4AIHA

Crystal structure of rova from yersinia in its free form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
142
structure length
139
Chain Sequence
ESTLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
total genus 50
structure length 139
sequence length 142
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aihA00
3EETA 5FLXK 3I64A 1UCRA 3QU3A 5L3BA 1DP7P 4ENJA 2KKOA 4WF2A 4RGUA 1IXSB 2IJLA 2JSCA 3K2ZA 2K4BA 3MEXA 3GW2A 3KZYA 2H27A 3K1NA 1QGPA 2EV5A 4B8XA 1IZ1A 1FX7A 2OBPA 2DFIA 3KP5A 2DT5A 4A0ZA 1CF7A 1OR7A 2HOEA 5ILUA 1ZARA 2P8TA 3PQKA 2HQRA 2Y48A 3ECOA 3V8KA 3TOBA 3MFKA 2OQRA 2VOOA 1FPQA 3GFMA 2OZ6A 2ISZA 2O6GE 2ESHA 3WTVC 5TJJA 3I54A 5HS8A 1BBYA 1K7AA 1BC8C 5ILVA 1OYIA 4IXAA 4A5MA 2P5VA 1UB9A 5CVVA 4ENMA 3JSPA 2DQRA 4UHTA 3KEOA 3C1DA 2EFPA 4EVIA 2MH9A 3PFIA 2QM3A 4XLPF 5AIQA 3F8BA 4KDPA 1Z91A 2B0LA 4EMSA 4HX4A 1MZBA 2ZBKA 1R1UA 1I1SA 1KQ8A 3P7NA 1J75A 4DNCA 3GLXA 3JAMK 1YLFA 5DCFA 1ZGJA 1IN5A 3I58A 2X4HA 2H94A 2STTA 1P4XA 4R79A 1FC3A 1W7PA 3U9GA 5BPDA 4L18B 1Z1DA 1ZHFA 4U0VA 1WRJA 3LFKA 1JGSA 4HX8A 1HW5A 4HLYA 3WG9A 5LHGA 3HTSB 5E18F 1FYMA 2VN2A 2H6CA 4MQVA 1ZYRF 1FNNA 1FT9A 2M1BA 3KETA 1QZZA 4KIBA 5H20A 2L4MA 3BJ6A 1T38A 2P5KA 2FBIA 2FNPA 2VT2A 3DQVC 3CUQA 2FNAA 4UV9A 3V7RA 2G9WA 4NB5A 4HF2A 1QQIA 2V9VA 3GEZA 2VBXA 5HDGA 2FBHA 2PMHA 1IXRC 4G6DA 1ZN2A 2CGPA 4AIHA 3RPUA 1U3EM 2NNNA 1IUYA 5CVUA 5H6RA 5L3FA 3IRQA 2DQLA 3ZPLA 2JPBA 1Y0UA 3KE2A 2XGXA 4WCGA 1P4WA 4GGGA 4R1HA 5KVRA 2MD5A 3CTAA 2E7WA 4M6XA 1B6AA 1B9NA 4A6DA 5JR3A 1ZH5A 2P7VB 1GXQA 3COAC 3F8FA 3WTXC 1LEBA 4IRIA 5L3CA 4EJVA 1ZRDA 2EWNA 2XHKA 4ESBA 1WSUA 1FY7A 3WGGA 5KK1A 5CJ9A 4HOBA 1FSEA 3ZMUA 3DEUA 5E8GA 3P9IA 1SFXA 1XGSA 1U78A 1MJ9A 5L3EA 2LDUA 4EGZA 1F5TA 1U8RA 2DAOA 1Z6RA 3WU0A 2A3SA 4I2OA 3CUQC 3GZ5A 3FM3A 2W25A 2P7CB 5LGUA 2A61A 3GWZA 1XMAA 2V1UA 4HDVA 2EA4A 2HKXA 3I71A 3FZVA 3DPLC 4KUMA 2EFWA 1FP1D 3G73A 2ZCWA 4L9TA 1KU7A 4AIJA 2DBBA 3FMQA 4MTEA 2FU4A 5F6FA 2XIGA 2O61A 1F1ZA 4RGRA 4LGWA 3ROUA 3KP3A 1FSHA 1KYZA 5IT3A 4HV6A 1BJAA 3CLOA 2K86A 4IHTA 1P6RA 1WQ2A 1E17A 3DF8A 4PDKA 4OMZA 4ZZLA 4RS8A 5HLHA 3H3UA 5D5XB 3BPXA 2IW5A 2PG4A 5JVTA 2K7LA 1PP7U 1DPRA 4HDUA 3CO6C 1NHAA 3Q9VA 3LQRA 2HS5A 1SD6A 2PN6A 2YSRA 1A04A 5DUKA 1O7FA 1J59A 4YFNF 2NYXA 2V79A 1EH6A 3RYRA 4U88A 1BI1A 5BMZA 2F5FA 3ZMDA 2FMYA 2EV0A 4OIOF 3WODF 3DFGA 2XROA 5DEQA 3BROA 2VBYA 3QOPA 3ZMVA 3EUHA 3NRVA 1W7PB 2MBFA 3L09A 3BWGA 2FF4A 1XGNA 3M9AA 2PBIA 2EFQA 4Q4ZF 1G3YA 3J7AO 3M8FA 3E3VA 4XRFA 2OQGA 2D2WA 4S04A 4LJZF 2BYVE 2W84A 3QP5A 4XLNF 1EH8A 3LSTA 5D6FA 2DI3A 1W7PD 1OYYA 4EGYA 5FFXA 3HOSA 4RB1A 3KP7A 2ZO4A 5J6XA 4XSZF 3IWFA 1T2KA 1SD5A 4CDGA 1DUXC 2G7UA 4HF1A 5D5UB 4EM1A 3P9CA 1KU3A 1FBSA 1B9MA 1BOAA 1YO5C 1YS6A 1GVJA 2HWVA 3CDHA 5HS9A 3KLNA 4KIGA 2M30A 2LF7A 1V4RA 1Z7UA 4G6QA 1IN8A 1XSDA 3F3XA 4EQQA 1YS7A 3IHUA 4PGGA 3RDIA 2GXBA 4AVPA 1UFMA 2RDPA 2COMA 2W85A 1BC7C 2VE8A 2E1NA 1RI7A 1CF7B 2J5OA 1XDSA 1O3RA 4I98B 1BI0A 2LSOA 4IRHA 2D1HA 2ELHA 1RNLA 2O3FA 1YQAA 4Q47A 3HRUA 1OYWA 3VEPA 1WWXA 1H9TA 2CWEA 3FWEA 2PMUA 2XKOA 1HW1A 2GWRA 3Q5FA 3I5UA 2IVMA 2WC2A 2VC1A 3EYYA 1LJ9A 3L00A 2YX4A 2Q2EA 1R00A 3RIRA 4LK1F 1IN6A 3O2PE 2IP2A 2QVOA 3SXYA 4KT5C 4BHPA 4UUVA 5E8IA 2UXNA 1R1VA 2QYOA 3F6OA 3KEQA 1U6GA 1MGTA 2F5CA 4S05A 2IRFG 2RV8A 2PFBA 5LLQA 4ESFA 4LG0B 3TKYA 2RKHA 3C7JA 1R5GA 1TLHB 4A0XA 5DD4A 4JBAA 1QBJA 2WV0A 3HRSA 1ONVA 3NQOA 5F1RA 1R36A 2ZNZA 3ZMZA 3GUDA 1VTNC 1S8NA 5HLGA 3IKTA 1ULYA 5LRSA 2KIUA 1OPCA 4UVCA 3CJNA 4BH9A 2QWWA 4L0ZB 3AAFA 4A5NA 1R1TA 1E2XA 4YFXF 2ACJA 1J0RA 2NS0A 3J80Z 4PCQA 3JAMZ 4CYDA 1D8JA 1YW8A 2FE3A 3LA7A 3HUGA 5FLXZ 1S3JA 3U2RA 3BZ6A 2Y0MA 1KU9A 2DTRA 2OA4A 3HRMA 4BHBA 3IWZA 4ZZDA 1USSA 2ADUA 4EJTA 3C18A 3WTSC 5IT9Z 1FYLA 2MLKA 2A6EF 3E5XA 3GFLA 5FFZA 2GAUA 3KLOA 3SHFA 4DQ2A 4O3MA 4ZH4F 4HLXA 3IKVA 1G4DA 4YG2F 2HFHA 2XASA 4MNUA 5CVIA 1KQ0A 5K5OA 1RZ4A 2VBZA 1D3YA 2EFNA 4OOIA 2MH2A 3MQ0A 1XGOA 3ZP5A 2F2EA 2P6TA 2O8XA 5FO5A 2NNYA 3V8JA 3I4PA 1Z6TA 2Z3YA 3FF5A 1RUNA 1IN7A 4RGXA 4HBLA 1O7LA 4K2EA 3T8TA 3ABUA 3DXJF 2DK8A 2QLZA 1FWZA 3QU6A 3BY6A 1G3WA 5HS7A 4Y15A 4GXOA 4ESJA 3G3ZA 4WXHA 2L4AA 5K1YA 4IJAA 5D8LB 4QWQA 1O3QA 1ZGAA 3H92A 1G3TA 1ZG5A 5ICFA 5HLIA 4CXFA 2O0YA 2O03A 3HSFA 4HZFA 3ML6A 1PP8F 1W5SA 1K6OA 1S29A 1S7OA 2H6BA 3TGNA 1R22A 3JW4A 3F72A 4P5OA 3L9FA 1KQ9A 2R7FA 3WE2A 4U7DA 1UHWA 1TW2A 3J81K 5DUIA 4L9VA 1PDNC 5LEJA 3C3WA 2CYYA 5JI6A 1U5TA 4CZZA 2FOKA 3E5QA 3K0LA 5TRDA 1RIOH 2X0LA 3ELKA 5E1XA 3RTRA 3HRTA 4KN7X 3HHHA 4AWXB 4RB3C 1XDUA 1HSTA 2RNJA 4FT8A 3WTZA 5H6QA 1F9NA 3FMSA 5BQTA 1FP2A 4M71A 4O6JA 4I01A 4I09A 3TDUC 2VODA 1ON1A 1JE8A 3E6DA 3J80K 1R7JA 3HSEA 2K02A 4G7ZF 4LD5A 1HKSA 3U1DA 4LK0F 1TNTA 2PEXA 3DKWA 1XMKA 1XD7A 2VONA 1XB4A 3D5LA 1K79A 4UXNA 3DPTA 1XSXA 5L3DA 1IRGA 1HKTA 2VC0A 2P6SA 4Q5SF 5IT9K 1SFEA 1J9IA 2KIMA 3RYPA 5HVQC 4LFUA 3FHZA 1IW7F 3IRRA 2HEOA 2ESNA 3CUQB 2DPDA 3ZMTA 4L9NA 4L9JA 2XVCA 5DV5A 3T8RA 4ZYGA 3L7WA 3R0AA 4IRGA 2Q0OA 2ZJ2A 5D8KB 2KRFA 4ZYHA 2J5PA 4EJOA 2HKOA 1JXSA 1HSJA 1KGSA 1R23A 2IA0A 2QBYA 4LMYA 1P4AA 3ZN0A 2QQ9A 2HR3A 4LLGF 2UXXA 4LLLA 3O3KA 2L02A 1HW2A 1FYKA 2M5WA 1HBXG 5D5WB 1L3LA 5HDNA 2GA1A 4BYYA 4OU0A 3CUOA 2ISYA 1YG2A 4N9HA 3WE3A 3HSRA 5AIPA 1T98A 1PUEE 3LA3A 3WGHA 4ENNA 3I59A 5D6EA 5E17F 4IF4A 2OAZA 4L5IA 5ICGA 3RKXA 1MJAA 5LHHA 3E97A 2DLLA 1G6NA 3F8MA 4OIQF 5J8FA 2AXLA 2L54A 1FBQA 2QENA 2RGVA 2V1DA 4ON0A 2IT0A 2EJRA 1W4MA 2LNBA 3F21A 2QBYB 2H09A 4OIPF 4JQFA 5BPIA 2GIVA 4OMYA 1SD7A 5FD6A 1K78A 5EEHA 4A0YA 3I59B 3TOAA 1TW3A 2FXAA 1MD0A 1OKRA 3GO5A 1S6LA 1U5TB 3GFIA 3MZYA 2ZMEA 4TV7A 5D4SA 4F7ZA 4P9FA 4U0WA 3I53A 3R0JA 1T0FA 3VB2A 5FB2A 4CHUA 2ZMEB 2Z33A 4CO8A 4M9XA 3N4MA 2STWA 1CGPA 1T39A 1Z9CA 5DYMA 2GA2A 5LGNA 1EV7A 4HV5A 1I6XA 3FMRA 5L3GA 2HTSA 2RQPA 5LHIA 2BEOA 2XAGA 2W24A 4EJWA 3WU1B 5CVRA 4KICA 2OD5A 1J5YA 1T6SA 4L5JA 2A07F 2LF8A 3ZQ7A 6PAXA 1O3SA 1D8KA 1I27A 4IHSA 3M7GA 5ED4A 2CW0F 3RKWA 2PQ8A 4UV8A 2OZUA 3BPVA 3JTHA 2HYFA 2YU3A 1AOYA 2M45A 4MGRA 1BM9A 3LAJA 2ETHA 1FLIA 1UHMA 3N97A 1KU2A 4M72A 2K27A 1HQCA 3O6BB 3R60A 4Z2YA 2DO7A 4NHJA 3PQJA 1H9GA 4U0YA 1QO0D 4G94A 4U7BA 5A2QZ 3Q9SA 2HDCA 1JHFA 1GXPA 3EYIA 3F23A 4KNYA 1IN4A 2YX7A 2PI0A 2DPUA 3RPQA 5CVJA 2PJPA 1ZAOA 2A5YB 4HQMA 3E6MA 3TO9A 2VT3A 2R3SA 1OMIA 4BNCA 1XGMA 1B4AA 2L3DA 1AWCA 4HF0A 4E70A 4G7OF 2MC3A 3SZPA 4A6EA 1XCVA 2P5LC 3BJOA 3REOA 3VFZA 4HQEA 2DW4A 1RUOA 4YIIA 1GHCA 2LKPA 4R8HA 4M9SA 3DV8A 5CYVA 4EM2A 2MA3A 3BJAA 2GQQA 3K69A 3KP2A 3HOTA 4MHGA 2L01A 4BXUA 2QUFA 1IAWA 1R5HA 1YTYA 3RI4A 4LLNA 2FBKA 2IPQX 4I0BA 1G3SA 1MJBA 3R6SA 2JPCA 2Z9OA 1SD4A 3R61A 2IA2A 1V3FA 2HTJA 4KYWA 4AD9A 1J2XA 3GF2A 2A68F 4P9UA 3WTTC 1ODDA 2XRNA 1MKMA 4EV0A 4M9ZA 2HYGD 4UNOA 1F4KA 2FSWA 1LDDA 4I7HA 5EEGA 1IF1A 3R4KA 3HYIA 3SFZA 3GYHX 1YIOA 2JZYA 2MLGA 1IRFA 3WGIA 2XV4S 3HIFA 2KIFA 3LQQA 1LDJA 4D0PA 4M6YA 4KMUX 3F8NA 4B09A 4WXDA 3MCZA 2V1XA 4RGSA 1B59A 5ICCA 3P9KA 3HTUA 4G8XA 4UVAA 3T0YA 4GCVA 4P96A 3W6KB 3W6JB 5LBQA 1LEAA 3GXOA 2HGCA 3JTGA 3F6VA 2BGCA 1U2WA 2FRHA 2QZ8A 3S2WA 4ASNA 1H0MA 2XUBA 3K1PA 3I0TA 5K5QA 4OIRF 1YYVA 4H0EA 4YFKF 2BBYA 5DCMA 2CFXA 3B02A 5K5RA 4G9YA 3SZTA 3QRFF 4CGZA 3FXRA 1TQIA 4XSXF 4NQWA 5J8CA 4KN4X 4EJUA 4RAYA 2ZFWA 1O3TA 2K4JA 4ZYEA 1DDNA 4MTDA 1BIBA 3KCCA 1EH7A 5JHUA 4ZYDA 5FGMA 3TO7A 4MEYF 1QPMA 5AONA 2XAHA 2F5DA 3J81Z 1TTYA 1TBXA 2FA5A 3CO7C 2CO5A 3ULQB 3BDDA 3T5XA 1ZG3A 4LG0A 5ILSA 3KZZA 2RVCA 3D0SA 2DK5A 3F22A 2VE9A 2G7HA 3VODA 1LQ1A 5LEKA 2EFOA 2BE5F 1J7KA 1B1BA 2Z5UA 1STZA 2CSOA 1YFHA 4A12A 3V4GA 2UZKA 2AS5F 5F64A 2V6CA 3V8LA 2ZKZA 3GVAA 1ZG1A 2XAFA 4ENKA 2NAZA 1LB2A 1ZRFA 3SQNA 3M1EA 1HKQA 3ABTA 2ZNYA 5HDKA 2HQNA 1D5VA 1I1GA 2EK5A 4BAYA 2KJBA 3T1BA 1XSVA 3KFWX 2VXZA 4HX7A 2C6YA 2YPRA 4XBFA 4RB2C 2KJCA 5LRRA 2M87A 5DDGA 1U5TC 4A2UA 1SAXA 3TDZC 2A6HF 3KP4A 3FXUA 3VOEA 1WKMA 3BOQA 5E1ZB 2GXGA 5BS6A 1HXDA 4GO1A 1BIAA 3FXQA 2WWYA 2RC4A 2W57A 3OOPA 1FOKA 2XKPA 3ECHA 2JTVA 4KA4A 1P2FA 1JHHA 5JFRA 4FX4A 2BV6A 4LB5A 4HYEA 1YW7A 3K9TA 4PGHA 2RN7A 2QQBA 3WTWC 1KA8A 5FD5A 4CICA 4GYGA 3BP8A 4Q48A 4UVBA 4HA8A 1P92A 1LDKB 3IC7A 2EB7A 2FEZA 3E6BA 3RKYA 1SMTA 3TQNA 4JK1X 4RB0A 2QQAA 4AIKA 1FBUA 5BOXA 3V7SA 3KP6A 4MEXF 4BQAA 2VBWA 4I02A 3E5UA 5E20A 3MWMA 3QAHA 4WX9A 2EV6A 1BI2A 1TQMA 2ZXJA 3L2CA 4HAMA 4BHCA 1ZREA 2F5EA 1KYWA 2P4WA 2CG4A 2A69F 3IL2A 3EDPA 5D5VB 4P55A 4FX0A 3WTYC 1LVAA 4RAZA 1YW9A 4I0AA 3GX4X 3TO6A 4Y17A 1I5ZA 3QP6A 3V7CA 4IPAA 4N0BA 1XCBA 4OINF 2JRTA 4PZJA 1TNSA 1Z05A 4O5VA 1USTA 2IA1A 2E1CA 4Y13A 3HHGA 3F8CA 3LWFA 1C0WA 2CQKA 1L0OC 1ON2A 5CLSA 3GZ6A 2D1VA 3JSOA 3QPHA 4LB6B 5DD8A 5ICEA 3FX3A 3M8EA 5DCMB 4KIFA 1MDMB 1ZLJA 5A2QK 4WK8F 4YIFA 2VOPA 4FHTA 1K78B 4KMFA 1SMYF 2Q8KA 4WWCA 4ETSA 2XAJA 1Q1HA 5ERIA 2UWMA 1O57A 2FQ3A 4IVNA 4M74A 4WXCA 1DPUA 1X3UA 2TDXA 3OV8A 3ZN1A 1REPC 1R58A 5LGTA 1BI3A 1LNWA 2EA2A 3LAPA 3K1MA 1QNTA 4GYIA 2D45A 5D4RA 2Z99A 2R7DA 2NRAC 2FMLA 3E6CC 1WI9A 5HOOA 2M8EA 1TQPA 3ZMSA 3FM5A 2Y75A 2YR2A 1MDMA 4EM0B 2DU9A 4MQ9F 5E1WA 4QLCU 1SFUA 1BN5A 1ZLKA 3RJPA 4G7HF 3NEUA 3MAJA 1XN7A 1IXCA 3QPTA 2GZWA 2E7XA 2OU2A 4N9IA 3H3ZA 1S7AA 2PLYA 4L0YB 2XAQA 4M73A 3WTUC 2JT1A 4HW0A 3MZHA 1W5TA 3LA2A 1ZRCA 3ERED 3GFJA 3DP7A 1QZYA 4KFCA 2WTEA 1FZPB 3B73A 2HZTA 3ISPA 3EQLF
chains in the Genus database with same CATH superfamily
3EETA 4CCJA 5FLXK 3I64A 2X51A 3OIQA 2RQQA 1UCRA 3QU3A 3DPUA 5L3BA 1H8AC 3A0HC 1DP7P 4ENJA 5KAIC 2KKOA 4RAGA 4WF2A 4UUSA 4RGUA 1IXSB 2JN6A 2IJLA 2JSCA 3JRBA 3K2ZA 5IPAA 2K4BA 3MEXA 4KJZA 4IX7A 3ZQHA 3GW2A 3KZYA 3G4SI 2M9HA 3AG3H 3I56I 1VQLI 2E36A 4M3GA 2UV1A 1R6RA 4HSRA 4XLAA 3MVPA 4CCOA 3G6EI 1QVTA 1W0TA 2LKSA 2H27A 3K1NA 1QGPA 2EV5A 1MMNA 3C2BA 3NARA 2DJIA 4B8XA 1IZ1A 2PJRB 4CSWA 4NC8A 3LMMA 1FX7A 2OBPA 2DFIA 2VPRA 3KP5A 4AC0A 1NG6A 2DT5A 4A0ZA 4BACA 2EQRA 1SVLA 1CF7A 4UUTA 1OR7A 2HOEA 5ILUA 3K4KA 5F0FA 1ZARA 1RKTA 4RDUA 2HNHA 2K85A 2P8TA 3PQKA 4FISA 3K2AA 2HQRA 2JK3A 2Y48A 2DMNA 3ECOA 2XB0X 1RPWA 3V8KA 3TOBA 3MFKA 1A31A 3BTJA 2OQRA 3EUHC 1R5ID 3FK6A 3S16J 1AKHB 2VOOA 2R0QC 4KISA 1FPQA 3B6CA 3GFMA 3QWLA 2OZ6A 2ISZA 2O6GE 2ESHA 2CS3A 3A1YA 2EPFA 3WTVC 1F43A 5TJJA 3MKZA 2VQCA 3I54A 2DOAA 1PYVA 1BBYA 5HS8A 3P5JA 3S8PA 1MH4A 3DTEA 3A4CA 1K7AA 2Y9ZA 1BC8C 5ILVA 1OYIA 3CMMA 4IXAA 4BEHB 4A5MA 1LFPA 2P5VA 1UB9A 3FKJA 2ZXWH 3PSIA 1MBGA 2E2IJ 4JX6A 1Y1WJ 5CVVA 3QQAA 3K4BA 2MD0A 3JSPA 4ENMA 3OOUA 2DQRA 1X3ZB 4UHTA 2HVQA 3ZQCA 2VKHA 3O8HA 2O9LA 3CDIA 3KEOA 3C1DA 2EFPA 3PO3J 4AU7A 1MBFA 1X1AA 4EVIA 5FJ8J 1T08B 2CQXA 4BY7J 1EJ9A 2MH9A 1YX3A 2FOWA 3PFIA 4YELA 3PFYA 2QM3A 4XLPF 5AIQA 3M07A 2LVSA 4M3FA 3F8BA 4KDPA 2WAFA 1Z91A 2B0LA 5TGTA 4EMSA 4HX4A 1MZBA 1IRXA 1X1BA 2E34A 5M5XJ 1D1CA 1LFBA 2ZBKA 4DW6A 4KITB 2EIMH 4PUSA 1R1UA 2DCEA 1Z3XA 1I1SA 1KQ8A 3P7NA 1J75A 4DNCA 1XPXA 3GLXA 1B72B 4PJLA 3JAMK 1YLFA 1LPQA 3J7YJ 5DCFA 1ZGJA 2Y30A 3RPUD 2CRGA 1IN5A 2DA1A 4NC7A 1E3OC 3I58A 2NS7A 4XKWA 5JLWA 2X4HA 2H94A 4QTRA 2STTA 1P4XA 2IS6A 2E1MC 4R79A 1FC3A 1LVKA 3VSLA 1W7PA 1UAAA 2HOSA 3U9GA 5BPDA 4L18B 1YHQI 5EEAA 1Z1DA 1ZHFA 4U0VA 5F08A 4B4CA 3S3NA 1WRJA 2ID6A 2IAIA 3LFKA 3OS1A 2K40A 1N77A 1JGSA 2AQFA 4HX8A 5E3LA 1HW5A 2CQQA 1WJCA 4HLYA 3WG9A 5IYDJ 4A3GJ 1SFOJ 3KIOA 4QSHA 5LHGA 3GTGJ 3HTSB 5E18F 1FYMA 2DA4A 5IOZA 3HG9A 5IP6A 2VN2A 5E79C 2L7MP 4IQ4A 2H6CA 4MQVA 1ZYRF 1FNNA 4BDYA 1FT9A 1ENHA 2M1BA 3KETA 1YOVB 5IP9J 1QZZA 3PNYA 4KIBA 5H20A 2L4MA 3BJ6A 3QPLA 1T38A 2P5KA 2FBIA 2FNPA 2VT2A 5FLMJ 1JT0A 3DQVC 3OY9A 3CUQA 3G71I 1S9HA 1MBKA 2FNAA 3BLYA 4UV9A 3V7RA 2G9WA 1IRZA 4NB5A 4HF2A 1FOYA 1QQIA 2V9VA 2R7WA 3GEZA 2VBXA 5HDGA 2FBHA 1D1AA 2HPIA 2PMHA 1IXRC 3OSGA 4G6DA 1ZN2A 2CGPA 2WY7Q 4AIHA 2ZJQF 5FRNA 1GLNA 2VASA 3RPUA 3JRDA 1U3EM 1ZQ3P 2NNNA 2KLOA 1IUYA 1Z3YA 2HXOA 5CVUA 2LBFB 1ZR4A 3MKWB 1X4PA 5H6RA 4HNUA 3A01A 1T8IA 2ICWG 1JUMA 5L3FA 3IRQA 2DQLA 2EZKA 3ZPLA 4QIWN 2JPBA 1Y0UA 2VIXA 3KE2A 4NBQA 2XGXA 4WCGA 1YRNB 4XK4A 1P4WA 3L2UA 4GGGA 2KPMA 4R1HA 2E35A 4PSWA 3JRGA 3JRHA 5KVRA 1E3PA 3HOXJ 3K4LA 2MD5A 3CTAA 2H1LA 3TMOA 1QZEA 1VQPI 4AIDA 4PFOA 2NVXJ 2E7WA 4M6XA 1B6AA 2LMDA 1B9NA 3CCLI 4LIUA 3IH4A 3WHCA 4A6DA 1AU7A 4L5EA 2GXAA 3IV5A 3LL7A 3BTCA 4A93J 5JR3A 3QODA 1ZH5A 2P7VB 1GXQA 2DT6A 3HOZJ 4X0GA 3COAC 2DDAA 3OS0A 2HOTA 2VJ5A 2Z16A 3F8FA 3KPHA 3I55I 3ZRGA 3WTXC 1LEBA 4E4HA 2DMPA 4IRIA 3BZCA 5L3CA 4EJVA 4A3IJ 2XC7A 4J00A 1MIJA 1ZRDA 2EWNA 2R7VA 2XHKA 1AKHA 2XPVA 4ESBA 1TWFJ 1WSUA 1FY7A 3WGGA 5KK1A 2LRDA 1ETWA 3OYCA 5CJ9A 5E3NA 3KEYA 4HOBA 4FE7A 1FSEA 1B8IA 2IS2A 3ZMUA 2LFBA 1SANA 4RBOA 2BVMA 2DJNA 5EG0B 1R9TJ 3DEUA 1N75A 2CUJA 3NWTA 3P9IA 1N25A 1SFXA 1XGSA 5E8GA 3CF5F 1U78A 1MJ9A 5L3EA 2ECBA 1RESA 2LDUA 4XQFA 4EGZA 1F5TA 1U8RA 2DAOA 1Z6RA 3WU0A 3H5RA 3FISA 3CC7I 2A3SA 3DCFA 4I2OA 3CUQC 3GZ5A 4A3CJ 3D5RC 3FM3A 2W25A 3IH2A 5FROA 2P7CB 1VZ0A 3GTLJ 5LGUA 3ZQLA 3QYFA 3JRCA 2A61A 3LSHA 3GWZA 2FQ4A 3IP4B 3S32A 1XMAA 2V1UA 4HDVA 2NVYJ 2EA4A 3DTIA 2EH3A 2HKXA 2HVRA 3I71A 4ZJZA 3VYSB 4NUBA 2LLKA 3BG9A 3FZVA 3DPLC 4KUMA 1NK3P 2EFWA 1FP1D 3G73A 2ZCWA 2TRTA 4L9TA 2R93J 4F92B 3IH3A 2VJ4A 4IKFA 2QSFX 2VL8A 1KU7A 4XLCA 5IYBJ 1V54H 4AIJA 2CH0A 2DBBA 2HZDA 2QQ8A 4A3KJ 4RLQA 4BEHA 3FMQA 3FXMA 2MC4A 4MTEA 2VI6A 2FU4A 2LP0A 5F6FA 2XIGA 2O61A 2Z1DA 1I6HJ 1F1ZA 1VQ4I 4RGRA 4DBQA 4LGWA 1WI3A 3ROUA 4B43A 3KP3A 1O4XA 2V9PA 1FSHA 4ANJA 1V55H 1YRNA 1KYZA 2AQEA 3WG7H 5IT3A 4HV6A 1BJAA 2H1KA 3CLOA 4G6TB 2K86A 1PJRA 4IHTA 1P6RA 1WQ2A 4BE1A 1E17A 1MMDA 3DF8A 4PDKA 4OMZA 3A01B 4ZZLA 4RS8A 5HLHA 3H3UA 2L7ZA 2F4MB 3HOUJ 3BC8A 2R7ZJ 5D5XB 2ZJPF 3BPXA 2IW5A 2PG4A 5JVTA 2K7LA 1PP7U 1DPRA 2BY1A 5DS9A 2PJRA 2VKEA 4HDUA 1GVDA 3GCMA 3CO6C 4NNJA 1T33A 1NHAA 3Q9VA 3LQRA 2R4GA 4IL6C 3E7LA 4YRVA 4AUXA 2HS5A 1SD6A 2PN6A 5IYCJ 4XNFA 2YSRA 4CCMA 1A04A 2IS1A 4X6AJ 1WHUA 2HU9A 5DUKA 5J1RA 2L2OA 1O7FA 1J59A 4YFNF 2X9DA 2NYXA 5EZGA 3CCJI 3AL0B 2V79A 1EH6A 3DLLF 3RYRA 4U88A 3NAUA 1BI1A 3UKGA 1K61A 5BMZA 1OCTC 2F5FA 3ZMDA 2FMYA 1POGA 2LR8A 2VQGA 2EV0A 4OIOF 3WODF 4M6VA 3NWSA 3DFGA 2XROA 5DEQA 2GBYA 1SC7A 3BROA 2VBYA 3QOPA 3ZMVA 3EUHA 3NRVA 1TL8A 1W7PB 2GM4A 2B63J 2MBFA 3PNVA 3L09A 2R7OA 3D5SC 3BWGA 2FF4A 1XGNA 2KHMA 2NS8A 3M9AA 2PBIA 2EFQA 2KZGA 1BR2A 2BHZA 1G3YA 4Q4ZF 3ERMA 3J7AO 3M8FA 3CP8A 3PJRA 3E3VA 5M3MJ 1B72A 4XRFA 2OQGA 3L2QA 4RLFA 1I50J 2D2WA 4S04A 1E3HA 4LJZF 3JRAA 2BYVE 2W84A 1UMQA 2KISA 3QP5A 4XLNF 2VLAA 1EH8A 3LSTA 2V26A 5D6FA 2DI3A 1W7PD 1OYYA 1Y0NA 4EGYA 2GLOA 5FFXA 3HOSA 4LITA 3PL8A 4RB1A 3X2QH 2JA7J 4D7NA 1FTZA 5EGOA 3KP7A 2ZO4A 5J6XA 1SEUA 4JX5A 4XSZF 5EYRA 3IWFA 3S3OA 1T2KA 1EA3A 4BJTA 2ZC2A 1SD5A 1P7IA 4CDGA 1DUXC 2G7UA 4HF1A 5D5UB 4XKCA 4I99C 4EM1A 4II3A 4D5CA 3P9CA 1KU3A 5FKKA 3ZXSA 1BW5A 1FBSA 1B9MA 1BOAA 1YO5C 1YS6A 1GVJA 5KCMA 2HWVA 3CDHA 3EUKL 4N4NB 5HS9A 1OCRH 4IEJA 3KLNA 4KIGA 4A3JJ 2M30A 1JKOC 2YU9J 5TISC 4A3EJ 5DM7F 2LF7A 3DU5A 1V4RA 1Z7UA 2QCOA 4G6QA 4V2GA 5B1AH 1IN8A 1XSDA 3F3XA 4EQQA 4N4OB 3RZDJ 1YS7A 2W00A 1ETVA 3TBIA 2COBA 3IHUA 4PGGA 3RDIA 3OMYA 2O5RA 2GXBA 4AVPA 3LSPA 1UFMA 2RDPA 2XSJC 1JKRC 1A6QA 2CQNA 1Y1VJ 2COMA 2W85A 3KYDB 3H3VK 2NXNB 2BY0A 2EBIA 2XPWA 3CQZJ 3LFUA 2HXIA 1BC7C 3HUGB 2VE8A 5FKNA 2E1NA 1RI7A 1CF7B 2J5OA 2LY9A 1GDTA 1FTTA 3SDGA 2X1DA 4CH7A 3OYAA 5FRMA 5IY5H 1FEXA 1XDSA 1O3RA 4I98B 1LE8A 1BI0A 4HSTA 4II2A 3S14J 3RQIA 3CCQI 2R5YA 2LSOA 4IRHA 2D1HA 3H0DA 3GBGA 3ONQA 2ELHA 3VYTB 3G1OA 1RNLA 2O3FA 1YQAA 4Q47A 3HRUA 3FBIB 3MKYB 3CCVI 1LFUP 1OYWA 3VEPA 3W6VA 1WWXA 3BG6A 1H9TA 2WBMA 1VQMI 3RZOJ 2CWEA 4PJ0C 3Q3SA 3IAM2 2ELJA 3FWEA 1VQKI 1TWHJ 4I76A 2PMUA 2XKOA 4EATA 3BR3A 2YS9A 3IAS2 5EDNA 1HW1A 2BHYA 3ZQGA 3B6AA 2GWRA 1K83J 3Q5FA 3I5UA 2F5VA 4UB8C 1DGRM 3ASNH 2IVMA 2WC2A 2VC1A 3EYYA 1LJ9A 3L00A 3GMEA 2YX4A 5LFAA 2L9NA 2Q2EA 1R00A 3RIRA 4LK1F 1IN6A 3O2PE 2IP2A 2QVOA 3SXYA 4KT5C 4BHPA 4UUVA 5E8IA 2UXNA 1R1VA 2QYOA 2HOAA 3F6OA 3KEQA 1U6GA 1MGTA 2P81A 2IXSA 2F5CA 2M3AA 3OIPA 4S05A 1T95A 3OSFA 2IRFG 2CJJA 4BE2A 1HC8A 2RV8A 2PFBA 2WAQA 5LLQA 1IG7A 4ESFA 4LG0B 4C9YA 2IGMA 1ZTRA 1FMVA 3TKYA 3CCMI 2RKHA 4FTHA 2EINH 3J7AY 4F91B 2I5UA 3C7JA 1G2HA 2CV1A 1R5GA 4FQGA 1VF9A 2K3FA 1TLHB 4A0XA 2L9VA 3S15J 5DD4A 4JBAA 3QPSA 2DA7A 1QBJA 3SEQA 2WV0A 3K4JA 3HRSA 1ONVA 3NQOA 5F1RA 1R36A 3TL4X 2ZNZA 2DTZA 3ZMZA 4E7ZA 3GUDA 2ME6A 1VTNC 1S8NA 4CCNA 2KQRA 1YX5A 5HLGA 3CJTB 2O7OA 3H5AA 5EGOB 3IKTA 3KZIC 1ULYA 5LRSA 1VQ8I 2KIUA 2MW8A 1OPCA 4UVCA 3CJNA 4BH9A 2QWWA 4L0ZB 1Z21A 3AAFA 4A5NA 4A69C 1R1TA 3K70D 3M3YJ 1P9QC 1E2XA 2CUFA 3ESWB 4E7HA 2D5VA 4BUPA 4YFXF 2QA4I 2ACJA 4B47A 1J0RA 2NS0A 3J80Z 4PCQA 3JAMZ 1D0YA 3ZOBA 4CYDA 3GLLA 1Y8QB 2IS4A 1YW8A 3KYCB 1QU3A 1D8JA 2FE3A 3LA7A 2M0MA 3HUGA 4B3XA 5FLXZ 1S3JA 1H88C 1EF4A 1I3AA 4BL0B 1D0XA 3Q0UA 3L2WA 3U2RA 4BXXJ 3BZ6A 2Y0MA 5DM6F 2R7QA 1KU9A 2DTRA 2DYRH 2OA4A 3HRMA 4BHBA 3JRIA 1OQYA 3IWZA 4ZZDA 1USSA 3BTIA 4BBRJ 4V2FA 2ADUA 4EJTA 3C18A 3H36A 3WTSC 1D1BA 2BXYA 5IT9Z 5FKLA 1XMXA 1FYLA 2MLKA 4OWRB 2A6EF 3E5XA 3GFLA 5FFZA 2JA6J 2NVUB 2GAUA 1U8BA 2HPMA 3KLOA 3SHFA 4DQ2A 2WADA 4O3MA 1T0FC 4ZH4F 1AA7A 3CCRI 4HLXA 1MMSA 3IKVA 1G4DA 2R7XA 1SFKA 2AHQA 2ZSHB 4DIQA 2HFHA 4YG2F 2XASA 2W82A 4MNUA 5CVIA 2OPTA 3GTPJ 1KQ0A 3CJQB 1S5LC 5K5OA 3WHBA 1JKPC 1DP3A 1RZ4A 4HNVA 2VBZA 1D3YA 3VSKA 1FIAA 2EFNA 4OOIA 3U21A 2MH2A 2YUSA 3DEEA 3MQ0A 1XGOA 3OYDA 3ZP5A 5F27A 2F2EA 2P6TA 2MYSA 3W2AA 2HDWA 3HZJA 2O8XA 1UELB 1RR8C 5FO5A 1PUFB 2NNYA 4XM3A 4UB6C 3V8JA 3I4PA 3HPHA 1Z6TA 2Z3YA 2UUZA 3A03A 3FF5A 1RUNA 1IN7A 3G2BA 1TZLA 2JRMA 4RGXA 1VQ5I 4HBLA 1O7LA 4K2EA 3H9QA 3T8TA 3ABUA 3DXJF 2DK8A 4IHVA 2QLZA 1TT5B 1FWZA 4ZDOA 3QU6A 5KHDA 3BY6A 4B44A 3OYNA 1G3WA 2IGOA 3DLAA 4F55A 5HS7A 2VB6A 3I9V2 2CV2A 4Y15A 1WPKA 4GXOA 4JX4A 4ESJA 3HOYJ 3G3ZA 4WXHA 5J47A 2JVHA 4BJ6C 1XX5A 4E7KA 2NVQJ 2DOEA 3WU2C 2DN0A 2L4AA 1X58A 2LYCA 1XTAA 3W2WA 4AYBN 4GFBA 5K1YA 3QYEA 2DA2A 4IJAA 4NDLA 5D8LB 4XICA 4QWQA 2OCCH 4CUGA 1O3QA 1R4MB 2OUMA 3EUAA 4XKVA 1ZGAA 3H92A 3BR0A 1G3TA 1ZG5A 5ICFA 3SJMA 5HLIA 1M1EB 4CXFA 2O0YA 5J4YA 2O03A 3HSFA 4HZFA 3ML6A 2K3PA 1PP8F 1W5SA 1Z7LA 1K6OA 1S29A 1S7OA 4M3BA 2H6BA 2Y69H 3TGNA 4FCYA 1R22A 3JW4A 3F72A 4P5OA 1YJWI 3L9FA 2XF6A 1KQ9A 5F04A 2R7FA 3WE2A 4U7DA 1UHWA 1TW2A 1LE8B 5GAEJ 3J81K 5DUIA 1UJ8A 4M3DA 2JUCA 4L9VA 1PDNC 4W97A 5LEJA 3C3WA 2CYYA 2Y2ZA 5JI6A 1U5TA 4CZZA 1J09A 2FOKA 3E5QA 3MKLA 3K0LA 5TRDA 1RIOH 2X0LA 3ELKA 5E1XA 1TWCJ 2QKLB 3RTRA 1FMWA 3HRTA 4KN7X 3HHHA 4AWXB 4RB3C 1XDUA 2KIQA 3S1NJ 5EZHA 4H4KC 4JOMA 1HSTA 4QPOA 2RNJA 4DJAA 4FT8A 5H6QA 3WTZA 4GRIA 1F9NA 3FMSA 1FOWA 5BQTA 5KAFC 1FP2A 4M71A 2LH9A 4O6JA 1G8XA 4I01A 4I09A 5B66C 3TDUC 1R71A 2VODA 2Y0SA 1ON1A 1JE8A 1A36A 1MSFC 1TP4A 4U87A 3E6DA 4F3QA 3CLQA 3PUBA 1ITYA 3J80K 1R7JA 3S93A 2QGUA 2K02A 3HSEA 4BS9A 4D5FA 4G7ZF 4LD5A 1HKSA 3U1DA 3L2VA 4LK0F 2CU7A 1TNTA 2PEXA 2CFOA 3DKWA 1XMKA 1XD7A 2Q1ZB 4LG3A 1WH5A 2VONA 1XB4A 2K5CA 3D5LA 5FLVA 3MZ8A 3I3LA 4X1EA 1K79A 3CMEI 3LSRA 4UXNA 2JA8J 3DPTA 1XSXA 5L3DA 3M8JA 4D9JA 1IRGA 1HKTA 2VC0A 1TWGJ 2P6SA 2LY2A 1MNDA 4Q5SF 2BY2A 3OYGA 2M2EA 5IT9K 3I4NJ 1P7JA 4RAFA 3BR6A 5GAHJ 1SFEA 2BW3B 4OAYA 1J9IA 2KIMA 1ZGWA 3SYTA 2E2HJ 3RYPA 2XPUA 5HVQC 1D0ZA 4LFUA 2OC6A 3L1PA 3BG3A 1BR4A 3BZKA 5GP9A 2ZXHA 4PFPA 3OYMA 3FHZA 2FX0A 1IW7F 2JA2A 3IRRA 1IV6A 3ABMH 1K4TA 2HEOA 2ESNA 3CUQB 3OL3A 2DPDA 1VQ7I 2BVLA 4F52A 4YEJA 3ZMTA 4CYCB 3Q0WA 4L9NA 4L9JA 3OWTA 2QF7A 2XVCA 1QRYA 5DV5A 2R5ZA 4BDZA 3T8RA 2AO9A 4ZYGA 3L7WA 3R0AA 4ITVA 4IRGA 3E0JB 1HOMA 2Q0OA 2ZJ2A 5D8KB 2EIKH 4ZTJA 2WB1N 2JUGA 2KRFA 4ZYHA 2J5PA 3OYHA 4EJOA 2HKOA 1JXSA 2F48A 1HSJA 1KGSA 1PVEA 3BQYA 4DGWB 1R23A 2IA0A 2X6OA 2QBYA 4LMYA 1P4AA 1MBEA 1SVMA 1UG2A 3ZN0A 1XC5A 3CMYA 1BJZA 1OCCH 1WH7A 5GADJ 2QQ9A 2HR3A 2V4JC 4LLGF 2UXXA 4LLLA 3PO2J 1IDZA 4B1RA 3O3KA 2L02A 1HW2A 1MW7A 3HDDA 1FYKA 2JA5J 1FIPA 2M5WA 1HBXG 2G0EA 5D5WB 1L3LA 3TW7A 5HDNA 2MG4A 2GA1A 4BYYA 3HB9A 4OU0A 5IP7J 2M4KA 3CUOA 2DFFA 4MLOA 3FIWA 3FXKA 4XONA 2MGQA 2ISYA 1YG2A 4N9HA 4A3MJ 3WE3A 2XGCA 4IOAF 3HSRA 4IHXA 1K6YA 2DT7B 3A02A 5GPAA 4C3IJ 1ORKA 5AIPA 4BQQA 1T98A 1CQTA 1JT6A 1BR1A 5K7FA 2TCTA 1PUEE 3LA3A 2ZSIB 3WGHA 4ENNA 2GOXB 3I59A 5D6EA 5E17F 4IF4A 1QVUA 2L0KA 2OAZA 4HG2A 3S1QJ 4L5IA 4BQNA 4XRMA 3V42A 5ICGA 5B1BH 3RKXA 1MJAA 5JVGF 5LHHA 3E97A 2DLLA 5HNFA 1GV2A 4JYKA 3FK7A 3TW6A 1G6NA 3F8MA 4OIQF 5J8FA 2AXLA 2L54A 1FBQA 2QENA 3AFHA 2RGVA 5KNLA 2V1DA 1RETA 4RM2A 4ON0A 3KYLA 1MH3A 2IT0A 2EJRA 4MFDA 3SDBA 1W4MA 1ERDA 2LNBA 3F21A 1WGXA 2QBYB 2H09A 1KONA 4HPQA 4DYCA 4OIPF 4JQFA 3CP2A 5DTDA 1OJLA 3OR2C 5BPIA 5C4XJ 2EZHA 2GIVA 4OMYA 1SD7A 3K4CA 5FD6A 1K78A 1E0EA 5EEHA 3JRFA 4A0YA 2XRLA 4OAZA 3OS2A 3L2RA 2EZIA 2E71A 2E5ZA 3SZGA 4CYCA 3I59B 3TOAA 1TW3A 2XGEA 2FXAA 1MD0A 1OKRA 2EZLA 3HGYA 2E60A 2CMPA 3GO5A 1S6LA 1U5TB 3GFIA 3MZYA 2ZMEA 4TV7A 2K9MA 5D4SA 5E3OA 4F7ZA 2R7RA 4P9FA 4U0WA 3H1CA 1APLC 3I53A 3CMAI 2XSDC 3R0JA 1T0FA 3VB2A 5FB2A 1YJ9I 4CHUA 3AG2H 3OYBA 2ZMEB 2Z33A 3EPZA 4CO8A 2JJ7A 4ZDPA 4F93B 4AYBA 2PMZA 4M9XA 2MFZA 5B3SH 3N4MA 2STWA 2L7FP 1CGPA 1T39A 1Z9CA 5J1YA 5DYMA 2GA2A 2WV1A 5LGNA 1EV7A 4HV5A 1I6XA 3FMRA 5L3GA 1TC3C 2HTSA 5C4JJ 2RQPA 5LHIA 2BEOA 2OF7A 2XAGA 2W24A 1IO2A 4EJWA 2WAEA 3WU1B 1UHSA 5CVRA 1YE9A 3PNTA 5C3EJ 4KICA 2OD5A 2DA5A 3OL4A 1J5YA 1JUPA 3FHNA 1T6SA 2A5WA 4L5JA 2A07F 2LF8A 2DYSH 2M4GA 3ZQ7A 6PAXA 1O3SA 1D8KA 2OJED 1WJEA 1I27A 2GIZA 4IHSA 3M7GA 5ED4A 4BBSJ 2CW0F 5F0HA 1RC9A 3QOEA 3RKWA 2PQ8A 3ABKH 3MD2A 3Q0VA 4UV8A 1WFXA 2OZUA 4Y52J 1MMGA 2CUEA 3BPVA 5HODA 3JTHA 2ME0A 1XS9A 2HYFA 2R5ZB 2YU3A 1AOYA 5M5WJ 2M45A 2DA3A 1W0UA 4MGRA 1BM9A 2RREA 3VYUB 3K4MA 3O8GA 1DGWY 3LAJA 3RQ4A 3G1LA 2X85A 2ETHA 2WAQN 1D5YA 4I6ZA 1MBHA 1FLIA 1MNMC 2A05A 5GPCA 1UHMA 3N97A 1S72I 2CW7A 1KU2A 4M72A 4E7SA 5HLTA 2K27A 2E1OA 3BR1A 3OR1C 2HYJA 1HQCA 3O6BB 3R60A 4Z2YA 1HDPA 4Y33A 2DO7A 4NHJA 3CC2I 3PQJA 1H9GA 2Y0SN 1NTCA 3ABLH 4U0YA 1QO0D 4G94A 1I39A 4PK4A 4U7BA 5A2QZ 3Q9SA 2HDCA 4XRSG 1W1WE 1JHFA 1GXPA 3EYIA 1OFCX 1R4NB 4RM3A 3F23A 4KNYA 1IN4A 2YX7A 5FKOA 4IOCF 2PI0A 3UNGC 2DPUA 3RPQA 3OYLA 5CVJA 2PJPA 4A3FJ 2M8GX 4BQOA 3OYFA 3ZQFA 4XRSA 1ZAOA 2A5YB 1RRJA 2V7FA 4HQMA 1JJ6C 4XKBA 3E6MA 5K7ZA 1WZ2A 1JTYA 3TO9A 1Y56A 2VT3A 2R3SA 3G1MA 1OMIA 3AG1H 4BNCA 1XGMA 4NQWB 4Z6YA 1X1PA 1V5EA 1B4AA 2VJJA 3CCEI 2KZVA 2I10A 2L3DA 2KL4A 2CUZA 2W1OA 2DOFA 1AWCA 1JJ8C 1IDYA 4HF0A 4E70A 4J01A 1H89C 1ZR2A 4G7OF 3A0BC 2MC3A 3SZPA 1IJWC 1T56A 4LIVA 3CDLA 2ECCA 1R49A 4BY1J 5J1UA 2JQ7A 2KFDA 4A6EA 3H9GA 1JUSA 1XCVA 2KP6A 1F36A 2P5LC 3BJOA 4Y3OA 1ETKA 4FETA 3REOA 3VFZA 5JLXA 1ZKGA 2NOGA 4HQEA 1VNDA 2DW4A 1RUOA 5CQGA 3S2DJ 4YIIA 2KDZA 1GHCA 1ETXA 1S7EA 2LKPA 4JP0A 4R8HA 4M9SA 4S0HB 3D1NI 3DV8A 2R7UA 4ZTFA 5CYVA 3VPRA 4EM2A 2MA3A 2OTJI 3BT9A 3BJAA 2GQQA 3K69A 3HGGA 4C3HJ 2LKXA 2BZTA 1MMAA 2RNGA 3KP2A 2WB1A 4MHGA 2PMZN 3HOTA 2L01A 4BXUA 2QUFA 3DKXA 4C30A 2X6YA 4BGDA 1IAWA 1VQ9I 1R5HA 2P0WA 1YTYA 2X1EA 3RI4A 2LK2A 2V6EA 4LLNA 2FBKA 3BTLA 2IPQX 4I0BA 3LSKA 2RAEA 1G3SA 1MJBA 2K9NA 2JPCA 3R6SA 1YIJI 1SD4A 4W1UA 2Z9OA 3R61A 2IA2A 2HQ5A 4DYRA 4BKXA 1V3FA 2E1MB 4E7JA 2HTJA 3PIPF 2JSPA 4AD9A 1J2XA 3GF2A 2A68F 4P9UA 3WTTC 1QA6A 4KYWA 1ODDA 2XRNA 2WY8Q 1MSEC 4PSXA 1MKMA 2KT0A 2ZXIA 4M9ZA 4EV0A 2HYGD 4DBRA 4UNOA 2EIJH 1F4KA 2H8RA 3UR3C 2FSWA 2QEXI 4HEA2 5CQEA 1Y39A 1WVRA 1LDDA 2L7KA 4I7HA 5J40A 2L5QA 5EEGA 1IF1A 1X3WB 1V5GA 2X48A 3H35A 3R4KA 2M0CA 4E6KG 3HYIA 2MSYA 3SFZA 3GYHX 1YIOA 2LD5A 2JZYA 2MLGA 1IRFA 2XV4S 3HIFA 3DBLB 3WGIA 2KIFA 3LQQA 1MBJA 1LDJA 4D0PA 4M6YA 4KMUX 5B5EC 2DMUA 3F8NA 3HOWJ 2DFEA 4B09A 3GTOJ 4WXDA 1V5FA 3MCZA 4MFEA 4P1WA 2V1XA 1Q1VA 4RGSA 2R7TA 1B59A 5ICCA 3P9KA 3HTUA 4G8XA 4UVAA 3T0YA 4GCVA 2XDVA 1EKEA 4P96A 3W6KB 4BU2A 2Y31A 3W6JB 5LBQA 3FKIJ 1LEAA 3GXOA 2HGCA 4XIDA 3JTGA 2X6WA 3F6VA 2BGCA 1U2WA 2Q2EB 2FRHA 1LUJB 2QZ8A 3S2WA 2BXZA 4ASNA 1H0MA 1HF0A 2XUBA 3K1PA 3I0TA 5K5QA 4OIRF 1YYVA 2K9SA 4H0EA 4YFKF 4NC6A 1DU0A 2BBYA 4G12A 5DCMA 1X2MA 2CFXA 3B02A 5K5RA 4G9YA 3GZNB 1PUFA 3SZTA 4KT6A 3QRFF 1WJFA 4RA2A 5BNGA 4CGZA 3MMYB 4IHWA 2VPLA 1W5CC 2KRCA 3LSGA 3FXRA 1TQIA 3LNQA 4CCLA 4XSXF 4NQWA 5J8CA 4KN4X 4EJUA 4RAYA 2ZFWA 4B48A 1O3TA 2K4JA 3LOCA 3DEWA 3C2GA 4ZYEA 1DDNA 4MTDA 1BIBA 3KCCA 1EH7A 5JHUA 1VI0A 3S3MA 4ZYDA 5FGMA 2K9QA 4RMNA 3TO7A 4MEYF 1QPMA 2R5YB 1K4SA 2KDOA 1QPIA 4FE4A 2I8DA 3S1MJ 1WJDA 3DTKA 3RSNA 5C44J 3DBRB 4DYQA 5AONA 1GUUA 2XAHA 2F5DA 3TP3A 3J81Z 5E3MA 2DMTA 4IZZA 2XGDA 3MN2A 3TEDA 1TTYA 1TBXA 3HKZA 1Y8RB 2FA5A 2CO5A 3W2VA 3CO7C 3ULQB 9ANTA 1JTXA 1W36D 5GTIC 3BDDA 1OCZH 1X1DA 2DA6A 3T5XA 1ZG3A 2DFHA 4LG0A 1G59A 5ILSA 3KZZA 1FJLA 5EF6A 2RVCA 3D0SA 4HRIA 3J7ZI 2O8KA 2DK5A 3F22A 2VE9A 3E1SA 2QSGX 2G7HA 1ETYA 3VODA 2W4SA 1Z77A 2ZFUA 1LQ1A 5LEKA 2EFOA 1VFCA 1AHDP 1Z0XA 2DXIA 3S2HJ 3HJEA 2BE5F 1J7KA 1B1BA 1ZK8A 1STZA 2Z5UA 2CSOA 4E7IA 1YFHA 3CC4I 4C2TA 1VQNI 4A12A 4EEFG 3V4GA 2UZKA 1A35A 5F64A 2AS5F 2V6CA 2FUG2 3V8LA 2ZKZA 3GVAA 3SEZA 2HQAA 1ZG1A 2A6TA 2XAFA 3K4NA 5HNHA 4ENKA 3S17J 2NAZA 4IQJA 2IGNA 1LB2A 1ZRFA 3SQNA 3ZCOA 3M1EA 1HKQA 1U0JA 1SAUA 3OYIA 3ABTA 5F1JA 2ZNYA 3K6GA 5HDKA 2HQNA 1OISA 1D5VA 4CCKA 1NG7A 1I1GA 2EK5A 1X2NA 4BAYA 1N78A 2MABA 4XMYA 2KJBA 3T1BA 3M4OJ 1XSVA 3KFWX 2JMWA 2VXZA 3K10A 2E19A 2W48A 4HX7A 2C6YA 2DODA 1GT0C 2YPRA 1HA8A 4XBFA 4RB2C 2KJCA 5LRRA 1OLTA 2M87A 4A3LJ 2L9RA 3H0GJ 5DDGA 5IOYA 1U5TC 4A2UA 2IEKA 1SAXA 3TDZC 2A6HF 1IC8A 3KP4A 3FXUA 3FXOA 3JCUC 3VOEA 2NOJB 3LSJA 2QSHX 1BA5A 1WKMA 3BOQA 5E1ZB 4CZCA 5EG0A 2GXGA 2VXDA 5BS6A 1HXDA 1U9NA 3PUFA 4GO1A 1BIAA 3A2KA 2W7NA 2L9SA 3FXQA 2WWYA 2RC4A 2W57A 3OOPA 4IO9F 1FOKA 2XKPA 3ECHA 3BQZA 1UZCA 2JTVA 4XOTA 3GTKJ 4KA4A 1P2FA 1JHHA 2Y9YA 5JFRA 4FX4A 2BV6A 4LB5A 1LKXA 4HYEA 2IBDA 1YW7A 3K9TA 4PGHA 2FJ1A 2RN7A 2QQBA 1HLVA 3WTWC 1KA8A 3BCBA 5FD5A 4CICA 5M3FJ 4GYGA 2VUMJ 4CA0A 3BR5A 3W3CA 2F4IA 2HVSA 3BP8A 2BOLA 4Q48A 1ZELA 3DU6A 3HEFA 4UVBA 1OCOH 3TP0A 4HA8A 1JI8A 1P92A 4D7MA 3BG5A 1LDKB 3IC7A 1HDDC 2EB7A 2FEZA 3JREA 5JHFA 3E6BA 3ZGKA 3RKYA 1SMTA 3VWBA 4ZYAA 3TQNA 2R7SA 4JK1X 4RB0A 1OR7C 2QQAA 4AIKA 1XG1A 1FBUA 5BOXA 3BR2A 3V7SA 3KP6A 1X1CA 4MEXF 1A5JA 4BQAA 5CKTA 3N05A 3HKZN 4PJJA 2VBWA 4AVZA 2OV7A 3AL0C 4I02A 3E5UA 5E20A 5J3LA 2ZB9A 3HBLA 3MWMA 3QAHA 1FOXA 4WX9A 1WJBA 2EV6A 1BI2A 3OYJA 2LBFA 2V1NA 1TQMA 1DU6A 1X19A 4FASD 2ZXJA 4HAMA 3L2CA 4BHCA 5J4VA 1ZREA 2F5EA 1KYWA 2P4WA 2CG4A 3GTJJ 3BCAA 1KZHA 2A69F 4MIMA 1IGNA 3CZ6A 2R92J 2K9LA 3FDYA 2M34A 1TT0A 2F6CA 1WCMJ 3IL2A 1IV8A 1YI2I 3K7AJ 1ACIA 3FXJA 3HOVJ 2BY3A 3EDPA 4C3JJ 1DQUA 5D5VB 3ASOH 1WJAA 4P55A 3FXLA 4FX0A 5LD2C 5K7HA 3LSMA 3WTYC 2V9KA 1LVAA 2ID3A 4IHYA 2OTLI 2X1CA 4RAZA 2LOOA 2DMQA 1YW9A 2B9SA 1MNEA 4C2MJ 3H9JA 4I0AA 2NVTJ 1UG0A 3LSIA 3HM5A 1HCRA 5GAGJ 2QKMB 3ZR8X 4A3DJ 3GX4X 3TO6A 2HI3A 4Y17A 4V19K 4DZJA 1I5ZA 2LTPA 1YITI 3QP6A 4PJMA 2VKVA 4HNTA 2BW3A 3FBNB 2AXTC 3V7CA 3DBHB 2DDBA 4IPAA 4N0BA 1XCBA 4B3AA 4OINF 2JRTA 3OIOA 4PZJA 5FKMA 4Y4RA 1Z67A 3PSFA 1QHHD 1TNSA 2IGKA 1Z05A 3QYBA 4O5VA 1USTA 2IA1A 2LC2A 1ETQA 2VJIA 2E1CA 1RKWA 4Y13A 3HHGA 2VKDA 3CESA 1BOBA 3F8CA 2CW8A 3OYKA 3K70C 1JKQC 3LWFA 1C0WA 2E5NA 5EJCA 3DKYA 2CQKA 1I3QJ 1TWAJ 1L0OC 1ON2A 2KMUA 5CLSA 3GZ6A 1VQOI 2D1VA 2LG4A 4GDFA 3JSOA 3QPHA 3CJRB 3HPGA 4LB6B 2GOMA 5DD8A 5ICEA 3FX3A 3M8EA 5DCMB 4ABZA 3CCYA 3PM1A 1B8IB 4KIFA 4BE0A 1MDMB 1ZLJA 4XLFA 4M3EA 5A2QK 3ZQIA 2JWTA 2OCEA 1GV5A 3M1CA 4WK8F 1OCPA 1BW6A 2B7EA 5H2FC 3RKQA 2CQ7A 4YIFA 2VOPA 2XF5A 1QHGA 4BXFA 4Y7NJ 2EILH 4FHTA 1K78B 4XORA 3VDXA 4KMFA 2ELKA 1SMYF 4XN0A 2Q8KA 2FD5A 3CD6I 4WWCA 4DOZA 5M5YJ 4UY8I 4ETSA 3SFIA 4E7LA 2VQLA 3KX2A 2M7BA 2XAJA 1Q1HA 5ERIA 2UWMA 1O57A 2FQ3A 4IVNA 4M74A 4WXCA 4YIRX 1DPUA 2LY1A 4BJ5C 1X3UA 2TDXA 2Z2SB 3OV8A 4XL9A 4J19A 3ZN1A 3OYEA 1REPC 1R58A 2XF7A 2KRHA 4PJNA 1X4OA 5LGTA 3ZQQA 3PIOF 3VYRB 1NK2P 4XR6A 1BI3A 1LNWA 5GTHC 4XOPA 2EA2A 2E2JJ 3GTMJ 3LAPA 1JGGA 2CV0A 3K1MA 1QNTA 4XLHA 4A3BJ 4GYIA 2D45A 3BG7A 5D4RA 2Z99A 1Y6IA 3RCOA 2R7DA 2NRAC 3U1KA 2FMLA 2N8GA 3F9KA 1SVOA 3E6CC 3I4MJ 3CCSI 1WI9A 1IUFA 1BL0A 3HC7A 2M8EA 5HOOA 1TQPA 1WJ5A 3DWLE 2XAUA 1W36C 3ZMSA 3FM5A 4DZPA 2Y75A 2HDDA 2H8WA 2YR2A 1MDMA 4EM0B 3AG4H 2DU9A 4ZDLA 3S1RJ 4MQ9F 5E1WA 4QLCU 3CCUI 1SFUA 1YJNI 1BN5A 3GTQJ 1ZLKA 4QPQA 4D1QA 2ZJRF 3RJPA 4G7HF 3NEUA 3C2HA 1XN7A 3MAJA 1IXCA 2LREA 4MO7A 3QPTA 2GZWA 2E7XA 2F4OB 3IUOA 4ZC3A 3AKZA 1U9OA 2JVGA 2OU2A 4LOCA 5CPRB 3JR9A 4XLEA 4AM3A 4N9IA 3H3ZA 1S7AA 5F0CA 2ZMEC 2PLYA 4L0YB 2XAQA 3HXLA 3HL2A 4M73A 1A6IA 2XB5A 3WTUC 2JT1A 4HW0A 3MZHA 1W5TA 1NH3A 2WA0A 2X6XA 3LA2A 1ZRCA 3ERED 3GFJA 2M7AA 4UUSB 1RR7A 4XN3A 3CF2A 3DP7A 1VQ6I 3H5NA 1QZYA 2VQHA 4KFCA 2WTEA 1ETOA 1FZPB 4C2UA 3B73A 2HZTA 3F0CA 3ISPA 3EQLF 2PX9A
chains in the Genus database with same CATH topology
3EETA 5FLXK 3I64A 1UCRA 3QU3A 5L3BA 1DP7P 4ENJA 2KKOA 4WF2A 4RGUA 1IXSB 2IJLA 2JSCA 3K2ZA 2K4BA 3MEXA 3GW2A 3KZYA 2H27A 3K1NA 1QGPA 2EV5A 4B8XA 1IZ1A 1FX7A 2OBPA 2DFIA 3KP5A 2DT5A 4A0ZA 1CF7A 1OR7A 2HOEA 5ILUA 1ZARA 2P8TA 3PQKA 2HQRA 2Y48A 3ECOA 3V8KA 3TOBA 3MFKA 2OQRA 2VOOA 1FPQA 3GFMA 2OZ6A 2ISZA 2O6GE 2ESHA 3WTVC 5TJJA 3I54A 5HS8A 1BBYA 1K7AA 1BC8C 5ILVA 1OYIA 4IXAA 4A5MA 2P5VA 1UB9A 5CVVA 4ENMA 3JSPA 2DQRA 4UHTA 3KEOA 3C1DA 2EFPA 4EVIA 2MH9A 3PFIA 2QM3A 4XLPF 5AIQA 3F8BA 4KDPA 1Z91A 2B0LA 4EMSA 4HX4A 1MZBA 2ZBKA 1R1UA 1I1SA 1KQ8A 3P7NA 1J75A 4DNCA 3GLXA 3JAMK 1YLFA 5DCFA 1ZGJA 1IN5A 3I58A 2X4HA 2H94A 2STTA 1P4XA 4R79A 1FC3A 1W7PA 3U9GA 5BPDA 4L18B 1Z1DA 1ZHFA 4U0VA 1WRJA 3LFKA 1JGSA 4HX8A 1HW5A 4HLYA 3WG9A 5LHGA 3HTSB 5E18F 1FYMA 2VN2A 2H6CA 4MQVA 1ZYRF 1FNNA 1FT9A 2M1BA 3KETA 1QZZA 4KIBA 5H20A 2L4MA 3BJ6A 1T38A 2P5KA 2FBIA 2FNPA 2VT2A 3DQVC 3CUQA 2FNAA 4UV9A 3V7RA 2G9WA 4NB5A 4HF2A 1QQIA 2V9VA 3GEZA 2VBXA 5HDGA 2FBHA 2PMHA 1IXRC 4G6DA 1ZN2A 2CGPA 4AIHA 3RPUA 1U3EM 2NNNA 1IUYA 5CVUA 5H6RA 5L3FA 3IRQA 2DQLA 3ZPLA 2JPBA 1Y0UA 3KE2A 2XGXA 4WCGA 1P4WA 4GGGA 4R1HA 5KVRA 2MD5A 3CTAA 2E7WA 4M6XA 1B6AA 1B9NA 4A6DA 5JR3A 1ZH5A 2P7VB 1GXQA 3COAC 3F8FA 3WTXC 1LEBA 4IRIA 5L3CA 4EJVA 1ZRDA 2EWNA 2XHKA 4ESBA 1WSUA 1FY7A 3WGGA 5KK1A 5CJ9A 4HOBA 1FSEA 3ZMUA 3DEUA 5E8GA 3P9IA 1SFXA 1XGSA 1U78A 1MJ9A 5L3EA 2LDUA 4EGZA 1F5TA 1U8RA 2DAOA 1Z6RA 3WU0A 2A3SA 4I2OA 3CUQC 3GZ5A 3FM3A 2W25A 2P7CB 5LGUA 2A61A 3GWZA 1XMAA 2V1UA 4HDVA 2EA4A 2HKXA 3I71A 3FZVA 3DPLC 4KUMA 2EFWA 1FP1D 3G73A 2ZCWA 4L9TA 1KU7A 4AIJA 2DBBA 3FMQA 4MTEA 2FU4A 5F6FA 2XIGA 2O61A 1F1ZA 4RGRA 4LGWA 3ROUA 3KP3A 1FSHA 1KYZA 5IT3A 4HV6A 1BJAA 3CLOA 2K86A 4IHTA 1P6RA 1WQ2A 1E17A 3DF8A 4PDKA 4OMZA 4ZZLA 4RS8A 5HLHA 3H3UA 5D5XB 3BPXA 2IW5A 2PG4A 5JVTA 2K7LA 1PP7U 1DPRA 4HDUA 3CO6C 1NHAA 3Q9VA 3LQRA 2HS5A 1SD6A 2PN6A 2YSRA 1A04A 5DUKA 1O7FA 1J59A 4YFNF 2NYXA 2V79A 1EH6A 3RYRA 4U88A 1BI1A 5BMZA 2F5FA 3ZMDA 2FMYA 2EV0A 4OIOF 3WODF 3DFGA 2XROA 5DEQA 3BROA 2VBYA 3QOPA 3ZMVA 3EUHA 3NRVA 1W7PB 2MBFA 3L09A 3BWGA 2FF4A 1XGNA 3M9AA 2PBIA 2EFQA 4Q4ZF 1G3YA 3J7AO 3M8FA 3E3VA 4XRFA 2OQGA 2D2WA 4S04A 4LJZF 2BYVE 2W84A 3QP5A 4XLNF 1EH8A 3LSTA 5D6FA 2DI3A 1W7PD 1OYYA 4EGYA 5FFXA 3HOSA 4RB1A 3KP7A 2ZO4A 5J6XA 4XSZF 3IWFA 1T2KA 1SD5A 4CDGA 1DUXC 2G7UA 4HF1A 5D5UB 4EM1A 3P9CA 1KU3A 1FBSA 1B9MA 1BOAA 1YO5C 1YS6A 1GVJA 2HWVA 3CDHA 5HS9A 3KLNA 4KIGA 2M30A 2LF7A 1V4RA 1Z7UA 4G6QA 1IN8A 1XSDA 3F3XA 4EQQA 1YS7A 3IHUA 4PGGA 3RDIA 2GXBA 4AVPA 1UFMA 2RDPA 2COMA 2W85A 1BC7C 2VE8A 2E1NA 1RI7A 1CF7B 2J5OA 1XDSA 1O3RA 4I98B 1BI0A 2LSOA 4IRHA 2D1HA 2ELHA 1RNLA 2O3FA 1YQAA 4Q47A 3HRUA 1OYWA 3VEPA 1WWXA 1H9TA 2CWEA 3FWEA 2PMUA 2XKOA 1HW1A 2GWRA 3Q5FA 3I5UA 2IVMA 2WC2A 2VC1A 3EYYA 1LJ9A 3L00A 2YX4A 2Q2EA 1R00A 3RIRA 4LK1F 1IN6A 3O2PE 2IP2A 2QVOA 3SXYA 4KT5C 4BHPA 4UUVA 5E8IA 2UXNA 1R1VA 2QYOA 3F6OA 3KEQA 1U6GA 1MGTA 2F5CA 4S05A 2IRFG 2RV8A 2PFBA 5LLQA 4ESFA 4LG0B 3TKYA 2RKHA 3C7JA 1R5GA 1TLHB 4A0XA 5DD4A 4JBAA 1QBJA 2WV0A 3HRSA 1ONVA 3NQOA 5F1RA 1R36A 2ZNZA 3ZMZA 3GUDA 1VTNC 1S8NA 5HLGA 3IKTA 1ULYA 5LRSA 2KIUA 1OPCA 4UVCA 3CJNA 4BH9A 2QWWA 4L0ZB 3AAFA 4A5NA 1R1TA 1E2XA 4YFXF 2ACJA 1J0RA 2NS0A 3J80Z 4PCQA 3JAMZ 4CYDA 1D8JA 1YW8A 2FE3A 3LA7A 3HUGA 5FLXZ 1S3JA 3U2RA 3BZ6A 2Y0MA 1KU9A 2DTRA 2OA4A 3HRMA 4BHBA 3IWZA 4ZZDA 1USSA 2ADUA 4EJTA 3C18A 3WTSC 5IT9Z 1FYLA 2MLKA 2A6EF 3E5XA 3GFLA 5FFZA 2GAUA 3KLOA 3SHFA 4DQ2A 4O3MA 4ZH4F 4HLXA 3IKVA 1G4DA 4YG2F 2HFHA 2XASA 4MNUA 5CVIA 1KQ0A 5K5OA 1RZ4A 2VBZA 1D3YA 2EFNA 4OOIA 2MH2A 3MQ0A 1XGOA 3ZP5A 2F2EA 2P6TA 2O8XA 5FO5A 2NNYA 3V8JA 3I4PA 1Z6TA 2Z3YA 3FF5A 1RUNA 1IN7A 4RGXA 4HBLA 1O7LA 4K2EA 3T8TA 3ABUA 3DXJF 2DK8A 2QLZA 1FWZA 3QU6A 3BY6A 1G3WA 5HS7A 4Y15A 4GXOA 4ESJA 3G3ZA 4WXHA 2L4AA 5K1YA 4IJAA 5D8LB 4QWQA 1O3QA 1ZGAA 3H92A 1G3TA 1ZG5A 5ICFA 5HLIA 4CXFA 2O0YA 2O03A 3HSFA 4HZFA 3ML6A 1PP8F 1W5SA 1K6OA 1S29A 1S7OA 2H6BA 3TGNA 1R22A 3JW4A 3F72A 4P5OA 3L9FA 1KQ9A 2R7FA 3WE2A 4U7DA 1UHWA 1TW2A 3J81K 5DUIA 4L9VA 1PDNC 5LEJA 3C3WA 2CYYA 5JI6A 1U5TA 4CZZA 2FOKA 3E5QA 3K0LA 5TRDA 1RIOH 2X0LA 3ELKA 5E1XA 3RTRA 3HRTA 4KN7X 3HHHA 4AWXB 4RB3C 1XDUA 1HSTA 2RNJA 4FT8A 3WTZA 5H6QA 1F9NA 3FMSA 5BQTA 1FP2A 4M71A 4O6JA 4I01A 4I09A 3TDUC 2VODA 1ON1A 1JE8A 3E6DA 3J80K 1R7JA 3HSEA 2K02A 4G7ZF 4LD5A 1HKSA 3U1DA 4LK0F 1TNTA 2PEXA 3DKWA 1XMKA 1XD7A 2VONA 1XB4A 3D5LA 1K79A 4UXNA 3DPTA 1XSXA 5L3DA 1IRGA 1HKTA 2VC0A 2P6SA 4Q5SF 5IT9K 1SFEA 1J9IA 2KIMA 3RYPA 5HVQC 4LFUA 3FHZA 1IW7F 3IRRA 2HEOA 2ESNA 3CUQB 2DPDA 3ZMTA 4L9NA 4L9JA 2XVCA 5DV5A 3T8RA 4ZYGA 3L7WA 3R0AA 4IRGA 2Q0OA 2ZJ2A 5D8KB 2KRFA 4ZYHA 2J5PA 4EJOA 2HKOA 1JXSA 1HSJA 1KGSA 1R23A 2IA0A 2QBYA 4LMYA 1P4AA 3ZN0A 2QQ9A 2HR3A 4LLGF 2UXXA 4LLLA 3O3KA 2L02A 1HW2A 1FYKA 2M5WA 1HBXG 5D5WB 1L3LA 5HDNA 2GA1A 4BYYA 4OU0A 3CUOA 2ISYA 1YG2A 4N9HA 3WE3A 3HSRA 5AIPA 1T98A 1PUEE 3LA3A 3WGHA 4ENNA 3I59A 5D6EA 5E17F 4IF4A 2OAZA 4L5IA 5ICGA 3RKXA 1MJAA 5LHHA 3E97A 2DLLA 1G6NA 3F8MA 4OIQF 5J8FA 2AXLA 2L54A 1FBQA 2QENA 2RGVA 2V1DA 4ON0A 2IT0A 2EJRA 1W4MA 2LNBA 3F21A 2QBYB 2H09A 4OIPF 4JQFA 5BPIA 2GIVA 4OMYA 1SD7A 5FD6A 1K78A 5EEHA 4A0YA 3I59B 3TOAA 1TW3A 2FXAA 1MD0A 1OKRA 3GO5A 1S6LA 1U5TB 3GFIA 3MZYA 2ZMEA 4TV7A 5D4SA 4F7ZA 4P9FA 4U0WA 3I53A 3R0JA 1T0FA 3VB2A 5FB2A 4CHUA 2ZMEB 2Z33A 4CO8A 4M9XA 3N4MA 2STWA 1CGPA 1T39A 1Z9CA 5DYMA 2GA2A 5LGNA 1EV7A 4HV5A 1I6XA 3FMRA 5L3GA 2HTSA 2RQPA 5LHIA 2BEOA 2XAGA 2W24A 4EJWA 3WU1B 5CVRA 4KICA 2OD5A 1J5YA 1T6SA 4L5JA 2A07F 2LF8A 3ZQ7A 6PAXA 1O3SA 1D8KA 1I27A 4IHSA 3M7GA 5ED4A 2CW0F 3RKWA 2PQ8A 4UV8A 2OZUA 3BPVA 3JTHA 2HYFA 2YU3A 1AOYA 2M45A 4MGRA 1BM9A 3LAJA 2ETHA 1FLIA 1UHMA 3N97A 1KU2A 4M72A 2K27A 1HQCA 3O6BB 3R60A 4Z2YA 2DO7A 4NHJA 3PQJA 1H9GA 4U0YA 1QO0D 4G94A 4U7BA 5A2QZ 3Q9SA 2HDCA 1JHFA 1GXPA 3EYIA 3F23A 4KNYA 1IN4A 2YX7A 2PI0A 2DPUA 3RPQA 5CVJA 2PJPA 1ZAOA 2A5YB 4HQMA 3E6MA 3TO9A 2VT3A 2R3SA 1OMIA 4BNCA 1XGMA 1B4AA 2L3DA 1AWCA 4HF0A 4E70A 4G7OF 2MC3A 3SZPA 4A6EA 1XCVA 2P5LC 3BJOA 3REOA 3VFZA 4HQEA 2DW4A 1RUOA 4YIIA 1GHCA 2LKPA 4R8HA 4M9SA 3DV8A 5CYVA 4EM2A 2MA3A 3BJAA 2GQQA 3K69A 3KP2A 3HOTA 4MHGA 2L01A 4BXUA 2QUFA 1IAWA 1R5HA 1YTYA 3RI4A 4LLNA 2FBKA 2IPQX 4I0BA 1G3SA 1MJBA 3R6SA 2JPCA 2Z9OA 1SD4A 3R61A 2IA2A 1V3FA 2HTJA 4KYWA 4AD9A 1J2XA 3GF2A 2A68F 4P9UA 3WTTC 1ODDA 2XRNA 1MKMA 4EV0A 4M9ZA 2HYGD 4UNOA 1F4KA 2FSWA 1LDDA 4I7HA 5EEGA 1IF1A 3R4KA 3HYIA 3SFZA 3GYHX 1YIOA 2JZYA 2MLGA 1IRFA 3WGIA 2XV4S 3HIFA 2KIFA 3LQQA 1LDJA 4D0PA 4M6YA 4KMUX 3F8NA 4B09A 4WXDA 3MCZA 2V1XA 4RGSA 1B59A 5ICCA 3P9KA 3HTUA 4G8XA 4UVAA 3T0YA 4GCVA 4P96A 3W6KB 3W6JB 5LBQA 1LEAA 3GXOA 2HGCA 3JTGA 3F6VA 2BGCA 1U2WA 2FRHA 2QZ8A 3S2WA 4ASNA 1H0MA 2XUBA 3K1PA 3I0TA 5K5QA 4OIRF 1YYVA 4H0EA 4YFKF 2BBYA 5DCMA 2CFXA 3B02A 5K5RA 4G9YA 3SZTA 3QRFF 4CGZA 3FXRA 1TQIA 4XSXF 4NQWA 5J8CA 4KN4X 4EJUA 4RAYA 2ZFWA 1O3TA 2K4JA 4ZYEA 1DDNA 4MTDA 1BIBA 3KCCA 1EH7A 5JHUA 4ZYDA 5FGMA 3TO7A 4MEYF 1QPMA 5AONA 2XAHA 2F5DA 3J81Z 1TTYA 1TBXA 2FA5A 3CO7C 2CO5A 3ULQB 3BDDA 3T5XA 1ZG3A 4LG0A 5ILSA 3KZZA 2RVCA 3D0SA 2DK5A 3F22A 2VE9A 2G7HA 3VODA 1LQ1A 5LEKA 2EFOA 2BE5F 1J7KA 1B1BA 2Z5UA 1STZA 2CSOA 1YFHA 4A12A 3V4GA 2UZKA 2AS5F 5F64A 2V6CA 3V8LA 2ZKZA 3GVAA 1ZG1A 2XAFA 4ENKA 2NAZA 1LB2A 1ZRFA 3SQNA 3M1EA 1HKQA 3ABTA 2ZNYA 5HDKA 2HQNA 1D5VA 1I1GA 2EK5A 4BAYA 2KJBA 3T1BA 1XSVA 3KFWX 2VXZA 4HX7A 2C6YA 2YPRA 4XBFA 4RB2C 2KJCA 5LRRA 2M87A 5DDGA 1U5TC 4A2UA 1SAXA 3TDZC 2A6HF 3KP4A 3FXUA 3VOEA 1WKMA 3BOQA 5E1ZB 2GXGA 5BS6A 1HXDA 4GO1A 1BIAA 3FXQA 2WWYA 2RC4A 2W57A 3OOPA 1FOKA 2XKPA 3ECHA 2JTVA 4KA4A 1P2FA 1JHHA 5JFRA 4FX4A 2BV6A 4LB5A 4HYEA 1YW7A 3K9TA 4PGHA 2RN7A 2QQBA 3WTWC 1KA8A 5FD5A 4CICA 4GYGA 3BP8A 4Q48A 4UVBA 4HA8A 1P92A 1LDKB 3IC7A 2EB7A 2FEZA 3E6BA 3RKYA 1SMTA 3TQNA 4JK1X 4RB0A 2QQAA 4AIKA 1FBUA 5BOXA 3V7SA 3KP6A 4MEXF 4BQAA 2VBWA 4I02A 3E5UA 5E20A 3MWMA 3QAHA 4WX9A 2EV6A 1BI2A 1TQMA 2ZXJA 3L2CA 4HAMA 4BHCA 1ZREA 2F5EA 1KYWA 2P4WA 2CG4A 2A69F 3IL2A 3EDPA 5D5VB 4P55A 4FX0A 3WTYC 1LVAA 4RAZA 1YW9A 4I0AA 3GX4X 3TO6A 4Y17A 1I5ZA 3QP6A 3V7CA 4IPAA 4N0BA 1XCBA 4OINF 2JRTA 4PZJA 1TNSA 1Z05A 4O5VA 1USTA 2IA1A 2E1CA 4Y13A 3HHGA 3F8CA 3LWFA 1C0WA 2CQKA 1L0OC 1ON2A 5CLSA 3GZ6A 2D1VA 3JSOA 3QPHA 4LB6B 5DD8A 5ICEA 3FX3A 3M8EA 5DCMB 4KIFA 1MDMB 1ZLJA 5A2QK 4WK8F 4YIFA 2VOPA 4FHTA 1K78B 4KMFA 1SMYF 2Q8KA 4WWCA 4ETSA 2XAJA 1Q1HA 5ERIA 2UWMA 1O57A 2FQ3A 4IVNA 4M74A 4WXCA 1DPUA 1X3UA 2TDXA 3OV8A 3ZN1A 1REPC 1R58A 5LGTA 1BI3A 1LNWA 2EA2A 3LAPA 3K1MA 1QNTA 4GYIA 2D45A 5D4RA 2Z99A 2R7DA 2NRAC 2FMLA 3E6CC 1WI9A 5HOOA 2M8EA 1TQPA 3ZMSA 3FM5A 2Y75A 2YR2A 1MDMA 4EM0B 2DU9A 4MQ9F 5E1WA 4QLCU 1SFUA 1BN5A 1ZLKA 3RJPA 4G7HF 3NEUA 3MAJA 1XN7A 1IXCA 3QPTA 2GZWA 2E7XA 2OU2A 4N9IA 3H3ZA 1S7AA 2PLYA 4L0YB 2XAQA 4M73A 3WTUC 2JT1A 4HW0A 3MZHA 1W5TA 3LA2A 1ZRCA 3ERED 3GFJA 3DP7A 1QZYA 4KFCA 2WTEA 1FZPB 3B73A 2HZTA 3ISPA 3EQLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EET A;  5FLX K;  3I64 A;  1UCR A;  3QU3 A;  5L3B A;  1DP7 P;  4ENJ A;  2KKO A;  4WF2 A;  4RGU A;  1IXS B;  2IJL A;  2JSC A;  3K2Z A;  2K4B A;  3MEX A;  3GW2 A;  3KZY A;  2H27 A;  3K1N A;  1QGP A;  2EV5 A;  4B8X A;  1IZ1 A;  1FX7 A;  2OBP A;  2DFI A;  3KP5 A;  2DT5 A;  4A0Z A;  1CF7 A;  1OR7 A;  2HOE A;  5ILU A;  1ZAR A;  2P8T A;  3PQK A;  2HQR A;  2Y48 A;  3ECO A;  3V8K A;  3TOB A;  3MFK A;  2OQR A;  2VOO A;  1FPQ A;  3GFM A;  2OZ6 A;  2ISZ A;  2O6G E;  2ESH A;  3WTV C;  5TJJ A;  3I54 A;  5HS8 A;  1BBY A;  1K7A A;  1BC8 C;  5ILV A;  1OYI A;  4IXA A;  4A5M A;  2P5V A;  1UB9 A;  5CVV A;  4ENM A;  3JSP A;  2DQR A;  4UHT A;  3KEO A;  3C1D A;  2EFP A;  4EVI A;  2MH9 A;  3PFI A;  2QM3 A;  4XLP F;  5AIQ A;  3F8B A;  4KDP A;  1Z91 A;  2B0L A;  4EMS A;  4HX4 A;  1MZB A;  2ZBK A;  1R1U A;  1I1S A;  1KQ8 A;  3P7N A;  1J75 A;  4DNC A;  3GLX A;  3JAM K;  1YLF A;  5DCF A;  1ZGJ A;  1IN5 A;  3I58 A;  2X4H A;  2H94 A;  2STT A;  1P4X A;  4R79 A;  1FC3 A;  1W7P A;  3U9G A;  5BPD A;  4L18 B;  1Z1D A;  1ZHF A;  4U0V A;  1WRJ A;  3LFK A;  1JGS A;  4HX8 A;  1HW5 A;  4HLY A;  3WG9 A;  5LHG A;  3HTS B;  5E18 F;  1FYM A;  2VN2 A;  2H6C A;  4MQV A;  1ZYR F;  1FNN A;  1FT9 A;  2M1B A;  3KET A;  1QZZ A;  4KIB A;  5H20 A;  2L4M A;  3BJ6 A;  1T38 A;  2P5K A;  2FBI A;  2FNP A;  2VT2 A;  3DQV C;  3CUQ A;  2FNA A;  4UV9 A;  3V7R A;  2G9W A;  4NB5 A;  4HF2 A;  1QQI A;  2V9V A;  3GEZ A;  2VBX A;  5HDG A;  2FBH A;  2PMH A;  1IXR C;  4G6D A;  1ZN2 A;  2CGP A;  4AIH A;  3RPU A;  1U3E M;  2NNN A;  1IUY A;  5CVU A;  5H6R A;  5L3F A;  3IRQ A;  2DQL A;  3ZPL A;  2JPB A;  1Y0U A;  3KE2 A;  2XGX A;  4WCG A;  1P4W A;  4GGG A;  4R1H A;  5KVR A;  2MD5 A;  3CTA A;  2E7W A;  4M6X A;  1B6A A;  1B9N A;  4A6D A;  5JR3 A;  1ZH5 A;  2P7V B;  1GXQ A;  3COA C;  3F8F A;  3WTX C;  1LEB A;  4IRI A;  5L3C A;  4EJV A;  1ZRD A;  2EWN A;  2XHK A;  4ESB A;  1WSU A;  1FY7 A;  3WGG A;  5KK1 A;  5CJ9 A;  4HOB A;  1FSE A;  3ZMU A;  3DEU A;  5E8G A;  3P9I A;  1SFX A;  1XGS A;  1U78 A;  1MJ9 A;  5L3E A;  2LDU A;  4EGZ A;  1F5T A;  1U8R A;  2DAO A;  1Z6R A;  3WU0 A;  2A3S A;  4I2O A;  3CUQ C;  3GZ5 A;  3FM3 A;  2W25 A;  2P7C B;  5LGU A;  2A61 A;  3GWZ A;  1XMA A;  2V1U A;  4HDV A;  2EA4 A;  2HKX A;  3I71 A;  3FZV A;  3DPL C;  4KUM A;  2EFW A;  1FP1 D;  3G73 A;  2ZCW A;  4L9T A;  1KU7 A;  4AIJ A;  2DBB A;  3FMQ A;  4MTE A;  2FU4 A;  5F6F A;  2XIG A;  2O61 A;  1F1Z A;  4RGR A;  4LGW A;  3ROU A;  3KP3 A;  1FSH A;  1KYZ A;  5IT3 A;  4HV6 A;  1BJA A;  3CLO A;  2K86 A;  4IHT A;  1P6R A;  1WQ2 A;  1E17 A;  3DF8 A;  4PDK A;  4OMZ A;  4ZZL A;  4RS8 A;  5HLH A;  3H3U A;  5D5X B;  3BPX A;  2IW5 A;  2PG4 A;  5JVT A;  2K7L A;  1PP7 U;  1DPR A;  4HDU A;  3CO6 C;  1NHA A;  3Q9V A;  3LQR A;  2HS5 A;  1SD6 A;  2PN6 A;  2YSR A;  1A04 A;  5DUK A;  1O7F A;  1J59 A;  4YFN F;  2NYX A;  2V79 A;  1EH6 A;  3RYR A;  4U88 A;  1BI1 A;  5BMZ A;  2F5F A;  3ZMD A;  2FMY A;  2EV0 A;  4OIO F;  3WOD F;  3DFG A;  2XRO A;  5DEQ A;  3BRO A;  2VBY A;  3QOP A;  3ZMV A;  3EUH A;  3NRV A;  1W7P B;  2MBF A;  3L09 A;  3BWG A;  2FF4 A;  1XGN A;  3M9A A;  2PBI A;  2EFQ A;  4Q4Z F;  1G3Y A;  3J7A O;  3M8F A;  3E3V A;  4XRF A;  2OQG A;  2D2W A;  4S04 A;  4LJZ F;  2BYV E;  2W84 A;  3QP5 A;  4XLN F;  1EH8 A;  3LST A;  5D6F A;  2DI3 A;  1W7P D;  1OYY A;  4EGY A;  5FFX A;  3HOS A;  4RB1 A;  3KP7 A;  2ZO4 A;  5J6X A;  4XSZ F;  3IWF A;  1T2K A;  1SD5 A;  4CDG A;  1DUX C;  2G7U A;  4HF1 A;  5D5U B;  4EM1 A;  3P9C A;  1KU3 A;  1FBS A;  1B9M A;  1BOA A;  1YO5 C;  1YS6 A;  1GVJ A;  2HWV A;  3CDH A;  5HS9 A;  3KLN A;  4KIG A;  2M30 A;  2LF7 A;  1V4R A;  1Z7U A;  4G6Q A;  1IN8 A;  1XSD A;  3F3X A;  4EQQ A;  1YS7 A;  3IHU A;  4PGG A;  3RDI A;  2GXB A;  4AVP A;  1UFM A;  2RDP A;  2COM A;  2W85 A;  1BC7 C;  2VE8 A;  2E1N A;  1RI7 A;  1CF7 B;  2J5O A;  1XDS A;  1O3R A;  4I98 B;  1BI0 A;  2LSO A;  4IRH A;  2D1H A;  2ELH A;  1RNL A;  2O3F A;  1YQA A;  4Q47 A;  3HRU A;  1OYW A;  3VEP A;  1WWX A;  1H9T A;  2CWE A;  3FWE A;  2PMU A;  2XKO A;  1HW1 A;  2GWR A;  3Q5F A;  3I5U A;  2IVM A;  2WC2 A;  2VC1 A;  3EYY A;  1LJ9 A;  3L00 A;  2YX4 A;  2Q2E A;  1R00 A;  3RIR A;  4LK1 F;  1IN6 A;  3O2P E;  2IP2 A;  2QVO A;  3SXY A;  4KT5 C;  4BHP A;  4UUV A;  5E8I A;  2UXN A;  1R1V A;  2QYO A;  3F6O A;  3KEQ A;  1U6G A;  1MGT A;  2F5C A;  4S05 A;  2IRF G;  2RV8 A;  2PFB A;  5LLQ A;  4ESF A;  4LG0 B;  3TKY A;  2RKH A;  3C7J A;  1R5G A;  1TLH B;  4A0X A;  5DD4 A;  4JBA A;  1QBJ A;  2WV0 A;  3HRS A;  1ONV A;  3NQO A;  5F1R A;  1R36 A;  2ZNZ A;  3ZMZ A;  3GUD A;  1VTN C;  1S8N A;  5HLG A;  3IKT A;  1ULY A;  5LRS A;  2KIU A;  1OPC A;  4UVC A;  3CJN A;  4BH9 A;  2QWW A;  4L0Z B;  3AAF A;  4A5N A;  1R1T A;  1E2X A;  4YFX F;  2ACJ A;  1J0R A;  2NS0 A;  3J80 Z;  4PCQ A;  3JAM Z;  4CYD A;  1D8J A;  1YW8 A;  2FE3 A;  3LA7 A;  3HUG A;  5FLX Z;  1S3J A;  3U2R A;  3BZ6 A;  2Y0M A;  1KU9 A;  2DTR A;  2OA4 A;  3HRM A;  4BHB A;  3IWZ A;  4ZZD A;  1USS A;  2ADU A;  4EJT A;  3C18 A;  3WTS C;  5IT9 Z;  1FYL A;  2MLK A;  2A6E F;  3E5X A;  3GFL A;  5FFZ A;  2GAU A;  3KLO A;  3SHF A;  4DQ2 A;  4O3M A;  4ZH4 F;  4HLX A;  3IKV A;  1G4D A;  4YG2 F;  2HFH A;  2XAS A;  4MNU A;  5CVI A;  1KQ0 A;  5K5O A;  1RZ4 A;  2VBZ A;  1D3Y A;  2EFN A;  4OOI A;  2MH2 A;  3MQ0 A;  1XGO A;  3ZP5 A;  2F2E A;  2P6T A;  2O8X A;  5FO5 A;  2NNY A;  3V8J A;  3I4P A;  1Z6T A;  2Z3Y A;  3FF5 A;  1RUN A;  1IN7 A;  4RGX A;  4HBL A;  1O7L A;  4K2E A;  3T8T A;  3ABU A;  3DXJ F;  2DK8 A;  2QLZ A;  1FWZ A;  3QU6 A;  3BY6 A;  1G3W A;  5HS7 A;  4Y15 A;  4GXO A;  4ESJ A;  3G3Z A;  4WXH A;  2L4A A;  5K1Y A;  4IJA A;  5D8L B;  4QWQ A;  1O3Q A;  1ZGA A;  3H92 A;  1G3T A;  1ZG5 A;  5ICF A;  5HLI A;  4CXF A;  2O0Y A;  2O03 A;  3HSF A;  4HZF A;  3ML6 A;  1PP8 F;  1W5S A;  1K6O A;  1S29 A;  1S7O A;  2H6B A;  3TGN A;  1R22 A;  3JW4 A;  3F72 A;  4P5O A;  3L9F A;  1KQ9 A;  2R7F A;  3WE2 A;  4U7D A;  1UHW A;  1TW2 A;  3J81 K;  5DUI A;  4L9V A;  1PDN C;  5LEJ A;  3C3W A;  2CYY A;  5JI6 A;  1U5T A;  4CZZ A;  2FOK A;  3E5Q A;  3K0L A;  5TRD A;  1RIO H;  2X0L A;  3ELK A;  5E1X A;  3RTR A;  3HRT A;  4KN7 X;  3HHH A;  4AWX B;  4RB3 C;  1XDU A;  1HST A;  2RNJ A;  4FT8 A;  3WTZ A;  5H6Q A;  1F9N A;  3FMS A;  5BQT A;  1FP2 A;  4M71 A;  4O6J A;  4I01 A;  4I09 A;  3TDU C;  2VOD A;  1ON1 A;  1JE8 A;  3E6D A;  3J80 K;  1R7J A;  3HSE A;  2K02 A;  4G7Z F;  4LD5 A;  1HKS A;  3U1D A;  4LK0 F;  1TNT A;  2PEX A;  3DKW A;  1XMK A;  1XD7 A;  2VON A;  1XB4 A;  3D5L A;  1K79 A;  4UXN A;  3DPT A;  1XSX A;  5L3D A;  1IRG A;  1HKT A;  2VC0 A;  2P6S A;  4Q5S F;  5IT9 K;  1SFE A;  1J9I A;  2KIM A;  3RYP A;  5HVQ C;  4LFU A;  3FHZ A;  1IW7 F;  3IRR A;  2HEO A;  2ESN A;  3CUQ B;  2DPD A;  3ZMT A;  4L9N A;  4L9J A;  2XVC A;  5DV5 A;  3T8R A;  4ZYG A;  3L7W A;  3R0A A;  4IRG A;  2Q0O A;  2ZJ2 A;  5D8K B;  2KRF A;  4ZYH A;  2J5P A;  4EJO A;  2HKO A;  1JXS A;  1HSJ A;  1KGS A;  1R23 A;  2IA0 A;  2QBY A;  4LMY A;  1P4A A;  3ZN0 A;  2QQ9 A;  2HR3 A;  4LLG F;  2UXX A;  4LLL A;  3O3K A;  2L02 A;  1HW2 A;  1FYK A;  2M5W A;  1HBX G;  5D5W B;  1L3L A;  5HDN A;  2GA1 A;  4BYY A;  4OU0 A;  3CUO A;  2ISY A;  1YG2 A;  4N9H A;  3WE3 A;  3HSR A;  5AIP A;  1T98 A;  1PUE E;  3LA3 A;  3WGH A;  4ENN A;  3I59 A;  5D6E A;  5E17 F;  4IF4 A;  2OAZ A;  4L5I A;  5ICG A;  3RKX A;  1MJA A;  5LHH A;  3E97 A;  2DLL A;  1G6N A;  3F8M A;  4OIQ F;  5J8F A;  2AXL A;  2L54 A;  1FBQ A;  2QEN A;  2RGV A;  2V1D A;  4ON0 A;  2IT0 A;  2EJR A;  1W4M A;  2LNB A;  3F21 A;  2QBY B;  2H09 A;  4OIP F;  4JQF A;  5BPI A;  2GIV A;  4OMY A;  1SD7 A;  5FD6 A;  1K78 A;  5EEH A;  4A0Y A;  3I59 B;  3TOA A;  1TW3 A;  2FXA A;  1MD0 A;  1OKR A;  3GO5 A;  1S6L A;  1U5T B;  3GFI A;  3MZY A;  2ZME A;  4TV7 A;  5D4S A;  4F7Z A;  4P9F A;  4U0W A;  3I53 A;  3R0J A;  1T0F A;  3VB2 A;  5FB2 A;  4CHU A;  2ZME B;  2Z33 A;  4CO8 A;  4M9X A;  3N4M A;  2STW A;  1CGP A;  1T39 A;  1Z9C A;  5DYM A;  2GA2 A;  5LGN A;  1EV7 A;  4HV5 A;  1I6X A;  3FMR A;  5L3G A;  2HTS A;  2RQP A;  5LHI A;  2BEO A;  2XAG A;  2W24 A;  4EJW A;  3WU1 B;  5CVR A;  4KIC A;  2OD5 A;  1J5Y A;  1T6S A;  4L5J A;  2A07 F;  2LF8 A;  3ZQ7 A;  6PAX A;  1O3S A;  1D8K A;  1I27 A;  4IHS A;  3M7G A;  5ED4 A;  2CW0 F;  3RKW A;  2PQ8 A;  4UV8 A;  2OZU A;  3BPV A;  3JTH A;  2HYF A;  2YU3 A;  1AOY A;  2M45 A;  4MGR A;  1BM9 A;  3LAJ A;  2ETH A;  1FLI A;  1UHM A;  3N97 A;  1KU2 A;  4M72 A;  2K27 A;  1HQC A;  3O6B B;  3R60 A;  4Z2Y A;  2DO7 A;  4NHJ A;  3PQJ A;  1H9G A;  4U0Y A;  1QO0 D;  4G94 A;  4U7B A;  5A2Q Z;  3Q9S A;  2HDC A;  1JHF A;  1GXP A;  3EYI A;  3F23 A;  4KNY A;  1IN4 A;  2YX7 A;  2PI0 A;  2DPU A;  3RPQ A;  5CVJ A;  2PJP A;  1ZAO A;  2A5Y B;  4HQM A;  3E6M A;  3TO9 A;  2VT3 A;  2R3S A;  1OMI A;  4BNC A;  1XGM A;  1B4A A;  2L3D A;  1AWC A;  4HF0 A;  4E70 A;  4G7O F;  2MC3 A;  3SZP A;  4A6E A;  1XCV A;  2P5L C;  3BJO A;  3REO A;  3VFZ A;  4HQE A;  2DW4 A;  1RUO A;  4YII A;  1GHC A;  2LKP A;  4R8H A;  4M9S A;  3DV8 A;  5CYV A;  4EM2 A;  2MA3 A;  3BJA A;  2GQQ A;  3K69 A;  3KP2 A;  3HOT A;  4MHG A;  2L01 A;  4BXU A;  2QUF A;  1IAW A;  1R5H A;  1YTY A;  3RI4 A;  4LLN A;  2FBK A;  2IPQ X;  4I0B A;  1G3S A;  1MJB A;  3R6S A;  2JPC A;  2Z9O A;  1SD4 A;  3R61 A;  2IA2 A;  1V3F A;  2HTJ A;  4KYW A;  4AD9 A;  1J2X A;  3GF2 A;  2A68 F;  4P9U A;  3WTT C;  1ODD A;  2XRN A;  1MKM A;  4EV0 A;  4M9Z A;  2HYG D;  4UNO A;  1F4K A;  2FSW A;  1LDD A;  4I7H A;  5EEG A;  1IF1 A;  3R4K A;  3HYI A;  3SFZ A;  3GYH X;  1YIO A;  2JZY A;  2MLG A;  1IRF A;  3WGI A;  2XV4 S;  3HIF A;  2KIF A;  3LQQ A;  1LDJ A;  4D0P A;  4M6Y A;  4KMU X;  3F8N A;  4B09 A;  4WXD A;  3MCZ A;  2V1X A;  4RGS A;  1B59 A;  5ICC A;  3P9K A;  3HTU A;  4G8X A;  4UVA A;  3T0Y A;  4GCV A;  4P96 A;  3W6K B;  3W6J B;  5LBQ A;  1LEA A;  3GXO A;  2HGC A;  3JTG A;  3F6V A;  2BGC A;  1U2W A;  2FRH A;  2QZ8 A;  3S2W A;  4ASN A;  1H0M A;  2XUB A;  3K1P A;  3I0T A;  5K5Q A;  4OIR F;  1YYV A;  4H0E A;  4YFK F;  2BBY A;  5DCM A;  2CFX A;  3B02 A;  5K5R A;  4G9Y A;  3SZT A;  3QRF F;  4CGZ A;  3FXR A;  1TQI A;  4XSX F;  4NQW A;  5J8C A;  4KN4 X;  4EJU A;  4RAY A;  2ZFW A;  1O3T A;  2K4J A;  4ZYE A;  1DDN A;  4MTD A;  1BIB A;  3KCC A;  1EH7 A;  5JHU A;  4ZYD A;  5FGM A;  3TO7 A;  4MEY F;  1QPM A;  5AON A;  2XAH A;  2F5D A;  3J81 Z;  1TTY A;  1TBX A;  2FA5 A;  3CO7 C;  2CO5 A;  3ULQ B;  3BDD A;  3T5X A;  1ZG3 A;  4LG0 A;  5ILS A;  3KZZ A;  2RVC A;  3D0S A;  2DK5 A;  3F22 A;  2VE9 A;  2G7H A;  3VOD A;  1LQ1 A;  5LEK A;  2EFO A;  2BE5 F;  1J7K A;  1B1B A;  2Z5U A;  1STZ A;  2CSO A;  1YFH A;  4A12 A;  3V4G A;  2UZK A;  2AS5 F;  5F64 A;  2V6C A;  3V8L A;  2ZKZ A;  3GVA A;  1ZG1 A;  2XAF A;  4ENK A;  2NAZ A;  1LB2 A;  1ZRF A;  3SQN A;  3M1E A;  1HKQ A;  3ABT A;  2ZNY A;  5HDK A;  2HQN A;  1D5V A;  1I1G A;  2EK5 A;  4BAY A;  2KJB A;  3T1B A;  1XSV A;  3KFW X;  2VXZ A;  4HX7 A;  2C6Y A;  2YPR A;  4XBF A;  4RB2 C;  2KJC A;  5LRR A;  2M87 A;  5DDG A;  1U5T C;  4A2U A;  1SAX A;  3TDZ C;  2A6H F;  3KP4 A;  3FXU A;  3VOE A;  1WKM A;  3BOQ A;  5E1Z B;  2GXG A;  5BS6 A;  1HXD A;  4GO1 A;  1BIA A;  3FXQ A;  2WWY A;  2RC4 A;  2W57 A;  3OOP A;  1FOK A;  2XKP A;  3ECH A;  2JTV A;  4KA4 A;  1P2F A;  1JHH A;  5JFR A;  4FX4 A;  2BV6 A;  4LB5 A;  4HYE A;  1YW7 A;  3K9T A;  4PGH A;  2RN7 A;  2QQB A;  3WTW C;  1KA8 A;  5FD5 A;  4CIC A;  4GYG A;  3BP8 A;  4Q48 A;  4UVB A;  4HA8 A;  1P92 A;  1LDK B;  3IC7 A;  2EB7 A;  2FEZ A;  3E6B A;  3RKY A;  1SMT A;  3TQN A;  4JK1 X;  4RB0 A;  2QQA A;  4AIK A;  1FBU A;  5BOX A;  3V7S A;  3KP6 A;  4MEX F;  4BQA A;  2VBW A;  4I02 A;  3E5U A;  5E20 A;  3MWM A;  3QAH A;  4WX9 A;  2EV6 A;  1BI2 A;  1TQM A;  2ZXJ A;  3L2C A;  4HAM A;  4BHC A;  1ZRE A;  2F5E A;  1KYW A;  2P4W A;  2CG4 A;  2A69 F;  3IL2 A;  3EDP A;  5D5V B;  4P55 A;  4FX0 A;  3WTY C;  1LVA A;  4RAZ A;  1YW9 A;  4I0A A;  3GX4 X;  3TO6 A;  4Y17 A;  1I5Z A;  3QP6 A;  3V7C A;  4IPA A;  4N0B A;  1XCB A;  4OIN F;  2JRT A;  4PZJ A;  1TNS A;  1Z05 A;  4O5V A;  1UST A;  2IA1 A;  2E1C A;  4Y13 A;  3HHG A;  3F8C A;  3LWF A;  1C0W A;  2CQK A;  1L0O C;  1ON2 A;  5CLS A;  3GZ6 A;  2D1V A;  3JSO A;  3QPH A;  4LB6 B;  5DD8 A;  5ICE A;  3FX3 A;  3M8E A;  5DCM B;  4KIF A;  1MDM B;  1ZLJ A;  5A2Q K;  4WK8 F;  4YIF A;  2VOP A;  4FHT A;  1K78 B;  4KMF A;  1SMY F;  2Q8K A;  4WWC A;  4ETS A;  2XAJ A;  1Q1H A;  5ERI A;  2UWM A;  1O57 A;  2FQ3 A;  4IVN A;  4M74 A;  4WXC A;  1DPU A;  1X3U A;  2TDX A;  3OV8 A;  3ZN1 A;  1REP C;  1R58 A;  5LGT A;  1BI3 A;  1LNW A;  2EA2 A;  3LAP A;  3K1M A;  1QNT A;  4GYI A;  2D45 A;  5D4R A;  2Z99 A;  2R7D A;  2NRA C;  2FML A;  3E6C C;  1WI9 A;  5HOO A;  2M8E A;  1TQP A;  3ZMS A;  3FM5 A;  2Y75 A;  2YR2 A;  1MDM A;  4EM0 B;  2DU9 A;  4MQ9 F;  5E1W A;  4QLC U;  1SFU A;  1BN5 A;  1ZLK A;  3RJP A;  4G7H F;  3NEU A;  3MAJ A;  1XN7 A;  1IXC A;  3QPT A;  2GZW A;  2E7X A;  2OU2 A;  4N9I A;  3H3Z A;  1S7A A;  2PLY A;  4L0Y B;  2XAQ A;  4M73 A;  3WTU C;  2JT1 A;  4HW0 A;  3MZH A;  1W5T A;  3LA2 A;  1ZRC A;  3ERE D;  3GFJ A;  3DP7 A;  1QZY A;  4KFC A;  2WTE A;  1FZP B;  3B73 A;  2HZT A;  3ISP A;  3EQL F; 
#chains in the Genus database with same CATH topology
 3EET A;  4CCJ A;  5FLX K;  3I64 A;  2X51 A;  3OIQ A;  2RQQ A;  1UCR A;  3QU3 A;  3DPU A;  5L3B A;  1H8A C;  3A0H C;  1DP7 P;  4ENJ A;  5KAI C;  2KKO A;  4RAG A;  4WF2 A;  4UUS A;  4RGU A;  1IXS B;  2JN6 A;  2IJL A;  2JSC A;  3JRB A;  3K2Z A;  5IPA A;  2K4B A;  3MEX A;  4KJZ A;  4IX7 A;  3ZQH A;  3GW2 A;  3KZY A;  3G4S I;  2M9H A;  3AG3 H;  3I56 I;  1VQL I;  2E36 A;  4M3G A;  2UV1 A;  1R6R A;  4HSR A;  4XLA A;  3MVP A;  4CCO A;  3G6E I;  1QVT A;  1W0T A;  2LKS A;  2H27 A;  3K1N A;  1QGP A;  2EV5 A;  1MMN A;  3C2B A;  3NAR A;  2DJI A;  4B8X A;  1IZ1 A;  2PJR B;  4CSW A;  4NC8 A;  3LMM A;  1FX7 A;  2OBP A;  2DFI A;  2VPR A;  3KP5 A;  4AC0 A;  1NG6 A;  2DT5 A;  4A0Z A;  4BAC A;  2EQR A;  1SVL A;  1CF7 A;  4UUT A;  1OR7 A;  2HOE A;  5ILU A;  3K4K A;  5F0F A;  1ZAR A;  1RKT A;  4RDU A;  2HNH A;  2K85 A;  2P8T A;  3PQK A;  4FIS A;  3K2A A;  2HQR A;  2JK3 A;  2Y48 A;  2DMN A;  3ECO A;  2XB0 X;  1RPW A;  3V8K A;  3TOB A;  3MFK A;  1A31 A;  3BTJ A;  2OQR A;  3EUH C;  1R5I D;  3FK6 A;  3S16 J;  1AKH B;  2VOO A;  2R0Q C;  4KIS A;  1FPQ A;  3B6C A;  3GFM A;  3QWL A;  2OZ6 A;  2ISZ A;  2O6G E;  2ESH A;  2CS3 A;  3A1Y A;  2EPF A;  3WTV C;  1F43 A;  5TJJ A;  3MKZ A;  2VQC A;  3I54 A;  2DOA A;  1PYV A;  1BBY A;  5HS8 A;  3P5J A;  3S8P A;  1MH4 A;  3DTE A;  3A4C A;  1K7A A;  2Y9Z A;  1BC8 C;  5ILV A;  1OYI A;  3CMM A;  4IXA A;  4BEH B;  4A5M A;  1LFP A;  2P5V A;  1UB9 A;  3FKJ A;  2ZXW H;  3PSI A;  1MBG A;  2E2I J;  4JX6 A;  1Y1W J;  5CVV A;  3QQA A;  3K4B A;  2MD0 A;  3JSP A;  4ENM A;  3OOU A;  2DQR A;  1X3Z B;  4UHT A;  2HVQ A;  3ZQC A;  2VKH A;  3O8H A;  2O9L A;  3CDI A;  3KEO A;  3C1D A;  2EFP A;  3PO3 J;  4AU7 A;  1MBF A;  1X1A A;  4EVI A;  5FJ8 J;  1T08 B;  2CQX A;  4BY7 J;  1EJ9 A;  2MH9 A;  1YX3 A;  2FOW A;  3PFI A;  4YEL A;  3PFY A;  2QM3 A;  4XLP F;  5AIQ A;  3M07 A;  2LVS A;  4M3F A;  3F8B A;  4KDP A;  2WAF A;  1Z91 A;  2B0L A;  5TGT A;  4EMS A;  4HX4 A;  1MZB A;  1IRX A;  1X1B A;  2E34 A;  5M5X J;  1D1C A;  1LFB A;  2ZBK A;  4DW6 A;  4KIT B;  2EIM H;  4PUS A;  1R1U A;  2DCE A;  1Z3X A;  1I1S A;  1KQ8 A;  3P7N A;  1J75 A;  4DNC A;  1XPX A;  3GLX A;  1B72 B;  4PJL A;  3JAM K;  1YLF A;  1LPQ A;  3J7Y J;  5DCF A;  1ZGJ A;  2Y30 A;  3RPU D;  2CRG A;  1IN5 A;  2DA1 A;  4NC7 A;  1E3O C;  3I58 A;  2NS7 A;  4XKW A;  5JLW A;  2X4H A;  2H94 A;  4QTR A;  2STT A;  1P4X A;  2IS6 A;  2E1M C;  4R79 A;  1FC3 A;  1LVK A;  3VSL A;  1W7P A;  1UAA A;  2HOS A;  3U9G A;  5BPD A;  4L18 B;  1YHQ I;  5EEA A;  1Z1D A;  1ZHF A;  4U0V A;  5F08 A;  4B4C A;  3S3N A;  1WRJ A;  2ID6 A;  2IAI A;  3LFK A;  3OS1 A;  2K40 A;  1N77 A;  1JGS A;  2AQF A;  4HX8 A;  5E3L A;  1HW5 A;  2CQQ A;  1WJC A;  4HLY A;  3WG9 A;  5IYD J;  4A3G J;  1SFO J;  3KIO A;  4QSH A;  5LHG A;  3GTG J;  3HTS B;  5E18 F;  1FYM A;  2DA4 A;  5IOZ A;  3HG9 A;  5IP6 A;  2VN2 A;  5E79 C;  2L7M P;  4IQ4 A;  2H6C A;  4MQV A;  1ZYR F;  1FNN A;  4BDY A;  1FT9 A;  1ENH A;  2M1B A;  3KET A;  1YOV B;  5IP9 J;  1QZZ A;  3PNY A;  4KIB A;  5H20 A;  2L4M A;  3BJ6 A;  3QPL A;  1T38 A;  2P5K A;  2FBI A;  2FNP A;  2VT2 A;  5FLM J;  1JT0 A;  3DQV C;  3OY9 A;  3CUQ A;  3G71 I;  1S9H A;  1MBK A;  2FNA A;  3BLY A;  4UV9 A;  3V7R A;  2G9W A;  1IRZ A;  4NB5 A;  4HF2 A;  1FOY A;  1QQI A;  2V9V A;  2R7W A;  3GEZ A;  2VBX A;  5HDG A;  2FBH A;  1D1A A;  2HPI A;  2PMH A;  1IXR C;  3OSG A;  4G6D A;  1ZN2 A;  2CGP A;  2WY7 Q;  4AIH A;  2ZJQ F;  5FRN A;  1GLN A;  2VAS A;  3RPU A;  3JRD A;  1U3E M;  1ZQ3 P;  2NNN A;  2KLO A;  1IUY A;  1Z3Y A;  2HXO A;  5CVU A;  2LBF B;  1ZR4 A;  3MKW B;  1X4P A;  5H6R A;  4HNU A;  3A01 A;  1T8I A;  2ICW G;  1JUM A;  5L3F A;  3IRQ A;  2DQL A;  2EZK A;  3ZPL A;  4QIW N;  2JPB A;  1Y0U A;  2VIX A;  3KE2 A;  4NBQ A;  2XGX A;  4WCG A;  1YRN B;  4XK4 A;  1P4W A;  3L2U A;  4GGG A;  2KPM A;  4R1H A;  2E35 A;  4PSW A;  3JRG A;  3JRH A;  5KVR A;  1E3P A;  3HOX J;  3K4L A;  2MD5 A;  3CTA A;  2H1L A;  3TMO A;  1QZE A;  1VQP I;  4AID A;  4PFO A;  2NVX J;  2E7W A;  4M6X A;  1B6A A;  2LMD A;  1B9N A;  3CCL I;  4LIU A;  3IH4 A;  3WHC A;  4A6D A;  1AU7 A;  4L5E A;  2GXA A;  3IV5 A;  3LL7 A;  3BTC A;  4A93 J;  5JR3 A;  3QOD A;  1ZH5 A;  2P7V B;  1GXQ A;  2DT6 A;  3HOZ J;  4X0G A;  3COA C;  2DDA A;  3OS0 A;  2HOT A;  2VJ5 A;  2Z16 A;  3F8F A;  3KPH A;  3I55 I;  3ZRG A;  3WTX C;  1LEB A;  4E4H A;  2DMP A;  4IRI A;  3BZC A;  5L3C A;  4EJV A;  4A3I J;  2XC7 A;  4J00 A;  1MIJ A;  1ZRD A;  2EWN A;  2R7V A;  2XHK A;  1AKH A;  2XPV A;  4ESB A;  1TWF J;  1WSU A;  1FY7 A;  3WGG A;  5KK1 A;  2LRD A;  1ETW A;  3OYC A;  5CJ9 A;  5E3N A;  3KEY A;  4HOB A;  4FE7 A;  1FSE A;  1B8I A;  2IS2 A;  3ZMU A;  2LFB A;  1SAN A;  4RBO A;  2BVM A;  2DJN A;  5EG0 B;  1R9T J;  3DEU A;  1N75 A;  2CUJ A;  3NWT A;  3P9I A;  1N25 A;  1SFX A;  1XGS A;  5E8G A;  3CF5 F;  1U78 A;  1MJ9 A;  5L3E A;  2ECB A;  1RES A;  2LDU A;  4XQF A;  4EGZ A;  1F5T A;  1U8R A;  2DAO A;  1Z6R A;  3WU0 A;  3H5R A;  3FIS A;  3CC7 I;  2A3S A;  3DCF A;  4I2O A;  3CUQ C;  3GZ5 A;  4A3C J;  3D5R C;  3FM3 A;  2W25 A;  3IH2 A;  5FRO A;  2P7C B;  1VZ0 A;  3GTL J;  5LGU A;  3ZQL A;  3QYF A;  3JRC A;  2A61 A;  3LSH A;  3GWZ A;  2FQ4 A;  3IP4 B;  3S32 A;  1XMA A;  2V1U A;  4HDV A;  2NVY J;  2EA4 A;  3DTI A;  2EH3 A;  2HKX A;  2HVR A;  3I71 A;  4ZJZ A;  3VYS B;  4NUB A;  2LLK A;  3BG9 A;  3FZV A;  3DPL C;  4KUM A;  1NK3 P;  2EFW A;  1FP1 D;  3G73 A;  2ZCW A;  2TRT A;  4L9T A;  2R93 J;  4F92 B;  3IH3 A;  2VJ4 A;  4IKF A;  2QSF X;  2VL8 A;  1KU7 A;  4XLC A;  5IYB J;  1V54 H;  4AIJ A;  2CH0 A;  2DBB A;  2HZD A;  2QQ8 A;  4A3K J;  4RLQ A;  4BEH A;  3FMQ A;  3FXM A;  2MC4 A;  4MTE A;  2VI6 A;  2FU4 A;  2LP0 A;  5F6F A;  2XIG A;  2O61 A;  2Z1D A;  1I6H J;  1F1Z A;  1VQ4 I;  4RGR A;  4DBQ A;  4LGW A;  1WI3 A;  3ROU A;  4B43 A;  3KP3 A;  1O4X A;  2V9P A;  1FSH A;  4ANJ A;  1V55 H;  1YRN A;  1KYZ A;  2AQE A;  3WG7 H;  5IT3 A;  4HV6 A;  1BJA A;  2H1K A;  3CLO A;  4G6T B;  2K86 A;  1PJR A;  4IHT A;  1P6R A;  1WQ2 A;  4BE1 A;  1E17 A;  1MMD A;  3DF8 A;  4PDK A;  4OMZ A;  3A01 B;  4ZZL A;  4RS8 A;  5HLH A;  3H3U A;  2L7Z A;  2F4M B;  3HOU J;  3BC8 A;  2R7Z J;  5D5X B;  2ZJP F;  3BPX A;  2IW5 A;  2PG4 A;  5JVT A;  2K7L A;  1PP7 U;  1DPR A;  2BY1 A;  5DS9 A;  2PJR A;  2VKE A;  4HDU A;  1GVD A;  3GCM A;  3CO6 C;  4NNJ A;  1T33 A;  1NHA A;  3Q9V A;  3LQR A;  2R4G A;  4IL6 C;  3E7L A;  4YRV A;  4AUX A;  2HS5 A;  1SD6 A;  2PN6 A;  5IYC J;  4XNF A;  2YSR A;  4CCM A;  1A04 A;  2IS1 A;  4X6A J;  1WHU A;  2HU9 A;  5DUK A;  5J1R A;  2L2O A;  1O7F A;  1J59 A;  4YFN F;  2X9D A;  2NYX A;  5EZG A;  3CCJ I;  3AL0 B;  2V79 A;  1EH6 A;  3DLL F;  3RYR A;  4U88 A;  3NAU A;  1BI1 A;  3UKG A;  1K61 A;  5BMZ A;  1OCT C;  2F5F A;  3ZMD A;  2FMY A;  1POG A;  2LR8 A;  2VQG A;  2EV0 A;  4OIO F;  3WOD F;  4M6V A;  3NWS A;  3DFG A;  2XRO A;  5DEQ A;  2GBY A;  1SC7 A;  3BRO A;  2VBY A;  3QOP A;  3ZMV A;  3EUH A;  3NRV A;  1TL8 A;  1W7P B;  2GM4 A;  2B63 J;  2MBF A;  3PNV A;  3L09 A;  2R7O A;  3D5S C;  3BWG A;  2FF4 A;  1XGN A;  2KHM A;  2NS8 A;  3M9A A;  2PBI A;  2EFQ A;  2KZG A;  1BR2 A;  2BHZ A;  1G3Y A;  4Q4Z F;  3ERM A;  3J7A O;  3M8F A;  3CP8 A;  3PJR A;  3E3V A;  5M3M J;  1B72 A;  4XRF A;  2OQG A;  3L2Q A;  4RLF A;  1I50 J;  2D2W A;  4S04 A;  1E3H A;  4LJZ F;  3JRA A;  2BYV E;  2W84 A;  1UMQ A;  2KIS A;  3QP5 A;  4XLN F;  2VLA A;  1EH8 A;  3LST A;  2V26 A;  5D6F A;  2DI3 A;  1W7P D;  1OYY A;  1Y0N A;  4EGY A;  2GLO A;  5FFX A;  3HOS A;  4LIT A;  3PL8 A;  4RB1 A;  3X2Q H;  2JA7 J;  4D7N A;  1FTZ A;  5EGO A;  3KP7 A;  2ZO4 A;  5J6X A;  1SEU A;  4JX5 A;  4XSZ F;  5EYR A;  3IWF A;  3S3O A;  1T2K A;  1EA3 A;  4BJT A;  2ZC2 A;  1SD5 A;  1P7I A;  4CDG A;  1DUX C;  2G7U A;  4HF1 A;  5D5U B;  4XKC A;  4I99 C;  4EM1 A;  4II3 A;  4D5C A;  3P9C A;  1KU3 A;  5FKK A;  3ZXS A;  1BW5 A;  1FBS A;  1B9M A;  1BOA A;  1YO5 C;  1YS6 A;  1GVJ A;  5KCM A;  2HWV A;  3CDH A;  3EUK L;  4N4N B;  5HS9 A;  1OCR H;  4IEJ A;  3KLN A;  4KIG A;  4A3J J;  2M30 A;  1JKO C;  2YU9 J;  5TIS C;  4A3E J;  5DM7 F;  2LF7 A;  3DU5 A;  1V4R A;  1Z7U A;  2QCO A;  4G6Q A;  4V2G A;  5B1A H;  1IN8 A;  1XSD A;  3F3X A;  4EQQ A;  4N4O B;  3RZD J;  1YS7 A;  2W00 A;  1ETV A;  3TBI A;  2COB A;  3IHU A;  4PGG A;  3RDI A;  3OMY A;  2O5R A;  2GXB A;  4AVP A;  3LSP A;  1UFM A;  2RDP A;  2XSJ C;  1JKR C;  1A6Q A;  2CQN A;  1Y1V J;  2COM A;  2W85 A;  3KYD B;  3H3V K;  2NXN B;  2BY0 A;  2EBI A;  2XPW A;  3CQZ J;  3LFU A;  2HXI A;  1BC7 C;  3HUG B;  2VE8 A;  5FKN A;  2E1N A;  1RI7 A;  1CF7 B;  2J5O A;  2LY9 A;  1GDT A;  1FTT A;  3SDG A;  2X1D A;  4CH7 A;  3OYA A;  5FRM A;  5IY5 H;  1FEX A;  1XDS A;  1O3R A;  4I98 B;  1LE8 A;  1BI0 A;  4HST A;  4II2 A;  3S14 J;  3RQI A;  3CCQ I;  2R5Y A;  2LSO A;  4IRH A;  2D1H A;  3H0D A;  3GBG A;  3ONQ A;  2ELH A;  3VYT B;  3G1O A;  1RNL A;  2O3F A;  1YQA A;  4Q47 A;  3HRU A;  3FBI B;  3MKY B;  3CCV I;  1LFU P;  1OYW A;  3VEP A;  3W6V A;  1WWX A;  3BG6 A;  1H9T A;  2WBM A;  1VQM I;  3RZO J;  2CWE A;  4PJ0 C;  3Q3S A;  3IAM 2;  2ELJ A;  3FWE A;  1VQK I;  1TWH J;  4I76 A;  2PMU A;  2XKO A;  4EAT A;  3BR3 A;  2YS9 A;  3IAS 2;  5EDN A;  1HW1 A;  2BHY A;  3ZQG A;  3B6A A;  2GWR A;  1K83 J;  3Q5F A;  3I5U A;  2F5V A;  4UB8 C;  1DGR M;  3ASN H;  2IVM A;  2WC2 A;  2VC1 A;  3EYY A;  1LJ9 A;  3L00 A;  3GME A;  2YX4 A;  5LFA A;  2L9N A;  2Q2E A;  1R00 A;  3RIR A;  4LK1 F;  1IN6 A;  3O2P E;  2IP2 A;  2QVO A;  3SXY A;  4KT5 C;  4BHP A;  4UUV A;  5E8I A;  2UXN A;  1R1V A;  2QYO A;  2HOA A;  3F6O A;  3KEQ A;  1U6G A;  1MGT A;  2P81 A;  2IXS A;  2F5C A;  2M3A A;  3OIP A;  4S05 A;  1T95 A;  3OSF A;  2IRF G;  2CJJ A;  4BE2 A;  1HC8 A;  2RV8 A;  2PFB A;  2WAQ A;  5LLQ A;  1IG7 A;  4ESF A;  4LG0 B;  4C9Y A;  2IGM A;  1ZTR A;  1FMV A;  3TKY A;  3CCM I;  2RKH A;  4FTH A;  2EIN H;  3J7A Y;  4F91 B;  2I5U A;  3C7J A;  1G2H A;  2CV1 A;  1R5G A;  4FQG A;  1VF9 A;  2K3F A;  1TLH B;  4A0X A;  2L9V A;  3S15 J;  5DD4 A;  4JBA A;  3QPS A;  2DA7 A;  1QBJ A;  3SEQ A;  2WV0 A;  3K4J A;  3HRS A;  1ONV A;  3NQO A;  5F1R A;  1R36 A;  3TL4 X;  2ZNZ A;  2DTZ A;  3ZMZ A;  4E7Z A;  3GUD A;  2ME6 A;  1VTN C;  1S8N A;  4CCN A;  2KQR A;  1YX5 A;  5HLG A;  3CJT B;  2O7O A;  3H5A A;  5EGO B;  3IKT A;  3KZI C;  1ULY A;  5LRS A;  1VQ8 I;  2KIU A;  2MW8 A;  1OPC A;  4UVC A;  3CJN A;  4BH9 A;  2QWW A;  4L0Z B;  1Z21 A;  3AAF A;  4A5N A;  4A69 C;  1R1T A;  3K70 D;  3M3Y J;  1P9Q C;  1E2X A;  2CUF A;  3ESW B;  4E7H A;  2D5V A;  4BUP A;  4YFX F;  2QA4 I;  2ACJ A;  4B47 A;  1J0R A;  2NS0 A;  3J80 Z;  4PCQ A;  3JAM Z;  1D0Y A;  3ZOB A;  4CYD A;  3GLL A;  1Y8Q B;  2IS4 A;  1YW8 A;  3KYC B;  1QU3 A;  1D8J A;  2FE3 A;  3LA7 A;  2M0M A;  3HUG A;  4B3X A;  5FLX Z;  1S3J A;  1H88 C;  1EF4 A;  1I3A A;  4BL0 B;  1D0X A;  3Q0U A;  3L2W A;  3U2R A;  4BXX J;  3BZ6 A;  2Y0M A;  5DM6 F;  2R7Q A;  1KU9 A;  2DTR A;  2DYR H;  2OA4 A;  3HRM A;  4BHB A;  3JRI A;  1OQY A;  3IWZ A;  4ZZD A;  1USS A;  3BTI A;  4BBR J;  4V2F A;  2ADU A;  4EJT A;  3C18 A;  3H36 A;  3WTS C;  1D1B A;  2BXY A;  5IT9 Z;  5FKL A;  1XMX A;  1FYL A;  2MLK A;  4OWR B;  2A6E F;  3E5X A;  3GFL A;  5FFZ A;  2JA6 J;  2NVU B;  2GAU A;  1U8B A;  2HPM A;  3KLO A;  3SHF A;  4DQ2 A;  2WAD A;  4O3M A;  1T0F C;  4ZH4 F;  1AA7 A;  3CCR I;  4HLX A;  1MMS A;  3IKV A;  1G4D A;  2R7X A;  1SFK A;  2AHQ A;  2ZSH B;  4DIQ A;  2HFH A;  4YG2 F;  2XAS A;  2W82 A;  4MNU A;  5CVI A;  2OPT A;  3GTP J;  1KQ0 A;  3CJQ B;  1S5L C;  5K5O A;  3WHB A;  1JKP C;  1DP3 A;  1RZ4 A;  4HNV A;  2VBZ A;  1D3Y A;  3VSK A;  1FIA A;  2EFN A;  4OOI A;  3U21 A;  2MH2 A;  2YUS A;  3DEE A;  3MQ0 A;  1XGO A;  3OYD A;  3ZP5 A;  5F27 A;  2F2E A;  2P6T A;  2MYS A;  3W2A A;  2HDW A;  3HZJ A;  2O8X A;  1UEL B;  1RR8 C;  5FO5 A;  1PUF B;  2NNY A;  4XM3 A;  4UB6 C;  3V8J A;  3I4P A;  3HPH A;  1Z6T A;  2Z3Y A;  2UUZ A;  3A03 A;  3FF5 A;  1RUN A;  1IN7 A;  3G2B A;  1TZL A;  2JRM A;  4RGX A;  1VQ5 I;  4HBL A;  1O7L A;  4K2E A;  3H9Q A;  3T8T A;  3ABU A;  3DXJ F;  2DK8 A;  4IHV A;  2QLZ A;  1TT5 B;  1FWZ A;  4ZDO A;  3QU6 A;  5KHD A;  3BY6 A;  4B44 A;  3OYN A;  1G3W A;  2IGO A;  3DLA A;  4F55 A;  5HS7 A;  2VB6 A;  3I9V 2;  2CV2 A;  4Y15 A;  1WPK A;  4GXO A;  4JX4 A;  4ESJ A;  3HOY J;  3G3Z A;  4WXH A;  5J47 A;  2JVH A;  4BJ6 C;  1XX5 A;  4E7K A;  2NVQ J;  2DOE A;  3WU2 C;  2DN0 A;  2L4A A;  1X58 A;  2LYC A;  1XTA A;  3W2W A;  4AYB N;  4GFB A;  5K1Y A;  3QYE A;  2DA2 A;  4IJA A;  4NDL A;  5D8L B;  4XIC A;  4QWQ A;  2OCC H;  4CUG A;  1O3Q A;  1R4M B;  2OUM A;  3EUA A;  4XKV A;  1ZGA A;  3H92 A;  3BR0 A;  1G3T A;  1ZG5 A;  5ICF A;  3SJM A;  5HLI A;  1M1E B;  4CXF A;  2O0Y A;  5J4Y A;  2O03 A;  3HSF A;  4HZF A;  3ML6 A;  2K3P A;  1PP8 F;  1W5S A;  1Z7L A;  1K6O A;  1S29 A;  1S7O A;  4M3B A;  2H6B A;  2Y69 H;  3TGN A;  4FCY A;  1R22 A;  3JW4 A;  3F72 A;  4P5O A;  1YJW I;  3L9F A;  2XF6 A;  1KQ9 A;  5F04 A;  2R7F A;  3WE2 A;  4U7D A;  1UHW A;  1TW2 A;  1LE8 B;  5GAE J;  3J81 K;  5DUI A;  1UJ8 A;  4M3D A;  2JUC A;  4L9V A;  1PDN C;  4W97 A;  5LEJ A;  3C3W A;  2CYY A;  2Y2Z A;  5JI6 A;  1U5T A;  4CZZ A;  1J09 A;  2FOK A;  3E5Q A;  3MKL A;  3K0L A;  5TRD A;  1RIO H;  2X0L A;  3ELK A;  5E1X A;  1TWC J;  2QKL B;  3RTR A;  1FMW A;  3HRT A;  4KN7 X;  3HHH A;  4AWX B;  4RB3 C;  1XDU A;  2KIQ A;  3S1N J;  5EZH A;  4H4K C;  4JOM A;  1HST A;  4QPO A;  2RNJ A;  4DJA A;  4FT8 A;  5H6Q A;  3WTZ A;  4GRI A;  1F9N A;  3FMS A;  1FOW A;  5BQT A;  5KAF C;  1FP2 A;  4M71 A;  2LH9 A;  4O6J A;  1G8X A;  4I01 A;  4I09 A;  5B66 C;  3TDU C;  1R71 A;  2VOD A;  2Y0S A;  1ON1 A;  1JE8 A;  1A36 A;  1MSF C;  1TP4 A;  4U87 A;  3E6D A;  4F3Q A;  3CLQ A;  3PUB A;  1ITY A;  3J80 K;  1R7J A;  3S93 A;  2QGU A;  2K02 A;  3HSE A;  4BS9 A;  4D5F A;  4G7Z F;  4LD5 A;  1HKS A;  3U1D A;  3L2V A;  4LK0 F;  2CU7 A;  1TNT A;  2PEX A;  2CFO A;  3DKW A;  1XMK A;  1XD7 A;  2Q1Z B;  4LG3 A;  1WH5 A;  2VON A;  1XB4 A;  2K5C A;  3D5L A;  5FLV A;  3MZ8 A;  3I3L A;  4X1E A;  1K79 A;  3CME I;  3LSR A;  4UXN A;  2JA8 J;  3DPT A;  1XSX A;  5L3D A;  3M8J A;  4D9J A;  1IRG A;  1HKT A;  2VC0 A;  1TWG J;  2P6S A;  2LY2 A;  1MND A;  4Q5S F;  2BY2 A;  3OYG A;  2M2E A;  5IT9 K;  3I4N J;  1P7J A;  4RAF A;  3BR6 A;  5GAH J;  1SFE A;  2BW3 B;  4OAY A;  1J9I A;  2KIM A;  1ZGW A;  3SYT A;  2E2H J;  3RYP A;  2XPU A;  5HVQ C;  1D0Z A;  4LFU A;  2OC6 A;  3L1P A;  3BG3 A;  1BR4 A;  3BZK A;  5GP9 A;  2ZXH A;  4PFP A;  3OYM A;  3FHZ A;  2FX0 A;  1IW7 F;  2JA2 A;  3IRR A;  1IV6 A;  3ABM H;  1K4T A;  2HEO A;  2ESN A;  3CUQ B;  3OL3 A;  2DPD A;  1VQ7 I;  2BVL A;  4F52 A;  4YEJ A;  3ZMT A;  4CYC B;  3Q0W A;  4L9N A;  4L9J A;  3OWT A;  2QF7 A;  2XVC A;  1QRY A;  5DV5 A;  2R5Z A;  4BDZ A;  3T8R A;  2AO9 A;  4ZYG A;  3L7W A;  3R0A A;  4ITV A;  4IRG A;  3E0J B;  1HOM A;  2Q0O A;  2ZJ2 A;  5D8K B;  2EIK H;  4ZTJ A;  2WB1 N;  2JUG A;  2KRF A;  4ZYH A;  2J5P A;  3OYH A;  4EJO A;  2HKO A;  1JXS A;  2F48 A;  1HSJ A;  1KGS A;  1PVE A;  3BQY A;  4DGW B;  1R23 A;  2IA0 A;  2X6O A;  2QBY A;  4LMY A;  1P4A A;  1MBE A;  1SVM A;  1UG2 A;  3ZN0 A;  1XC5 A;  3CMY A;  1BJZ A;  1OCC H;  1WH7 A;  5GAD J;  2QQ9 A;  2HR3 A;  2V4J C;  4LLG F;  2UXX A;  4LLL A;  3PO2 J;  1IDZ A;  4B1R A;  3O3K A;  2L02 A;  1HW2 A;  1MW7 A;  3HDD A;  1FYK A;  2JA5 J;  1FIP A;  2M5W A;  1HBX G;  2G0E A;  5D5W B;  1L3L A;  3TW7 A;  5HDN A;  2MG4 A;  2GA1 A;  4BYY A;  3HB9 A;  4OU0 A;  5IP7 J;  2M4K A;  3CUO A;  2DFF A;  4MLO A;  3FIW A;  3FXK A;  4XON A;  2MGQ A;  2ISY A;  1YG2 A;  4N9H A;  4A3M J;  3WE3 A;  2XGC A;  4IOA F;  3HSR A;  4IHX A;  1K6Y A;  2DT7 B;  3A02 A;  5GPA A;  4C3I J;  1ORK A;  5AIP A;  4BQQ A;  1T98 A;  1CQT A;  1JT6 A;  1BR1 A;  5K7F A;  2TCT A;  1PUE E;  3LA3 A;  2ZSI B;  3WGH A;  4ENN A;  2GOX B;  3I59 A;  5D6E A;  5E17 F;  4IF4 A;  1QVU A;  2L0K A;  2OAZ A;  4HG2 A;  3S1Q J;  4L5I A;  4BQN A;  4XRM A;  3V42 A;  5ICG A;  5B1B H;  3RKX A;  1MJA A;  5JVG F;  5LHH A;  3E97 A;  2DLL A;  5HNF A;  1GV2 A;  4JYK A;  3FK7 A;  3TW6 A;  1G6N A;  3F8M A;  4OIQ F;  5J8F A;  2AXL A;  2L54 A;  1FBQ A;  2QEN A;  3AFH A;  2RGV A;  5KNL A;  2V1D A;  1RET A;  4RM2 A;  4ON0 A;  3KYL A;  1MH3 A;  2IT0 A;  2EJR A;  4MFD A;  3SDB A;  1W4M A;  1ERD A;  2LNB A;  3F21 A;  1WGX A;  2QBY B;  2H09 A;  1KON A;  4HPQ A;  4DYC A;  4OIP F;  4JQF A;  3CP2 A;  5DTD A;  1OJL A;  3OR2 C;  5BPI A;  5C4X J;  2EZH A;  2GIV A;  4OMY A;  1SD7 A;  3K4C A;  5FD6 A;  1K78 A;  1E0E A;  5EEH A;  3JRF A;  4A0Y A;  2XRL A;  4OAZ A;  3OS2 A;  3L2R A;  2EZI A;  2E71 A;  2E5Z A;  3SZG A;  4CYC A;  3I59 B;  3TOA A;  1TW3 A;  2XGE A;  2FXA A;  1MD0 A;  1OKR A;  2EZL A;  3HGY A;  2E60 A;  2CMP A;  3GO5 A;  1S6L A;  1U5T B;  3GFI A;  3MZY A;  2ZME A;  4TV7 A;  2K9M A;  5D4S A;  5E3O A;  4F7Z A;  2R7R A;  4P9F A;  4U0W A;  3H1C A;  1APL C;  3I53 A;  3CMA I;  2XSD C;  3R0J A;  1T0F A;  3VB2 A;  5FB2 A;  1YJ9 I;  4CHU A;  3AG2 H;  3OYB A;  2ZME B;  2Z33 A;  3EPZ A;  4CO8 A;  2JJ7 A;  4ZDP A;  4F93 B;  4AYB A;  2PMZ A;  4M9X A;  2MFZ A;  5B3S H;  3N4M A;  2STW A;  2L7F P;  1CGP A;  1T39 A;  1Z9C A;  5J1Y A;  5DYM A;  2GA2 A;  2WV1 A;  5LGN A;  1EV7 A;  4HV5 A;  1I6X A;  3FMR A;  5L3G A;  1TC3 C;  2HTS A;  5C4J J;  2RQP A;  5LHI A;  2BEO A;  2OF7 A;  2XAG A;  2W24 A;  1IO2 A;  4EJW A;  2WAE A;  3WU1 B;  1UHS A;  5CVR A;  1YE9 A;  3PNT A;  5C3E J;  4KIC A;  2OD5 A;  2DA5 A;  3OL4 A;  1J5Y A;  1JUP A;  3FHN A;  1T6S A;  2A5W A;  4L5J A;  2A07 F;  2LF8 A;  2DYS H;  2M4G A;  3ZQ7 A;  6PAX A;  1O3S A;  1D8K A;  2OJE D;  1WJE A;  1I27 A;  2GIZ A;  4IHS A;  3M7G A;  5ED4 A;  4BBS J;  2CW0 F;  5F0H A;  1RC9 A;  3QOE A;  3RKW A;  2PQ8 A;  3ABK H;  3MD2 A;  3Q0V A;  4UV8 A;  1WFX A;  2OZU A;  4Y52 J;  1MMG A;  2CUE A;  3BPV A;  5HOD A;  3JTH A;  2ME0 A;  1XS9 A;  2HYF A;  2R5Z B;  2YU3 A;  1AOY A;  5M5W J;  2M45 A;  2DA3 A;  1W0U A;  4MGR A;  1BM9 A;  2RRE A;  3VYU B;  3K4M A;  3O8G A;  1DGW Y;  3LAJ A;  3RQ4 A;  3G1L A;  2X85 A;  2ETH A;  2WAQ N;  1D5Y A;  4I6Z A;  1MBH A;  1FLI A;  1MNM C;  2A05 A;  5GPC A;  1UHM A;  3N97 A;  1S72 I;  2CW7 A;  1KU2 A;  4M72 A;  4E7S A;  5HLT A;  2K27 A;  2E1O A;  3BR1 A;  3OR1 C;  2HYJ A;  1HQC A;  3O6B B;  3R60 A;  4Z2Y A;  1HDP A;  4Y33 A;  2DO7 A;  4NHJ A;  3CC2 I;  3PQJ A;  1H9G A;  2Y0S N;  1NTC A;  3ABL H;  4U0Y A;  1QO0 D;  4G94 A;  1I39 A;  4PK4 A;  4U7B A;  5A2Q Z;  3Q9S A;  2HDC A;  4XRS G;  1W1W E;  1JHF A;  1GXP A;  3EYI A;  1OFC X;  1R4N B;  4RM3 A;  3F23 A;  4KNY A;  1IN4 A;  2YX7 A;  5FKO A;  4IOC F;  2PI0 A;  3UNG C;  2DPU A;  3RPQ A;  3OYL A;  5CVJ A;  2PJP A;  4A3F J;  2M8G X;  4BQO A;  3OYF A;  3ZQF A;  4XRS A;  1ZAO A;  2A5Y B;  1RRJ A;  2V7F A;  4HQM A;  1JJ6 C;  4XKB A;  3E6M A;  5K7Z A;  1WZ2 A;  1JTY A;  3TO9 A;  1Y56 A;  2VT3 A;  2R3S A;  3G1M A;  1OMI A;  3AG1 H;  4BNC A;  1XGM A;  4NQW B;  4Z6Y A;  1X1P A;  1V5E A;  1B4A A;  2VJJ A;  3CCE I;  2KZV A;  2I10 A;  2L3D A;  2KL4 A;  2CUZ A;  2W1O A;  2DOF A;  1AWC A;  1JJ8 C;  1IDY A;  4HF0 A;  4E70 A;  4J01 A;  1H89 C;  1ZR2 A;  4G7O F;  3A0B C;  2MC3 A;  3SZP A;  1IJW C;  1T56 A;  4LIV A;  3CDL A;  2ECC A;  1R49 A;  4BY1 J;  5J1U A;  2JQ7 A;  2KFD A;  4A6E A;  3H9G A;  1JUS A;  1XCV A;  2KP6 A;  1F36 A;  2P5L C;  3BJO A;  4Y3O A;  1ETK A;  4FET A;  3REO A;  3VFZ A;  5JLX A;  1ZKG A;  2NOG A;  4HQE A;  1VND A;  2DW4 A;  1RUO A;  5CQG A;  3S2D J;  4YII A;  2KDZ A;  1GHC A;  1ETX A;  1S7E A;  2LKP A;  4JP0 A;  4R8H A;  4M9S A;  4S0H B;  3D1N I;  3DV8 A;  2R7U A;  4ZTF A;  5CYV A;  3VPR A;  4EM2 A;  2MA3 A;  2OTJ I;  3BT9 A;  3BJA A;  2GQQ A;  3K69 A;  3HGG A;  4C3H J;  2LKX A;  2BZT A;  1MMA A;  2RNG A;  3KP2 A;  2WB1 A;  4MHG A;  2PMZ N;  3HOT A;  2L01 A;  4BXU A;  2QUF A;  3DKX A;  4C30 A;  2X6Y A;  4BGD A;  1IAW A;  1VQ9 I;  1R5H A;  2P0W A;  1YTY A;  2X1E A;  3RI4 A;  2LK2 A;  2V6E A;  4LLN A;  2FBK A;  3BTL A;  2IPQ X;  4I0B A;  3LSK A;  2RAE A;  1G3S A;  1MJB A;  2K9N A;  2JPC A;  3R6S A;  1YIJ I;  1SD4 A;  4W1U A;  2Z9O A;  3R61 A;  2IA2 A;  2HQ5 A;  4DYR A;  4BKX A;  1V3F A;  2E1M B;  4E7J A;  2HTJ A;  3PIP F;  2JSP A;  4AD9 A;  1J2X A;  3GF2 A;  2A68 F;  4P9U A;  3WTT C;  1QA6 A;  4KYW A;  1ODD A;  2XRN A;  2WY8 Q;  1MSE C;  4PSX A;  1MKM A;  2KT0 A;  2ZXI A;  4M9Z A;  4EV0 A;  2HYG D;  4DBR A;  4UNO A;  2EIJ H;  1F4K A;  2H8R A;  3UR3 C;  2FSW A;  2QEX I;  4HEA 2;  5CQE A;  1Y39 A;  1WVR A;  1LDD A;  2L7K A;  4I7H A;  5J40 A;  2L5Q A;  5EEG A;  1IF1 A;  1X3W B;  1V5G A;  2X48 A;  3H35 A;  3R4K A;  2M0C A;  4E6K G;  3HYI A;  2MSY A;  3SFZ A;  3GYH X;  1YIO A;  2LD5 A;  2JZY A;  2MLG A;  1IRF A;  2XV4 S;  3HIF A;  3DBL B;  3WGI A;  2KIF A;  3LQQ A;  1MBJ A;  1LDJ A;  4D0P A;  4M6Y A;  4KMU X;  5B5E C;  2DMU A;  3F8N A;  3HOW J;  2DFE A;  4B09 A;  3GTO J;  4WXD A;  1V5F A;  3MCZ A;  4MFE A;  4P1W A;  2V1X A;  1Q1V A;  4RGS A;  2R7T A;  1B59 A;  5ICC A;  3P9K A;  3HTU A;  4G8X A;  4UVA A;  3T0Y A;  4GCV A;  2XDV A;  1EKE A;  4P96 A;  3W6K B;  4BU2 A;  2Y31 A;  3W6J B;  5LBQ A;  3FKI J;  1LEA A;  3GXO A;  2HGC A;  4XID A;  3JTG A;  2X6W A;  3F6V A;  2BGC A;  1U2W A;  2Q2E B;  2FRH A;  1LUJ B;  2QZ8 A;  3S2W A;  2BXZ A;  4ASN A;  1H0M A;  1HF0 A;  2XUB A;  3K1P A;  3I0T A;  5K5Q A;  4OIR F;  1YYV A;  2K9S A;  4H0E A;  4YFK F;  4NC6 A;  1DU0 A;  2BBY A;  4G12 A;  5DCM A;  1X2M A;  2CFX A;  3B02 A;  5K5R A;  4G9Y A;  3GZN B;  1PUF A;  3SZT A;  4KT6 A;  3QRF F;  1WJF A;  4RA2 A;  5BNG A;  4CGZ A;  3MMY B;  4IHW A;  2VPL A;  1W5C C;  2KRC A;  3LSG A;  3FXR A;  1TQI A;  3LNQ A;  4CCL A;  4XSX F;  4NQW A;  5J8C A;  4KN4 X;  4EJU A;  4RAY A;  2ZFW A;  4B48 A;  1O3T A;  2K4J A;  3LOC A;  3DEW A;  3C2G A;  4ZYE A;  1DDN A;  4MTD A;  1BIB A;  3KCC A;  1EH7 A;  5JHU A;  1VI0 A;  3S3M A;  4ZYD A;  5FGM A;  2K9Q A;  4RMN A;  3TO7 A;  4MEY F;  1QPM A;  2R5Y B;  1K4S A;  2KDO A;  1QPI A;  4FE4 A;  2I8D A;  3S1M J;  1WJD A;  3DTK A;  3RSN A;  5C44 J;  3DBR B;  4DYQ A;  5AON A;  1GUU A;  2XAH A;  2F5D A;  3TP3 A;  3J81 Z;  5E3M A;  2DMT A;  4IZZ A;  2XGD A;  3MN2 A;  3TED A;  1TTY A;  1TBX A;  3HKZ A;  1Y8R B;  2FA5 A;  2CO5 A;  3W2V A;  3CO7 C;  3ULQ B;  9ANT A;  1JTX A;  1W36 D;  5GTI C;  3BDD A;  1OCZ H;  1X1D A;  2DA6 A;  3T5X A;  1ZG3 A;  2DFH A;  4LG0 A;  1G59 A;  5ILS A;  3KZZ A;  1FJL A;  5EF6 A;  2RVC A;  3D0S A;  4HRI A;  3J7Z I;  2O8K A;  2DK5 A;  3F22 A;  2VE9 A;  3E1S A;  2QSG X;  2G7H A;  1ETY A;  3VOD A;  2W4S A;  1Z77 A;  2ZFU A;  1LQ1 A;  5LEK A;  2EFO A;  1VFC A;  1AHD P;  1Z0X A;  2DXI A;  3S2H J;  3HJE A;  2BE5 F;  1J7K A;  1B1B A;  1ZK8 A;  1STZ A;  2Z5U A;  2CSO A;  4E7I A;  1YFH A;  3CC4 I;  4C2T A;  1VQN I;  4A12 A;  4EEF G;  3V4G A;  2UZK A;  1A35 A;  5F64 A;  2AS5 F;  2V6C A;  2FUG 2;  3V8L A;  2ZKZ A;  3GVA A;  3SEZ A;  2HQA A;  1ZG1 A;  2A6T A;  2XAF A;  3K4N A;  5HNH A;  4ENK A;  3S17 J;  2NAZ A;  4IQJ A;  2IGN A;  1LB2 A;  1ZRF A;  3SQN A;  3ZCO A;  3M1E A;  1HKQ A;  1U0J A;  1SAU A;  3OYI A;  3ABT A;  5F1J A;  2ZNY A;  3K6G A;  5HDK A;  2HQN A;  1OIS A;  1D5V A;  4CCK A;  1NG7 A;  1I1G A;  2EK5 A;  1X2N A;  4BAY A;  1N78 A;  2MAB A;  4XMY A;  2KJB A;  3T1B A;  3M4O J;  1XSV A;  3KFW X;  2JMW A;  2VXZ A;  3K10 A;  2E19 A;  2W48 A;  4HX7 A;  2C6Y A;  2DOD A;  1GT0 C;  2YPR A;  1HA8 A;  4XBF A;  4RB2 C;  2KJC A;  5LRR A;  1OLT A;  2M87 A;  4A3L J;  2L9R A;  3H0G J;  5DDG A;  5IOY A;  1U5T C;  4A2U A;  2IEK A;  1SAX A;  3TDZ C;  2A6H F;  1IC8 A;  3KP4 A;  3FXU A;  3FXO A;  3JCU C;  3VOE A;  2NOJ B;  3LSJ A;  2QSH X;  1BA5 A;  1WKM A;  3BOQ A;  5E1Z B;  4CZC A;  5EG0 A;  2GXG A;  2VXD A;  5BS6 A;  1HXD A;  1U9N A;  3PUF A;  4GO1 A;  1BIA A;  3A2K A;  2W7N A;  2L9S A;  3FXQ A;  2WWY A;  2RC4 A;  2W57 A;  3OOP A;  4IO9 F;  1FOK A;  2XKP A;  3ECH A;  3BQZ A;  1UZC A;  2JTV A;  4XOT A;  3GTK J;  4KA4 A;  1P2F A;  1JHH A;  2Y9Y A;  5JFR A;  4FX4 A;  2BV6 A;  4LB5 A;  1LKX A;  4HYE A;  2IBD A;  1YW7 A;  3K9T A;  4PGH A;  2FJ1 A;  2RN7 A;  2QQB A;  1HLV A;  3WTW C;  1KA8 A;  3BCB A;  5FD5 A;  4CIC A;  5M3F J;  4GYG A;  2VUM J;  4CA0 A;  3BR5 A;  3W3C A;  2F4I A;  2HVS A;  3BP8 A;  2BOL A;  4Q48 A;  1ZEL A;  3DU6 A;  3HEF A;  4UVB A;  1OCO H;  3TP0 A;  4HA8 A;  1JI8 A;  1P92 A;  4D7M A;  3BG5 A;  1LDK B;  3IC7 A;  1HDD C;  2EB7 A;  2FEZ A;  3JRE A;  5JHF A;  3E6B A;  3ZGK A;  3RKY A;  1SMT A;  3VWB A;  4ZYA A;  3TQN A;  2R7S A;  4JK1 X;  4RB0 A;  1OR7 C;  2QQA A;  4AIK A;  1XG1 A;  1FBU A;  5BOX A;  3BR2 A;  3V7S A;  3KP6 A;  1X1C A;  4MEX F;  1A5J A;  4BQA A;  5CKT A;  3N05 A;  3HKZ N;  4PJJ A;  2VBW A;  4AVZ A;  2OV7 A;  3AL0 C;  4I02 A;  3E5U A;  5E20 A;  5J3L A;  2ZB9 A;  3HBL A;  3MWM A;  3QAH A;  1FOX A;  4WX9 A;  1WJB A;  2EV6 A;  1BI2 A;  3OYJ A;  2LBF A;  2V1N A;  1TQM A;  1DU6 A;  1X19 A;  4FAS D;  2ZXJ A;  4HAM A;  3L2C A;  4BHC A;  5J4V A;  1ZRE A;  2F5E A;  1KYW A;  2P4W A;  2CG4 A;  3GTJ J;  3BCA A;  1KZH A;  2A69 F;  4MIM A;  1IGN A;  3CZ6 A;  2R92 J;  2K9L A;  3FDY A;  2M34 A;  1TT0 A;  2F6C A;  1WCM J;  3IL2 A;  1IV8 A;  1YI2 I;  3K7A J;  1ACI A;  3FXJ A;  3HOV J;  2BY3 A;  3EDP A;  4C3J J;  1DQU A;  5D5V B;  3ASO H;  1WJA A;  4P55 A;  3FXL A;  4FX0 A;  5LD2 C;  5K7H A;  3LSM A;  3WTY C;  2V9K A;  1LVA A;  2ID3 A;  4IHY A;  2OTL I;  2X1C A;  4RAZ A;  2LOO A;  2DMQ A;  1YW9 A;  2B9S A;  1MNE A;  4C2M J;  3H9J A;  4I0A A;  2NVT J;  1UG0 A;  3LSI A;  3HM5 A;  1HCR A;  5GAG J;  2QKM B;  3ZR8 X;  4A3D J;  3GX4 X;  3TO6 A;  2HI3 A;  4Y17 A;  4V19 K;  4DZJ A;  1I5Z A;  2LTP A;  1YIT I;  3QP6 A;  4PJM A;  2VKV A;  4HNT A;  2BW3 A;  3FBN B;  2AXT C;  3V7C A;  3DBH B;  2DDB A;  4IPA A;  4N0B A;  1XCB A;  4B3A A;  4OIN F;  2JRT A;  3OIO A;  4PZJ A;  5FKM A;  4Y4R A;  1Z67 A;  3PSF A;  1QHH D;  1TNS A;  2IGK A;  1Z05 A;  3QYB A;  4O5V A;  1UST A;  2IA1 A;  2LC2 A;  1ETQ A;  2VJI A;  2E1C A;  1RKW A;  4Y13 A;  3HHG A;  2VKD A;  3CES A;  1BOB A;  3F8C A;  2CW8 A;  3OYK A;  3K70 C;  1JKQ C;  3LWF A;  1C0W A;  2E5N A;  5EJC A;  3DKY A;  2CQK A;  1I3Q J;  1TWA J;  1L0O C;  1ON2 A;  2KMU A;  5CLS A;  3GZ6 A;  1VQO I;  2D1V A;  2LG4 A;  4GDF A;  3JSO A;  3QPH A;  3CJR B;  3HPG A;  4LB6 B;  2GOM A;  5DD8 A;  5ICE A;  3FX3 A;  3M8E A;  5DCM B;  4ABZ A;  3CCY A;  3PM1 A;  1B8I B;  4KIF A;  4BE0 A;  1MDM B;  1ZLJ A;  4XLF A;  4M3E A;  5A2Q K;  3ZQI A;  2JWT A;  2OCE A;  1GV5 A;  3M1C A;  4WK8 F;  1OCP A;  1BW6 A;  2B7E A;  5H2F C;  3RKQ A;  2CQ7 A;  4YIF A;  2VOP A;  2XF5 A;  1QHG A;  4BXF A;  4Y7N J;  2EIL H;  4FHT A;  1K78 B;  4XOR A;  3VDX A;  4KMF A;  2ELK A;  1SMY F;  4XN0 A;  2Q8K A;  2FD5 A;  3CD6 I;  4WWC A;  4DOZ A;  5M5Y J;  4UY8 I;  4ETS A;  3SFI A;  4E7L A;  2VQL A;  3KX2 A;  2M7B A;  2XAJ A;  1Q1H A;  5ERI A;  2UWM A;  1O57 A;  2FQ3 A;  4IVN A;  4M74 A;  4WXC A;  4YIR X;  1DPU A;  2LY1 A;  4BJ5 C;  1X3U A;  2TDX A;  2Z2S B;  3OV8 A;  4XL9 A;  4J19 A;  3ZN1 A;  3OYE A;  1REP C;  1R58 A;  2XF7 A;  2KRH A;  4PJN A;  1X4O A;  5LGT A;  3ZQQ A;  3PIO F;  3VYR B;  1NK2 P;  4XR6 A;  1BI3 A;  1LNW A;  5GTH C;  4XOP A;  2EA2 A;  2E2J J;  3GTM J;  3LAP A;  1JGG A;  2CV0 A;  3K1M A;  1QNT A;  4XLH A;  4A3B J;  4GYI A;  2D45 A;  3BG7 A;  5D4R A;  2Z99 A;  1Y6I A;  3RCO A;  2R7D A;  2NRA C;  3U1K A;  2FML A;  2N8G A;  3F9K A;  1SVO A;  3E6C C;  3I4M J;  3CCS I;  1WI9 A;  1IUF A;  1BL0 A;  3HC7 A;  2M8E A;  5HOO A;  1TQP A;  1WJ5 A;  3DWL E;  2XAU A;  1W36 C;  3ZMS A;  3FM5 A;  4DZP A;  2Y75 A;  2HDD A;  2H8W A;  2YR2 A;  1MDM A;  4EM0 B;  3AG4 H;  2DU9 A;  4ZDL A;  3S1R J;  4MQ9 F;  5E1W A;  4QLC U;  3CCU I;  1SFU A;  1YJN I;  1BN5 A;  3GTQ J;  1ZLK A;  4QPQ A;  4D1Q A;  2ZJR F;  3RJP A;  4G7H F;  3NEU A;  3C2H A;  1XN7 A;  3MAJ A;  1IXC A;  2LRE A;  4MO7 A;  3QPT A;  2GZW A;  2E7X A;  2F4O B;  3IUO A;  4ZC3 A;  3AKZ A;  1U9O A;  2JVG A;  2OU2 A;  4LOC A;  5CPR B;  3JR9 A;  4XLE A;  4AM3 A;  4N9I A;  3H3Z A;  1S7A A;  5F0C A;  2ZME C;  2PLY A;  4L0Y B;  2XAQ A;  3HXL A;  3HL2 A;  4M73 A;  1A6I A;  2XB5 A;  3WTU C;  2JT1 A;  4HW0 A;  3MZH A;  1W5T A;  1NH3 A;  2WA0 A;  2X6X A;  3LA2 A;  1ZRC A;  3ERE D;  3GFJ A;  2M7A A;  4UUS B;  1RR7 A;  4XN3 A;  3CF2 A;  3DP7 A;  1VQ6 I;  3H5N A;  1QZY A;  2VQH A;  4KFC A;  2WTE A;  1ETO A;  1FZP B;  4C2U A;  3B73 A;  2HZT A;  3F0C A;  3ISP A;  3EQL F;  2PX9 A; 
#chains in the Genus database with same CATH homology
 3EET A;  5FLX K;  3I64 A;  1UCR A;  3QU3 A;  5L3B A;  1DP7 P;  4ENJ A;  2KKO A;  4WF2 A;  4RGU A;  1IXS B;  2IJL A;  2JSC A;  3K2Z A;  2K4B A;  3MEX A;  3GW2 A;  3KZY A;  2H27 A;  3K1N A;  1QGP A;  2EV5 A;  4B8X A;  1IZ1 A;  1FX7 A;  2OBP A;  2DFI A;  3KP5 A;  2DT5 A;  4A0Z A;  1CF7 A;  1OR7 A;  2HOE A;  5ILU A;  1ZAR A;  2P8T A;  3PQK A;  2HQR A;  2Y48 A;  3ECO A;  3V8K A;  3TOB A;  3MFK A;  2OQR A;  2VOO A;  1FPQ A;  3GFM A;  2OZ6 A;  2ISZ A;  2O6G E;  2ESH A;  3WTV C;  5TJJ A;  3I54 A;  5HS8 A;  1BBY A;  1K7A A;  1BC8 C;  5ILV A;  1OYI A;  4IXA A;  4A5M A;  2P5V A;  1UB9 A;  5CVV A;  4ENM A;  3JSP A;  2DQR A;  4UHT A;  3KEO A;  3C1D A;  2EFP A;  4EVI A;  2MH9 A;  3PFI A;  2QM3 A;  4XLP F;  5AIQ A;  3F8B A;  4KDP A;  1Z91 A;  2B0L A;  4EMS A;  4HX4 A;  1MZB A;  2ZBK A;  1R1U A;  1I1S A;  1KQ8 A;  3P7N A;  1J75 A;  4DNC A;  3GLX A;  3JAM K;  1YLF A;  5DCF A;  1ZGJ A;  1IN5 A;  3I58 A;  2X4H A;  2H94 A;  2STT A;  1P4X A;  4R79 A;  1FC3 A;  1W7P A;  3U9G A;  5BPD A;  4L18 B;  1Z1D A;  1ZHF A;  4U0V A;  1WRJ A;  3LFK A;  1JGS A;  4HX8 A;  1HW5 A;  4HLY A;  3WG9 A;  5LHG A;  3HTS B;  5E18 F;  1FYM A;  2VN2 A;  2H6C A;  4MQV A;  1ZYR F;  1FNN A;  1FT9 A;  2M1B A;  3KET A;  1QZZ A;  4KIB A;  5H20 A;  2L4M A;  3BJ6 A;  1T38 A;  2P5K A;  2FBI A;  2FNP A;  2VT2 A;  3DQV C;  3CUQ A;  2FNA A;  4UV9 A;  3V7R A;  2G9W A;  4NB5 A;  4HF2 A;  1QQI A;  2V9V A;  3GEZ A;  2VBX A;  5HDG A;  2FBH A;  2PMH A;  1IXR C;  4G6D A;  1ZN2 A;  2CGP A;  4AIH A;  3RPU A;  1U3E M;  2NNN A;  1IUY A;  5CVU A;  5H6R A;  5L3F A;  3IRQ A;  2DQL A;  3ZPL A;  2JPB A;  1Y0U A;  3KE2 A;  2XGX A;  4WCG A;  1P4W A;  4GGG A;  4R1H A;  5KVR A;  2MD5 A;  3CTA A;  2E7W A;  4M6X A;  1B6A A;  1B9N A;  4A6D A;  5JR3 A;  1ZH5 A;  2P7V B;  1GXQ A;  3COA C;  3F8F A;  3WTX C;  1LEB A;  4IRI A;  5L3C A;  4EJV A;  1ZRD A;  2EWN A;  2XHK A;  4ESB A;  1WSU A;  1FY7 A;  3WGG A;  5KK1 A;  5CJ9 A;  4HOB A;  1FSE A;  3ZMU A;  3DEU A;  5E8G A;  3P9I A;  1SFX A;  1XGS A;  1U78 A;  1MJ9 A;  5L3E A;  2LDU A;  4EGZ A;  1F5T A;  1U8R A;  2DAO A;  1Z6R A;  3WU0 A;  2A3S A;  4I2O A;  3CUQ C;  3GZ5 A;  3FM3 A;  2W25 A;  2P7C B;  5LGU A;  2A61 A;  3GWZ A;  1XMA A;  2V1U A;  4HDV A;  2EA4 A;  2HKX A;  3I71 A;  3FZV A;  3DPL C;  4KUM A;  2EFW A;  1FP1 D;  3G73 A;  2ZCW A;  4L9T A;  1KU7 A;  4AIJ A;  2DBB A;  3FMQ A;  4MTE A;  2FU4 A;  5F6F A;  2XIG A;  2O61 A;  1F1Z A;  4RGR A;  4LGW A;  3ROU A;  3KP3 A;  1FSH A;  1KYZ A;  5IT3 A;  4HV6 A;  1BJA A;  3CLO A;  2K86 A;  4IHT A;  1P6R A;  1WQ2 A;  1E17 A;  3DF8 A;  4PDK A;  4OMZ A;  4ZZL A;  4RS8 A;  5HLH A;  3H3U A;  5D5X B;  3BPX A;  2IW5 A;  2PG4 A;  5JVT A;  2K7L A;  1PP7 U;  1DPR A;  4HDU A;  3CO6 C;  1NHA A;  3Q9V A;  3LQR A;  2HS5 A;  1SD6 A;  2PN6 A;  2YSR A;  1A04 A;  5DUK A;  1O7F A;  1J59 A;  4YFN F;  2NYX A;  2V79 A;  1EH6 A;  3RYR A;  4U88 A;  1BI1 A;  5BMZ A;  2F5F A;  3ZMD A;  2FMY A;  2EV0 A;  4OIO F;  3WOD F;  3DFG A;  2XRO A;  5DEQ A;  3BRO A;  2VBY A;  3QOP A;  3ZMV A;  3EUH A;  3NRV A;  1W7P B;  2MBF A;  3L09 A;  3BWG A;  2FF4 A;  1XGN A;  3M9A A;  2PBI A;  2EFQ A;  4Q4Z F;  1G3Y A;  3J7A O;  3M8F A;  3E3V A;  4XRF A;  2OQG A;  2D2W A;  4S04 A;  4LJZ F;  2BYV E;  2W84 A;  3QP5 A;  4XLN F;  1EH8 A;  3LST A;  5D6F A;  2DI3 A;  1W7P D;  1OYY A;  4EGY A;  5FFX A;  3HOS A;  4RB1 A;  3KP7 A;  2ZO4 A;  5J6X A;  4XSZ F;  3IWF A;  1T2K A;  1SD5 A;  4CDG A;  1DUX C;  2G7U A;  4HF1 A;  5D5U B;  4EM1 A;  3P9C A;  1KU3 A;  1FBS A;  1B9M A;  1BOA A;  1YO5 C;  1YS6 A;  1GVJ A;  2HWV A;  3CDH A;  5HS9 A;  3KLN A;  4KIG A;  2M30 A;  2LF7 A;  1V4R A;  1Z7U A;  4G6Q A;  1IN8 A;  1XSD A;  3F3X A;  4EQQ A;  1YS7 A;  3IHU A;  4PGG A;  3RDI A;  2GXB A;  4AVP A;  1UFM A;  2RDP A;  2COM A;  2W85 A;  1BC7 C;  2VE8 A;  2E1N A;  1RI7 A;  1CF7 B;  2J5O A;  1XDS A;  1O3R A;  4I98 B;  1BI0 A;  2LSO A;  4IRH A;  2D1H A;  2ELH A;  1RNL A;  2O3F A;  1YQA A;  4Q47 A;  3HRU A;  1OYW A;  3VEP A;  1WWX A;  1H9T A;  2CWE A;  3FWE A;  2PMU A;  2XKO A;  1HW1 A;  2GWR A;  3Q5F A;  3I5U A;  2IVM A;  2WC2 A;  2VC1 A;  3EYY A;  1LJ9 A;  3L00 A;  2YX4 A;  2Q2E A;  1R00 A;  3RIR A;  4LK1 F;  1IN6 A;  3O2P E;  2IP2 A;  2QVO A;  3SXY A;  4KT5 C;  4BHP A;  4UUV A;  5E8I A;  2UXN A;  1R1V A;  2QYO A;  3F6O A;  3KEQ A;  1U6G A;  1MGT A;  2F5C A;  4S05 A;  2IRF G;  2RV8 A;  2PFB A;  5LLQ A;  4ESF A;  4LG0 B;  3TKY A;  2RKH A;  3C7J A;  1R5G A;  1TLH B;  4A0X A;  5DD4 A;  4JBA A;  1QBJ A;  2WV0 A;  3HRS A;  1ONV A;  3NQO A;  5F1R A;  1R36 A;  2ZNZ A;  3ZMZ A;  3GUD A;  1VTN C;  1S8N A;  5HLG A;  3IKT A;  1ULY A;  5LRS A;  2KIU A;  1OPC A;  4UVC A;  3CJN A;  4BH9 A;  2QWW A;  4L0Z B;  3AAF A;  4A5N A;  1R1T A;  1E2X A;  4YFX F;  2ACJ A;  1J0R A;  2NS0 A;  3J80 Z;  4PCQ A;  3JAM Z;  4CYD A;  1D8J A;  1YW8 A;  2FE3 A;  3LA7 A;  3HUG A;  5FLX Z;  1S3J A;  3U2R A;  3BZ6 A;  2Y0M A;  1KU9 A;  2DTR A;  2OA4 A;  3HRM A;  4BHB A;  3IWZ A;  4ZZD A;  1USS A;  2ADU A;  4EJT A;  3C18 A;  3WTS C;  5IT9 Z;  1FYL A;  2MLK A;  2A6E F;  3E5X A;  3GFL A;  5FFZ A;  2GAU A;  3KLO A;  3SHF A;  4DQ2 A;  4O3M A;  4ZH4 F;  4HLX A;  3IKV A;  1G4D A;  4YG2 F;  2HFH A;  2XAS A;  4MNU A;  5CVI A;  1KQ0 A;  5K5O A;  1RZ4 A;  2VBZ A;  1D3Y A;  2EFN A;  4OOI A;  2MH2 A;  3MQ0 A;  1XGO A;  3ZP5 A;  2F2E A;  2P6T A;  2O8X A;  5FO5 A;  2NNY A;  3V8J A;  3I4P A;  1Z6T A;  2Z3Y A;  3FF5 A;  1RUN A;  1IN7 A;  4RGX A;  4HBL A;  1O7L A;  4K2E A;  3T8T A;  3ABU A;  3DXJ F;  2DK8 A;  2QLZ A;  1FWZ A;  3QU6 A;  3BY6 A;  1G3W A;  5HS7 A;  4Y15 A;  4GXO A;  4ESJ A;  3G3Z A;  4WXH A;  2L4A A;  5K1Y A;  4IJA A;  5D8L B;  4QWQ A;  1O3Q A;  1ZGA A;  3H92 A;  1G3T A;  1ZG5 A;  5ICF A;  5HLI A;  4CXF A;  2O0Y A;  2O03 A;  3HSF A;  4HZF A;  3ML6 A;  1PP8 F;  1W5S A;  1K6O A;  1S29 A;  1S7O A;  2H6B A;  3TGN A;  1R22 A;  3JW4 A;  3F72 A;  4P5O A;  3L9F A;  1KQ9 A;  2R7F A;  3WE2 A;  4U7D A;  1UHW A;  1TW2 A;  3J81 K;  5DUI A;  4L9V A;  1PDN C;  5LEJ A;  3C3W A;  2CYY A;  5JI6 A;  1U5T A;  4CZZ A;  2FOK A;  3E5Q A;  3K0L A;  5TRD A;  1RIO H;  2X0L A;  3ELK A;  5E1X A;  3RTR A;  3HRT A;  4KN7 X;  3HHH A;  4AWX B;  4RB3 C;  1XDU A;  1HST A;  2RNJ A;  4FT8 A;  3WTZ A;  5H6Q A;  1F9N A;  3FMS A;  5BQT A;  1FP2 A;  4M71 A;  4O6J A;  4I01 A;  4I09 A;  3TDU C;  2VOD A;  1ON1 A;  1JE8 A;  3E6D A;  3J80 K;  1R7J A;  3HSE A;  2K02 A;  4G7Z F;  4LD5 A;  1HKS A;  3U1D A;  4LK0 F;  1TNT A;  2PEX A;  3DKW A;  1XMK A;  1XD7 A;  2VON A;  1XB4 A;  3D5L A;  1K79 A;  4UXN A;  3DPT A;  1XSX A;  5L3D A;  1IRG A;  1HKT A;  2VC0 A;  2P6S A;  4Q5S F;  5IT9 K;  1SFE A;  1J9I A;  2KIM A;  3RYP A;  5HVQ C;  4LFU A;  3FHZ A;  1IW7 F;  3IRR A;  2HEO A;  2ESN A;  3CUQ B;  2DPD A;  3ZMT A;  4L9N A;  4L9J A;  2XVC A;  5DV5 A;  3T8R A;  4ZYG A;  3L7W A;  3R0A A;  4IRG A;  2Q0O A;  2ZJ2 A;  5D8K B;  2KRF A;  4ZYH A;  2J5P A;  4EJO A;  2HKO A;  1JXS A;  1HSJ A;  1KGS A;  1R23 A;  2IA0 A;  2QBY A;  4LMY A;  1P4A A;  3ZN0 A;  2QQ9 A;  2HR3 A;  4LLG F;  2UXX A;  4LLL A;  3O3K A;  2L02 A;  1HW2 A;  1FYK A;  2M5W A;  1HBX G;  5D5W B;  1L3L A;  5HDN A;  2GA1 A;  4BYY A;  4OU0 A;  3CUO A;  2ISY A;  1YG2 A;  4N9H A;  3WE3 A;  3HSR A;  5AIP A;  1T98 A;  1PUE E;  3LA3 A;  3WGH A;  4ENN A;  3I59 A;  5D6E A;  5E17 F;  4IF4 A;  2OAZ A;  4L5I A;  5ICG A;  3RKX A;  1MJA A;  5LHH A;  3E97 A;  2DLL A;  1G6N A;  3F8M A;  4OIQ F;  5J8F A;  2AXL A;  2L54 A;  1FBQ A;  2QEN A;  2RGV A;  2V1D A;  4ON0 A;  2IT0 A;  2EJR A;  1W4M A;  2LNB A;  3F21 A;  2QBY B;  2H09 A;  4OIP F;  4JQF A;  5BPI A;  2GIV A;  4OMY A;  1SD7 A;  5FD6 A;  1K78 A;  5EEH A;  4A0Y A;  3I59 B;  3TOA A;  1TW3 A;  2FXA A;  1MD0 A;  1OKR A;  3GO5 A;  1S6L A;  1U5T B;  3GFI A;  3MZY A;  2ZME A;  4TV7 A;  5D4S A;  4F7Z A;  4P9F A;  4U0W A;  3I53 A;  3R0J A;  1T0F A;  3VB2 A;  5FB2 A;  4CHU A;  2ZME B;  2Z33 A;  4CO8 A;  4M9X A;  3N4M A;  2STW A;  1CGP A;  1T39 A;  1Z9C A;  5DYM A;  2GA2 A;  5LGN A;  1EV7 A;  4HV5 A;  1I6X A;  3FMR A;  5L3G A;  2HTS A;  2RQP A;  5LHI A;  2BEO A;  2XAG A;  2W24 A;  4EJW A;  3WU1 B;  5CVR A;  4KIC A;  2OD5 A;  1J5Y A;  1T6S A;  4L5J A;  2A07 F;  2LF8 A;  3ZQ7 A;  6PAX A;  1O3S A;  1D8K A;  1I27 A;  4IHS A;  3M7G A;  5ED4 A;  2CW0 F;  3RKW A;  2PQ8 A;  4UV8 A;  2OZU A;  3BPV A;  3JTH A;  2HYF A;  2YU3 A;  1AOY A;  2M45 A;  4MGR A;  1BM9 A;  3LAJ A;  2ETH A;  1FLI A;  1UHM A;  3N97 A;  1KU2 A;  4M72 A;  2K27 A;  1HQC A;  3O6B B;  3R60 A;  4Z2Y A;  2DO7 A;  4NHJ A;  3PQJ A;  1H9G A;  4U0Y A;  1QO0 D;  4G94 A;  4U7B A;  5A2Q Z;  3Q9S A;  2HDC A;  1JHF A;  1GXP A;  3EYI A;  3F23 A;  4KNY A;  1IN4 A;  2YX7 A;  2PI0 A;  2DPU A;  3RPQ A;  5CVJ A;  2PJP A;  1ZAO A;  2A5Y B;  4HQM A;  3E6M A;  3TO9 A;  2VT3 A;  2R3S A;  1OMI A;  4BNC A;  1XGM A;  1B4A A;  2L3D A;  1AWC A;  4HF0 A;  4E70 A;  4G7O F;  2MC3 A;  3SZP A;  4A6E A;  1XCV A;  2P5L C;  3BJO A;  3REO A;  3VFZ A;  4HQE A;  2DW4 A;  1RUO A;  4YII A;  1GHC A;  2LKP A;  4R8H A;  4M9S A;  3DV8 A;  5CYV A;  4EM2 A;  2MA3 A;  3BJA A;  2GQQ A;  3K69 A;  3KP2 A;  3HOT A;  4MHG A;  2L01 A;  4BXU A;  2QUF A;  1IAW A;  1R5H A;  1YTY A;  3RI4 A;  4LLN A;  2FBK A;  2IPQ X;  4I0B A;  1G3S A;  1MJB A;  3R6S A;  2JPC A;  2Z9O A;  1SD4 A;  3R61 A;  2IA2 A;  1V3F A;  2HTJ A;  4KYW A;  4AD9 A;  1J2X A;  3GF2 A;  2A68 F;  4P9U A;  3WTT C;  1ODD A;  2XRN A;  1MKM A;  4EV0 A;  4M9Z A;  2HYG D;  4UNO A;  1F4K A;  2FSW A;  1LDD A;  4I7H A;  5EEG A;  1IF1 A;  3R4K A;  3HYI A;  3SFZ A;  3GYH X;  1YIO A;  2JZY A;  2MLG A;  1IRF A;  3WGI A;  2XV4 S;  3HIF A;  2KIF A;  3LQQ A;  1LDJ A;  4D0P A;  4M6Y A;  4KMU X;  3F8N A;  4B09 A;  4WXD A;  3MCZ A;  2V1X A;  4RGS A;  1B59 A;  5ICC A;  3P9K A;  3HTU A;  4G8X A;  4UVA A;  3T0Y A;  4GCV A;  4P96 A;  3W6K B;  3W6J B;  5LBQ A;  1LEA A;  3GXO A;  2HGC A;  3JTG A;  3F6V A;  2BGC A;  1U2W A;  2FRH A;  2QZ8 A;  3S2W A;  4ASN A;  1H0M A;  2XUB A;  3K1P A;  3I0T A;  5K5Q A;  4OIR F;  1YYV A;  4H0E A;  4YFK F;  2BBY A;  5DCM A;  2CFX A;  3B02 A;  5K5R A;  4G9Y A;  3SZT A;  3QRF F;  4CGZ A;  3FXR A;  1TQI A;  4XSX F;  4NQW A;  5J8C A;  4KN4 X;  4EJU A;  4RAY A;  2ZFW A;  1O3T A;  2K4J A;  4ZYE A;  1DDN A;  4MTD A;  1BIB A;  3KCC A;  1EH7 A;  5JHU A;  4ZYD A;  5FGM A;  3TO7 A;  4MEY F;  1QPM A;  5AON A;  2XAH A;  2F5D A;  3J81 Z;  1TTY A;  1TBX A;  2FA5 A;  3CO7 C;  2CO5 A;  3ULQ B;  3BDD A;  3T5X A;  1ZG3 A;  4LG0 A;  5ILS A;  3KZZ A;  2RVC A;  3D0S A;  2DK5 A;  3F22 A;  2VE9 A;  2G7H A;  3VOD A;  1LQ1 A;  5LEK A;  2EFO A;  2BE5 F;  1J7K A;  1B1B A;  2Z5U A;  1STZ A;  2CSO A;  1YFH A;  4A12 A;  3V4G A;  2UZK A;  2AS5 F;  5F64 A;  2V6C A;  3V8L A;  2ZKZ A;  3GVA A;  1ZG1 A;  2XAF A;  4ENK A;  2NAZ A;  1LB2 A;  1ZRF A;  3SQN A;  3M1E A;  1HKQ A;  3ABT A;  2ZNY A;  5HDK A;  2HQN A;  1D5V A;  1I1G A;  2EK5 A;  4BAY A;  2KJB A;  3T1B A;  1XSV A;  3KFW X;  2VXZ A;  4HX7 A;  2C6Y A;  2YPR A;  4XBF A;  4RB2 C;  2KJC A;  5LRR A;  2M87 A;  5DDG A;  1U5T C;  4A2U A;  1SAX A;  3TDZ C;  2A6H F;  3KP4 A;  3FXU A;  3VOE A;  1WKM A;  3BOQ A;  5E1Z B;  2GXG A;  5BS6 A;  1HXD A;  4GO1 A;  1BIA A;  3FXQ A;  2WWY A;  2RC4 A;  2W57 A;  3OOP A;  1FOK A;  2XKP A;  3ECH A;  2JTV A;  4KA4 A;  1P2F A;  1JHH A;  5JFR A;  4FX4 A;  2BV6 A;  4LB5 A;  4HYE A;  1YW7 A;  3K9T A;  4PGH A;  2RN7 A;  2QQB A;  3WTW C;  1KA8 A;  5FD5 A;  4CIC A;  4GYG A;  3BP8 A;  4Q48 A;  4UVB A;  4HA8 A;  1P92 A;  1LDK B;  3IC7 A;  2EB7 A;  2FEZ A;  3E6B A;  3RKY A;  1SMT A;  3TQN A;  4JK1 X;  4RB0 A;  2QQA A;  4AIK A;  1FBU A;  5BOX A;  3V7S A;  3KP6 A;  4MEX F;  4BQA A;  2VBW A;  4I02 A;  3E5U A;  5E20 A;  3MWM A;  3QAH A;  4WX9 A;  2EV6 A;  1BI2 A;  1TQM A;  2ZXJ A;  3L2C A;  4HAM A;  4BHC A;  1ZRE A;  2F5E A;  1KYW A;  2P4W A;  2CG4 A;  2A69 F;  3IL2 A;  3EDP A;  5D5V B;  4P55 A;  4FX0 A;  3WTY C;  1LVA A;  4RAZ A;  1YW9 A;  4I0A A;  3GX4 X;  3TO6 A;  4Y17 A;  1I5Z A;  3QP6 A;  3V7C A;  4IPA A;  4N0B A;  1XCB A;  4OIN F;  2JRT A;  4PZJ A;  1TNS A;  1Z05 A;  4O5V A;  1UST A;  2IA1 A;  2E1C A;  4Y13 A;  3HHG A;  3F8C A;  3LWF A;  1C0W A;  2CQK A;  1L0O C;  1ON2 A;  5CLS A;  3GZ6 A;  2D1V A;  3JSO A;  3QPH A;  4LB6 B;  5DD8 A;  5ICE A;  3FX3 A;  3M8E A;  5DCM B;  4KIF A;  1MDM B;  1ZLJ A;  5A2Q K;  4WK8 F;  4YIF A;  2VOP A;  4FHT A;  1K78 B;  4KMF A;  1SMY F;  2Q8K A;  4WWC A;  4ETS A;  2XAJ A;  1Q1H A;  5ERI A;  2UWM A;  1O57 A;  2FQ3 A;  4IVN A;  4M74 A;  4WXC A;  1DPU A;  1X3U A;  2TDX A;  3OV8 A;  3ZN1 A;  1REP C;  1R58 A;  5LGT A;  1BI3 A;  1LNW A;  2EA2 A;  3LAP A;  3K1M A;  1QNT A;  4GYI A;  2D45 A;  5D4R A;  2Z99 A;  2R7D A;  2NRA C;  2FML A;  3E6C C;  1WI9 A;  5HOO A;  2M8E A;  1TQP A;  3ZMS A;  3FM5 A;  2Y75 A;  2YR2 A;  1MDM A;  4EM0 B;  2DU9 A;  4MQ9 F;  5E1W A;  4QLC U;  1SFU A;  1BN5 A;  1ZLK A;  3RJP A;  4G7H F;  3NEU A;  3MAJ A;  1XN7 A;  1IXC A;  3QPT A;  2GZW A;  2E7X A;  2OU2 A;  4N9I A;  3H3Z A;  1S7A A;  2PLY A;  4L0Y B;  2XAQ A;  4M73 A;  3WTU C;  2JT1 A;  4HW0 A;  3MZH A;  1W5T A;  3LA2 A;  1ZRC A;  3ERE D;  3GFJ A;  3DP7 A;  1QZY A;  4KFC A;  2WTE A;  1FZP B;  3B73 A;  2HZT A;  3ISP A;  3EQL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...