG2A 2PMHA 5LHHA 3I64A 3RKXA 4YIIA 1V3FA 3F21A 4HLYA 4M9ZA 1FP2A 2BBYA 1ZYRF 3QPTA 5DD8A 2LSOA 4M9XA 2QQBA 3CLOA 1OR7A 1XN7A 2GAUA 3E3VA 3R0JA 1XSDA 1Z91A 2DK5A 3WTWC 2IT0A 3EYYA 2JTVA 2MA3A 5BOXA 2XKPA 5HVQC 2ESHA 1FNNA 3K9TA 3GFIA 2DAOA 3E97A 2CQKA 3LA3A 5KK1A 2H09A 3U1DA 2FSWA 4IRIA 2AS5F 1SMYF 4F7ZA 1FBQA 3R60A 4LLLA 2HTSA 4AWXB 1LDKB 5J8FA 3BJOA 1ZGAA 1MDMB 3P9KA 4KMFA 1S8NA 1MGTA 3JSPA 1MKMA 4M9SA 4Q48A 1I1SA 1EH7A 5K1YA 3MAJA 1LDDA 2QYOA 1WRJA 2VE8A 3I59B 4RB3C 3IL2A 1D3YA 4JBAA 2Z99A 3M8EA 4ENMA 2MLKA 3LAPA 4HLXA 3TGNA 3R0AA 2MLGA 2RVCA 2XAQA 3GO5A 4ZZDA 4FX0A 3F6OA 4U0VA 3LA2A 4Q5SF 5HDKA 3F6VA 4KMUX 1XGNA 3CDHA 2CGPA 3R4KA 2DQLA 4CGZA 2UXNA 3PQJA 1MD0A 1F1ZA 2WV0A 4LFUA 3SXYA 3H92A 2FBIA 3L2CA 2Q0OA 2XKOA 3FX3A 2Q2EA 3F8CA 5D5XB 1ZAOA 3DF8A 3K1PA 3BJ6A 1FBSA 3Q9VA 3M9AA 5L3EA 3TOAA 4UV9A 5FFZA 2VBXA 3KP4A 3QU6A 4R79A 2ZCWA 2GZWA 1TBXA 5LLQA 3M7GA 4U0YA 2JPBA 4EM1A 2HWVA 1D8KA 4RAYA 3DXJF 3TO7A 2FNPA 4ESFA 2QBYA 1BIBA 4IXAA 1REPC 2ETHA 4NB5A 5LGNA 4Z2YA 1ZRDA 1QZYA 3ROUA 4A2UA 4HDUA 5HDNA 1QPMA 2E1NA 2J5PA 4L9NA 2L3DA 3AAFA 1XB4A 1SD6A 1B4AA 4WWCA 3CJNA 4HX8A 3CUQA 2V79A 2C6YA 4A6EA
chains in the Genus database with same CATH superfamily
2RNGA 1VFCA 4OIOF 1ZHFA 2VQLA 2TDXA 2PQ8A 1IRGA 3CUOA 2A69F 1QVTA 3H35A 4CYCA 1Y8RB 2DU9A 5A2QK 4DW6A 4M6YA 1XGSA 2KISA 5L3DA 2WAEA 1RIOH 5AONA 1S3JA 2EV6A 2O8XA 2V1XA 1N77A 2NNYA 3W2WA 3RPUD 2G7HA 1TP4A 3K4MA 1VQNI 3A0BC 3K1MA 2CUZA 4BYYA 1BJZA 2GA2A 1K6OA 2DFEA 3RKYA 1QA6A 1T2KA 2M4KA 5DCFA 3V7CA 3I4MJ 3QOPA 1L0OC 3SQNA 4XSZF 4EGYA 1YIOA 3J80K 4O6JA 3HOXJ 4XLFA 1TWFJ 4AIJA 2HDWA 1FC3A 3JCUC 1MMAA 5KAFC 1K6YA 2VI6A 2JT1A 2IGMA 2JRMA 3RZOJ 2X85A 3DTEA 1ON2A 5HNFA 3T5XA 1BW5A 2P81A 3E6BA 4ZYGA 3K69A 4P5OA 2B63J 2BGCA 1RKTA 2RN7A 4E7JA 2EZIA 2M0CA 3GZ6A 2DOEA 2R3SA 4KDPA 4P96A 2K86A 4W97A 1TNSA 2EV5A 1BJAA 5FLMJ 4PJJA 2CV2A 5LFAA 1BI0A 2WAQA 2XAHA 3IV5A 3CCYA 3GEZA 4EJTA 2EA2A 1U8RA 5E3MA 2R0QC 2OUMA 3Q0WA 1WKMA 3BR1A 2KKOA 4GCVA 3MKWB 5CQEA 1J09A 2W84A 4XL9A 2ZJPF 1F43A 4UNOA 3BG5A 5F0CA 2O9LA 4JYKA 1TWCJ 2VJ5A 3H1CA 4HSTA 1SFXA 3X2QH 5IOZA 2HQNA 2BXZA 4E70A 4ESBA 3U9GA 5IYCJ 4XICA 3KYDB 2VXDA 1KQ8A 1MBHA 3TQNA 3D5SC 2JRTA 3RTRA 1CF7A 3CUQC 1Y1VJ 4MTDA 2KRFA 1QHGA 3LMMA 5IP7J 3CC2I 1IJWC 2NRAC 1USSA 3K4NA 2V7FA 3JRHA 1K78B 2EJRA 5FLXZ 2EZHA 2KDOA 3IH4A 3K0LA 5DS9A 5D6EA 3R6SA 2F4MB 4RAZA 1XDSA 2HVQA 1IUYA 4YEJA 4MFEA 2HI3A 2E2JJ 3LFKA 2E7WA 3GWZA 4FE7A 2G9WA 2E1OA 1UCRA 3V8JA 4PGHA 3ZQCA 1SFKA 2EIMH 4D9JA 3GX4X 1MBEA 4F91B 4HG2A 3I4PA 4XSXF 4DZJA 4RBOA 4A3CJ 1ON1A 2QZ8A 3E0JB 4HNTA 3OYNA 3ELKA 5JLXA 2LKPA 3OYGA 2W48A 5E18F 2P4WA 3HUGB 4ESJA 5H20A 5D5UB 4I0AA 2UWMA 4AIDA 3RDIA 1O3TA 2F4IA 3JRAA 2QCOA 3UR3C 1S29A 4WXDA 3GZ5A 2E19A 3OYDA 1FJLA 3E6DA 2VXZA 2CSOA 1I50J 3CCMI 3HB9A 3EYIA 1ZR4A 4I6ZA 4RAFA 2R7RA 4BQOA 1D8JA 4L0YB 4DGWB 4BH9A 3H5NA 2F2EA 4N4NB 4HEA2 4XLCA 4NBQA 2FA5A 2WB1A 3F8NA 4HPQA 3BR3A 1T98A 4DZPA 5ICCA 3M8JA 4M3GA 3QYEA 1HXDA 1KYWA 4L5IA 5ICGA 3OV8A 4Y15A 4CCKA 4FETA 2M87A 2QQAA 1VQLI 1IRZA 3SZPA 1IW7F 3T8RA 1BL0A 4KIBA 5LRRA 1WH7A 1X1BA 1FSHA 2FX0A 3FK7A 3L2QA 4QWQA 4MLOA 3ML6A 2DLLA 1GVJA 2DMQA 3KETA 3FBIB 4A3KJ 3BTJA 3LWFA 2XV4S 2DFHA 4LIUA 3AG1H 5LHGA 1D0XA 1HQCA 4M6XA 3OR1C 3KLOA 2WA0A 1VTNC 2M34A 4GO1A 1IXRC 1FZPB 1VNDA 2DYSH 1W5CC 3QRFF 5TRDA 3MFKA 4QLCU 3FKJA 3GBGA 1FX7A 4B47A 3SEZA 2KDZA 5FD5A 3PUBA 1UHWA 4ON0A 1HKQA 4XQFA 1KGSA 4HDVA 1XX5A 2F4OB 1NG7A 3MVPA 4L0ZB 2NVYJ 1ETQA 1TT0A 1TZLA 5HODA 3QAHA 4LG0B 5BNGA 4RB2C 3OYHA 4XOPA 4A3JJ 2B7EA 3NEUA 1IRFA 1SAXA 4OIQF 3REOA 5IT9Z 2EFNA 2K02A 2GA1A 3G73A 4D5FA 4XKCA 3QP5A 1ITYA 4EQQA 1LVKA 4RGXA 3KZYA 2HXOA 1QNTA 2LR8A 3OYEA 3VFZA 2CMPA 4FCYA 2MGQA 5HOOA 3P5JA 3JRCA 3Q9SA 2KMUA 3J7AO 4ENJA 1WJEA 2KL4A 1YJNI 3E1SA 4YIRX 1YW7A 4UVAA 1G6NA 4MNUA 1W7PA 2R5ZA 1R58A 2KRCA 2ADUA 4A3FJ 2Y48A 2HDDA 2FMYA 1HBXG 2RQPA 4BE0A 3ZMZA 3JR9A 1A36A 1S5LC 2XGCA 4M3BA 4RDUA 3K70D 1Z9CA 5E17F 2X51A 2RGVA 4KN4X 3TKYA 3PNVA 5E3OA 1CF7B 3QYFA 2E71A 3IWFA 1QO0D 3KEYA 3RPQA 4A0XA 4BEHB 5D4RA 4MEXF 2UZKA 4UVCA 2XGDA 4MO7A 5FD6A 4N0BA 1EA3A 2EZLA 4XKVA 4PJ0C 1J59A 5D8LB 3S1MJ 3HHGA 3C7JA 6PAXA 1KQ0A 2XB0X 2OD5A 1IN5A 5FO5A 1BR1A 4Q47A 3C18A 4QIWN 1MBKA 1K83J 2BHZA 4BL0B 3GTQJ 1YQAA 1MNEA 4ZC3A 5AIQA 2CG4A 1RC9A 1LEAA 3BLYA 3LSHA 5LBQA 1DPUA 1G3WA 1NHAA 5CLSA 2AXTC 4FASD 1MNMC 3L00A 1ONVA 4NC7A 2ISYA 4EJOA 3SZTA 3QWLA 1FIPA 3HRMA 1I5ZA 2F5VA 4M74A 4HNVA 5J1UA 4C9YA 5B5EC 3ZMTA 5ILVA 1XC5A 3LOCA 3RQIA 3OOPA 2V1DA 1EJ9A 3GXOA 5E1WA 3PO2J 2ELHA 5DUIA 3N97A 2VT2A 3FXOA 1MMNA 2DA6A 3KYCB 5L3FA 4RB0A 4AUXA 3DTKA 1OKRA 4MGRA 3BPVA 2KZVA 3ABMH 2MABA 1JKRC 2A5YB 1YLFA 2X4HA 2HNHA 1XPXA 1GXPA 4HRIA 4PGGA 1SFOJ 4M3FA 4LB5A 5FB2A 4IQ4A 4K2EA 1XCBA 4XLAA 3J81K 1F4KA 4M71A 2AQFA 3WGGA 2HVRA 1JJ8C 2CW7A 3WTZA 4TV7A 4IOCF 5IOYA 2J5OA 4ENKA 2IA0A 2QUFA 5FKNA 3S1RJ 1XGMA 5IP6A 4DNCA 1A6QA 3DV8A 3P9IA 4HX7A 1FSEA 1QQIA 3HRTA 3HKZN 1UZCA 4HQEA 2KJBA 1KONA 4XBFA 1Q1VA 1TC3C 3BCAA 3C1DA 1HW2A 2LVSA 3CJRB 2WY7Q 1GV5A 1T0FA 3SDBA 2PMZN 5HS9A 1ZTRA 4F93B 1Z3YA 1HW1A 5M3FJ 2PN6A 2XRNA 3I5UA 3WTUC 1I3AA 2ACJA 3FMQA 1MNDA 4B4CA 3P7NA 1HW5A 2DFFA 2NYXA 2KLOA 1P6RA 5B3SH 5LRSA 1V5EA 1W0UA 1O7FA 2CW8A 1ZGWA 3I9V2 1R23A 2BZTA 1H8AC 3O6BB 2KIUA 5TJJA 1MBJA 3RKQA 1Y0UA 4LK0F 2ZKZA 3PIPF 2EA4A 4JOMA 3V7RA 2A5WA 1LKXA 2ZMEB 3HPGA 1XDUA 3OIQA 4CXFA 2JMWA 5KVRA 3OMYA 4IQJA 3CQZJ 2V9KA 4AYBN 1OFCX 1DU0A 5M5YJ 2DJNA 2IBDA 3VYUB 1PP8F 1H88C 2Z16A 2DCEA 1RKWA 1YW8A 4S0HB 1X2MA 4EGZA 3CJTB 2MC3A 2FE3A 4E7SA 1WJCA 3HZJA 3S8PA 3CCRI 4JX4A 3BQZA 5IYBJ 1TNTA 2NOJB 3WTTC 2DDAA 2DODA 4FTHA 4U88A 3CF5F 4KN7X 3HGGA 2R5ZB 4A3DJ 5JVGF 3DBLB 1PDNC 2PG4A 4M3DA 1MJBA 2IGNA 3A4CA 3OYCA 2R7ZJ 3SEQA 2YUSA 2TCTA 1XD7A 3OYLA 1VQ6I 2YSRA 1O57A 1DGWY 2JUGA 2K3FA 5IPAA 4CCMA 3WHBA 3I54A 3P9CA 4MEYF 3L2UA 1QBJA 2W1OA 1LE8B 2DT5A 4MQ9F 3S1NJ 2E5ZA 2R7OA 4I99C 4LK1F 4LITA 2QQ9A 3EDPA 3CMYA 3F3XA 4XOTA 3CC7I 3DEUA 5HLIA 4UUSA 1DDNA 2BW3A 2AHQA 5L3CA 1LDJA 4A5MA 4AD9A 5EDNA 4RGUA 4KYWA 3WHCA 2OTLI 2X6WA 1YITI 3RSNA 4BXFA 3FHZA 3EUAA 3TBIA 2A61A 2FF4A 2MD5A 1N78A 4JK1X 3CJQB 1T95A 2XUBA 3F72A 3ECHA 1NH3A 3BROA 1ULYA 3LQRA 1VF9A 5E8IA 1IRXA 4YFXF 2ELJA 2LF8A 4L9TA 2EB7A 2L9NA 2X6OA 2H1KA 1OYIA 2NAZA 2LY2A 3MZYA 2XSDC 1V54H 4GRIA 2BY3A 3CZ6A 4P1WA 4Y13A 3LNQA 2D1HA 5ICEA 4RS8A 2KFDA 1DU6A 1XMXA 1Z6TA 2EWNA 1A6IA 4E6KG 4J01A 1HC8A 1SFEA 1E0EA 1WH5A 1QU3A 3I3LA 4S04A 4L18B 4M73A 3FXQA 4BXXJ 2QM3A 2NNNA 2VQHA 2K4BA 3FMRA 3KZZA 2W25A 2VKDA 4HAMA 1IXCA 3ZGKA 1B6AA 2BEOA 2JA2A 1BIAA 3E5XA 2JQ7A 4Y33A 4XRSA 1SAUA 1YI2I 3FM5A 5FFXA 1ZQ3P 2STWA 3C2BA 1ETVA 1F5TA 2G0EA 2XRLA 3VSLA 3LSPA 1BC7C 1FOKA 2WC2A 3VODA 5J1RA 2EBIA 5FKMA 4AU7A 1W36D 3ZQ7A 1S6LA 2I8DA 3BCBA 4HOBA 4RA2A 2V6EA 5EG0A 3H0GJ 4YFNF 1H89C 4OMYA 1V55H 3IAM2 3WU0A 2E5NA 4IRHA 2WB1N 3BOQA 5LEJA 1LQ1A 3BQYA 2K85A 2IA1A 2MH9A 4JX6A 5GTHC 3K1NA 1JUPA 3ZQIA 3QODA 2JA6J 3DKXA 1ZH5A 3CDLA 1WI9A 3OYKA 2O6GE 4O3MA 1FBUA 2CH0A 1YW9A 1ZLKA 4W1UA 3QYBA 3EQLF 4L9VA 3H36A 1R1VA 3GTPJ 1P4AA 2PEXA 3PFYA 3K4BA 2P8TA 2UXXA 4FX4A 1JT6A 2AXLA 2ESNA 3J7ZI 1I6XA 1U5TA 2E1CA 3H5AA 3ASNH 4XRMA 3G2BA 4G8XA 2ZFUA 1W4MA 3HKZA 1DGRM 3G4SI 3U2RA 1FTZA 3KIOA 1AKHA 3BT9A 1OCRH 1TWHJ 4LB6B 3S3MA 1UB9A 2X1CA 3VPRA 1SMTA 1P9QC 2PMZA 2P5LC 1YRNA 1FYMA 2F5DA 3CMEI 2L9RA 1Y56A 5E3NA 3J80Z 3SFZA 5EJCA 1U9NA 2RAEA 1LB2A 2YR2A 2DMNA 5KCMA 1O3RA 4AM3A 3QPHA 2JZYA 2DPDA 3FWEA 3H9GA 3ABTA 3VDXA 1FEXA 1Q1HA 2HQRA 1W5TA 4YFKF 3CCQI 2QSFX 5DCMA 1XMAA 2DA4A 4FHTA 3CD6I 2X1DA 1GHCA 3GTGJ 4WXHA 2K40A 5DEQA 4II3A 3TO6A 4GXOA 2FXAA 5F64A 5J4YA 5EF6A 2R5YB 1P2FA 4YELA 4EJWA 2EPFA 5M5XJ 2HZDA 3D1NI 1WCMJ 4AYBA 1TT5B 5F1RA 2D2WA 1X1PA 3LSIA 1KU7A 4AC0A 1WJFA 2OF7A 2RV8A 4X6AJ 3F8FA 4LLGF 4D7NA 2WWYA 1UG2A 1SVLA 2XAGA 3GLLA 2K4JA 2V6CA 3DPTA 4MTEA 2GOXB 2ME0A 3K4CA 5CJ9A 4KISA 3HIFA 2A05A 5LGTA 1OPCA 2CFOA 2DMTA 2MD0A 3U21A 2FBKA 4HYEA 2O7OA 1BI3A 5HLGA 3PNYA 5JFRA 2Z3YA 3GVAA 1ZG1A 3H5RA 2Y9YA 4RAGA 3CCSI 2NVUB 1R22A 3DCFA 5F1JA 2R7FA 2DA7A 3LSGA 3M1CA 2W24A 2VASA 3GF2A 4EJVA 1ZKGA 2IS6A 4RGRA 3OSFA 2HOTA 2NS8A 1BM9A 3IKTA 1VQ4I 2DPUA 4IZZA 2BVLA 3FDYA 1RUOA 3WG7H 2XDVA 2EIJH 1YYVA 3DPLC 2P5VA 2M2EA 2VKEA 2L4AA 4HF1A 1CQTA 2KP6A 1U5TC 1U2WA 3TDZC 1OLTA 2FEZA 2H8WA 2HS5A 2IP2A 2YX4A 4A12A 1SC7A 3NQOA 3VYRB 2WV1A 3S17J 3DEWA 2COMA 1X4PA 4UVBA 2X6XA 4ZYHA 2YU9J 4IHYA 1GUUA 5ED4A 2K3PA 3VWBA 2XVCA 4EEFG 4KUMA 5GAHJ 4XRFA 1B59A 5HNHA 1IF1A 3BG7A 2DMPA 1HSJA 2NOGA 3PFIA 2HQAA 4QPOA 5JR3A 1B1BA 1MSFC 3I0TA 3TO9A 2VJJA 3OS1A 5D5WB 3I55I 3VOEA 5GTIC 5F0FA 1PUFB 2DDBA 2Q2EB 2GXAA 4ZTJA 2H6CA 4IVNA 5EG0B 2HGCA 2KIQA 1FIAA 4BHCA 3S2DJ 4IHWA 4KIFA 3EUKL 4P9FA 3U1KA 2YS9A 2O61A 3FMSA 3MKZA 1VQPI 3OR2C 2HPIA 2Y0SN 2XC7A 5HLTA 3CCEI 1VQ9I 1RESA 1IV6A 3S16J 2V26A 3RCOA 3WE3A 4WX9A 4C3IJ 4BJ5C 1JI8A 4F52A 5BQTA 4HQMA 3DKYA 3ZQGA 3CCJI 3VB2A 1IG7A 1UFMA 1ZR2A 3CLQA 3G71I 1SEUA 4ANJA 4QPQA 3RI4A 4CH7A 3TMOA 3I58A 3OYIA 2E35A 1V4RA 1Z6RA 2W4SA 3HXLA 2IRFG 1AWCA 2QBYB 4GGGA 2M9HA 2E2IJ 3IH3A 5EYRA 4BJ6C 1ZRCA 5E8GA 3ECOA 2M45A 5TISC 3W3CA 1JJ6C 1Y6IA 2EILH 3I56I 4KFCA 1P4XA 4M6VA 2M3AA 2K9QA 4PJNA 1KYZA 3E7LA 2OAZA 2M4GA 3SHFA 4HX4A 2YPRA 3MZ8A 4NNJA 5CVUA 2CFXA 1YRNB 1OMIA 1MMGA 1B8IB 4ZYAA 2DA3A 1IUFA 4LJZF 2V9PA 4A3MJ 3FKIJ 2IVMA 1T38A 3DLAA 4BDYA 1A35A 5FLVA 3N05A 1R6RA 3F8BA 2QENA 1X1DA 3CUQB 4DOZA 1D1BA 5FKKA 2QF7A 4FQGA 2COBA 5BS6A 1H9TA 4ZDOA 5D6FA 3FM3A 1KU3A 4PUSA 2VB6A 1O4XA 1IZ1A 1BI1A 2ZNYA 1NTCA 3S2WA 2GWRA 3COAC 4BHBA 3HRSA 1WJBA 3EETA 5DCMB 4CYCB 2DOAA 3KZIC 2XAUA 4IPAA 1RZ4A 2EFPA 2LK2A 1MJAA 1B72A 4HF0A 2LD5A 2F5EA 1S7OA 1E3PA 2XF7A 4BHPA 5F08A 4A3IJ 2VODA 1NG6A 3LSJA 1I3QJ 1R4MB 2HQ5A 3FXJA 3OWTA 2XSJC 5C44J 4I09A 2JN6A 2MYSA 3BY6A 4GYIA 3OYMA 1D5VA 3KLNA 3ZN0A 3CTAA 2HKOA 4DBRA 2FRHA 5BPIA 1FPQA 3K7AJ 3OY9A 1RR8C 5DDGA 2XGXA 2VN2A 1JTYA 1Z21A 1R49A 3ZPLA 2FJ1A 2LNBA 2IEKA 3F8MA 1N75A 3BR5A 2EV0A 3RPUA 4NDLA 4ABZA 3CO7C 5FRNA 2STTA 3LFUA 2F6CA 2DBBA 3JREA 4LOCA 1U8BA 4E7IA 2Z33A 2PBIA 3HTUA 4BQQA 2DOFA 3KP7A 4AVZA 3AL0C 2KIFA 5EEAA 3KP3A 3I53A 2GLOA 2L01A 2L5QA 2OQGA 4XLPF 3BG9A 3MQ0A 2OJED 3FXKA 1YIJI 4CSWA 1M1EB 2JSCA 3G1OA 4DIQA 4UXNA 4P55A 3SYTA 1YJ9I 3SZGA 3W6KB 1JHHA 1LJ9A 3K10A 4CICA 2DA5A 3L09A 2GXBA 1XMKA 2PJRA 3PUFA 4OAZA 4XLNF 2YU3A 2QLZA 1ZELA 3DQVC 4KITB 1HA8A 2I10A 2MW8A 1Z77A 2XROA 3B02A 5CVRA 2EFQA 2VUMJ 4UB8C 2B0LA 3ZQFA 3ZP5A 1XTAA 4ZYDA 1APLC 4Y52J 4BS9A 5DD4A 3F22A 3IRRA 3KP5A 3KCCA 1HKTA 3MMYB 3BP8A 5EGOA 1D1CA 3PSIA 4PSXA 4C2UA 1FWZA 2X1EA 2LMDA 3DBHB 4Y17A 3BR0A 3VSKA 1UHMA 2FOKA 3IHUA 2ZSHB 4OIPF 2CU7A 4CYDA 1FT9A 5DM7F 4EV0A 3HBLA 2DO7A 3GZNB 3LSTA 3J81Z 2JA5J 2CQXA 1ETKA 2LBFA 1USTA 2O5RA 1MDMA 2E34A 2QGUA 3KEOA 1K7AA 3S2HJ 3TOBA 2AO9A 3OYFA 4M3EA 1IN7A 1RI7A 1SD4A 3RYRA 1IXSB 1I1GA 2LH9A 4A5NA 2ZJQF 1XSVA 5J4VA 2L2OA 2OC6A 4F55A 1OCTC 2LF7A 1RUNA 3I59A 3M1EA 1ENHA 3FIWA 3FXUA 3GUDA 3JAMK 3VEPA 5JI6A 4AIKA 2HXIA 2PMUA 3NARA 4A69C 1LFUP 3Q0VA 3M3YJ 1YHQI 1GT0C 4IX7A 4KJZA 3AG4H 1JTXA 1X1CA 3KPHA 4CCNA 4DJAA 1JKOC 1B9NA 3WTVC 1T56A 1NK2P 4OWRB 5JVTA 4I0BA 2Y0SA 4G94A 2IJLA 1TLHB 4D5CA 2E1MC 2M8GX 2O8KA 2W82A 5BMZA 4XIDA 1AA7A 2KJCA 1Z0XA 4II2A 2M7BA 3OIPA 2R7UA 3KP6A 4R8HA 1TWGJ 1PJRA 1X3ZB 2QQ8A 4CZZA 2H8RA 3G6EI 4LD5A 4EATA 2P7VB 4E7HA 3WU1B 4B8XA 1J2XA 3DLLF 1P7JA 5FRMA 2DFIA 2P0WA 1XSXA 1ZRFA 5EEHA 3WGHA 1H9GA 4XLEA 2ZJ2A 3TL4X 2OBPA 3GMEA 4B44A 3PO3J 4HSRA 4B3XA 3UKGA 1FYLA 3GFJA 1P4WA 4BXUA 2V1UA 2LFBA 2QWWA 3ISPA 3JRGA 4UUVA 2RNJA 1JT0A 4NC8A 2DA1A 3HHHA 2CV1A 2Y31A 2HEOA 1Z7UA 2HDCA 3SDGA 4G7ZF 3GTOJ 2XASA 1KU9A 3H9QA 1R36A 4HZFA 2EZKA 1DUXC 3IH2A 5HS7A 2OU2A 2LYCA 3Q5FA 1QHHD 2VC0A 4ZJZA 1OISA 2UUZA 3HOWJ 5LHIA 5CVIA 3GYHX 3CCVI 4JX5A 1W0TA 2ME6A 1FOXA 1RNLA 4XNFA 4BDZA 4A0ZA 3M8FA 3O2PE 3QP6A 4PJLA 4WXCA 1Z05A 3ZMSA 4LGWA 3OL3A 4KT5C 2MH2A 5EEGA 5H6QA 4L5JA 3W2VA 2FNAA 4I2OA 1SFUA 2BOLA 1WPKA 3BJAA 3KFWX 4RM3A 3MEXA 1Z1DA 3HOYJ 2R7TA 5IYDJ 2M8EA 4HF2A 1G4DA 3J7YJ 4O5VA 4BQNA 1YFHA 3TW7A 5ILSA 4GDFA 2HFHA 3G1LA 2VE9A 3ZCOA 2R7XA 5IP9J 3ZXSA 2KZGA 4A3EJ 4AVPA 5FROA 4Y4RA 5K7ZA 2PJRB 4BJTA 1IGNA 1ETYA 2M0MA 1W7PB 3ZOBA 3BWGA 1PYVA 3KEQA 3ULQB 3QQAA 3ZMVA 2VQGA 4EMSA 1O3SA 1IDZA 4BACA 3FXMA 3IRQA 2L54A 4N9IA 1K4SA 3V8KA 3L7WA 3A2KA 1JGSA 1N25A 1I6HJ 3MCZA 2OZUA 1G59A 1I39A 5GPCA 1IN6A 2DN0A 4HV6A 5J6XA 3RKWA 3WTSC 1RRJA 1STZA 2YX7A 3ZN1A 3H3VK 3FISA 3HOUJ 1TW3A 2UV1A 2ZO4A 1UMQA 4PK4A 2VT3A 2LOOA 2JA8J 3L9FA 1HOMA 3FZVA 4I76A 4XONA 1O3QA 3RIRA 1C0WA 2A6HF 4IHTA 4IF4A 2BY1A 4V2FA 2LBFB 2HTJA 4U0WA 2TRTA 1IN8A 4OOIA 1EF4A 4KICA 3LSMA 3H3ZA 1J75A 4HBLA 1EH6A 2IPQX 1Z67A 3CDIA 2R92J 1SVMA 1LEBA 4M72A 3KP2A 5KNLA 3QPSA 2PX9A 1U6GA 2IS4A 2W00A 1UHSA 3WG9A 1QZZA 2HYFA 3GTMJ 2HYJA 4BE2A 1VZ0A 2IW5A 2VL8A 2OCEA 2Y30A 5J47A 1UAAA 3TEDA 4EM2A 2A6TA 3N4MA 4KIGA 1POGA 2P6SA 1Z3XA 2ZXWH 3IC7A 2PI0A 5K5OA 1TQIA 2IAIA 3W6JB 5M5WJ 4X0GA 2L7KA 4L5EA 2Y75A 2OA4A 3BPXA 3ESWB 3KYLA 1BR2A 2NS0A 1WQ2A 1DP3A 3RJPA 3IP4B 4X1EA 1OYWA 2DTZA 2E7XA 4RLQA 2L7FP 1HLVA 3C2HA 2VOOA 4A3GJ 5DTDA 2Y0MA 3Q3SA 1LNWA 2X0LA 2R7WA 2PFBA 3ASOH 2HOSA 2R7DA 2VOPA 2VC1A 1X2NA 1WWXA 2GM4A 4IHVA 1OJLA 3HYIA 4LLNA 5E1ZB 4RM2A 1SANA 2R93J 2BY0A 3EPZA 1FTTA 2ID6A 2O03A 3HOZJ 1OCCH 2XF5A 1AU7A 1ZREA 3CP8A 4OAYA 4G7HF 1ACIA 2CJJA 1V5FA 1XCVA 1QVUA 1ZARA 2XPWA 3HEFA 2ZFWA 2KIMA 2BE5F 1K78A 3CP2A 3DU5A 4A3LJ 2L4MA 2XPUA 4HA8A 2D5VA 1YJWI 1G3SA 5IY5H 4R1HA 3GFMA 2QSGX 2MBFA 2WTEA 2ZXHA 4CUGA 3S15J 2HYGD 5A2QZ 4NQWA 1H0MA 3TDUC 2BY2A 3LSKA 1X58A 3E5UA 2QSHX 4XMYA 4D1QA 3WE2A 1JHFA 2P7CB 2PLYA 3K70C 2QKLB 3T8TA 4WK8F 2P6TA 2BYVE 2XIGA 2MC4A 2H94A 4F92B 3C3WA 2VJIA 4GFBA 2V4JC 4NC6A 4PCQA 4MIMA 1KU2A 2RC4A 1FYKA 1GDTA 3BTIA 1ZG3A 2L02A 2QVOA 5JHUA 1ZLJA 3G3ZA 1TQPA 2VIXA 5HS8A 1DP7P 1NK3P 1LVAA 3HSEA 2K9MA 1WFXA 2HVSA 3JRDA 1XGOA 3HUGA 3CESA 3JSOA 2CUJA 1TQMA 3WU2C 1PP7U 1J0RA 4B1RA 1D0YA 2KHMA 1W5SA 5K7HA 4J00A 3LAJA 2V9VA 2IA2A 2EH3A 4PDKA 4ZZLA 2BV6A 3HSRA 4LMYA 1R1UA 2JPCA 4ZH4F 4H4KC 4BKXA 3KX2A 4OINF 2H27A 3CC4I 2WAFA 2XGEA 1MJ9A 2A68F 3M07A 1YS7A 5D4SA 3BR2A 4XLHA 4XKBA 2LP0A 2CV0A 3I4NJ 4B3AA 3OYBA 3OS0A 2D45A 3MKYB 4BNCA 3S14J 1VQ5I 2K7LA 3H0DA 5E3LA 2GQQA 4WF2A 2ZXJA 4BE1A 3B6CA 3RQ4A 4UUSB 3JRIA 4PFOA 3BTLA 2BW3B 1YX3A 3ZQQA 2N8GA 3FXRA 3DWLE 3E6MA 4ASNA 1GXQA 1WSUA 4IKFA 4IRGA 1F9NA 5DV5A 1U78A 2OQRA 1VQOI 2Z9OA 2Z5UA 1WZ2A 4I98B 2R7SA 1J7KA 4UV8A 5EZGA 4PFPA 3GFLA 1FLIA 2F5FA 1YS6A 2WY8Q 4G6QA 3PQKA 2EINH 2ISZA 2XAFA 4G6TB 1KA8A 3FF5A 4IJAA 4XKWA 2JVHA 2LY9A 3T0YA 4KA4A 4YG2F 3PL8A 1ZG5A 3IWZA 2VPLA 1R00A 1Y1WJ 3H9JA 1GV2A 1MW7A 2DT7B 2LDUA 4U7BA 2VLAA 5GAEJ 5KHDA 5TGTA 4LG0A 1R5ID 4A0YA 5E1XA 3B73A 1MBGA 1W7PD 2DTRA 1ETXA 3L2VA 3BG6A 2IS1A 5H6RA 2JJ7A 3ABKH 1YO5C 3PSFA 3JTGA 3R61A 3V8LA 2XB5A 4FT8A 2CQNA 4C2MJ 1A04A 2Y9ZA 1WVRA 2M1BA 3NWSA 1YOVB 1BN5A 1D0ZA 1LFPA 1ETOA 1E2XA 3NAUA 4DYCA 3UNGC 5F04A 5L3GA 5D5VB 1JKPC 3S1QJ 4ZYEA 2HOEA 4QTRA 2E2HJ 2GIVA 3E5QA 1FY7A 4HV5A 4ETSA 3TP0A 1O7LA 4BUPA 5JHFA 1HSTA 5J1YA 2X6YA 5F27A 1U0JA 5K5QA 2DK8A 1E17A 3T1BA 1VQ8I 4BEHA 3HTSB 2DA2A 3JTHA 4B43A 1IAWA 5K5RA 2XHKA 1T08B 1HDPA 2QA4I 2DW4A 3PIOF 4UB6C 4Z6YA 2MSYA 1OCZH 4OIRF 2Q8KA 5LGUA 5M3MJ 2PJPA 2M30A 2ELKA 3I71A 4NQWB 1BI2A 3TW6A 1G3TA 3HPHA 1EH8A 1U5TB 3MWMA 2DI3A 3ZMUA 1K79A 4I02A 3NRVA 4E7LA 4BY7J 5DYMA 1QGPA 1R5HA 5CVVA 5AIPA 2WBMA 1JXSA 1R7JA 2R7QA 3O8HA 3WTYC 2CS3A 1S72I 1AKHB 4CDGA 4H0EA 3ERED 3CO6C 2CQ7A 5ERIA 1T39A 1X3UA 2LLKA 1Z7LA 4BU2A 1D1AA 1W1WE 3CCLI 1YTYA 4J19A 5LEKA 3HOSA 4CHUA 2VBZA 3B6AA 1R1TA 3K4LA 4CCOA 3FXLA 1FOWA 1ZK8A 4EJUA 1ODDA 2CO5A 3HRUA 1PVEA 1G8XA 2DYRH 3CMAI 1I27A 5DUKA 2ICWG 2K5CA 1G3YA 3W6VA 5FKOA 3ZQLA 2EK5A 5FLXK 2K27A 1G2HA 5F6FA 2VBWA 2GXGA 4NHJA 1BOAA 4U7DA 3F23A 3TP3A 4HW0A 1F36A 1HKSA 2RREA 4GYGA 4PZJA 2CQQA 2CW0F 1JKQC 2EFOA 3GW2A 1BBYA 4FISA 4Y7NJ 2O0YA 2W85A 3M4OJ 2IGKA 4UHTA 1KZHA 2VKVA 4Y3OA 4E7ZA 1VQMI 4Q4ZF 1T33A 2NVXJ 1JUMA 3BDDA 3MN2A 4KNYA 2IS2A 1YX5A 4ZDLA 1E3OC 5C4JJ 3GTJJ 2OZ6A 1IV8A 4JP0A 2K9LA 4RGSA 4AIHA 4A6DA 2ECBA 4IO9F 3ABLH 1K4TA 2F5CA 3KE2A 2XAJA 5ICFA 4C3JJ 2DXIA 2LKSA 2CUEA 3H3UA 5CQGA 3HG9A 1FMVA 4DBQA 1TL8A 3V7SA 2ZSIB 3DFGA 3S3OA 1WJ5A 3F9KA 1BR4A 5B1BH 3WGIA 2IGOA 2Y69H 2Y2ZA 4YIFA 5HLHA 3A02A 3G1MA 2GBYA 2CWEA 4WCGA 2VONA 1W36C 9ANTA 1LPQA 1E3HA 2OV7A 2R7VA 4RB1A 3ZR8X 4JQFA 1BC8C 2R4GA 1VQKI 2ECCA 5J3LA 3ERMA 3DU6A 4A3BJ 2RKHA 2FBHA 2Z2SB 4N4OB 2KT0A 2G7UA 3DBRB 2ZJRF 2X48A 1B9MA 2ZMEA 4XK4A 1ORKA 2FMLA 2DQRA 1WHUA 2LY1A 5GADJ 5L3BA 4ENNA 2DT6A 2HR3A 1XG1A 2CYYA 2EQRA 2KQRA 5D8KB 2I5UA 3HOVJ 3W2AA 2M7AA 3HSFA 1WGXA 4EVIA 3A1YA 3LSRA 3GLXA 3V4GA 3S3NA 1L3LA 1JE8A 1J9IA 2A6EF 3QU3A 4XN3A 3JAMZ 3MKLA 3O3KA 4B48A 1HDDC 3E6CC 5C4XJ 1ETWA 2OTJI 3D5RC 1OQYA 1FP1D 4I7HA 3LA7A 1OCPA 3C2GA 4CZCA 4MQVA 4BAYA 4CA0A 1ZN2A 1TW2A 1CGPA 2IXSA 1GLNA 4I01A 4UY8I 2ZNZA 3BZKA 2LRDA 3ZMDA 3L1PA 5JLWA 3BC8A 2HU9A 2D1VA 3PM1A 2JUCA 3AG3H 4ZDPA 2P5KA 4KT6A 4C30A 1LE8A 4MHGA 2NVQJ 3FK6A 1WI3A 3WODF 3AL0B 5IT9K 3A0HC 1BA5A 1R4NB 3DTIA 2E36A 1SD7A 2LTPA 3JRBA 3CF2A 3HM5A 3D0SA 3EUHA 5IT3A 4CO8A 3VYTB 3DP7A 3S32A 1J5YA 1EV7A 1SD5A 1P92A 3V42A 4XORA 4DYQA 4BBSJ 1BOBA 1DQUA 4XN0A 1Y39A 1UELB 2VBYA 1QRYA 2A07F 4A93J 2BVMA 1KQ9A 1Y0NA 2RDPA 2O3FA 3DKWA 4G6DA 1FMWA 3DEEA 4B09A 2JVGA 3BZ6A 4P9UA 4S05A 2QKMB 2FOWA 2Q1ZB 5H2FC 1A5JA 2FU4A 1FOYA 2JA7J 3NWTA 1DPRA 2VKHA 1S7AA 4G9YA 2FQ3A 4N9HA 4PSWA 3OS2A 4G7OF 3QPLA 1OYYA 5HDGA 1MSEC 1PUEE 4DQ2A 3JW4A 2B9SA 2NVTJ 3IKVA 4CCLA 1S9HA 2ZMEC 2DJIA 4L9JA 3HOTA 3ZRGA 5E20A 5K7FA 5J8CA 1B72B 2HZTA 1ZGJA 4UUTA 4NUBA 5J40A 5CPRB 4CCJA 5CYVA 3MZHA 1T6SA 2HPMA 1MZBA 3OL4A 3DPUA 2HOAA 1VI0A 3ABUA 5CVJA 4XM3A 5C3EJ 3VYSB 3K4KA 5FGMA 5ILUA 5BPDA 4RMNA 4BQAA 1TTYA 1R71A 1V5GA 4OU0A 2HKXA 1MH4A 3K2ZA 1P7IA 2H6BA 4IHSA 1R5GA 1AHDP 4OMZA 4C3HJ 2K9NA 2EFWA 1RPWA 1JUSA 4EM0B 3FHNA 3QOEA 1IN4A 2DMUA 3FBNB 1UG0A 4ITVA 1AOYA 3HL2A 3J7AY 3RYPA 2OCCH 3WTXC 2W57A 2ZBKA 2X9DA 4D0PA 3LQQA 1U3EM 2L9VA 3D5LA 2M5WA 1YG2A 2PMHA 2ZC2A 4YRVA 5LHHA 3I64A 5DM6F 3RKXA 5KAIC 4YIIA 1V3FA 2E1MB 2VJ4A 3EUHC 3F21A 3A01A 4M9ZA 4HLYA 4BY1J 1FP2A 5EZHA 5B66C 2BBYA 1ZYRF 4BBRJ 3BZCA 3QPTA 2BHYA 2LSOA 5DD8A 5E79C 1XS9A 2K9SA 2EIKH 4M9XA 2QQBA 3CLOA 3BTCA 1K61A 1OR7A 3PJRA 1XN7A 1X4OA 2GAUA 3JRFA 3E3VA 2CRGA 3R0JA 1XSDA 1Z91A 2DK5A 3WTWC 2IT0A 1OCOH 3OIOA 3EYYA 5FKLA 5B1AH 2JTVA 2MA3A 5BOXA 2KRHA 2XKPA 3K2AA 5HVQC 5FJ8J 2ESHA 1FNNA 3K9TA 3AKZA 4QSHA 4IL6C 3GFIA 2DAOA 3E97A 2CQKA 1U9OA 4MFDA 3LA3A 1MIJA 2W7NA 4IOAF 4A6EA 2LC2A 5KK1A 3K6GA 1YE9A 2H09A 2L9SA 4U87A 5EGOB 3U1DA 2FSWA 4IRIA 2AS5F 1SMYF 4F7ZA 1FBQA 3R60A 1RETA 2F48A 4LLLA 2HTSA 4AWXB 1LDKB 5J8FA 3BJOA 3MD2A 2VQCA 4E4HA 5F0HA 2R5YA 1ZGAA 1MDMB 3HGYA 1SVOA 2WAQN 3P9KA 3HJEA 1WJAA 4KMFA 1S8NA 1MGTA 3OSGA 3JSPA 1A31A 1MKMA 3AFHA 4M9SA 4Q48A 1I1SA 1EH7A 5LD2C 2QEXI 4E7KA 2CUFA 5K1YA 3BR6A 3MAJA 1LDDA 2QYOA 4IHXA 2RQQA 2ZB9A 4G12A 1X1AA 1WRJA 5GP9A 4FE4A 2VE8A 3I59B 5CKTA 2Z1DA 1QPIA 1T0FC 4RB3C 4RLFA 1D5YA 3IL2A 3L2WA 1D3YA 1LUJB 1T8IA 1IDYA 1S7EA 4JBAA 2Z99A 3OYAA 4D7MA 3M8EA 4ENMA 1BW6A 1TWAJ 2AQEA 2MLKA 3CMMA 3IAS2 3LAPA 2GIZA 1JGGA 4HLXA 1X19A 3TGNA 2WADA 2H1LA 1EKEA 3R0AA 2MLGA 2RVCA 2XAQA 3GO5A 4ZZDA 4FX0A 2E60A 3F6OA 1Y8QB 2NS7A 2MFZA 3O8GA 2LG4A 3LL7A 1OR7C 4U0VA 5GPAA 3LA2A 4XRSG 3PNTA 4Q5SF 5GAGJ 1UJ8A 5HDKA 3F6VA 4KMUX 3GCMA 1IO2A 1XGNA 2XPVA 3CDHA 2CGPA 1LFBA 3ONQA 3L2RA 2JSPA 3R4KA 2DQLA 4CGZA 4BGDA 2UXNA 3PQJA 3AG2H 1MD0A 2OPTA 3IUOA 4V2GA 2ID3A 1F1ZA 2KPMA 2WV0A 4LFUA 3SXYA 4C2TA 3H92A 1HCRA 2FBIA 4LG3A 3L2CA 3SJMA 2Q0OA 2XKOA 3FX3A 1QZEA 1PUFA 3CCUI 2Q2EA 2V1NA 3K4JA 1MBFA 3Q0UA 3F8CA 5D5XB 1ZAOA 3GTLJ 3DF8A 3S93A 2XF6A 3K1PA 3RZDJ 3BJ6A 1FBSA 3HDDA 3Q9VA 3M9AA 5L3EA 3TOAA 1GVDA 4UV9A 3OYJA 5FFZA 2VBXA 4ZTFA 3KP4A 3QU6A 4DYRA 4PJMA 2JWTA 2L7ZA 3HC7A 4R79A 2ZCWA 2L0KA 2L7MP 2GZWA 1VQ7I 1TBXA 2ZXIA 2NXNB 5LLQA 2GOMA 3M7GA 3BG3A 4U0YA 2JPBA 4EM1A 1ERDA 2HWVA 1D8KA 4RAYA 3A01B 1MMDA 3DXJF 3SFIA 1HF0A 3TO7A 2FNPA 1IC8A 4ESFA 2QBYA 4IEJA 1BIBA 4IXAA 1REPC 2ETHA 4NB5A 5LGNA 2LKXA 4Z2YA 1ZRDA 1QZYA 3OOUA 2MG4A 3ROUA 4A2UA 4HDUA 3GTKJ 2FD5A 1MMSA 4V19K 5HDNA 4HNUA 4LIVA 4F3QA 1QPMA 2E1NA 2J5PA 2JK3A 3A03A 2BXYA 4L9NA 1R9TJ 2L3DA 4XR6A 2FQ4A 1B8IA 3AAFA 2LREA 1XB4A 2VPRA 1MH3A 1SD6A 2FUG2 1B4AA 3ZQHA 4WWCA 3CJNA 4HX8A 3CUQA 1WJDA 2V79A 2C6YA 1X3WB 2A3SA 1RR7A 3F0CA
chains in the Genus database with same CATH topology
4OIOF 1ZHFA 2TDXA 2PQ8A 1IRGA 3CUOA 2A69F 2DU9A 5A2QK 4M6YA 1XGSA 5L3DA 1RIOH 5AONA 1S3JA 2EV6A 2O8XA 2V1XA 2NNYA 2G7HA 3K1MA 4BYYA 2GA2A 1K6OA 3RKYA 1T2KA 5DCFA 3V7CA 3QOPA 1L0OC 3SQNA 4XSZF 4EGYA 1YIOA 3J80K 4O6JA 4AIJA 1FC3A 2JT1A 1ON2A 3T5XA 3E6BA 4ZYGA 3K69A 4P5OA 2BGCA 2RN7A 3GZ6A 2R3SA 4KDPA 4P96A 2K86A 1TNSA 2EV5A 1BJAA 1BI0A 2XAHA 3GEZA 4EJTA 2EA2A 1U8RA 1WKMA 4GCVA 2KKOA 2W84A 4UNOA 1SFXA 2HQNA 4E70A 4ESBA 3U9GA 1KQ8A 3TQNA 3RTRA 2JRTA 1CF7A 3CUQC 4MTDA 2KRFA 2NRAC 1USSA 1K78B 2EJRA 5FLXZ 3K0LA 5D6EA 3R6SA 4RAZA 1XDSA 1IUYA 3LFKA 2E7WA 3GWZA 2G9WA 1UCRA 3V8JA 4PGHA 3GX4X 3I4PA 4XSXF 1ON1A 2QZ8A 3ELKA 2LKPA 5E18F 2P4WA 4ESJA 5H20A 5D5UB 4I0AA 2UWMA 3RDIA 1O3TA 1S29A 4WXDA 3GZ5A 3E6DA 2VXZA 2CSOA 3EYIA 1D8JA 4L0YB 4BH9A 2F2EA 2FA5A 3F8NA 1T98A 5ICCA 1HXDA 1KYWA 4L5IA 5ICGA 3OV8A 4Y15A 2M87A 2QQAA 3SZPA 1IW7F 3T8RA 4KIBA 5LRRA 1FSHA 4QWQA 3ML6A 2DLLA 1GVJA 3KETA 3LWFA 2XV4S 5LHGA 1HQCA 4M6XA 3KLOA 1VTNC 4GO1A 1IXRC 1FZPB 3QRFF 5TRDA 3MFKA 4QLCU 1FX7A 5FD5A 1UHWA 4ON0A 1HKQA 1KGSA 4HDVA 4L0ZB 3QAHA 4LG0B 4RB2C 3NEUA 1IRFA 1SAXA 4OIQF 3REOA 5IT9Z 2EFNA 2K02A 2GA1A 3G73A 3QP5A 4EQQA 4RGXA 3KZYA 1QNTA 3VFZA 5HOOA 3Q9SA 3J7AO 4ENJA 1YW7A 4UVAA 1G6NA 4MNUA 1W7PA 1R58A 2ADUA 2Y48A 2FMYA 1HBXG 2RQPA 3ZMZA 5E17F 1Z9CA 2RGVA 4KN4X 3TKYA 1CF7B 3IWFA 5D4RA 1QO0D 3RPQA 4A0XA 4MEXF 2UZKA 4UVCA 5FD6A 4N0BA 1J59A 5D8LB 3HHGA 3C7JA 6PAXA 1KQ0A 2OD5A 1IN5A 5FO5A 4Q47A 3C18A 1YQAA 5AIQA 2CG4A 1LEAA 5LBQA 1DPUA 1G3WA 1NHAA 5CLSA 3L00A 1ONVA 2ISYA 4EJOA 3SZTA 3HRMA 1I5ZA 4M74A 3ZMTA 5ILVA 3OOPA 2V1DA 3GXOA 5E1WA 2ELHA 5DUIA 3N97A 2VT2A 5L3FA 4RB0A 1OKRA 4MGRA 3BPVA 2A5YB 1YLFA 2X4HA 1GXPA 4PGGA 4LB5A 5FB2A 4K2EA 1XCBA 3J81K 1F4KA 4M71A 3WGGA 3WTZA 4TV7A 2J5OA 4ENKA 2IA0A 2QUFA 1XGMA 4DNCA 3DV8A 3P9IA 4HX7A 1FSEA 1QQIA 3HRTA 4HQEA 2KJBA 4XBFA 1HW2A 3C1DA 1T0FA 5HS9A 1HW1A 2PN6A 2XRNA 3I5UA 3WTUC 2ACJA 3FMQA 3P7NA 1HW5A 2NYXA 1P6RA 5LRSA 1O7FA 1R23A 3O6BB 2KIUA 5TJJA 1Y0UA 4LK0F 2ZKZA 2EA4A 3V7RA 2ZMEB 1XDUA 4CXFA 5KVRA 1PP8F 1YW8A 4EGZA 2MC3A 2FE3A 1TNTA 3WTTC 4U88A 4KN7X 1PDNC 2PG4A 1MJBA 1XD7A 2YSRA 1O57A 3I54A 3P9CA 4MEYF 1QBJA 2DT5A 4MQ9F 4LK1F 2QQ9A 3EDPA 3F3XA 3DEUA 5HLIA 1DDNA 5L3CA 1LDJA 4A5MA 4AD9A 4RGUA 4KYWA 3FHZA 2A61A 2FF4A 2MD5A 4JK1X 2XUBA 3F72A 3ECHA 3BROA 1ULYA 3LQRA 5E8IA 4YFXF 2LF8A 4L9TA 2EB7A 1OYIA 2NAZA 3MZYA 4Y13A 2D1HA 5ICEA 4RS8A 1Z6TA 2EWNA 1SFEA 4S04A 4L18B 4M73A 3FXQA 2QM3A 2NNNA 3FMRA 2K4BA 3KZZA 2W25A 4HAMA 1IXCA 1B6AA 2BEOA 1BIAA 3E5XA 2STWA 3FM5A 5FFXA 1F5TA 1BC7C 1FOKA 2WC2A 3VODA 3ZQ7A 1S6LA 4HOBA 4YFNF 4OMYA 3WU0A 4IRHA 1LQ1A 3BOQA 5LEJA 2IA1A 2MH9A 3K1NA 1ZH5A 1WI9A 2O6GE 4O3MA 1FBUA 1YW9A 1ZLKA 3EQLF 4L9VA 1R1VA 1P4AA 2PEXA 2P8TA 2UXXA 4FX4A 2AXLA 2ESNA 1I6XA 1U5TA 2E1CA 4G8XA 1W4MA 3U2RA 4LB6B 1UB9A 1SMTA 2P5LC 1FYMA 2F5DA 3J80Z 3SFZA 1LB2A 2YR2A 1O3RA 3QPHA 2JZYA 2DPDA 3FWEA 3ABTA 1Q1HA 2HQRA 1W5TA 4YFKF 5DCMA 1XMAA 4FHTA 1GHCA 4WXHA 5DEQA 3TO6A 4GXOA 2FXAA 5F64A 1P2FA 4EJWA 5F1RA 2D2WA 1KU7A 2RV8A 3F8FA 4LLGF 2WWYA 2XAGA 2K4JA 2V6CA 3DPTA 4MTEA 5CJ9A 3HIFA 5LGTA 1OPCA 2FBKA 4HYEA 1BI3A 5HLGA 5JFRA 2Z3YA 3GVAA 1ZG1A 1R22A 2R7FA 2W24A 3GF2A 4EJVA 4RGRA 3IKTA 1BM9A 2DPUA 1RUOA 1YYVA 3DPLC 2P5VA 2L4AA 4HF1A 1U5TC 1U2WA 3TDZC 2FEZA 2HS5A 2IP2A 2YX4A 4A12A 3NQOA 2COMA 4UVBA 4ZYHA 5ED4A 2XVCA 4KUMA 4XRFA 1B59A 1IF1A 1HSJA 3PFIA 5JR3A 1B1BA 3I0TA 3TO9A 5D5WB 3VOEA 2H6CA 4IVNA 2HGCA 4BHCA 4KIFA 4P9FA 2O61A 3FMSA 3WE3A 4WX9A 5BQTA 4HQMA 3VB2A 1UFMA 3RI4A 3I58A 1V4RA 1Z6RA 2IRFG 1AWCA 2QBYB 4GGGA 1ZRCA 5E8GA 3ECOA 2M45A 4KFCA 1P4XA 1KYZA 2OAZA 3SHFA 4HX4A 2YPRA 5CVUA 2CFXA 1OMIA 4LJZF 2IVMA 1T38A 3F8BA 2QENA 3CUQB 1H9TA 5BS6A 5D6FA 3FM3A 1KU3A 1IZ1A 1BI1A 2ZNYA 3S2WA 2GWRA 3COAC 4BHBA 3HRSA 3EETA 5DCMB 4IPAA 1RZ4A 2EFPA 1MJAA 4HF0A 2F5EA 1S7OA 4BHPA 2VODA 4I09A 3BY6A 4GYIA 1D5VA 3KLNA 3ZN0A 3CTAA 2HKOA 2FRHA 5BPIA 1FPQA 5DDGA 2XGXA 2VN2A 3ZPLA 2LNBA 3F8MA 2EV0A 3RPUA 3CO7C 2STTA 2DBBA 2Z33A 2PBIA 3HTUA 3KP7A 2KIFA 3KP3A 3I53A 2L01A 2OQGA 4XLPF 3MQ0A 2JSCA 4UXNA 4P55A 3W6KB 1JHHA 1LJ9A 4CICA 3L09A 2GXBA 1XMKA 4XLNF 2YU3A 2QLZA 3DQVC 2XROA 3B02A 5CVRA 2EFQA 2B0LA 3ZP5A 4ZYDA 5DD4A 3F22A 3IRRA 3KP5A 3KCCA 1HKTA 3BP8A 1FWZA 4Y17A 1UHMA 2FOKA 3IHUA 4OIPF 4CYDA 1FT9A 4EV0A 2DO7A 3LSTA 3J81Z 1USTA 1MDMA 1K7AA 3KEOA 3TOBA 1IN7A 1RI7A 1SD4A 3RYRA 1IXSB 1I1GA 4A5NA 1XSVA 2LF7A 1RUNA 3I59A 3M1EA 3FXUA 3JAMK 3GUDA 3VEPA 5JI6A 4AIKA 2PMUA 1B9NA 3WTVC 5JVTA 4I0BA 4G94A 2IJLA 1TLHB 5BMZA 2KJCA 3KP6A 4R8HA 4CZZA 4LD5A 2P7VB 3WU1B 4B8XA 1J2XA 2DFIA 1XSXA 1ZRFA 5EEHA 3WGHA 1H9GA 2ZJ2A 2OBPA 1FYLA 3GFJA 1P4WA 4BXUA 2V1UA 2QWWA 3ISPA 4UUVA 2RNJA 3HHHA 2HEOA 1Z7UA 2HDCA 4G7ZF 2XASA 1KU9A 1R36A 4HZFA 1DUXC 5HS7A 2OU2A 3Q5FA 2VC0A 5LHIA 5CVIA 3GYHX 1RNLA 4A0ZA 3M8FA 3O2PE 3QP6A 4WXCA 1Z05A 3ZMSA 4LGWA 4KT5C 2MH2A 5EEGA 5H6QA 4L5JA 2FNAA 4I2OA 1SFUA 3KFWX 3BJAA 3MEXA 1Z1DA 2M8EA 4HF2A 1G4DA 4O5VA 1YFHA 5ILSA 2HFHA 2VE9A 4AVPA 1W7PB 3BWGA 3KEQA 3ULQB 3ZMVA 1O3SA 4EMSA 3IRQA 2L54A 4N9IA 3V8KA 3L7WA 1JGSA 3MCZA 2OZUA 1IN6A 4HV6A 5J6XA 3RKWA 3WTSC 1STZA 2YX7A 3ZN1A 1TW3A 2ZO4A 2VT3A 3L9FA 3FZVA 1O3QA 3RIRA 1C0WA 2A6HF 4IHTA 4IF4A 2HTJA 4U0WA 1IN8A 4OOIA 4KICA 3H3ZA 1J75A 4HBLA 1EH6A 2IPQX 1LEBA 4M72A 3KP2A 1U6GA 3WG9A 1QZZA 2HYFA 2IW5A 4EM2A 3N4MA 4KIGA 2P6SA 3IC7A 2PI0A 5K5OA 1TQIA 3W6JB 2Y75A 2OA4A 3BPXA 2NS0A 1WQ2A 3RJPA 1OYWA 2E7XA 2VOOA 2Y0MA 1LNWA 2X0LA 2PFBA 2R7DA 2VOPA 2VC1A 1WWXA 3HYIA 4LLNA 5E1ZB 2O03A 1ZREA 4G7HF 1XCVA 1ZARA 2ZFWA 2KIMA 2BE5F 1K78A 2L4MA 4HA8A 1G3SA 4R1HA 3GFMA 2MBFA 2WTEA 2HYGD 5A2QZ 4NQWA 1H0MA 3TDUC 3E5UA 3WE2A 1JHFA 2P7CB 2PLYA 3T8TA 4WK8F 2P6TA 2BYVE 2XIGA 2H94A 3C3WA 4PCQA 1KU2A 2RC4A 1FYKA 1ZG3A 2L02A 2QVOA 5JHUA 1ZLJA 3G3ZA 1TQPA 5HS8A 1DP7P 1LVAA 3HSEA 1XGOA 3HUGA 3JSOA 1TQMA 1PP7U 1J0RA 1W5SA 3LAJA 2V9VA 2IA2A 4PDKA 4ZZLA 2BV6A 3HSRA 4LMYA 1R1UA 2JPCA 4ZH4F 4OINF 2H27A 1MJ9A 2A68F 1YS7A 5D4SA 2D45A 4BNCA 2K7LA 2GQQA 4WF2A 2ZXJA 3FXRA 3E6MA 4ASNA 1GXQA 1WSUA 4IRGA 1F9NA 5DV5A 1U78A 2OQRA 2Z9OA 2Z5UA 4I98B 1J7KA 4UV8A 3GFLA 1FLIA 2F5FA 1YS6A 4G6QA 3PQKA 2ISZA 2XAFA 1KA8A 3FF5A 4IJAA 3T0YA 4KA4A 4YG2F 1ZG5A 3IWZA 1R00A 2LDUA 4U7BA 4LG0A 4A0YA 5E1XA 3B73A 1W7PD 2DTRA 5H6RA 1YO5C 3JTGA 3R61A 3V8LA 4FT8A 1A04A 2M1BA 1BN5A 1E2XA 5L3GA 5D5VB 4ZYEA 2HOEA 2GIVA 3E5QA 1FY7A 4HV5A 4ETSA 1O7LA 1HSTA 5K5QA 2DK8A 1E17A 3T1BA 3HTSB 3JTHA 1IAWA 5K5RA 2XHKA 2DW4A 4OIRF 2Q8KA 5LGUA 2PJPA 2M30A 3I71A 1BI2A 1G3TA 1EH8A 1U5TB 3MWMA 2DI3A 3ZMUA 1K79A 4I02A 3NRVA 5DYMA 1QGPA 1R5HA 5CVVA 5AIPA 1JXSA 1R7JA 3WTYC 4CDGA 4H0EA 3ERED 3CO6C 5ERIA 1T39A 1X3UA 1YTYA 5LEKA 3HOSA 4CHUA 2VBZA 1R1TA 4EJUA 1ODDA 2CO5A 3HRUA 1I27A 5DUKA 1G3YA 2EK5A 5FLXK 2K27A 5F6FA 2VBWA 2GXGA 4NHJA 1BOAA 4U7DA 3F23A 4HW0A 1HKSA 4GYGA 4PZJA 2CW0F 2EFOA 3GW2A 1BBYA 2O0YA 2W85A 4UHTA 4Q4ZF 4KNYA 3BDDA 2OZ6A 4AIHA 4RGSA 4A6DA 2F5CA 3KE2A 2XAJA 5ICFA 3H3UA 2A3SA 3V7SA 3DFGA 3WGIA 4YIFA 5HLHA 4WCGA 2CWEA 2VONA 4RB1A 1BC8C 4JQFA 2RKHA 2FBHA 2G7UA 1B9MA 2ZMEA 2FMLA 2DQRA 5L3BA 4ENNA 2HR3A 2CYYA 5D8KB 3HSFA 4EVIA 3GLXA 3V4GA 1L3LA 1JE8A 1J9IA 2A6EF 3QU3A 3JAMZ 3O3KA 3E6CC 1FP1D 4I7HA 3LA7A 4MQVA 4BAYA 1ZN2A 1TW2A 1CGPA 4I01A 2ZNZA 3ZMDA 2D1VA 2P5KA 4MHGA 3WODF 5IT9K 1SD7A 3D0SA 3EUHA 5IT3A 4CO8A 3DP7A 1J5YA 1EV7A 1SD5A 1P92A 2VBYA 2A07F 1KQ9A 2RDPA 2O3FA 3DKWA 4G6DA 4B09A 3BZ6A 4P9UA 4S05A 2FU4A 1DPRA 1S7AA 4G9YA 2FQ3A 4N9HA 4G7OF 1OYYA 5HDGA 1PUEE 4DQ2A 3JW4A 3IKVA 4L9JA 3HOTA 5E20A 5J8CA 2HZTA 1ZGJA 5CYVA 3MZHA 1T6SA 1MZBA 3ABUA 5CVJA 5ILUA 5FGMA 5BPDA 4BQAA 1TTYA 4OU0A 2HKXA 3K2ZA 2H6BA 4IHSA 1R5GA 4OMZA 2EFWA 4EM0B 1IN4A 1AOYA 3RYPA 3WTXC 2W57A 2ZBKA 4D0PA 3LQQA 1U3EM 3D5LA 2M5WA 1YG2A 2PMHA 5LHHA 3I64A 3RKXA 4YIIA 1V3FA 3F21A 4HLYA 4M9ZA 1FP2A 2BBYA 1ZYRF 3QPTA 5DD8A 2LSOA 4M9XA 2QQBA 3CLOA 1OR7A 1XN7A 2GAUA 3E3VA 3R0JA 1XSDA 1Z91A 2DK5A 3WTWC 2IT0A 3EYYA 2JTVA 2MA3A 5BOXA 2XKPA 5HVQC 2ESHA 1FNNA 3K9TA 3GFIA 2DAOA 3E97A 2CQKA 3LA3A 5KK1A 2H09A 3U1DA 2FSWA 4IRIA 2AS5F 1SMYF 4F7ZA 1FBQA 3R60A 4LLLA 2HTSA 4AWXB 1LDKB 5J8FA 3BJOA 1ZGAA 1MDMB 3P9KA 4KMFA 1S8NA 1MGTA 3JSPA 1MKMA 4M9SA 4Q48A 1I1SA 1EH7A 5K1YA 3MAJA 1LDDA 2QYOA 1WRJA 2VE8A 3I59B 4RB3C 3IL2A 1D3YA 4JBAA 2Z99A 3M8EA 4ENMA 2MLKA 3LAPA 4HLXA 3TGNA 3R0AA 2MLGA 2RVCA 2XAQA 3GO5A 4ZZDA 4FX0A 3F6OA 4U0VA 3LA2A 4Q5SF 5HDKA 3F6VA 4KMUX 1XGNA 3CDHA 2CGPA 3R4KA 2DQLA 4CGZA 2UXNA 3PQJA 1MD0A 1F1ZA 2WV0A 4LFUA 3SXYA 3H92A 2FBIA 3L2CA 2Q0OA 2XKOA 3FX3A 2Q2EA 3F8CA 5D5XB 1ZAOA 3DF8A 3K1PA 3BJ6A 1FBSA 3Q9VA 3M9AA 5L3EA 3TOAA 4UV9A 5FFZA 2VBXA 3KP4A 3QU6A 4R79A 2ZCWA 2GZWA 1TBXA 5LLQA 3M7GA 4U0YA 2JPBA 4EM1A 2HWVA 1D8KA 4RAYA 3DXJF 3TO7A 2FNPA 4ESFA 2QBYA 1BIBA 4IXAA 1REPC 2ETHA 4NB5A 5LGNA 4Z2YA 1ZRDA 1QZYA 3ROUA 4A2UA 4HDUA 5HDNA 1QPMA 2E1NA 2J5PA 4L9NA 2L3DA 3AAFA 1XB4A 1SD6A 1B4AA 4WWCA 3CJNA 4HX8A 3CUQA 2V79A 2C6YA 4A6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIO F;  1ZHF A;  2TDX A;  2PQ8 A;  1IRG A;  3CUO A;  2A69 F;  2DU9 A;  5A2Q K;  4M6Y A;  1XGS A;  5L3D A;  1RIO H;  5AON A;  1S3J A;  2EV6 A;  2O8X A;  2V1X A;  2NNY A;  2G7H A;  3K1M A;  4BYY A;  2GA2 A;  1K6O A;  3RKY A;  1T2K A;  5DCF A;  3V7C A;  3QOP A;  1L0O C;  3SQN A;  4XSZ F;  4EGY A;  1YIO A;  3J80 K;  4O6J A;  4AIJ A;  1FC3 A;  2JT1 A;  1ON2 A;  3T5X A;  3E6B A;  4ZYG A;  3K69 A;  4P5O A;  2BGC A;  2RN7 A;  3GZ6 A;  2R3S A;  4KDP A;  4P96 A;  2K86 A;  1TNS A;  2EV5 A;  1BJA A;  1BI0 A;  2XAH A;  3GEZ A;  4EJT A;  2EA2 A;  1U8R A;  1WKM A;  4GCV A;  2KKO A;  2W84 A;  4UNO A;  1SFX A;  2HQN A;  4E70 A;  4ESB A;  3U9G A;  1KQ8 A;  3TQN A;  3RTR A;  2JRT A;  1CF7 A;  3CUQ C;  4MTD A;  2KRF A;  2NRA C;  1USS A;  1K78 B;  2EJR A;  5FLX Z;  3K0L A;  5D6E A;  3R6S A;  4RAZ A;  1XDS A;  1IUY A;  3LFK A;  2E7W A;  3GWZ A;  2G9W A;  1UCR A;  3V8J A;  4PGH A;  3GX4 X;  3I4P A;  4XSX F;  1ON1 A;  2QZ8 A;  3ELK A;  2LKP A;  5E18 F;  2P4W A;  4ESJ A;  5H20 A;  5D5U B;  4I0A A;  2UWM A;  3RDI A;  1O3T A;  1S29 A;  4WXD A;  3GZ5 A;  3E6D A;  2VXZ A;  2CSO A;  3EYI A;  1D8J A;  4L0Y B;  4BH9 A;  2F2E A;  2FA5 A;  3F8N A;  1T98 A;  5ICC A;  1HXD A;  1KYW A;  4L5I A;  5ICG A;  3OV8 A;  4Y15 A;  2M87 A;  2QQA A;  3SZP A;  1IW7 F;  3T8R A;  4KIB A;  5LRR A;  1FSH A;  4QWQ A;  3ML6 A;  2DLL A;  1GVJ A;  3KET A;  3LWF A;  2XV4 S;  5LHG A;  1HQC A;  4M6X A;  3KLO A;  1VTN C;  4GO1 A;  1IXR C;  1FZP B;  3QRF F;  5TRD A;  3MFK A;  4QLC U;  1FX7 A;  5FD5 A;  1UHW A;  4ON0 A;  1HKQ A;  1KGS A;  4HDV A;  4L0Z B;  3QAH A;  4LG0 B;  4RB2 C;  3NEU A;  1IRF A;  1SAX A;  4OIQ F;  3REO A;  5IT9 Z;  2EFN A;  2K02 A;  2GA1 A;  3G73 A;  3QP5 A;  4EQQ A;  4RGX A;  3KZY A;  1QNT A;  3VFZ A;  5HOO A;  3Q9S A;  3J7A O;  4ENJ A;  1YW7 A;  4UVA A;  1G6N A;  4MNU A;  1W7P A;  1R58 A;  2ADU A;  2Y48 A;  2FMY A;  1HBX G;  2RQP A;  3ZMZ A;  5E17 F;  1Z9C A;  2RGV A;  4KN4 X;  3TKY A;  1CF7 B;  3IWF A;  5D4R A;  1QO0 D;  3RPQ A;  4A0X A;  4MEX F;  2UZK A;  4UVC A;  5FD6 A;  4N0B A;  1J59 A;  5D8L B;  3HHG A;  3C7J A;  6PAX A;  1KQ0 A;  2OD5 A;  1IN5 A;  5FO5 A;  4Q47 A;  3C18 A;  1YQA A;  5AIQ A;  2CG4 A;  1LEA A;  5LBQ A;  1DPU A;  1G3W A;  1NHA A;  5CLS A;  3L00 A;  1ONV A;  2ISY A;  4EJO A;  3SZT A;  3HRM A;  1I5Z A;  4M74 A;  3ZMT A;  5ILV A;  3OOP A;  2V1D A;  3GXO A;  5E1W A;  2ELH A;  5DUI A;  3N97 A;  2VT2 A;  5L3F A;  4RB0 A;  1OKR A;  4MGR A;  3BPV A;  2A5Y B;  1YLF A;  2X4H A;  1GXP A;  4PGG A;  4LB5 A;  5FB2 A;  4K2E A;  1XCB A;  3J81 K;  1F4K A;  4M71 A;  3WGG A;  3WTZ A;  4TV7 A;  2J5O A;  4ENK A;  2IA0 A;  2QUF A;  1XGM A;  4DNC A;  3DV8 A;  3P9I A;  4HX7 A;  1FSE A;  1QQI A;  3HRT A;  4HQE A;  2KJB A;  4XBF A;  1HW2 A;  3C1D A;  1T0F A;  5HS9 A;  1HW1 A;  2PN6 A;  2XRN A;  3I5U A;  3WTU C;  2ACJ A;  3FMQ A;  3P7N A;  1HW5 A;  2NYX A;  1P6R A;  5LRS A;  1O7F A;  1R23 A;  3O6B B;  2KIU A;  5TJJ A;  1Y0U A;  4LK0 F;  2ZKZ A;  2EA4 A;  3V7R A;  2ZME B;  1XDU A;  4CXF A;  5KVR A;  1PP8 F;  1YW8 A;  4EGZ A;  2MC3 A;  2FE3 A;  1TNT A;  3WTT C;  4U88 A;  4KN7 X;  1PDN C;  2PG4 A;  1MJB A;  1XD7 A;  2YSR A;  1O57 A;  3I54 A;  3P9C A;  4MEY F;  1QBJ A;  2DT5 A;  4MQ9 F;  4LK1 F;  2QQ9 A;  3EDP A;  3F3X A;  3DEU A;  5HLI A;  1DDN A;  5L3C A;  1LDJ A;  4A5M A;  4AD9 A;  4RGU A;  4KYW A;  3FHZ A;  2A61 A;  2FF4 A;  2MD5 A;  4JK1 X;  2XUB A;  3F72 A;  3ECH A;  3BRO A;  1ULY A;  3LQR A;  5E8I A;  4YFX F;  2LF8 A;  4L9T A;  2EB7 A;  1OYI A;  2NAZ A;  3MZY A;  4Y13 A;  2D1H A;  5ICE A;  4RS8 A;  1Z6T A;  2EWN A;  1SFE A;  4S04 A;  4L18 B;  4M73 A;  3FXQ A;  2QM3 A;  2NNN A;  3FMR A;  2K4B A;  3KZZ A;  2W25 A;  4HAM A;  1IXC A;  1B6A A;  2BEO A;  1BIA A;  3E5X A;  2STW A;  3FM5 A;  5FFX A;  1F5T A;  1BC7 C;  1FOK A;  2WC2 A;  3VOD A;  3ZQ7 A;  1S6L A;  4HOB A;  4YFN F;  4OMY A;  3WU0 A;  4IRH A;  1LQ1 A;  3BOQ A;  5LEJ A;  2IA1 A;  2MH9 A;  3K1N A;  1ZH5 A;  1WI9 A;  2O6G E;  4O3M A;  1FBU A;  1YW9 A;  1ZLK A;  3EQL F;  4L9V A;  1R1V A;  1P4A A;  2PEX A;  2P8T A;  2UXX A;  4FX4 A;  2AXL A;  2ESN A;  1I6X A;  1U5T A;  2E1C A;  4G8X A;  1W4M A;  3U2R A;  4LB6 B;  1UB9 A;  1SMT A;  2P5L C;  1FYM A;  2F5D A;  3J80 Z;  3SFZ A;  1LB2 A;  2YR2 A;  1O3R A;  3QPH A;  2JZY A;  2DPD A;  3FWE A;  3ABT A;  1Q1H A;  2HQR A;  1W5T A;  4YFK F;  5DCM A;  1XMA A;  4FHT A;  1GHC A;  4WXH A;  5DEQ A;  3TO6 A;  4GXO A;  2FXA A;  5F64 A;  1P2F A;  4EJW A;  5F1R A;  2D2W A;  1KU7 A;  2RV8 A;  3F8F A;  4LLG F;  2WWY A;  2XAG A;  2K4J A;  2V6C A;  3DPT A;  4MTE A;  5CJ9 A;  3HIF A;  5LGT A;  1OPC A;  2FBK A;  4HYE A;  1BI3 A;  5HLG A;  5JFR A;  2Z3Y A;  3GVA A;  1ZG1 A;  1R22 A;  2R7F A;  2W24 A;  3GF2 A;  4EJV A;  4RGR A;  3IKT A;  1BM9 A;  2DPU A;  1RUO A;  1YYV A;  3DPL C;  2P5V A;  2L4A A;  4HF1 A;  1U5T C;  1U2W A;  3TDZ C;  2FEZ A;  2HS5 A;  2IP2 A;  2YX4 A;  4A12 A;  3NQO A;  2COM A;  4UVB A;  4ZYH A;  5ED4 A;  2XVC A;  4KUM A;  4XRF A;  1B59 A;  1IF1 A;  1HSJ A;  3PFI A;  5JR3 A;  1B1B A;  3I0T A;  3TO9 A;  5D5W B;  3VOE A;  2H6C A;  4IVN A;  2HGC A;  4BHC A;  4KIF A;  4P9F A;  2O61 A;  3FMS A;  3WE3 A;  4WX9 A;  5BQT A;  4HQM A;  3VB2 A;  1UFM A;  3RI4 A;  3I58 A;  1V4R A;  1Z6R A;  2IRF G;  1AWC A;  2QBY B;  4GGG A;  1ZRC A;  5E8G A;  3ECO A;  2M45 A;  4KFC A;  1P4X A;  1KYZ A;  2OAZ A;  3SHF A;  4HX4 A;  2YPR A;  5CVU A;  2CFX A;  1OMI A;  4LJZ F;  2IVM A;  1T38 A;  3F8B A;  2QEN A;  3CUQ B;  1H9T A;  5BS6 A;  5D6F A;  3FM3 A;  1KU3 A;  1IZ1 A;  1BI1 A;  2ZNY A;  3S2W A;  2GWR A;  3COA C;  4BHB A;  3HRS A;  3EET A;  5DCM B;  4IPA A;  1RZ4 A;  2EFP A;  1MJA A;  4HF0 A;  2F5E A;  1S7O A;  4BHP A;  2VOD A;  4I09 A;  3BY6 A;  4GYI A;  1D5V A;  3KLN A;  3ZN0 A;  3CTA A;  2HKO A;  2FRH A;  5BPI A;  1FPQ A;  5DDG A;  2XGX A;  2VN2 A;  3ZPL A;  2LNB A;  3F8M A;  2EV0 A;  3RPU A;  3CO7 C;  2STT A;  2DBB A;  2Z33 A;  2PBI A;  3HTU A;  3KP7 A;  2KIF A;  3KP3 A;  3I53 A;  2L01 A;  2OQG A;  4XLP F;  3MQ0 A;  2JSC A;  4UXN A;  4P55 A;  3W6K B;  1JHH A;  1LJ9 A;  4CIC A;  3L09 A;  2GXB A;  1XMK A;  4XLN F;  2YU3 A;  2QLZ A;  3DQV C;  2XRO A;  3B02 A;  5CVR A;  2EFQ A;  2B0L A;  3ZP5 A;  4ZYD A;  5DD4 A;  3F22 A;  3IRR A;  3KP5 A;  3KCC A;  1HKT A;  3BP8 A;  1FWZ A;  4Y17 A;  1UHM A;  2FOK A;  3IHU A;  4OIP F;  4CYD A;  1FT9 A;  4EV0 A;  2DO7 A;  3LST A;  3J81 Z;  1UST A;  1MDM A;  1K7A A;  3KEO A;  3TOB A;  1IN7 A;  1RI7 A;  1SD4 A;  3RYR A;  1IXS B;  1I1G A;  4A5N A;  1XSV A;  2LF7 A;  1RUN A;  3I59 A;  3M1E A;  3FXU A;  3JAM K;  3GUD A;  3VEP A;  5JI6 A;  4AIK A;  2PMU A;  1B9N A;  3WTV C;  5JVT A;  4I0B A;  4G94 A;  2IJL A;  1TLH B;  5BMZ A;  2KJC A;  3KP6 A;  4R8H A;  4CZZ A;  4LD5 A;  2P7V B;  3WU1 B;  4B8X A;  1J2X A;  2DFI A;  1XSX A;  1ZRF A;  5EEH A;  3WGH A;  1H9G A;  2ZJ2 A;  2OBP A;  1FYL A;  3GFJ A;  1P4W A;  4BXU A;  2V1U A;  2QWW A;  3ISP A;  4UUV A;  2RNJ A;  3HHH A;  2HEO A;  1Z7U A;  2HDC A;  4G7Z F;  2XAS A;  1KU9 A;  1R36 A;  4HZF A;  1DUX C;  5HS7 A;  2OU2 A;  3Q5F A;  2VC0 A;  5LHI A;  5CVI A;  3GYH X;  1RNL A;  4A0Z A;  3M8F A;  3O2P E;  3QP6 A;  4WXC A;  1Z05 A;  3ZMS A;  4LGW A;  4KT5 C;  2MH2 A;  5EEG A;  5H6Q A;  4L5J A;  2FNA A;  4I2O A;  1SFU A;  3KFW X;  3BJA A;  3MEX A;  1Z1D A;  2M8E A;  4HF2 A;  1G4D A;  4O5V A;  1YFH A;  5ILS A;  2HFH A;  2VE9 A;  4AVP A;  1W7P B;  3BWG A;  3KEQ A;  3ULQ B;  3ZMV A;  1O3S A;  4EMS A;  3IRQ A;  2L54 A;  4N9I A;  3V8K A;  3L7W A;  1JGS A;  3MCZ A;  2OZU A;  1IN6 A;  4HV6 A;  5J6X A;  3RKW A;  3WTS C;  1STZ A;  2YX7 A;  3ZN1 A;  1TW3 A;  2ZO4 A;  2VT3 A;  3L9F A;  3FZV A;  1O3Q A;  3RIR A;  1C0W A;  2A6H F;  4IHT A;  4IF4 A;  2HTJ A;  4U0W A;  1IN8 A;  4OOI A;  4KIC A;  3H3Z A;  1J75 A;  4HBL A;  1EH6 A;  2IPQ X;  1LEB A;  4M72 A;  3KP2 A;  1U6G A;  3WG9 A;  1QZZ A;  2HYF A;  2IW5 A;  4EM2 A;  3N4M A;  4KIG A;  2P6S A;  3IC7 A;  2PI0 A;  5K5O A;  1TQI A;  3W6J B;  2Y75 A;  2OA4 A;  3BPX A;  2NS0 A;  1WQ2 A;  3RJP A;  1OYW A;  2E7X A;  2VOO A;  2Y0M A;  1LNW A;  2X0L A;  2PFB A;  2R7D A;  2VOP A;  2VC1 A;  1WWX A;  3HYI A;  4LLN A;  5E1Z B;  2O03 A;  1ZRE A;  4G7H F;  1XCV A;  1ZAR A;  2ZFW A;  2KIM A;  2BE5 F;  1K78 A;  2L4M A;  4HA8 A;  1G3S A;  4R1H A;  3GFM A;  2MBF A;  2WTE A;  2HYG D;  5A2Q Z;  4NQW A;  1H0M A;  3TDU C;  3E5U A;  3WE2 A;  1JHF A;  2P7C B;  2PLY A;  3T8T A;  4WK8 F;  2P6T A;  2BYV E;  2XIG A;  2H94 A;  3C3W A;  4PCQ A;  1KU2 A;  2RC4 A;  1FYK A;  1ZG3 A;  2L02 A;  2QVO A;  5JHU A;  1ZLJ A;  3G3Z A;  1TQP A;  5HS8 A;  1DP7 P;  1LVA A;  3HSE A;  1XGO A;  3HUG A;  3JSO A;  1TQM A;  1PP7 U;  1J0R A;  1W5S A;  3LAJ A;  2V9V A;  2IA2 A;  4PDK A;  4ZZL A;  2BV6 A;  3HSR A;  4LMY A;  1R1U A;  2JPC A;  4ZH4 F;  4OIN F;  2H27 A;  1MJ9 A;  2A68 F;  1YS7 A;  5D4S A;  2D45 A;  4BNC A;  2K7L A;  2GQQ A;  4WF2 A;  2ZXJ A;  3FXR A;  3E6M A;  4ASN A;  1GXQ A;  1WSU A;  4IRG A;  1F9N A;  5DV5 A;  1U78 A;  2OQR A;  2Z9O A;  2Z5U A;  4I98 B;  1J7K A;  4UV8 A;  3GFL A;  1FLI A;  2F5F A;  1YS6 A;  4G6Q A;  3PQK A;  2ISZ A;  2XAF A;  1KA8 A;  3FF5 A;  4IJA A;  3T0Y A;  4KA4 A;  4YG2 F;  1ZG5 A;  3IWZ A;  1R00 A;  2LDU A;  4U7B A;  4LG0 A;  4A0Y A;  5E1X A;  3B73 A;  1W7P D;  2DTR A;  5H6R A;  1YO5 C;  3JTG A;  3R61 A;  3V8L A;  4FT8 A;  1A04 A;  2M1B A;  1BN5 A;  1E2X A;  5L3G A;  5D5V B;  4ZYE A;  2HOE A;  2GIV A;  3E5Q A;  1FY7 A;  4HV5 A;  4ETS A;  1O7L A;  1HST A;  5K5Q A;  2DK8 A;  1E17 A;  3T1B A;  3HTS B;  3JTH A;  1IAW A;  5K5R A;  2XHK A;  2DW4 A;  4OIR F;  2Q8K A;  5LGU A;  2PJP A;  2M30 A;  3I71 A;  1BI2 A;  1G3T A;  1EH8 A;  1U5T B;  3MWM A;  2DI3 A;  3ZMU A;  1K79 A;  4I02 A;  3NRV A;  5DYM A;  1QGP A;  1R5H A;  5CVV A;  5AIP A;  1JXS A;  1R7J A;  3WTY C;  4CDG A;  4H0E A;  3ERE D;  3CO6 C;  5ERI A;  1T39 A;  1X3U A;  1YTY A;  5LEK A;  3HOS A;  4CHU A;  2VBZ A;  1R1T A;  4EJU A;  1ODD A;  2CO5 A;  3HRU A;  1I27 A;  5DUK A;  1G3Y A;  2EK5 A;  5FLX K;  2K27 A;  5F6F A;  2VBW A;  2GXG A;  4NHJ A;  1BOA A;  4U7D A;  3F23 A;  4HW0 A;  1HKS A;  4GYG A;  4PZJ A;  2CW0 F;  2EFO A;  3GW2 A;  1BBY A;  2O0Y A;  2W85 A;  4UHT A;  4Q4Z F;  4KNY A;  3BDD A;  2OZ6 A;  4AIH A;  4RGS A;  4A6D A;  2F5C A;  3KE2 A;  2XAJ A;  5ICF A;  3H3U A;  2A3S A;  3V7S A;  3DFG A;  3WGI A;  4YIF A;  5HLH A;  4WCG A;  2CWE A;  2VON A;  4RB1 A;  1BC8 C;  4JQF A;  2RKH A;  2FBH A;  2G7U A;  1B9M A;  2ZME A;  2FML A;  2DQR A;  5L3B A;  4ENN A;  2HR3 A;  2CYY A;  5D8K B;  3HSF A;  4EVI A;  3GLX A;  3V4G A;  1L3L A;  1JE8 A;  1J9I A;  2A6E F;  3QU3 A;  3JAM Z;  3O3K A;  3E6C C;  1FP1 D;  4I7H A;  3LA7 A;  4MQV A;  4BAY A;  1ZN2 A;  1TW2 A;  1CGP A;  4I01 A;  2ZNZ A;  3ZMD A;  2D1V A;  2P5K A;  4MHG A;  3WOD F;  5IT9 K;  1SD7 A;  3D0S A;  3EUH A;  5IT3 A;  4CO8 A;  3DP7 A;  1J5Y A;  1EV7 A;  1SD5 A;  1P92 A;  2VBY A;  2A07 F;  1KQ9 A;  2RDP A;  2O3F A;  3DKW A;  4G6D A;  4B09 A;  3BZ6 A;  4P9U A;  4S05 A;  2FU4 A;  1DPR A;  1S7A A;  4G9Y A;  2FQ3 A;  4N9H A;  4G7O F;  1OYY A;  5HDG A;  1PUE E;  4DQ2 A;  3JW4 A;  3IKV A;  4L9J A;  3HOT A;  5E20 A;  5J8C A;  2HZT A;  1ZGJ A;  5CYV A;  3MZH A;  1T6S A;  1MZB A;  3ABU A;  5CVJ A;  5ILU A;  5FGM A;  5BPD A;  4BQA A;  1TTY A;  4OU0 A;  2HKX A;  3K2Z A;  2H6B A;  4IHS A;  1R5G A;  4OMZ A;  2EFW A;  4EM0 B;  1IN4 A;  1AOY A;  3RYP A;  3WTX C;  2W57 A;  2ZBK A;  4D0P A;  3LQQ A;  1U3E M;  3D5L A;  2M5W A;  1YG2 A;  2PMH A;  5LHH A;  3I64 A;  3RKX A;  4YII A;  1V3F A;  3F21 A;  4HLY A;  4M9Z A;  1FP2 A;  2BBY A;  1ZYR F;  3QPT A;  5DD8 A;  2LSO A;  4M9X A;  2QQB A;  3CLO A;  1OR7 A;  1XN7 A;  2GAU A;  3E3V A;  3R0J A;  1XSD A;  1Z91 A;  2DK5 A;  3WTW C;  2IT0 A;  3EYY A;  2JTV A;  2MA3 A;  5BOX A;  2XKP A;  5HVQ C;  2ESH A;  1FNN A;  3K9T A;  3GFI A;  2DAO A;  3E97 A;  2CQK A;  3LA3 A;  5KK1 A;  2H09 A;  3U1D A;  2FSW A;  4IRI A;  2AS5 F;  1SMY F;  4F7Z A;  1FBQ A;  3R60 A;  4LLL A;  2HTS A;  4AWX B;  1LDK B;  5J8F A;  3BJO A;  1ZGA A;  1MDM B;  3P9K A;  4KMF A;  1S8N A;  1MGT A;  3JSP A;  1MKM A;  4M9S A;  4Q48 A;  1I1S A;  1EH7 A;  5K1Y A;  3MAJ A;  1LDD A;  2QYO A;  1WRJ A;  2VE8 A;  3I59 B;  4RB3 C;  3IL2 A;  1D3Y A;  4JBA A;  2Z99 A;  3M8E A;  4ENM A;  2MLK A;  3LAP A;  4HLX A;  3TGN A;  3R0A A;  2MLG A;  2RVC A;  2XAQ A;  3GO5 A;  4ZZD A;  4FX0 A;  3F6O A;  4U0V A;  3LA2 A;  4Q5S F;  5HDK A;  3F6V A;  4KMU X;  1XGN A;  3CDH A;  2CGP A;  3R4K A;  2DQL A;  4CGZ A;  2UXN A;  3PQJ A;  1MD0 A;  1F1Z A;  2WV0 A;  4LFU A;  3SXY A;  3H92 A;  2FBI A;  3L2C A;  2Q0O A;  2XKO A;  3FX3 A;  2Q2E A;  3F8C A;  5D5X B;  1ZAO A;  3DF8 A;  3K1P A;  3BJ6 A;  1FBS A;  3Q9V A;  3M9A A;  5L3E A;  3TOA A;  4UV9 A;  5FFZ A;  2VBX A;  3KP4 A;  3QU6 A;  4R79 A;  2ZCW A;  2GZW A;  1TBX A;  5LLQ A;  3M7G A;  4U0Y A;  2JPB A;  4EM1 A;  2HWV A;  1D8K A;  4RAY A;  3DXJ F;  3TO7 A;  2FNP A;  4ESF A;  2QBY A;  1BIB A;  4IXA A;  1REP C;  2ETH A;  4NB5 A;  5LGN A;  4Z2Y A;  1ZRD A;  1QZY A;  3ROU A;  4A2U A;  4HDU A;  5HDN A;  1QPM A;  2E1N A;  2J5P A;  4L9N A;  2L3D A;  3AAF A;  1XB4 A;  1SD6 A;  1B4A A;  4WWC A;  3CJN A;  4HX8 A;  3CUQ A;  2V79 A;  2C6Y A;  4A6E A; 
#chains in the Genus database with same CATH topology
 2RNG A;  1VFC A;  4OIO F;  1ZHF A;  2VQL A;  2TDX A;  2PQ8 A;  1IRG A;  3CUO A;  2A69 F;  1QVT A;  3H35 A;  4CYC A;  1Y8R B;  2DU9 A;  5A2Q K;  4DW6 A;  4M6Y A;  1XGS A;  2KIS A;  5L3D A;  2WAE A;  1RIO H;  5AON A;  1S3J A;  2EV6 A;  2O8X A;  2V1X A;  1N77 A;  2NNY A;  3W2W A;  3RPU D;  2G7H A;  1TP4 A;  3K4M A;  1VQN I;  3A0B C;  3K1M A;  2CUZ A;  4BYY A;  1BJZ A;  2GA2 A;  1K6O A;  2DFE A;  3RKY A;  1QA6 A;  1T2K A;  2M4K A;  5DCF A;  3V7C A;  3I4M J;  3QOP A;  1L0O C;  3SQN A;  4XSZ F;  4EGY A;  1YIO A;  3J80 K;  4O6J A;  3HOX J;  4XLF A;  1TWF J;  4AIJ A;  2HDW A;  1FC3 A;  3JCU C;  1MMA A;  5KAF C;  1K6Y A;  2VI6 A;  2JT1 A;  2IGM A;  2JRM A;  3RZO J;  2X85 A;  3DTE A;  1ON2 A;  5HNF A;  3T5X A;  1BW5 A;  2P81 A;  3E6B A;  4ZYG A;  3K69 A;  4P5O A;  2B63 J;  2BGC A;  1RKT A;  2RN7 A;  4E7J A;  2EZI A;  2M0C A;  3GZ6 A;  2DOE A;  2R3S A;  4KDP A;  4P96 A;  2K86 A;  4W97 A;  1TNS A;  2EV5 A;  1BJA A;  5FLM J;  4PJJ A;  2CV2 A;  5LFA A;  1BI0 A;  2WAQ A;  2XAH A;  3IV5 A;  3CCY A;  3GEZ A;  4EJT A;  2EA2 A;  1U8R A;  5E3M A;  2R0Q C;  2OUM A;  3Q0W A;  1WKM A;  3BR1 A;  2KKO A;  4GCV A;  3MKW B;  5CQE A;  1J09 A;  2W84 A;  4XL9 A;  2ZJP F;  1F43 A;  4UNO A;  3BG5 A;  5F0C A;  2O9L A;  4JYK A;  1TWC J;  2VJ5 A;  3H1C A;  4HST A;  1SFX A;  3X2Q H;  5IOZ A;  2HQN A;  2BXZ A;  4E70 A;  4ESB A;  3U9G A;  5IYC J;  4XIC A;  3KYD B;  2VXD A;  1KQ8 A;  1MBH A;  3TQN A;  3D5S C;  2JRT A;  3RTR A;  1CF7 A;  3CUQ C;  1Y1V J;  4MTD A;  2KRF A;  1QHG A;  3LMM A;  5IP7 J;  3CC2 I;  1IJW C;  2NRA C;  1USS A;  3K4N A;  2V7F A;  3JRH A;  1K78 B;  2EJR A;  5FLX Z;  2EZH A;  2KDO A;  3IH4 A;  3K0L A;  5DS9 A;  5D6E A;  3R6S A;  2F4M B;  4RAZ A;  1XDS A;  2HVQ A;  1IUY A;  4YEJ A;  4MFE A;  2HI3 A;  2E2J J;  3LFK A;  2E7W A;  3GWZ A;  4FE7 A;  2G9W A;  2E1O A;  1UCR A;  3V8J A;  4PGH A;  3ZQC A;  1SFK A;  2EIM H;  4D9J A;  3GX4 X;  1MBE A;  4F91 B;  4HG2 A;  3I4P A;  4XSX F;  4DZJ A;  4RBO A;  4A3C J;  1ON1 A;  2QZ8 A;  3E0J B;  4HNT A;  3OYN A;  3ELK A;  5JLX A;  2LKP A;  3OYG A;  2W48 A;  5E18 F;  2P4W A;  3HUG B;  4ESJ A;  5H20 A;  5D5U B;  4I0A A;  2UWM A;  4AID A;  3RDI A;  1O3T A;  2F4I A;  3JRA A;  2QCO A;  3UR3 C;  1S29 A;  4WXD A;  3GZ5 A;  2E19 A;  3OYD A;  1FJL A;  3E6D A;  2VXZ A;  2CSO A;  1I50 J;  3CCM I;  3HB9 A;  3EYI A;  1ZR4 A;  4I6Z A;  4RAF A;  2R7R A;  4BQO A;  1D8J A;  4L0Y B;  4DGW B;  4BH9 A;  3H5N A;  2F2E A;  4N4N B;  4HEA 2;  4XLC A;  4NBQ A;  2FA5 A;  2WB1 A;  3F8N A;  4HPQ A;  3BR3 A;  1T98 A;  4DZP A;  5ICC A;  3M8J A;  4M3G A;  3QYE A;  1HXD A;  1KYW A;  4L5I A;  5ICG A;  3OV8 A;  4Y15 A;  4CCK A;  4FET A;  2M87 A;  2QQA A;  1VQL I;  1IRZ A;  3SZP A;  1IW7 F;  3T8R A;  1BL0 A;  4KIB A;  5LRR A;  1WH7 A;  1X1B A;  1FSH A;  2FX0 A;  3FK7 A;  3L2Q A;  4QWQ A;  4MLO A;  3ML6 A;  2DLL A;  1GVJ A;  2DMQ A;  3KET A;  3FBI B;  4A3K J;  3BTJ A;  3LWF A;  2XV4 S;  2DFH A;  4LIU A;  3AG1 H;  5LHG A;  1D0X A;  1HQC A;  4M6X A;  3OR1 C;  3KLO A;  2WA0 A;  1VTN C;  2M34 A;  4GO1 A;  1IXR C;  1FZP B;  1VND A;  2DYS H;  1W5C C;  3QRF F;  5TRD A;  3MFK A;  4QLC U;  3FKJ A;  3GBG A;  1FX7 A;  4B47 A;  3SEZ A;  2KDZ A;  5FD5 A;  3PUB A;  1UHW A;  4ON0 A;  1HKQ A;  4XQF A;  1KGS A;  4HDV A;  1XX5 A;  2F4O B;  1NG7 A;  3MVP A;  4L0Z B;  2NVY J;  1ETQ A;  1TT0 A;  1TZL A;  5HOD A;  3QAH A;  4LG0 B;  5BNG A;  4RB2 C;  3OYH A;  4XOP A;  4A3J J;  2B7E A;  3NEU A;  1IRF A;  1SAX A;  4OIQ F;  3REO A;  5IT9 Z;  2EFN A;  2K02 A;  2GA1 A;  3G73 A;  4D5F A;  4XKC A;  3QP5 A;  1ITY A;  4EQQ A;  1LVK A;  4RGX A;  3KZY A;  2HXO A;  1QNT A;  2LR8 A;  3OYE A;  3VFZ A;  2CMP A;  4FCY A;  2MGQ A;  5HOO A;  3P5J A;  3JRC A;  3Q9S A;  2KMU A;  3J7A O;  4ENJ A;  1WJE A;  2KL4 A;  1YJN I;  3E1S A;  4YIR X;  1YW7 A;  4UVA A;  1G6N A;  4MNU A;  1W7P A;  2R5Z A;  1R58 A;  2KRC A;  2ADU A;  4A3F J;  2Y48 A;  2HDD A;  2FMY A;  1HBX G;  2RQP A;  4BE0 A;  3ZMZ A;  3JR9 A;  1A36 A;  1S5L C;  2XGC A;  4M3B A;  4RDU A;  3K70 D;  1Z9C A;  5E17 F;  2X51 A;  2RGV A;  4KN4 X;  3TKY A;  3PNV A;  5E3O A;  1CF7 B;  3QYF A;  2E71 A;  3IWF A;  1QO0 D;  3KEY A;  3RPQ A;  4A0X A;  4BEH B;  5D4R A;  4MEX F;  2UZK A;  4UVC A;  2XGD A;  4MO7 A;  5FD6 A;  4N0B A;  1EA3 A;  2EZL A;  4XKV A;  4PJ0 C;  1J59 A;  5D8L B;  3S1M J;  3HHG A;  3C7J A;  6PAX A;  1KQ0 A;  2XB0 X;  2OD5 A;  1IN5 A;  5FO5 A;  1BR1 A;  4Q47 A;  3C18 A;  4QIW N;  1MBK A;  1K83 J;  2BHZ A;  4BL0 B;  3GTQ J;  1YQA A;  1MNE A;  4ZC3 A;  5AIQ A;  2CG4 A;  1RC9 A;  1LEA A;  3BLY A;  3LSH A;  5LBQ A;  1DPU A;  1G3W A;  1NHA A;  5CLS A;  2AXT C;  4FAS D;  1MNM C;  3L00 A;  1ONV A;  4NC7 A;  2ISY A;  4EJO A;  3SZT A;  3QWL A;  1FIP A;  3HRM A;  1I5Z A;  2F5V A;  4M74 A;  4HNV A;  5J1U A;  4C9Y A;  5B5E C;  3ZMT A;  5ILV A;  1XC5 A;  3LOC A;  3RQI A;  3OOP A;  2V1D A;  1EJ9 A;  3GXO A;  5E1W A;  3PO2 J;  2ELH A;  5DUI A;  3N97 A;  2VT2 A;  3FXO A;  1MMN A;  2DA6 A;  3KYC B;  5L3F A;  4RB0 A;  4AUX A;  3DTK A;  1OKR A;  4MGR A;  3BPV A;  2KZV A;  3ABM H;  2MAB A;  1JKR C;  2A5Y B;  1YLF A;  2X4H A;  2HNH A;  1XPX A;  1GXP A;  4HRI A;  4PGG A;  1SFO J;  4M3F A;  4LB5 A;  5FB2 A;  4IQ4 A;  4K2E A;  1XCB A;  4XLA A;  3J81 K;  1F4K A;  4M71 A;  2AQF A;  3WGG A;  2HVR A;  1JJ8 C;  2CW7 A;  3WTZ A;  4TV7 A;  4IOC F;  5IOY A;  2J5O A;  4ENK A;  2IA0 A;  2QUF A;  5FKN A;  3S1R J;  1XGM A;  5IP6 A;  4DNC A;  1A6Q A;  3DV8 A;  3P9I A;  4HX7 A;  1FSE A;  1QQI A;  3HRT A;  3HKZ N;  1UZC A;  4HQE A;  2KJB A;  1KON A;  4XBF A;  1Q1V A;  1TC3 C;  3BCA A;  3C1D A;  1HW2 A;  2LVS A;  3CJR B;  2WY7 Q;  1GV5 A;  1T0F A;  3SDB A;  2PMZ N;  5HS9 A;  1ZTR A;  4F93 B;  1Z3Y A;  1HW1 A;  5M3F J;  2PN6 A;  2XRN A;  3I5U A;  3WTU C;  1I3A A;  2ACJ A;  3FMQ A;  1MND A;  4B4C A;  3P7N A;  1HW5 A;  2DFF A;  2NYX A;  2KLO A;  1P6R A;  5B3S H;  5LRS A;  1V5E A;  1W0U A;  1O7F A;  2CW8 A;  1ZGW A;  3I9V 2;  1R23 A;  2BZT A;  1H8A C;  3O6B B;  2KIU A;  5TJJ A;  1MBJ A;  3RKQ A;  1Y0U A;  4LK0 F;  2ZKZ A;  3PIP F;  2EA4 A;  4JOM A;  3V7R A;  2A5W A;  1LKX A;  2ZME B;  3HPG A;  1XDU A;  3OIQ A;  4CXF A;  2JMW A;  5KVR A;  3OMY A;  4IQJ A;  3CQZ J;  2V9K A;  4AYB N;  1OFC X;  1DU0 A;  5M5Y J;  2DJN A;  2IBD A;  3VYU B;  1PP8 F;  1H88 C;  2Z16 A;  2DCE A;  1RKW A;  1YW8 A;  4S0H B;  1X2M A;  4EGZ A;  3CJT B;  2MC3 A;  2FE3 A;  4E7S A;  1WJC A;  3HZJ A;  3S8P A;  3CCR I;  4JX4 A;  3BQZ A;  5IYB J;  1TNT A;  2NOJ B;  3WTT C;  2DDA A;  2DOD A;  4FTH A;  4U88 A;  3CF5 F;  4KN7 X;  3HGG A;  2R5Z B;  4A3D J;  5JVG F;  3DBL B;  1PDN C;  2PG4 A;  4M3D A;  1MJB A;  2IGN A;  3A4C A;  3OYC A;  2R7Z J;  3SEQ A;  2YUS A;  2TCT A;  1XD7 A;  3OYL A;  1VQ6 I;  2YSR A;  1O57 A;  1DGW Y;  2JUG A;  2K3F A;  5IPA A;  4CCM A;  3WHB A;  3I54 A;  3P9C A;  4MEY F;  3L2U A;  1QBJ A;  2W1O A;  1LE8 B;  2DT5 A;  4MQ9 F;  3S1N J;  2E5Z A;  2R7O A;  4I99 C;  4LK1 F;  4LIT A;  2QQ9 A;  3EDP A;  3CMY A;  3F3X A;  4XOT A;  3CC7 I;  3DEU A;  5HLI A;  4UUS A;  1DDN A;  2BW3 A;  2AHQ A;  5L3C A;  1LDJ A;  4A5M A;  4AD9 A;  5EDN A;  4RGU A;  4KYW A;  3WHC A;  2OTL I;  2X6W A;  1YIT I;  3RSN A;  4BXF A;  3FHZ A;  3EUA A;  3TBI A;  2A61 A;  2FF4 A;  2MD5 A;  1N78 A;  4JK1 X;  3CJQ B;  1T95 A;  2XUB A;  3F72 A;  3ECH A;  1NH3 A;  3BRO A;  1ULY A;  3LQR A;  1VF9 A;  5E8I A;  1IRX A;  4YFX F;  2ELJ A;  2LF8 A;  4L9T A;  2EB7 A;  2L9N A;  2X6O A;  2H1K A;  1OYI A;  2NAZ A;  2LY2 A;  3MZY A;  2XSD C;  1V54 H;  4GRI A;  2BY3 A;  3CZ6 A;  4P1W A;  4Y13 A;  3LNQ A;  2D1H A;  5ICE A;  4RS8 A;  2KFD A;  1DU6 A;  1XMX A;  1Z6T A;  2EWN A;  1A6I A;  4E6K G;  4J01 A;  1HC8 A;  1SFE A;  1E0E A;  1WH5 A;  1QU3 A;  3I3L A;  4S04 A;  4L18 B;  4M73 A;  3FXQ A;  4BXX J;  2QM3 A;  2NNN A;  2VQH A;  2K4B A;  3FMR A;  3KZZ A;  2W25 A;  2VKD A;  4HAM A;  1IXC A;  3ZGK A;  1B6A A;  2BEO A;  2JA2 A;  1BIA A;  3E5X A;  2JQ7 A;  4Y33 A;  4XRS A;  1SAU A;  1YI2 I;  3FM5 A;  5FFX A;  1ZQ3 P;  2STW A;  3C2B A;  1ETV A;  1F5T A;  2G0E A;  2XRL A;  3VSL A;  3LSP A;  1BC7 C;  1FOK A;  2WC2 A;  3VOD A;  5J1R A;  2EBI A;  5FKM A;  4AU7 A;  1W36 D;  3ZQ7 A;  1S6L A;  2I8D A;  3BCB A;  4HOB A;  4RA2 A;  2V6E A;  5EG0 A;  3H0G J;  4YFN F;  1H89 C;  4OMY A;  1V55 H;  3IAM 2;  3WU0 A;  2E5N A;  4IRH A;  2WB1 N;  3BOQ A;  5LEJ A;  1LQ1 A;  3BQY A;  2K85 A;  2IA1 A;  2MH9 A;  4JX6 A;  5GTH C;  3K1N A;  1JUP A;  3ZQI A;  3QOD A;  2JA6 J;  3DKX A;  1ZH5 A;  3CDL A;  1WI9 A;  3OYK A;  2O6G E;  4O3M A;  1FBU A;  2CH0 A;  1YW9 A;  1ZLK A;  4W1U A;  3QYB A;  3EQL F;  4L9V A;  3H36 A;  1R1V A;  3GTP J;  1P4A A;  2PEX A;  3PFY A;  3K4B A;  2P8T A;  2UXX A;  4FX4 A;  1JT6 A;  2AXL A;  2ESN A;  3J7Z I;  1I6X A;  1U5T A;  2E1C A;  3H5A A;  3ASN H;  4XRM A;  3G2B A;  4G8X A;  2ZFU A;  1W4M A;  3HKZ A;  1DGR M;  3G4S I;  3U2R A;  1FTZ A;  3KIO A;  1AKH A;  3BT9 A;  1OCR H;  1TWH J;  4LB6 B;  3S3M A;  1UB9 A;  2X1C A;  3VPR A;  1SMT A;  1P9Q C;  2PMZ A;  2P5L C;  1YRN A;  1FYM A;  2F5D A;  3CME I;  2L9R A;  1Y56 A;  5E3N A;  3J80 Z;  3SFZ A;  5EJC A;  1U9N A;  2RAE A;  1LB2 A;  2YR2 A;  2DMN A;  5KCM A;  1O3R A;  4AM3 A;  3QPH A;  2JZY A;  2DPD A;  3FWE A;  3H9G A;  3ABT A;  3VDX A;  1FEX A;  1Q1H A;  2HQR A;  1W5T A;  4YFK F;  3CCQ I;  2QSF X;  5DCM A;  1XMA A;  2DA4 A;  4FHT A;  3CD6 I;  2X1D A;  1GHC A;  3GTG J;  4WXH A;  2K40 A;  5DEQ A;  4II3 A;  3TO6 A;  4GXO A;  2FXA A;  5F64 A;  5J4Y A;  5EF6 A;  2R5Y B;  1P2F A;  4YEL A;  4EJW A;  2EPF A;  5M5X J;  2HZD A;  3D1N I;  1WCM J;  4AYB A;  1TT5 B;  5F1R A;  2D2W A;  1X1P A;  3LSI A;  1KU7 A;  4AC0 A;  1WJF A;  2OF7 A;  2RV8 A;  4X6A J;  3F8F A;  4LLG F;  4D7N A;  2WWY A;  1UG2 A;  1SVL A;  2XAG A;  3GLL A;  2K4J A;  2V6C A;  3DPT A;  4MTE A;  2GOX B;  2ME0 A;  3K4C A;  5CJ9 A;  4KIS A;  3HIF A;  2A05 A;  5LGT A;  1OPC A;  2CFO A;  2DMT A;  2MD0 A;  3U21 A;  2FBK A;  4HYE A;  2O7O A;  1BI3 A;  5HLG A;  3PNY A;  5JFR A;  2Z3Y A;  3GVA A;  1ZG1 A;  3H5R A;  2Y9Y A;  4RAG A;  3CCS I;  2NVU B;  1R22 A;  3DCF A;  5F1J A;  2R7F A;  2DA7 A;  3LSG A;  3M1C A;  2W24 A;  2VAS A;  3GF2 A;  4EJV A;  1ZKG A;  2IS6 A;  4RGR A;  3OSF A;  2HOT A;  2NS8 A;  1BM9 A;  3IKT A;  1VQ4 I;  2DPU A;  4IZZ A;  2BVL A;  3FDY A;  1RUO A;  3WG7 H;  2XDV A;  2EIJ H;  1YYV A;  3DPL C;  2P5V A;  2M2E A;  2VKE A;  2L4A A;  4HF1 A;  1CQT A;  2KP6 A;  1U5T C;  1U2W A;  3TDZ C;  1OLT A;  2FEZ A;  2H8W A;  2HS5 A;  2IP2 A;  2YX4 A;  4A12 A;  1SC7 A;  3NQO A;  3VYR B;  2WV1 A;  3S17 J;  3DEW A;  2COM A;  1X4P A;  4UVB A;  2X6X A;  4ZYH A;  2YU9 J;  4IHY A;  1GUU A;  5ED4 A;  2K3P A;  3VWB A;  2XVC A;  4EEF G;  4KUM A;  5GAH J;  4XRF A;  1B59 A;  5HNH A;  1IF1 A;  3BG7 A;  2DMP A;  1HSJ A;  2NOG A;  3PFI A;  2HQA A;  4QPO A;  5JR3 A;  1B1B A;  1MSF C;  3I0T A;  3TO9 A;  2VJJ A;  3OS1 A;  5D5W B;  3I55 I;  3VOE A;  5GTI C;  5F0F A;  1PUF B;  2DDB A;  2Q2E B;  2GXA A;  4ZTJ A;  2H6C A;  4IVN A;  5EG0 B;  2HGC A;  2KIQ A;  1FIA A;  4BHC A;  3S2D J;  4IHW A;  4KIF A;  3EUK L;  4P9F A;  3U1K A;  2YS9 A;  2O61 A;  3FMS A;  3MKZ A;  1VQP I;  3OR2 C;  2HPI A;  2Y0S N;  2XC7 A;  5HLT A;  3CCE I;  1VQ9 I;  1RES A;  1IV6 A;  3S16 J;  2V26 A;  3RCO A;  3WE3 A;  4WX9 A;  4C3I J;  4BJ5 C;  1JI8 A;  4F52 A;  5BQT A;  4HQM A;  3DKY A;  3ZQG A;  3CCJ I;  3VB2 A;  1IG7 A;  1UFM A;  1ZR2 A;  3CLQ A;  3G71 I;  1SEU A;  4ANJ A;  4QPQ A;  3RI4 A;  4CH7 A;  3TMO A;  3I58 A;  3OYI A;  2E35 A;  1V4R A;  1Z6R A;  2W4S A;  3HXL A;  2IRF G;  1AWC A;  2QBY B;  4GGG A;  2M9H A;  2E2I J;  3IH3 A;  5EYR A;  4BJ6 C;  1ZRC A;  5E8G A;  3ECO A;  2M45 A;  5TIS C;  3W3C A;  1JJ6 C;  1Y6I A;  2EIL H;  3I56 I;  4KFC A;  1P4X A;  4M6V A;  2M3A A;  2K9Q A;  4PJN A;  1KYZ A;  3E7L A;  2OAZ A;  2M4G A;  3SHF A;  4HX4 A;  2YPR A;  3MZ8 A;  4NNJ A;  5CVU A;  2CFX A;  1YRN B;  1OMI A;  1MMG A;  1B8I B;  4ZYA A;  2DA3 A;  1IUF A;  4LJZ F;  2V9P A;  4A3M J;  3FKI J;  2IVM A;  1T38 A;  3DLA A;  4BDY A;  1A35 A;  5FLV A;  3N05 A;  1R6R A;  3F8B A;  2QEN A;  1X1D A;  3CUQ B;  4DOZ A;  1D1B A;  5FKK A;  2QF7 A;  4FQG A;  2COB A;  5BS6 A;  1H9T A;  4ZDO A;  5D6F A;  3FM3 A;  1KU3 A;  4PUS A;  2VB6 A;  1O4X A;  1IZ1 A;  1BI1 A;  2ZNY A;  1NTC A;  3S2W A;  2GWR A;  3COA C;  4BHB A;  3HRS A;  1WJB A;  3EET A;  5DCM B;  4CYC B;  2DOA A;  3KZI C;  2XAU A;  4IPA A;  1RZ4 A;  2EFP A;  2LK2 A;  1MJA A;  1B72 A;  4HF0 A;  2LD5 A;  2F5E A;  1S7O A;  1E3P A;  2XF7 A;  4BHP A;  5F08 A;  4A3I J;  2VOD A;  1NG6 A;  3LSJ A;  1I3Q J;  1R4M B;  2HQ5 A;  3FXJ A;  3OWT A;  2XSJ C;  5C44 J;  4I09 A;  2JN6 A;  2MYS A;  3BY6 A;  4GYI A;  3OYM A;  1D5V A;  3KLN A;  3ZN0 A;  3CTA A;  2HKO A;  4DBR A;  2FRH A;  5BPI A;  1FPQ A;  3K7A J;  3OY9 A;  1RR8 C;  5DDG A;  2XGX A;  2VN2 A;  1JTY A;  1Z21 A;  1R49 A;  3ZPL A;  2FJ1 A;  2LNB A;  2IEK A;  3F8M A;  1N75 A;  3BR5 A;  2EV0 A;  3RPU A;  4NDL A;  4ABZ A;  3CO7 C;  5FRN A;  2STT A;  3LFU A;  2F6C A;  2DBB A;  3JRE A;  4LOC A;  1U8B A;  4E7I A;  2Z33 A;  2PBI A;  3HTU A;  4BQQ A;  2DOF A;  3KP7 A;  4AVZ A;  3AL0 C;  2KIF A;  5EEA A;  3KP3 A;  3I53 A;  2GLO A;  2L01 A;  2L5Q A;  2OQG A;  4XLP F;  3BG9 A;  3MQ0 A;  2OJE D;  3FXK A;  1YIJ I;  4CSW A;  1M1E B;  2JSC A;  3G1O A;  4DIQ A;  4UXN A;  4P55 A;  3SYT A;  1YJ9 I;  3SZG A;  3W6K B;  1JHH A;  1LJ9 A;  3K10 A;  4CIC A;  2DA5 A;  3L09 A;  2GXB A;  1XMK A;  2PJR A;  3PUF A;  4OAZ A;  4XLN F;  2YU3 A;  2QLZ A;  1ZEL A;  3DQV C;  4KIT B;  1HA8 A;  2I10 A;  2MW8 A;  1Z77 A;  2XRO A;  3B02 A;  5CVR A;  2EFQ A;  2VUM J;  4UB8 C;  2B0L A;  3ZQF A;  3ZP5 A;  1XTA A;  4ZYD A;  1APL C;  4Y52 J;  4BS9 A;  5DD4 A;  3F22 A;  3IRR A;  3KP5 A;  3KCC A;  1HKT A;  3MMY B;  3BP8 A;  5EGO A;  1D1C A;  3PSI A;  4PSX A;  4C2U A;  1FWZ A;  2X1E A;  2LMD A;  3DBH B;  4Y17 A;  3BR0 A;  3VSK A;  1UHM A;  2FOK A;  3IHU A;  2ZSH B;  4OIP F;  2CU7 A;  4CYD A;  1FT9 A;  5DM7 F;  4EV0 A;  3HBL A;  2DO7 A;  3GZN B;  3LST A;  3J81 Z;  2JA5 J;  2CQX A;  1ETK A;  2LBF A;  1UST A;  2O5R A;  1MDM A;  2E34 A;  2QGU A;  3KEO A;  1K7A A;  3S2H J;  3TOB A;  2AO9 A;  3OYF A;  4M3E A;  1IN7 A;  1RI7 A;  1SD4 A;  3RYR A;  1IXS B;  1I1G A;  2LH9 A;  4A5N A;  2ZJQ F;  1XSV A;  5J4V A;  2L2O A;  2OC6 A;  4F55 A;  1OCT C;  2LF7 A;  1RUN A;  3I59 A;  3M1E A;  1ENH A;  3FIW A;  3FXU A;  3GUD A;  3JAM K;  3VEP A;  5JI6 A;  4AIK A;  2HXI A;  2PMU A;  3NAR A;  4A69 C;  1LFU P;  3Q0V A;  3M3Y J;  1YHQ I;  1GT0 C;  4IX7 A;  4KJZ A;  3AG4 H;  1JTX A;  1X1C A;  3KPH A;  4CCN A;  4DJA A;  1JKO C;  1B9N A;  3WTV C;  1T56 A;  1NK2 P;  4OWR B;  5JVT A;  4I0B A;  2Y0S A;  4G94 A;  2IJL A;  1TLH B;  4D5C A;  2E1M C;  2M8G X;  2O8K A;  2W82 A;  5BMZ A;  4XID A;  1AA7 A;  2KJC A;  1Z0X A;  4II2 A;  2M7B A;  3OIP A;  2R7U A;  3KP6 A;  4R8H A;  1TWG J;  1PJR A;  1X3Z B;  2QQ8 A;  4CZZ A;  2H8R A;  3G6E I;  4LD5 A;  4EAT A;  2P7V B;  4E7H A;  3WU1 B;  4B8X A;  1J2X A;  3DLL F;  1P7J A;  5FRM A;  2DFI A;  2P0W A;  1XSX A;  1ZRF A;  5EEH A;  3WGH A;  1H9G A;  4XLE A;  2ZJ2 A;  3TL4 X;  2OBP A;  3GME A;  4B44 A;  3PO3 J;  4HSR A;  4B3X A;  3UKG A;  1FYL A;  3GFJ A;  1P4W A;  4BXU A;  2V1U A;  2LFB A;  2QWW A;  3ISP A;  3JRG A;  4UUV A;  2RNJ A;  1JT0 A;  4NC8 A;  2DA1 A;  3HHH A;  2CV1 A;  2Y31 A;  2HEO A;  1Z7U A;  2HDC A;  3SDG A;  4G7Z F;  3GTO J;  2XAS A;  1KU9 A;  3H9Q A;  1R36 A;  4HZF A;  2EZK A;  1DUX C;  3IH2 A;  5HS7 A;  2OU2 A;  2LYC A;  3Q5F A;  1QHH D;  2VC0 A;  4ZJZ A;  1OIS A;  2UUZ A;  3HOW J;  5LHI A;  5CVI A;  3GYH X;  3CCV I;  4JX5 A;  1W0T A;  2ME6 A;  1FOX A;  1RNL A;  4XNF A;  4BDZ A;  4A0Z A;  3M8F A;  3O2P E;  3QP6 A;  4PJL A;  4WXC A;  1Z05 A;  3ZMS A;  4LGW A;  3OL3 A;  4KT5 C;  2MH2 A;  5EEG A;  5H6Q A;  4L5J A;  3W2V A;  2FNA A;  4I2O A;  1SFU A;  2BOL A;  1WPK A;  3BJA A;  3KFW X;  4RM3 A;  3MEX A;  1Z1D A;  3HOY J;  2R7T A;  5IYD J;  2M8E A;  4HF2 A;  1G4D A;  3J7Y J;  4O5V A;  4BQN A;  1YFH A;  3TW7 A;  5ILS A;  4GDF A;  2HFH A;  3G1L A;  2VE9 A;  3ZCO A;  2R7X A;  5IP9 J;  3ZXS A;  2KZG A;  4A3E J;  4AVP A;  5FRO A;  4Y4R A;  5K7Z A;  2PJR B;  4BJT A;  1IGN A;  1ETY A;  2M0M A;  1W7P B;  3ZOB A;  3BWG A;  1PYV A;  3KEQ A;  3ULQ B;  3QQA A;  3ZMV A;  2VQG A;  4EMS A;  1O3S A;  1IDZ A;  4BAC A;  3FXM A;  3IRQ A;  2L54 A;  4N9I A;  1K4S A;  3V8K A;  3L7W A;  3A2K A;  1JGS A;  1N25 A;  1I6H J;  3MCZ A;  2OZU A;  1G59 A;  1I39 A;  5GPC A;  1IN6 A;  2DN0 A;  4HV6 A;  5J6X A;  3RKW A;  3WTS C;  1RRJ A;  1STZ A;  2YX7 A;  3ZN1 A;  3H3V K;  3FIS A;  3HOU J;  1TW3 A;  2UV1 A;  2ZO4 A;  1UMQ A;  4PK4 A;  2VT3 A;  2LOO A;  2JA8 J;  3L9F A;  1HOM A;  3FZV A;  4I76 A;  4XON A;  1O3Q A;  3RIR A;  1C0W A;  2A6H F;  4IHT A;  4IF4 A;  2BY1 A;  4V2F A;  2LBF B;  2HTJ A;  4U0W A;  2TRT A;  1IN8 A;  4OOI A;  1EF4 A;  4KIC A;  3LSM A;  3H3Z A;  1J75 A;  4HBL A;  1EH6 A;  2IPQ X;  1Z67 A;  3CDI A;  2R92 J;  1SVM A;  1LEB A;  4M72 A;  3KP2 A;  5KNL A;  3QPS A;  2PX9 A;  1U6G A;  2IS4 A;  2W00 A;  1UHS A;  3WG9 A;  1QZZ A;  2HYF A;  3GTM J;  2HYJ A;  4BE2 A;  1VZ0 A;  2IW5 A;  2VL8 A;  2OCE A;  2Y30 A;  5J47 A;  1UAA A;  3TED A;  4EM2 A;  2A6T A;  3N4M A;  4KIG A;  1POG A;  2P6S A;  1Z3X A;  2ZXW H;  3IC7 A;  2PI0 A;  5K5O A;  1TQI A;  2IAI A;  3W6J B;  5M5W J;  4X0G A;  2L7K A;  4L5E A;  2Y75 A;  2OA4 A;  3BPX A;  3ESW B;  3KYL A;  1BR2 A;  2NS0 A;  1WQ2 A;  1DP3 A;  3RJP A;  3IP4 B;  4X1E A;  1OYW A;  2DTZ A;  2E7X A;  4RLQ A;  2L7F P;  1HLV A;  3C2H A;  2VOO A;  4A3G J;  5DTD A;  2Y0M A;  3Q3S A;  1LNW A;  2X0L A;  2R7W A;  2PFB A;  3ASO H;  2HOS A;  2R7D A;  2VOP A;  2VC1 A;  1X2N A;  1WWX A;  2GM4 A;  4IHV A;  1OJL A;  3HYI A;  4LLN A;  5E1Z B;  4RM2 A;  1SAN A;  2R93 J;  2BY0 A;  3EPZ A;  1FTT A;  2ID6 A;  2O03 A;  3HOZ J;  1OCC H;  2XF5 A;  1AU7 A;  1ZRE A;  3CP8 A;  4OAY A;  4G7H F;  1ACI A;  2CJJ A;  1V5F A;  1XCV A;  1QVU A;  1ZAR A;  2XPW A;  3HEF A;  2ZFW A;  2KIM A;  2BE5 F;  1K78 A;  3CP2 A;  3DU5 A;  4A3L J;  2L4M A;  2XPU A;  4HA8 A;  2D5V A;  1YJW I;  1G3S A;  5IY5 H;  4R1H A;  3GFM A;  2QSG X;  2MBF A;  2WTE A;  2ZXH A;  4CUG A;  3S15 J;  2HYG D;  5A2Q Z;  4NQW A;  1H0M A;  3TDU C;  2BY2 A;  3LSK A;  1X58 A;  3E5U A;  2QSH X;  4XMY A;  4D1Q A;  3WE2 A;  1JHF A;  2P7C B;  2PLY A;  3K70 C;  2QKL B;  3T8T A;  4WK8 F;  2P6T A;  2BYV E;  2XIG A;  2MC4 A;  2H94 A;  4F92 B;  3C3W A;  2VJI A;  4GFB A;  2V4J C;  4NC6 A;  4PCQ A;  4MIM A;  1KU2 A;  2RC4 A;  1FYK A;  1GDT A;  3BTI A;  1ZG3 A;  2L02 A;  2QVO A;  5JHU A;  1ZLJ A;  3G3Z A;  1TQP A;  2VIX A;  5HS8 A;  1DP7 P;  1NK3 P;  1LVA A;  3HSE A;  2K9M A;  1WFX A;  2HVS A;  3JRD A;  1XGO A;  3HUG A;  3CES A;  3JSO A;  2CUJ A;  1TQM A;  3WU2 C;  1PP7 U;  1J0R A;  4B1R A;  1D0Y A;  2KHM A;  1W5S A;  5K7H A;  4J00 A;  3LAJ A;  2V9V A;  2IA2 A;  2EH3 A;  4PDK A;  4ZZL A;  2BV6 A;  3HSR A;  4LMY A;  1R1U A;  2JPC A;  4ZH4 F;  4H4K C;  4BKX A;  3KX2 A;  4OIN F;  2H27 A;  3CC4 I;  2WAF A;  2XGE A;  1MJ9 A;  2A68 F;  3M07 A;  1YS7 A;  5D4S A;  3BR2 A;  4XLH A;  4XKB A;  2LP0 A;  2CV0 A;  3I4N J;  4B3A A;  3OYB A;  3OS0 A;  2D45 A;  3MKY B;  4BNC A;  3S14 J;  1VQ5 I;  2K7L A;  3H0D A;  5E3L A;  2GQQ A;  4WF2 A;  2ZXJ A;  4BE1 A;  3B6C A;  3RQ4 A;  4UUS B;  3JRI A;  4PFO A;  3BTL A;  2BW3 B;  1YX3 A;  3ZQQ A;  2N8G A;  3FXR A;  3DWL E;  3E6M A;  4ASN A;  1GXQ A;  1WSU A;  4IKF A;  4IRG A;  1F9N A;  5DV5 A;  1U78 A;  2OQR A;  1VQO I;  2Z9O A;  2Z5U A;  1WZ2 A;  4I98 B;  2R7S A;  1J7K A;  4UV8 A;  5EZG A;  4PFP A;  3GFL A;  1FLI A;  2F5F A;  1YS6 A;  2WY8 Q;  4G6Q A;  3PQK A;  2EIN H;  2ISZ A;  2XAF A;  4G6T B;  1KA8 A;  3FF5 A;  4IJA A;  4XKW A;  2JVH A;  2LY9 A;  3T0Y A;  4KA4 A;  4YG2 F;  3PL8 A;  1ZG5 A;  3IWZ A;  2VPL A;  1R00 A;  1Y1W J;  3H9J A;  1GV2 A;  1MW7 A;  2DT7 B;  2LDU A;  4U7B A;  2VLA A;  5GAE J;  5KHD A;  5TGT A;  4LG0 A;  1R5I D;  4A0Y A;  5E1X A;  3B73 A;  1MBG A;  1W7P D;  2DTR A;  1ETX A;  3L2V A;  3BG6 A;  2IS1 A;  5H6R A;  2JJ7 A;  3ABK H;  1YO5 C;  3PSF A;  3JTG A;  3R61 A;  3V8L A;  2XB5 A;  4FT8 A;  2CQN A;  4C2M J;  1A04 A;  2Y9Z A;  1WVR A;  2M1B A;  3NWS A;  1YOV B;  1BN5 A;  1D0Z A;  1LFP A;  1ETO A;  1E2X A;  3NAU A;  4DYC A;  3UNG C;  5F04 A;  5L3G A;  5D5V B;  1JKP C;  3S1Q J;  4ZYE A;  2HOE A;  4QTR A;  2E2H J;  2GIV A;  3E5Q A;  1FY7 A;  4HV5 A;  4ETS A;  3TP0 A;  1O7L A;  4BUP A;  5JHF A;  1HST A;  5J1Y A;  2X6Y A;  5F27 A;  1U0J A;  5K5Q A;  2DK8 A;  1E17 A;  3T1B A;  1VQ8 I;  4BEH A;  3HTS B;  2DA2 A;  3JTH A;  4B43 A;  1IAW A;  5K5R A;  2XHK A;  1T08 B;  1HDP A;  2QA4 I;  2DW4 A;  3PIO F;  4UB6 C;  4Z6Y A;  2MSY A;  1OCZ H;  4OIR F;  2Q8K A;  5LGU A;  5M3M J;  2PJP A;  2M30 A;  2ELK A;  3I71 A;  4NQW B;  1BI2 A;  3TW6 A;  1G3T A;  3HPH A;  1EH8 A;  1U5T B;  3MWM A;  2DI3 A;  3ZMU A;  1K79 A;  4I02 A;  3NRV A;  4E7L A;  4BY7 J;  5DYM A;  1QGP A;  1R5H A;  5CVV A;  5AIP A;  2WBM A;  1JXS A;  1R7J A;  2R7Q A;  3O8H A;  3WTY C;  2CS3 A;  1S72 I;  1AKH B;  4CDG A;  4H0E A;  3ERE D;  3CO6 C;  2CQ7 A;  5ERI A;  1T39 A;  1X3U A;  2LLK A;  1Z7L A;  4BU2 A;  1D1A A;  1W1W E;  3CCL I;  1YTY A;  4J19 A;  5LEK A;  3HOS A;  4CHU A;  2VBZ A;  3B6A A;  1R1T A;  3K4L A;  4CCO A;  3FXL A;  1FOW A;  1ZK8 A;  4EJU A;  1ODD A;  2CO5 A;  3HRU A;  1PVE A;  1G8X A;  2DYR H;  3CMA I;  1I27 A;  5DUK A;  2ICW G;  2K5C A;  1G3Y A;  3W6V A;  5FKO A;  3ZQL A;  2EK5 A;  5FLX K;  2K27 A;  1G2H A;  5F6F A;  2VBW A;  2GXG A;  4NHJ A;  1BOA A;  4U7D A;  3F23 A;  3TP3 A;  4HW0 A;  1F36 A;  1HKS A;  2RRE A;  4GYG A;  4PZJ A;  2CQQ A;  2CW0 F;  1JKQ C;  2EFO A;  3GW2 A;  1BBY A;  4FIS A;  4Y7N J;  2O0Y A;  2W85 A;  3M4O J;  2IGK A;  4UHT A;  1KZH A;  2VKV A;  4Y3O A;  4E7Z A;  1VQM I;  4Q4Z F;  1T33 A;  2NVX J;  1JUM A;  3BDD A;  3MN2 A;  4KNY A;  2IS2 A;  1YX5 A;  4ZDL A;  1E3O C;  5C4J J;  3GTJ J;  2OZ6 A;  1IV8 A;  4JP0 A;  2K9L A;  4RGS A;  4AIH A;  4A6D A;  2ECB A;  4IO9 F;  3ABL H;  1K4T A;  2F5C A;  3KE2 A;  2XAJ A;  5ICF A;  4C3J J;  2DXI A;  2LKS A;  2CUE A;  3H3U A;  5CQG A;  3HG9 A;  1FMV A;  4DBQ A;  1TL8 A;  3V7S A;  2ZSI B;  3DFG A;  3S3O A;  1WJ5 A;  3F9K A;  1BR4 A;  5B1B H;  3WGI A;  2IGO A;  2Y69 H;  2Y2Z A;  4YIF A;  5HLH A;  3A02 A;  3G1M A;  2GBY A;  2CWE A;  4WCG A;  2VON A;  1W36 C;  9ANT A;  1LPQ A;  1E3H A;  2OV7 A;  2R7V A;  4RB1 A;  3ZR8 X;  4JQF A;  1BC8 C;  2R4G A;  1VQK I;  2ECC A;  5J3L A;  3ERM A;  3DU6 A;  4A3B J;  2RKH A;  2FBH A;  2Z2S B;  4N4O B;  2KT0 A;  2G7U A;  3DBR B;  2ZJR F;  2X48 A;  1B9M A;  2ZME A;  4XK4 A;  1ORK A;  2FML A;  2DQR A;  1WHU A;  2LY1 A;  5GAD J;  5L3B A;  4ENN A;  2DT6 A;  2HR3 A;  1XG1 A;  2CYY A;  2EQR A;  2KQR A;  5D8K B;  2I5U A;  3HOV J;  3W2A A;  2M7A A;  3HSF A;  1WGX A;  4EVI A;  3A1Y A;  3LSR A;  3GLX A;  3V4G A;  3S3N A;  1L3L A;  1JE8 A;  1J9I A;  2A6E F;  3QU3 A;  4XN3 A;  3JAM Z;  3MKL A;  3O3K A;  4B48 A;  1HDD C;  3E6C C;  5C4X J;  1ETW A;  2OTJ I;  3D5R C;  1OQY A;  1FP1 D;  4I7H A;  3LA7 A;  1OCP A;  3C2G A;  4CZC A;  4MQV A;  4BAY A;  4CA0 A;  1ZN2 A;  1TW2 A;  1CGP A;  2IXS A;  1GLN A;  4I01 A;  4UY8 I;  2ZNZ A;  3BZK A;  2LRD A;  3ZMD A;  3L1P A;  5JLW A;  3BC8 A;  2HU9 A;  2D1V A;  3PM1 A;  2JUC A;  3AG3 H;  4ZDP A;  2P5K A;  4KT6 A;  4C30 A;  1LE8 A;  4MHG A;  2NVQ J;  3FK6 A;  1WI3 A;  3WOD F;  3AL0 B;  5IT9 K;  3A0H C;  1BA5 A;  1R4N B;  3DTI A;  2E36 A;  1SD7 A;  2LTP A;  3JRB A;  3CF2 A;  3HM5 A;  3D0S A;  3EUH A;  5IT3 A;  4CO8 A;  3VYT B;  3DP7 A;  3S32 A;  1J5Y A;  1EV7 A;  1SD5 A;  1P92 A;  3V42 A;  4XOR A;  4DYQ A;  4BBS J;  1BOB A;  1DQU A;  4XN0 A;  1Y39 A;  1UEL B;  2VBY A;  1QRY A;  2A07 F;  4A93 J;  2BVM A;  1KQ9 A;  1Y0N A;  2RDP A;  2O3F A;  3DKW A;  4G6D A;  1FMW A;  3DEE A;  4B09 A;  2JVG A;  3BZ6 A;  4P9U A;  4S05 A;  2QKM B;  2FOW A;  2Q1Z B;  5H2F C;  1A5J A;  2FU4 A;  1FOY A;  2JA7 J;  3NWT A;  1DPR A;  2VKH A;  1S7A A;  4G9Y A;  2FQ3 A;  4N9H A;  4PSW A;  3OS2 A;  4G7O F;  3QPL A;  1OYY A;  5HDG A;  1MSE C;  1PUE E;  4DQ2 A;  3JW4 A;  2B9S A;  2NVT J;  3IKV A;  4CCL A;  1S9H A;  2ZME C;  2DJI A;  4L9J A;  3HOT A;  3ZRG A;  5E20 A;  5K7F A;  5J8C A;  1B72 B;  2HZT A;  1ZGJ A;  4UUT A;  4NUB A;  5J40 A;  5CPR B;  4CCJ A;  5CYV A;  3MZH A;  1T6S A;  2HPM A;  1MZB A;  3OL4 A;  3DPU A;  2HOA A;  1VI0 A;  3ABU A;  5CVJ A;  4XM3 A;  5C3E J;  3VYS B;  3K4K A;  5FGM A;  5ILU A;  5BPD A;  4RMN A;  4BQA A;  1TTY A;  1R71 A;  1V5G A;  4OU0 A;  2HKX A;  1MH4 A;  3K2Z A;  1P7I A;  2H6B A;  4IHS A;  1R5G A;  1AHD P;  4OMZ A;  4C3H J;  2K9N A;  2EFW A;  1RPW A;  1JUS A;  4EM0 B;  3FHN A;  3QOE A;  1IN4 A;  2DMU A;  3FBN B;  1UG0 A;  4ITV A;  1AOY A;  3HL2 A;  3J7A Y;  3RYP A;  2OCC H;  3WTX C;  2W57 A;  2ZBK A;  2X9D A;  4D0P A;  3LQQ A;  1U3E M;  2L9V A;  3D5L A;  2M5W A;  1YG2 A;  2PMH A;  2ZC2 A;  4YRV A;  5LHH A;  3I64 A;  5DM6 F;  3RKX A;  5KAI C;  4YII A;  1V3F A;  2E1M B;  2VJ4 A;  3EUH C;  3F21 A;  3A01 A;  4M9Z A;  4HLY A;  4BY1 J;  1FP2 A;  5EZH A;  5B66 C;  2BBY A;  1ZYR F;  4BBR J;  3BZC A;  3QPT A;  2BHY A;  2LSO A;  5DD8 A;  5E79 C;  1XS9 A;  2K9S A;  2EIK H;  4M9X A;  2QQB A;  3CLO A;  3BTC A;  1K61 A;  1OR7 A;  3PJR A;  1XN7 A;  1X4O A;  2GAU A;  3JRF A;  3E3V A;  2CRG A;  3R0J A;  1XSD A;  1Z91 A;  2DK5 A;  3WTW C;  2IT0 A;  1OCO H;  3OIO A;  3EYY A;  5FKL A;  5B1A H;  2JTV A;  2MA3 A;  5BOX A;  2KRH A;  2XKP A;  3K2A A;  5HVQ C;  5FJ8 J;  2ESH A;  1FNN A;  3K9T A;  3AKZ A;  4QSH A;  4IL6 C;  3GFI A;  2DAO A;  3E97 A;  2CQK A;  1U9O A;  4MFD A;  3LA3 A;  1MIJ A;  2W7N A;  4IOA F;  4A6E A;  2LC2 A;  5KK1 A;  3K6G A;  1YE9 A;  2H09 A;  2L9S A;  4U87 A;  5EGO B;  3U1D A;  2FSW A;  4IRI A;  2AS5 F;  1SMY F;  4F7Z A;  1FBQ A;  3R60 A;  1RET A;  2F48 A;  4LLL A;  2HTS A;  4AWX B;  1LDK B;  5J8F A;  3BJO A;  3MD2 A;  2VQC A;  4E4H A;  5F0H A;  2R5Y A;  1ZGA A;  1MDM B;  3HGY A;  1SVO A;  2WAQ N;  3P9K A;  3HJE A;  1WJA A;  4KMF A;  1S8N A;  1MGT A;  3OSG A;  3JSP A;  1A31 A;  1MKM A;  3AFH A;  4M9S A;  4Q48 A;  1I1S A;  1EH7 A;  5LD2 C;  2QEX I;  4E7K A;  2CUF A;  5K1Y A;  3BR6 A;  3MAJ A;  1LDD A;  2QYO A;  4IHX A;  2RQQ A;  2ZB9 A;  4G12 A;  1X1A A;  1WRJ A;  5GP9 A;  4FE4 A;  2VE8 A;  3I59 B;  5CKT A;  2Z1D A;  1QPI A;  1T0F C;  4RB3 C;  4RLF A;  1D5Y A;  3IL2 A;  3L2W A;  1D3Y A;  1LUJ B;  1T8I A;  1IDY A;  1S7E A;  4JBA A;  2Z99 A;  3OYA A;  4D7M A;  3M8E A;  4ENM A;  1BW6 A;  1TWA J;  2AQE A;  2MLK A;  3CMM A;  3IAS 2;  3LAP A;  2GIZ A;  1JGG A;  4HLX A;  1X19 A;  3TGN A;  2WAD A;  2H1L A;  1EKE A;  3R0A A;  2MLG A;  2RVC A;  2XAQ A;  3GO5 A;  4ZZD A;  4FX0 A;  2E60 A;  3F6O A;  1Y8Q B;  2NS7 A;  2MFZ A;  3O8G A;  2LG4 A;  3LL7 A;  1OR7 C;  4U0V A;  5GPA A;  3LA2 A;  4XRS G;  3PNT A;  4Q5S F;  5GAG J;  1UJ8 A;  5HDK A;  3F6V A;  4KMU X;  3GCM A;  1IO2 A;  1XGN A;  2XPV A;  3CDH A;  2CGP A;  1LFB A;  3ONQ A;  3L2R A;  2JSP A;  3R4K A;  2DQL A;  4CGZ A;  4BGD A;  2UXN A;  3PQJ A;  3AG2 H;  1MD0 A;  2OPT A;  3IUO A;  4V2G A;  2ID3 A;  1F1Z A;  2KPM A;  2WV0 A;  4LFU A;  3SXY A;  4C2T A;  3H92 A;  1HCR A;  2FBI A;  4LG3 A;  3L2C A;  3SJM A;  2Q0O A;  2XKO A;  3FX3 A;  1QZE A;  1PUF A;  3CCU I;  2Q2E A;  2V1N A;  3K4J A;  1MBF A;  3Q0U A;  3F8C A;  5D5X B;  1ZAO A;  3GTL J;  3DF8 A;  3S93 A;  2XF6 A;  3K1P A;  3RZD J;  3BJ6 A;  1FBS A;  3HDD A;  3Q9V A;  3M9A A;  5L3E A;  3TOA A;  1GVD A;  4UV9 A;  3OYJ A;  5FFZ A;  2VBX A;  4ZTF A;  3KP4 A;  3QU6 A;  4DYR A;  4PJM A;  2JWT A;  2L7Z A;  3HC7 A;  4R79 A;  2ZCW A;  2L0K A;  2L7M P;  2GZW A;  1VQ7 I;  1TBX A;  2ZXI A;  2NXN B;  5LLQ A;  2GOM A;  3M7G A;  3BG3 A;  4U0Y A;  2JPB A;  4EM1 A;  1ERD A;  2HWV A;  1D8K A;  4RAY A;  3A01 B;  1MMD A;  3DXJ F;  3SFI A;  1HF0 A;  3TO7 A;  2FNP A;  1IC8 A;  4ESF A;  2QBY A;  4IEJ A;  1BIB A;  4IXA A;  1REP C;  2ETH A;  4NB5 A;  5LGN A;  2LKX A;  4Z2Y A;  1ZRD A;  1QZY A;  3OOU A;  2MG4 A;  3ROU A;  4A2U A;  4HDU A;  3GTK J;  2FD5 A;  1MMS A;  4V19 K;  5HDN A;  4HNU A;  4LIV A;  4F3Q A;  1QPM A;  2E1N A;  2J5P A;  2JK3 A;  3A03 A;  2BXY A;  4L9N A;  1R9T J;  2L3D A;  4XR6 A;  2FQ4 A;  1B8I A;  3AAF A;  2LRE A;  1XB4 A;  2VPR A;  1MH3 A;  1SD6 A;  2FUG 2;  1B4A A;  3ZQH A;  4WWC A;  3CJN A;  4HX8 A;  3CUQ A;  1WJD A;  2V79 A;  2C6Y A;  1X3W B;  2A3S A;  1RR7 A;  3F0C A; 
#chains in the Genus database with same CATH homology
 4OIO F;  1ZHF A;  2TDX A;  2PQ8 A;  1IRG A;  3CUO A;  2A69 F;  2DU9 A;  5A2Q K;  4M6Y A;  1XGS A;  5L3D A;  1RIO H;  5AON A;  1S3J A;  2EV6 A;  2O8X A;  2V1X A;  2NNY A;  2G7H A;  3K1M A;  4BYY A;  2GA2 A;  1K6O A;  3RKY A;  1T2K A;  5DCF A;  3V7C A;  3QOP A;  1L0O C;  3SQN A;  4XSZ F;  4EGY A;  1YIO A;  3J80 K;  4O6J A;  4AIJ A;  1FC3 A;  2JT1 A;  1ON2 A;  3T5X A;  3E6B A;  4ZYG A;  3K69 A;  4P5O A;  2BGC A;  2RN7 A;  3GZ6 A;  2R3S A;  4KDP A;  4P96 A;  2K86 A;  1TNS A;  2EV5 A;  1BJA A;  1BI0 A;  2XAH A;  3GEZ A;  4EJT A;  2EA2 A;  1U8R A;  1WKM A;  4GCV A;  2KKO A;  2W84 A;  4UNO A;  1SFX A;  2HQN A;  4E70 A;  4ESB A;  3U9G A;  1KQ8 A;  3TQN A;  3RTR A;  2JRT A;  1CF7 A;  3CUQ C;  4MTD A;  2KRF A;  2NRA C;  1USS A;  1K78 B;  2EJR A;  5FLX Z;  3K0L A;  5D6E A;  3R6S A;  4RAZ A;  1XDS A;  1IUY A;  3LFK A;  2E7W A;  3GWZ A;  2G9W A;  1UCR A;  3V8J A;  4PGH A;  3GX4 X;  3I4P A;  4XSX F;  1ON1 A;  2QZ8 A;  3ELK A;  2LKP A;  5E18 F;  2P4W A;  4ESJ A;  5H20 A;  5D5U B;  4I0A A;  2UWM A;  3RDI A;  1O3T A;  1S29 A;  4WXD A;  3GZ5 A;  3E6D A;  2VXZ A;  2CSO A;  3EYI A;  1D8J A;  4L0Y B;  4BH9 A;  2F2E A;  2FA5 A;  3F8N A;  1T98 A;  5ICC A;  1HXD A;  1KYW A;  4L5I A;  5ICG A;  3OV8 A;  4Y15 A;  2M87 A;  2QQA A;  3SZP A;  1IW7 F;  3T8R A;  4KIB A;  5LRR A;  1FSH A;  4QWQ A;  3ML6 A;  2DLL A;  1GVJ A;  3KET A;  3LWF A;  2XV4 S;  5LHG A;  1HQC A;  4M6X A;  3KLO A;  1VTN C;  4GO1 A;  1IXR C;  1FZP B;  3QRF F;  5TRD A;  3MFK A;  4QLC U;  1FX7 A;  5FD5 A;  1UHW A;  4ON0 A;  1HKQ A;  1KGS A;  4HDV A;  4L0Z B;  3QAH A;  4LG0 B;  4RB2 C;  3NEU A;  1IRF A;  1SAX A;  4OIQ F;  3REO A;  5IT9 Z;  2EFN A;  2K02 A;  2GA1 A;  3G73 A;  3QP5 A;  4EQQ A;  4RGX A;  3KZY A;  1QNT A;  3VFZ A;  5HOO A;  3Q9S A;  3J7A O;  4ENJ A;  1YW7 A;  4UVA A;  1G6N A;  4MNU A;  1W7P A;  1R58 A;  2ADU A;  2Y48 A;  2FMY A;  1HBX G;  2RQP A;  3ZMZ A;  5E17 F;  1Z9C A;  2RGV A;  4KN4 X;  3TKY A;  1CF7 B;  3IWF A;  5D4R A;  1QO0 D;  3RPQ A;  4A0X A;  4MEX F;  2UZK A;  4UVC A;  5FD6 A;  4N0B A;  1J59 A;  5D8L B;  3HHG A;  3C7J A;  6PAX A;  1KQ0 A;  2OD5 A;  1IN5 A;  5FO5 A;  4Q47 A;  3C18 A;  1YQA A;  5AIQ A;  2CG4 A;  1LEA A;  5LBQ A;  1DPU A;  1G3W A;  1NHA A;  5CLS A;  3L00 A;  1ONV A;  2ISY A;  4EJO A;  3SZT A;  3HRM A;  1I5Z A;  4M74 A;  3ZMT A;  5ILV A;  3OOP A;  2V1D A;  3GXO A;  5E1W A;  2ELH A;  5DUI A;  3N97 A;  2VT2 A;  5L3F A;  4RB0 A;  1OKR A;  4MGR A;  3BPV A;  2A5Y B;  1YLF A;  2X4H A;  1GXP A;  4PGG A;  4LB5 A;  5FB2 A;  4K2E A;  1XCB A;  3J81 K;  1F4K A;  4M71 A;  3WGG A;  3WTZ A;  4TV7 A;  2J5O A;  4ENK A;  2IA0 A;  2QUF A;  1XGM A;  4DNC A;  3DV8 A;  3P9I A;  4HX7 A;  1FSE A;  1QQI A;  3HRT A;  4HQE A;  2KJB A;  4XBF A;  1HW2 A;  3C1D A;  1T0F A;  5HS9 A;  1HW1 A;  2PN6 A;  2XRN A;  3I5U A;  3WTU C;  2ACJ A;  3FMQ A;  3P7N A;  1HW5 A;  2NYX A;  1P6R A;  5LRS A;  1O7F A;  1R23 A;  3O6B B;  2KIU A;  5TJJ A;  1Y0U A;  4LK0 F;  2ZKZ A;  2EA4 A;  3V7R A;  2ZME B;  1XDU A;  4CXF A;  5KVR A;  1PP8 F;  1YW8 A;  4EGZ A;  2MC3 A;  2FE3 A;  1TNT A;  3WTT C;  4U88 A;  4KN7 X;  1PDN C;  2PG4 A;  1MJB A;  1XD7 A;  2YSR A;  1O57 A;  3I54 A;  3P9C A;  4MEY F;  1QBJ A;  2DT5 A;  4MQ9 F;  4LK1 F;  2QQ9 A;  3EDP A;  3F3X A;  3DEU A;  5HLI A;  1DDN A;  5L3C A;  1LDJ A;  4A5M A;  4AD9 A;  4RGU A;  4KYW A;  3FHZ A;  2A61 A;  2FF4 A;  2MD5 A;  4JK1 X;  2XUB A;  3F72 A;  3ECH A;  3BRO A;  1ULY A;  3LQR A;  5E8I A;  4YFX F;  2LF8 A;  4L9T A;  2EB7 A;  1OYI A;  2NAZ A;  3MZY A;  4Y13 A;  2D1H A;  5ICE A;  4RS8 A;  1Z6T A;  2EWN A;  1SFE A;  4S04 A;  4L18 B;  4M73 A;  3FXQ A;  2QM3 A;  2NNN A;  3FMR A;  2K4B A;  3KZZ A;  2W25 A;  4HAM A;  1IXC A;  1B6A A;  2BEO A;  1BIA A;  3E5X A;  2STW A;  3FM5 A;  5FFX A;  1F5T A;  1BC7 C;  1FOK A;  2WC2 A;  3VOD A;  3ZQ7 A;  1S6L A;  4HOB A;  4YFN F;  4OMY A;  3WU0 A;  4IRH A;  1LQ1 A;  3BOQ A;  5LEJ A;  2IA1 A;  2MH9 A;  3K1N A;  1ZH5 A;  1WI9 A;  2O6G E;  4O3M A;  1FBU A;  1YW9 A;  1ZLK A;  3EQL F;  4L9V A;  1R1V A;  1P4A A;  2PEX A;  2P8T A;  2UXX A;  4FX4 A;  2AXL A;  2ESN A;  1I6X A;  1U5T A;  2E1C A;  4G8X A;  1W4M A;  3U2R A;  4LB6 B;  1UB9 A;  1SMT A;  2P5L C;  1FYM A;  2F5D A;  3J80 Z;  3SFZ A;  1LB2 A;  2YR2 A;  1O3R A;  3QPH A;  2JZY A;  2DPD A;  3FWE A;  3ABT A;  1Q1H A;  2HQR A;  1W5T A;  4YFK F;  5DCM A;  1XMA A;  4FHT A;  1GHC A;  4WXH A;  5DEQ A;  3TO6 A;  4GXO A;  2FXA A;  5F64 A;  1P2F A;  4EJW A;  5F1R A;  2D2W A;  1KU7 A;  2RV8 A;  3F8F A;  4LLG F;  2WWY A;  2XAG A;  2K4J A;  2V6C A;  3DPT A;  4MTE A;  5CJ9 A;  3HIF A;  5LGT A;  1OPC A;  2FBK A;  4HYE A;  1BI3 A;  5HLG A;  5JFR A;  2Z3Y A;  3GVA A;  1ZG1 A;  1R22 A;  2R7F A;  2W24 A;  3GF2 A;  4EJV A;  4RGR A;  3IKT A;  1BM9 A;  2DPU A;  1RUO A;  1YYV A;  3DPL C;  2P5V A;  2L4A A;  4HF1 A;  1U5T C;  1U2W A;  3TDZ C;  2FEZ A;  2HS5 A;  2IP2 A;  2YX4 A;  4A12 A;  3NQO A;  2COM A;  4UVB A;  4ZYH A;  5ED4 A;  2XVC A;  4KUM A;  4XRF A;  1B59 A;  1IF1 A;  1HSJ A;  3PFI A;  5JR3 A;  1B1B A;  3I0T A;  3TO9 A;  5D5W B;  3VOE A;  2H6C A;  4IVN A;  2HGC A;  4BHC A;  4KIF A;  4P9F A;  2O61 A;  3FMS A;  3WE3 A;  4WX9 A;  5BQT A;  4HQM A;  3VB2 A;  1UFM A;  3RI4 A;  3I58 A;  1V4R A;  1Z6R A;  2IRF G;  1AWC A;  2QBY B;  4GGG A;  1ZRC A;  5E8G A;  3ECO A;  2M45 A;  4KFC A;  1P4X A;  1KYZ A;  2OAZ A;  3SHF A;  4HX4 A;  2YPR A;  5CVU A;  2CFX A;  1OMI A;  4LJZ F;  2IVM A;  1T38 A;  3F8B A;  2QEN A;  3CUQ B;  1H9T A;  5BS6 A;  5D6F A;  3FM3 A;  1KU3 A;  1IZ1 A;  1BI1 A;  2ZNY A;  3S2W A;  2GWR A;  3COA C;  4BHB A;  3HRS A;  3EET A;  5DCM B;  4IPA A;  1RZ4 A;  2EFP A;  1MJA A;  4HF0 A;  2F5E A;  1S7O A;  4BHP A;  2VOD A;  4I09 A;  3BY6 A;  4GYI A;  1D5V A;  3KLN A;  3ZN0 A;  3CTA A;  2HKO A;  2FRH A;  5BPI A;  1FPQ A;  5DDG A;  2XGX A;  2VN2 A;  3ZPL A;  2LNB A;  3F8M A;  2EV0 A;  3RPU A;  3CO7 C;  2STT A;  2DBB A;  2Z33 A;  2PBI A;  3HTU A;  3KP7 A;  2KIF A;  3KP3 A;  3I53 A;  2L01 A;  2OQG A;  4XLP F;  3MQ0 A;  2JSC A;  4UXN A;  4P55 A;  3W6K B;  1JHH A;  1LJ9 A;  4CIC A;  3L09 A;  2GXB A;  1XMK A;  4XLN F;  2YU3 A;  2QLZ A;  3DQV C;  2XRO A;  3B02 A;  5CVR A;  2EFQ A;  2B0L A;  3ZP5 A;  4ZYD A;  5DD4 A;  3F22 A;  3IRR A;  3KP5 A;  3KCC A;  1HKT A;  3BP8 A;  1FWZ A;  4Y17 A;  1UHM A;  2FOK A;  3IHU A;  4OIP F;  4CYD A;  1FT9 A;  4EV0 A;  2DO7 A;  3LST A;  3J81 Z;  1UST A;  1MDM A;  1K7A A;  3KEO A;  3TOB A;  1IN7 A;  1RI7 A;  1SD4 A;  3RYR A;  1IXS B;  1I1G A;  4A5N A;  1XSV A;  2LF7 A;  1RUN A;  3I59 A;  3M1E A;  3FXU A;  3JAM K;  3GUD A;  3VEP A;  5JI6 A;  4AIK A;  2PMU A;  1B9N A;  3WTV C;  5JVT A;  4I0B A;  4G94 A;  2IJL A;  1TLH B;  5BMZ A;  2KJC A;  3KP6 A;  4R8H A;  4CZZ A;  4LD5 A;  2P7V B;  3WU1 B;  4B8X A;  1J2X A;  2DFI A;  1XSX A;  1ZRF A;  5EEH A;  3WGH A;  1H9G A;  2ZJ2 A;  2OBP A;  1FYL A;  3GFJ A;  1P4W A;  4BXU A;  2V1U A;  2QWW A;  3ISP A;  4UUV A;  2RNJ A;  3HHH A;  2HEO A;  1Z7U A;  2HDC A;  4G7Z F;  2XAS A;  1KU9 A;  1R36 A;  4HZF A;  1DUX C;  5HS7 A;  2OU2 A;  3Q5F A;  2VC0 A;  5LHI A;  5CVI A;  3GYH X;  1RNL A;  4A0Z A;  3M8F A;  3O2P E;  3QP6 A;  4WXC A;  1Z05 A;  3ZMS A;  4LGW A;  4KT5 C;  2MH2 A;  5EEG A;  5H6Q A;  4L5J A;  2FNA A;  4I2O A;  1SFU A;  3KFW X;  3BJA A;  3MEX A;  1Z1D A;  2M8E A;  4HF2 A;  1G4D A;  4O5V A;  1YFH A;  5ILS A;  2HFH A;  2VE9 A;  4AVP A;  1W7P B;  3BWG A;  3KEQ A;  3ULQ B;  3ZMV A;  1O3S A;  4EMS A;  3IRQ A;  2L54 A;  4N9I A;  3V8K A;  3L7W A;  1JGS A;  3MCZ A;  2OZU A;  1IN6 A;  4HV6 A;  5J6X A;  3RKW A;  3WTS C;  1STZ A;  2YX7 A;  3ZN1 A;  1TW3 A;  2ZO4 A;  2VT3 A;  3L9F A;  3FZV A;  1O3Q A;  3RIR A;  1C0W A;  2A6H F;  4IHT A;  4IF4 A;  2HTJ A;  4U0W A;  1IN8 A;  4OOI A;  4KIC A;  3H3Z A;  1J75 A;  4HBL A;  1EH6 A;  2IPQ X;  1LEB A;  4M72 A;  3KP2 A;  1U6G A;  3WG9 A;  1QZZ A;  2HYF A;  2IW5 A;  4EM2 A;  3N4M A;  4KIG A;  2P6S A;  3IC7 A;  2PI0 A;  5K5O A;  1TQI A;  3W6J B;  2Y75 A;  2OA4 A;  3BPX A;  2NS0 A;  1WQ2 A;  3RJP A;  1OYW A;  2E7X A;  2VOO A;  2Y0M A;  1LNW A;  2X0L A;  2PFB A;  2R7D A;  2VOP A;  2VC1 A;  1WWX A;  3HYI A;  4LLN A;  5E1Z B;  2O03 A;  1ZRE A;  4G7H F;  1XCV A;  1ZAR A;  2ZFW A;  2KIM A;  2BE5 F;  1K78 A;  2L4M A;  4HA8 A;  1G3S A;  4R1H A;  3GFM A;  2MBF A;  2WTE A;  2HYG D;  5A2Q Z;  4NQW A;  1H0M A;  3TDU C;  3E5U A;  3WE2 A;  1JHF A;  2P7C B;  2PLY A;  3T8T A;  4WK8 F;  2P6T A;  2BYV E;  2XIG A;  2H94 A;  3C3W A;  4PCQ A;  1KU2 A;  2RC4 A;  1FYK A;  1ZG3 A;  2L02 A;  2QVO A;  5JHU A;  1ZLJ A;  3G3Z A;  1TQP A;  5HS8 A;  1DP7 P;  1LVA A;  3HSE A;  1XGO A;  3HUG A;  3JSO A;  1TQM A;  1PP7 U;  1J0R A;  1W5S A;  3LAJ A;  2V9V A;  2IA2 A;  4PDK A;  4ZZL A;  2BV6 A;  3HSR A;  4LMY A;  1R1U A;  2JPC A;  4ZH4 F;  4OIN F;  2H27 A;  1MJ9 A;  2A68 F;  1YS7 A;  5D4S A;  2D45 A;  4BNC A;  2K7L A;  2GQQ A;  4WF2 A;  2ZXJ A;  3FXR A;  3E6M A;  4ASN A;  1GXQ A;  1WSU A;  4IRG A;  1F9N A;  5DV5 A;  1U78 A;  2OQR A;  2Z9O A;  2Z5U A;  4I98 B;  1J7K A;  4UV8 A;  3GFL A;  1FLI A;  2F5F A;  1YS6 A;  4G6Q A;  3PQK A;  2ISZ A;  2XAF A;  1KA8 A;  3FF5 A;  4IJA A;  3T0Y A;  4KA4 A;  4YG2 F;  1ZG5 A;  3IWZ A;  1R00 A;  2LDU A;  4U7B A;  4LG0 A;  4A0Y A;  5E1X A;  3B73 A;  1W7P D;  2DTR A;  5H6R A;  1YO5 C;  3JTG A;  3R61 A;  3V8L A;  4FT8 A;  1A04 A;  2M1B A;  1BN5 A;  1E2X A;  5L3G A;  5D5V B;  4ZYE A;  2HOE A;  2GIV A;  3E5Q A;  1FY7 A;  4HV5 A;  4ETS A;  1O7L A;  1HST A;  5K5Q A;  2DK8 A;  1E17 A;  3T1B A;  3HTS B;  3JTH A;  1IAW A;  5K5R A;  2XHK A;  2DW4 A;  4OIR F;  2Q8K A;  5LGU A;  2PJP A;  2M30 A;  3I71 A;  1BI2 A;  1G3T A;  1EH8 A;  1U5T B;  3MWM A;  2DI3 A;  3ZMU A;  1K79 A;  4I02 A;  3NRV A;  5DYM A;  1QGP A;  1R5H A;  5CVV A;  5AIP A;  1JXS A;  1R7J A;  3WTY C;  4CDG A;  4H0E A;  3ERE D;  3CO6 C;  5ERI A;  1T39 A;  1X3U A;  1YTY A;  5LEK A;  3HOS A;  4CHU A;  2VBZ A;  1R1T A;  4EJU A;  1ODD A;  2CO5 A;  3HRU A;  1I27 A;  5DUK A;  1G3Y A;  2EK5 A;  5FLX K;  2K27 A;  5F6F A;  2VBW A;  2GXG A;  4NHJ A;  1BOA A;  4U7D A;  3F23 A;  4HW0 A;  1HKS A;  4GYG A;  4PZJ A;  2CW0 F;  2EFO A;  3GW2 A;  1BBY A;  2O0Y A;  2W85 A;  4UHT A;  4Q4Z F;  4KNY A;  3BDD A;  2OZ6 A;  4AIH A;  4RGS A;  4A6D A;  2F5C A;  3KE2 A;  2XAJ A;  5ICF A;  3H3U A;  2A3S A;  3V7S A;  3DFG A;  3WGI A;  4YIF A;  5HLH A;  4WCG A;  2CWE A;  2VON A;  4RB1 A;  1BC8 C;  4JQF A;  2RKH A;  2FBH A;  2G7U A;  1B9M A;  2ZME A;  2FML A;  2DQR A;  5L3B A;  4ENN A;  2HR3 A;  2CYY A;  5D8K B;  3HSF A;  4EVI A;  3GLX A;  3V4G A;  1L3L A;  1JE8 A;  1J9I A;  2A6E F;  3QU3 A;  3JAM Z;  3O3K A;  3E6C C;  1FP1 D;  4I7H A;  3LA7 A;  4MQV A;  4BAY A;  1ZN2 A;  1TW2 A;  1CGP A;  4I01 A;  2ZNZ A;  3ZMD A;  2D1V A;  2P5K A;  4MHG A;  3WOD F;  5IT9 K;  1SD7 A;  3D0S A;  3EUH A;  5IT3 A;  4CO8 A;  3DP7 A;  1J5Y A;  1EV7 A;  1SD5 A;  1P92 A;  2VBY A;  2A07 F;  1KQ9 A;  2RDP A;  2O3F A;  3DKW A;  4G6D A;  4B09 A;  3BZ6 A;  4P9U A;  4S05 A;  2FU4 A;  1DPR A;  1S7A A;  4G9Y A;  2FQ3 A;  4N9H A;  4G7O F;  1OYY A;  5HDG A;  1PUE E;  4DQ2 A;  3JW4 A;  3IKV A;  4L9J A;  3HOT A;  5E20 A;  5J8C A;  2HZT A;  1ZGJ A;  5CYV A;  3MZH A;  1T6S A;  1MZB A;  3ABU A;  5CVJ A;  5ILU A;  5FGM A;  5BPD A;  4BQA A;  1TTY A;  4OU0 A;  2HKX A;  3K2Z A;  2H6B A;  4IHS A;  1R5G A;  4OMZ A;  2EFW A;  4EM0 B;  1IN4 A;  1AOY A;  3RYP A;  3WTX C;  2W57 A;  2ZBK A;  4D0P A;  3LQQ A;  1U3E M;  3D5L A;  2M5W A;  1YG2 A;  2PMH A;  5LHH A;  3I64 A;  3RKX A;  4YII A;  1V3F A;  3F21 A;  4HLY A;  4M9Z A;  1FP2 A;  2BBY A;  1ZYR F;  3QPT A;  5DD8 A;  2LSO A;  4M9X A;  2QQB A;  3CLO A;  1OR7 A;  1XN7 A;  2GAU A;  3E3V A;  3R0J A;  1XSD A;  1Z91 A;  2DK5 A;  3WTW C;  2IT0 A;  3EYY A;  2JTV A;  2MA3 A;  5BOX A;  2XKP A;  5HVQ C;  2ESH A;  1FNN A;  3K9T A;  3GFI A;  2DAO A;  3E97 A;  2CQK A;  3LA3 A;  5KK1 A;  2H09 A;  3U1D A;  2FSW A;  4IRI A;  2AS5 F;  1SMY F;  4F7Z A;  1FBQ A;  3R60 A;  4LLL A;  2HTS A;  4AWX B;  1LDK B;  5J8F A;  3BJO A;  1ZGA A;  1MDM B;  3P9K A;  4KMF A;  1S8N A;  1MGT A;  3JSP A;  1MKM A;  4M9S A;  4Q48 A;  1I1S A;  1EH7 A;  5K1Y A;  3MAJ A;  1LDD A;  2QYO A;  1WRJ A;  2VE8 A;  3I59 B;  4RB3 C;  3IL2 A;  1D3Y A;  4JBA A;  2Z99 A;  3M8E A;  4ENM A;  2MLK A;  3LAP A;  4HLX A;  3TGN A;  3R0A A;  2MLG A;  2RVC A;  2XAQ A;  3GO5 A;  4ZZD A;  4FX0 A;  3F6O A;  4U0V A;  3LA2 A;  4Q5S F;  5HDK A;  3F6V A;  4KMU X;  1XGN A;  3CDH A;  2CGP A;  3R4K A;  2DQL A;  4CGZ A;  2UXN A;  3PQJ A;  1MD0 A;  1F1Z A;  2WV0 A;  4LFU A;  3SXY A;  3H92 A;  2FBI A;  3L2C A;  2Q0O A;  2XKO A;  3FX3 A;  2Q2E A;  3F8C A;  5D5X B;  1ZAO A;  3DF8 A;  3K1P A;  3BJ6 A;  1FBS A;  3Q9V A;  3M9A A;  5L3E A;  3TOA A;  4UV9 A;  5FFZ A;  2VBX A;  3KP4 A;  3QU6 A;  4R79 A;  2ZCW A;  2GZW A;  1TBX A;  5LLQ A;  3M7G A;  4U0Y A;  2JPB A;  4EM1 A;  2HWV A;  1D8K A;  4RAY A;  3DXJ F;  3TO7 A;  2FNP A;  4ESF A;  2QBY A;  1BIB A;  4IXA A;  1REP C;  2ETH A;  4NB5 A;  5LGN A;  4Z2Y A;  1ZRD A;  1QZY A;  3ROU A;  4A2U A;  4HDU A;  5HDN A;  1QPM A;  2E1N A;  2J5P A;  4L9N A;  2L3D A;  3AAF A;  1XB4 A;  1SD6 A;  1B4A A;  4WWC A;  3CJN A;  4HX8 A;  3CUQ A;  2V79 A;  2C6Y A;  4A6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...