4AIIA

Crystal structure of the rat rem2 gtpase - g domain bound to gdp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
144
Chain Sequence
DGVFKVMLLGESGVGKSTLAGTFGDTYERRIMVDKEEVTLIVYDDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN REM 2
publication title Structure of the Gdp-Bound G Domain of the Rgk Protein Rem2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Gtp-binding protein
total genus 51
structure length 144
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4aiiA00
3PUXA 4UNQA 4HAXA 1LS6A 3OHMA 3RC8A 4NDZA 2W83A 5DI9A 1L4YA 2ZRGA 3DZDA 2ORWA 3BGWA 3ZYCA 2ZE5A 4JL6A 5E4FA 5HCNA 1SHKA 4TT3A 3MMPA 4OQMA 3T5GA 1TEXA 2KE5A 4C3ZA 4QBIA 1LY1A 2VO1A 4ZO4A 1ZD1A 3H86A 5FL7A 4D4LA 1E9DA 4DRZA 3KFXA 4EAQA 4NL4H 2GXQA 1OSNA 2CLSA 1MR3F 5FTJA 1IQPA 4I1VA 2PX3A 3NBZC 4FXPA 2BEKA 4I1UA 1II0A 2PX0A 2AL7A 5B30A 2C96A 4PO1A 2X77A 4TLAA 5H68A 1F2UA 2CE7A 1FMJA 1CR1A 2D2FA 4EPVA 5JCPA 3K0EA 3FKQA 1UDXA 2N46A 1FX0A 2ZI6A 1HE1C 4HLDA 1BMFA 3SYKA 4YXWD 1U0LA 1KJWA 4BASA 2GJKA 5CYOA 2QBYB 1ZJ6A 621PA 1HV8A 5A5GA 4TMWA 1DAFA 3A8TA 3NC1C 3QE0A 5EUMA 3ZZUA 2NO7A 5IHPA 1JECA 4TYQA 2Q9CA 3NWJA 2ZRDA 2V54A 4GNKA 4YONB 4F92B 1X8KA 4V0KA 2FMXA 1GTVA 2WKPA 1II8B 3L0PA 2W6ID 4KV9A 1XD2A 3A1TA 1DVRA 2OBMA 2JJ1A 2O8DB 2D7DA 3AVUA 2V9PA 3QXSA 1G4UR 1L2TA 4I99A 3X1DA 1CEEA 4KFTA 1NVUQ 5KSPA 4XTRA 2CK3D 1IN4A 1SVOA 3K0CC 4C0BA 1TQ4A 5AUOB 4ZIRA 4MGZR 5LB2A 2P0EA 2BMEA 4P4SB 3WMGA 1Z29A 2OFWA 3THXB 4D25A 2XOKD 1K8RA 4NYMQ 4KBFA 1CR2A 1RFLA 1JQLB 4IJMA 3CF2A 3RS5A 3OE7A 4DEXA 3NG1A 4IDNA 2KJQA 1SVLA 5FUXA 2QGNA 4E07A 1RPZA 1T6NA 1SXJA 2EFCB 2ATVA 2HLDD 1OH8A 4JZKA 3ADKA 3T1TA 4LYFA 2ZUDA 3DEFA 2V1XA 4UXJA 4MGIR 3HYRA 1YZTA 2ONJA 2FFHA 1A82A 1A7JA 1P2TA 2G0TA 2D7CA 2QTFA 4YDSA 4IHQA 1CRQA 4PZLA 1HE8B 4TSFA 1RRFA 1ZINA 3D31A 1NBMA 4NH0A 3CPEA 3EAQA 1Y3AA 2IS4A 4QG7A 1OIXA 3P4XA 2GF0A 3W3AA 2FA9A 5BW8A 1MO5A 2AK2A 2O8CA 3IILA 1XMVA 4HB0A 2GXAA 2G1JA 2EFHB 2A5GA 4GL2A 2B7CA 1KYIA 3RLFA 2B92A 5JSZA 3C5CA 1YU9A 2OHFA 4EJSC 2GHIA 2W2XA 4OI4A 3M4YA 1G41A 2GNOA 3FOZA 2NZJA 5IDVA 1ESMA 4ZDKA 3PITA 1GP2A 1Z6YA 2O8EA 4OKSA 1ZM7A 1WBDA 1EX6A 1GNPA 1OXTA 2VHTA 1W5TA 2RGBA 2YC4C 4V02A 2Z4SA 4JYBA 2OAQ1 1UKEA 4B35A 2JEOA 4M4SA 1VYTA 2DYKA 1OH5A 2V8OA 1QG4A 2HT6A 4NTZA 4DCTA 1M8PA 1X8JA 2W2TA 1W1WA 3LWNA 1GKYA 1Z83A 1ZIOA 2RCNA 2XJ4A 3IGFA 3IPYA 4BLPA 1RYFA 2VIIA 5KNBA 3KQUA 3QSYA 2R6GA 4X8LA 2AFHE 5KNDA 2ZSDA 4HYYA 3WMEA 1HT2E 4Z1MA 2OE2A 3UG6A 2NQ2C 3GD7A 4PO9A 4BLTA 1DO0A 4AD8A 3W5IA 4B6FA 2VL7A 1YZKA 5LD2C 3PEYA 2JLRA 2NPFA 2IW3A 2VEDA 3FHOA 3I5XA 2REBA 5JWHA 1B0UA 4LJYA 5FOTA 4BLQA 1NLFA 1WCV1 4ACBA 1VHTA 3P20A 4IOJA 1RIFA 2VPPA 2ZJYA 3OIWA 1XEFA 1SXJB 2RGNA 2IX3A 1U8YA 4QJ4A 2WKQA 4RKEA 4AYTA 3QPWA 4Z54A 2WBLC 4US2R 3QEOA 4O3MA 1E0SA 5C4MA 1VHLA 1OFTA 4A8JA 5FBVB 4EQ6A 4EUNA 2W0SA 2IF2A 2RAPA 2VA8A 2FNAA 2MSEB 3GFOA 4PC3A 5SZKB 5FPKA 3LO5A 1XXHA 2XEXA 2R9VA 4BFYA 3WP0A 3IQWA 3FGNA 4BFXA 4M1SA 4C7OA 3TW8B 1KTVA 4JVSB 1VCNA 2RH5A 5EE1A 1VG1A 3DMNA 2QORA 4MYTA 4NCKA 1QZXA 5FPSA 3U3JA 1JR3A 1LTQA 4DLWA 4FCTA 1IY2A 1XTRA 1CULC 3AVPA 1TNDA 4OL0A 1MRSA 1E0JA 5KUTA 1FW6A 4Q03A 4A0GA 4NCJA 2DBYA 5JZVA 2NG1A 3QENA 2IYVA 2QAGC 4OHZA 2I4IA 4I1OA 1NVVQ 2ORVA 5BQ5A 3C7KA 3GLFE 3RDPA 2B7BA 1HURA 5BYKA 1KZ7B 4QL3A 1UBCA 3C14C 3EA5A 5F2EA 3T1QA 5KSZA 3ZVMA 4G0NA 4G1UC 1OIWA 4AC9A 3K0FA 4IOLA 5G53C 1XTIA 2VHQA 3LW8A 2FV8A 1YRAA 2ZEJA 2EFEB 3IIMA 1IN5A 3T12A 5E3HA 1E9CA 2UKDA 2V6JA 4G5SA 2ZANA 2R8RA 3QXJA 1OHHA 4H1UA 4TQ9A 1D2EA 4N1AA 5HCIA 5KOYA 4MDEA 3I4LA 1GRQA 2DWPA 4FCVA 1NIJA 3KFVA 2WJVA 1G7SA 1K6MA 1QHNA 5LPNA 3SYLA 1L4UA 2GK6A 4AKGA 1W36B 2R6AA 3L8ZA 3CRVA 4RSGA 4MKHA 5DLQC 2IUSA 4PPGA 2WZQA 3CNLA 1GNQA 1NG1A 3L2OB 4LYAA 4F4JA 1QVAA 3CRMA 4GZLA 2XZLA 4M9QA 1OKKA 3EIEA 4YLGA 3ICEA 4JLMA 2ZSBA 5AWFC 4AYXA 3E70C 2IUUA 5FOVA 3ZZTA 4LHWA 2WTUA 1V43A 1OB2A 2BKUA 2J3EA 3PVSA 4D80A 1AK2A 1T0JB 3OF5A 3HP1A 4BFVA 3W6OA 1KOFA 3KKPA 4TTQA 5EP1A 2PJZA 4EPWA 3KQLA 4C9BA 3MJHA 4A8JB 3WHKA 2H5EA 3K70D 2QM8A 1ZIPA 2J7KA 2FFAA 4BEBA 3FWYA 4AIIA 3T35A 4YMUA 4DLTA 4JLOA 4DSUA 4C7OB 2XX3A 2IYLD 2FSHA 4GOKA 1TUIA 2W0MA 2ZR9A 4B3CA 1D9ZA 2ZJZA 1I4TD 5L3QA 2DFNA 3NH9A 1AN0A 1JJ7A 2Q21A 1COWD 4IFBA 4IW3B 5JMTA 2CHVA 3SQWA 3CNOA 2HDNB 3W6NA 4OK3A 5KU1A 2ZRHA 4XIGS 5K8LA 1CJUC 721PA 3K0SA 2J41A 4A36A 5GJBA 1LW7A 2QMOA 4F93B 5TARA 3RRMA 2CHQA 3NHBA 3BORA 1AZTA 3D6TB 3THOA 3VKGA 2GAOA 5KSOA 1FNNA 3PEUA 4NPHA 1NY6A 3BRWD 4JSYA 3PUVA 4C0AC 3A1WA 3H0KA 1RVDA 1AGPA 2GVZC 2C5LA 3BERA 2NGRA 4HDCA 3FFAA 4P3YA 1FL9A 1FFHA 2CCGA 3KTAA 4QGGA 5ANRB 4QNRA 4XVUA 3AUXA 3W9YA 1NLZA 2DY1A 3CLVA 3SHWA 3NH6A 5JBQA 2R2AA 1R0ZA 2IHYA 3CX7A 1TF2A 1I4LD 4OQNA 2D4HA 4Q7MB 4QNMA 521PA 1QHIA 4I4LA 4RCZA 2ASEA 2CCJA 4JVNA 3TRFA 1FUKA 1HA3A 1GSIA 5AUQA 4DVGA 1U0HC 1EESA 1AS0A 1D8TA 3EASA 4D0NA 3QBTA 1NLYA 2OV2A 4C30A 1ZU4A 4BFSA 1XPOA 3ZJYA 3AP2A 2P65A 4DLZA 4QM7A 5JCZA 1QHHA 4N0DA 2DFLA 1M6NA 2KBEA 4OK6A 4EPXA 2B21A 3WBJA 5LDDC 1D5CA 2BCJQ 2PT7A 4NP6A 1W0JD 5CLQA 1EFHA 1W4AA 1W7AA 2XJ9A 3A4NA 3CZPA 3NC0C 1YZGA 2WSSA 4D4JA 2GVDC 1TU4A 5H1YA 4PX9A 3ZD7A 1NY5A 4PSVA 1XCPA 2PZGA 4JLNA 5HZKA 2F9LA 5J47A 2JLVA 4A1FA 2ZSEA 2IS6A 1FZQA 3GEIA 3H2YA 3NXSA 2QRNA 1RJ9B 4HUQA 4WZAE 3TR0A 1KO5A 3ND8A 1E1QA 1XZPA 3F8TA 1CF4A 4H1VA 1PJRA 3LX8A 2GWHA 1T0HB 3DPUA 3IHWA 5SZJA 1MKYA 2BJVA 4GSYA 2ORIA 4Q48A 4ZDIA 4GBMA 4URYR 3EARA 2ZPTX 4LJ8A 5DI3A 2O0HA 4PPQA 1D6JA 3U7EB 4L5BA 2FWRA 3GLGE 1CP2A 1OFHA 3A58B 3QVUA 2NIPA 3THWA 3TJZA 3VR3A 3EX7C 2GCOA 4IDPA 4NMMA 2BBTA 3GCGA 4P0TA 2QQ0A 3L43A 3QEJA 1UAAA 1G7TA 1L7VC 1XCMA 1U94A 3SJAA 3WNBA 1E4YA 3JZAA 4CEHA 4XSHA 4GT1A 5CYPA 1KKMA 4GMDA 4CF7A 3NBYC 4BE7B 1WRBA 2KWIA 3K1JA 4JLKA 4PR0A 2O8BA 3QQ5A 1RW4A 3AUYA 4DHEA 1OW3B 3D8BA 1JI0A 3EPKA 2QMUA 3B1WA 3SEAA 3AF1A 5C46F 1PLKA 4JMPA 2VP2A 1OYWA 4L8GA 1JPNA 4Q9LA 4BRWA 3A4LA 1G5RA 3CF0A 3QKRA 1BMFD 2IYXA 2ZYUX 4JLVA 3CIOA 1CLUA 3WBKA 4MGKR 4Q18A 3PEVA 2VYFA 3Q5DA 1TF7A 2WV9A 1H8HA 1X6VA 2XITA 1VIYA 3LBIA 2A5YB 5D3QA 1NN3A 2WOJA 3I8XA 3RABA 1QRAA 1WQ1R 2FGKA 1KY2A 1X3SA 1KIMA 1G8HA 1ZMXA 1LB1B 2Q9AA 1G3UA 4FMDB 2H16A 4UKDA 3TGPA 2FX3A 3KXKA 1H8EA 2FOLA 5DH9A 5EP4A 2Q9BA 3GLHE 1KJZA 4C2TA 3AKCA 1VDZA 4AWXA 2JJ1D 1E79A 4PHGA 4F91B 2FSIA 2J5XA 1W0KD 3BB4A 4LWZA 2GDJA 1Z3IX 3RVBA 4AKIA 3ADBA 3WNCA 2JJ2A 2ERYA 1W4RA 3K9NA 3OFNA 3RS3A 4XH9B 5E7IA 5JJLA 4X8OA 2EYQA 3HU1A 2J45A 4H9GA 4A0HA 1E96A 2J0VA 4B71A 3MWJA 1IHUA 4TWZA 2FPKA 3DHWC 1B23P 4Q7KA 3L8YA 4TLCA 4FI3C 4MDFA 2JLYA 1N0UA 5GVRA 1BH2A 4FWIB 5JS8A 1NNEA 4Z8XA 1NN1A 2Z4RA 4KVGA 1T5IA 2RGCA 1GOTA 4WW0A 1Q57A 4Q01A 1G5PA 2AKYA 1A4RA 4MQBA 4O2LA 1SXJD 1KI4A 4XWOA 1QVRA 2J7PD 1HUQA 3TSOA 2ZJ2A 3PUZA 3GJ4A 1KI6A 3U61B 4NHOA 1X86B 3EXAA 2PJRA 1XFAA 2XTZA 4NYIQ 2C2HA 3A1SA 3KKOA 4WZ6A 2OXRA 1OF1A 4U7DA 2EW1A 3THWB 1XTKA 1H65A 2DWOA 4C0SA 1LVGA 2GCOB 5L8VA 2CJWA 2GJ8A 2AD1A 1ZUIA 3E2IA 4GFDA 4TSFD 4IOKA 3AV0B 4UNRA 4LUCA 2H1LA 3T06B 5HZHA 1TTTA 2QPTA 2B6HA 1YHNA 2WWHA 3SOPA 1WP9A 4RZ2A 3CX6A 2QP3A 2ZI9A 4LBWA 1P7CA 1XB2A 2WWIA 3CONA 4QGFA 4Q7JB 4URVR 2FU5C 4CT4B 2V55B 4GPTA 1SVIA 1BKDR 4MGYR 3DO6A 3X2SA 5A4JA 3WRYC 2O8BB 3VKHA 1DELA 2DB3A 4J0QA 3N2IA 4RD2A 2VSXA 5G41A 5G40A 2ERXA 3EW9A 4ITRC 4YMSA 1IXSB 3GLFA 3U4QA 1D2MA 2CLDX 5JWOA 1DADA 1WBBA 2JIZD 1FP7A 2RGGA 2PMDA 4QJ3A 1T3LA 4ON9A 3GQBA 1EX7A 2VP5A 1P73A 1Y63A 3FFBA 3QNUA 1VMAA 3EWAA 3QF4B 1E4VA 1FMLA 3B8HA 3QG5A 4IFEA 1FP6A 4LDJA 2ZAOA 3THYA 2FGJA 1VPLA 3M1IA 4DUGA 3B6EA 4UNPA 3LVQE 4BFTA 4DC9A 1SVWA 2GRJA 2IXGA 2CCKA 1KSJA 5AJYA 3S1AA 3CWQA 2GZDA 2ZJ5A 4URWR 4AYWA 2WMOB 1LF5A 4MRSA 1U8ZA 1DARA 4B2PA 4KO8A 1JB1A 2QTHA 3FDIA 3G0HA 3TQFA 5UKDA 3W6PA 1NVWQ 2JGNA 4DBLC 1NJGA 2AR7A 1IONA 1N5IA 1ZP6A 2VH5R 3PR1A 1RE0A 1QF9A 1NVXQ 3EIQA 4JLDA 3RAPR 3FHCB 2QTVB 1DO2A 3I1FA 2Q3FA 4DLSA 3PFIA 1AQUA 1NIPA 2PZFA 3VHLB 1T9HA 2NO6A 2XB2A 1TQ2A 4QHYA 2F43A 3K70C 2X2FA 4RFSB 3K0CA 4DCNA 2NZ8A 5EE9A 2CMKA 4NYJQ 4BQSA 4CEJB 4XWAA 5FR2A 3H84A 3GLIB 1YZQA 3WNDA 3EG5A 3KJHA 3KXIA 1IBRA 2HF9A 5DN6A 2ZI7A 4M1YA 4Q4AB 1BYIA 3DZ8A 2Q0HA 3FYHA 4FN5A 4PHHA 1QG2A 1Z0IA 3RYTC 1U81A 3LAWA 1YZNA 2JA1A 2O0KA 2LCFA 2YYZA 2OT3B 5L3SB 1KI3A 1Z6TA 3HYTA 3KUCA 2CJWB 4K81B 3REGA 2AKAB 4WZBE 4G5RA 4YMWA 2IC5A 4C0LA 4D2IA 2OG2A 3VR1A 3HPQA 1KJYA 4URXR 2IF0A 2OILA 1JR3D 3Q9LA 2FZ4A 2O8FA 3DL0A 5JS7A 5GJWC 1E98A 1S1CA 2IS2A 1P2VA 1IOZA 4OK5A 1QBKC 4RD6A 4QRHA 1UPTA 3U4QB 1NKSA 5J5CA 1JBKA 1ZBDA 1X8LA 2J87A 4EJSA 3SHFA 5J4LA 3V9PA 4JLPA 2REOA 1TPZA 2HUPA 3I61A 1E9SA 1M1YE 2ZI4A 1CJVC 1F2TA 3RANA 4U5XA 2HJGA 3DMDA 3UWKA 3THYB 5CJPA 2QE7A 1N6NA 1LS1A 1CXZA 4XD7A 4US1R 4D81A 4KLNA 4DCVA 3AVVA 2WAXA 1UFQA 1E2JA 3QG1A 1P2SA 3KB2A 4RCYA 2BKEA 3S1AB 4QXAA 3QPVA 4IKEA 5CK5A 1D9XA 1XEWX 1W2HA 3HR8A 3CM0A 1U0JA 3SR0A 1G6HA 3QF7A 2VSOA 2BMDA 3ECCA 2CHGA 4HZUA 5EJEA 3MD0A 2QMHA 1R6BX 3U7GA 1MH1A 4WA7A 5TVKA 2QENA 2QY9A 2E87A 3TAHA 3BWDD 3BC1A 5FPTA 4A6PA 2EYUA 2VSFA 1HEIA 3DVLA 5B2ZA 2IL1A 4Q4HA 2UZIR 4TMVA 1NMYA 2F43B 2FSGA 2ZS8A 1NKTA 1ZYUA 1ZM9A 2Q3MA 3LLUA 1PUJA 4ESVA 1OKKD 1E99A 3NKVA 1MO6A 1KK1A 2V6IA 2CL7X 2WVJA 1WE2A 2WHXA 1U98A 1E32A 2JATA 1TU3A 2C03A 1EFRA 2DCUA 2OM2A 4JLBA 1BIFA 3WXMA 4E09A 1Q44A 2IYWA 1N6RA 1ZD9A 2QM7A 2E1RA 3VU9A 1A2KC 2NO1A 2A9KA 1F3OA 2F1JA 1X1SA 3T61A 1XWIA 3EZ6A 1N6PA 2GEVA 5KTYA 3O8BA 3GLGA 3TUZC 4B2IA 4LJ7A 1G8GA 4LJ5A 1Q12A 1Z0JA 1AS3A 3CX8A 1G7RA 1AS2A 1F2UB 1KK0A 2PL3A 4OQXA 3UANA 3NEJA 5FOXA 3VNVA 1GIAA 1UBEA 2ZJ8A 2ANBA 3EIHA 3E1SA 5IT5A 1FX0B 1KMQA 3IIKA 2OBNA 2OFXA 3P1JA 4M1KA 421PA 1XP8A 1M7BA 4KI0A 2FEMA 2RGEA 4ZKDA 5IK2D 1E2NA 1U2RA 2F1HA 4ZKEA 4DEYA 3U3OA 3I62A 1DAHA 1R0XA 3ZLJA 2WWWA 3QY0A 4JIMA 2IYTA 4TL7A 4HLCA 4EJSB 2WPDA 1T3HA 2BC9A 2A3RA 4ESHA 4MUBA 3FMFA 2P6UA 3IKJA 2QAGA 4U02A 1UBFA 1XEXA 1XD2B 4NYMR 3TSZA 5GADl 3Q5EA 4Q21A 1OXXK 1ZD8A 4GP6A 1XTQA 4Q9KA 4YC7A 2CDNA 2O52A 4AG5A 4PC6A 4BLSA 2HCBA 1G64A 1E0AA 4P31A 5E7JA 4MYCA 1CTQA 1KI8A 2ZQ5A 3W5JA 2FN4A 3CPJB 1BS1A 4Q1AA 1E1RA 1CS4C 1M2OB 2NOAA 2E9SA 4DLXA 5AUPB 5C2JB 1D2NA 2A5DA 3GLHA 1NSFA 4ZIRB 4HZUB 1RRGA 1ZAKA 4OJQA 5EZ6B 3TUJC 3VR5A 2HYIC 1W44A 1E6CA 2VHJA 2XSZA 2ZRJA 2G9NA 4JSTA 2ZM5A 1S9DA 2H18A 1IN7A 4K8OA 1GWNA 3BK7A 1GRNA 3LRPA 1Z2AA 1ONBA 4CYMA 1KAOA 2RGXA 3FE2A 3ASYA 3R8CA 3OIYA 4D0GA 3EC1A 3IQXA 1FTSA 1OFIA 4DLUA 3PCRB 5JI2E 1KDRA 2WWYA 4P4TA 2GEDA 4JBXA 3KZ1E 3UMRA 2ATXA 1NF3A 1ELOA 4LY6A 4BUJA 4Q1EA 3IIJA 2GESA 3EZ2A 3AGPA 3JZMA 1QHGA 2W00A 3WMFA 5G3YA 4KBGA 1SKYB 2IYYA 1J70A 4PAOA 1WMSA 4IXMA 2BV3A 2GCPA 2GK7A 4Q1BA 1E1QD 2AXNA 3UIEA 2OCYC 3VAAA 3LFUA 2RGAA 4F38A 4FMBB 1I4DD 4UJ5A 4JYCA 4A2PA 2O8CB 5A0FA 2XZPA 5BN5A 5DNYB 2WJHA 4M9XA 3QXXA 3NDBB 5JSZB 4WVFA 4ZDWA 4L9WA 2PLFA 2WJGA 4PPFA 3H4MA 4AKHA 3L0SA 2GTPA 2VLIA 1VYUA 2ONKA 2V1UA 1W5SA 2YWEA 1DEKA 4TLEA 4A0FA 2QEQA 3TH5A 4LJAA 5EUQB 3BJIC 4KAXA 4JBYA 2O8EB 1KDPA 2NTYC 2YOGA 2L0XA 1YR7A 4KSCA 4RVCA 4XWKA 2ZJOA 3BH0A 2QA5A 3HR7A 1G3IA 4OHWA 1IY1A 4TLDA 4QM6A 2ZRNA 3LBHA 3KKNA 5EE5B 3B82A 5FBLB 2ZR7A 5G3ZA 3I73A 2NO9A 3KB1A 5KDLA 2QMEA 4MKGA 3FTQA 4S2EA 1Z22A 4R7ZA 1XRJA 4BLRA 2GAAA 4LJ6A 4PC7A 2AFIE 4R9UC 5FOSA 4DCSA 1KO7A 3TVDA 4M21A 3CWZA 2JLWA 3L0IB 3R7WA 2OXCA 2R6DA 4KFSA 2W6IA 5P21A 4B44A 4AY2A 3LV8A 2WJJA 2DHRA 4IVPA 5FPYA 1AZSC 5JHHB 3G82C 4EPTA 5DSZA 3B7GA 3AVXA 5JWRA 2JLUA 3QKSA 2AWOA 2DWQA 2YWGA 1PV4A 1R8QA 3AF0A 3RRYA 3U5ZB 1OXVA 2BIFA 4HAYA 4JL8A 1H8ED 4V0NA 3LY5A 2ZR0A 1MV5A 1SVKA 2CK3A 5CB6A 5JRZA 1TMKA 1E79D 3SZRA 2QROA 4CIDA 1JEDA 2JCSA 2ZVQX 1ESNA 4OI2A 3W8RA 2GF9A 221PA 1EFTA 3AM1A 1GZSA 1MABA 1J99A 1ETUA 1XMIA 4C0JA 1GNRA 2MMCA 5HPYB 3LNCA 5J4KA 3MFYA 2N1BA 2P6NA 3EZFA 821PA 3DM9B 3U3RA 4W5WA 4EQ6B 5J4VA 4LV8B 4TYYA 1E2GA 3GJ0A 1OPXA 1DAMA 1XXHB 2HLDA 4B33A 1NVVR 1J2JA 1XD9A 3FB4A 2AK3A 1KDOA 2HYDA 4BFZA 5EXSA 1XEWY 1ZUHA 1US8A 1G291 3WYFA 1AQYA 2FH5B 3CF6R 1ZC4A 5FUVA 4MYHA 4A6XA 5F9FA 1JR6A 1FOEB 4M9SA 4RY2A 4I1SA 5JEEA 3OAAA 3MG9A 1N6OA 1MRNA 1AA9A 4G5OA 3DKPA 3PIRA 1PLLA 2WWFA 2A5FA 2WIBA 4PZZA 1DTSA 3LD9A 1E2MA 1GDDA 4OHYA 2C99A 3AVQA 1ZRHA 3OEHD 2YOHA 2RKOA 5AUNB 4GOJA 4TTRA 4LI0A 4ARZA 1JALA 2P67A 3BE4A 2C98A 5HTKA 1MT0A 2CVFA 4HZIA 4KXFB 3U2QA 5HE8A 1QHXA 3K0FB 5H70A 3OEED 3F3YA 4DSNA 5TMPA 1AKEA 1JAHA 4FMCB 2VRWA 4KCGA 3W8NA 2VBCA 1XMSA 3EPLA 1C4OA 1VG8A 3VKWA 4V0ME 1E2HA 4W5JA 2GKSA 3L82B 5KO2A 3BB3A 3TLXA 1KHTA 3LQQA 4P4UA 2OCPA 4PANA 3FHTA 3R7WB 1N6HA 2WKRA 2YJTD 3AB3A 1SULA 5FUYA 2IA5A 1XJCA 2FFBA 4POAA 1V5WA 4L16A 5SZIA 4F4IA 4XSGA 4DUGD 1UKVY 2WJIA 3RS4A 3WHLA 1N5LA 3OIUA 1ANKA 3FMOB 2ZREA 3QKSB 4YQFA 1DE0A 1N3BA 4Z51A 2R6FA 5AJXA 4LJ4A 3SU8A 2W6JD 3A37A 2CEAA 2IWHA 1DG1G 1VIAA 1NN0A 2PEYA 4MITA 4TMKA 2WMNB 4G5GA 2BBWA 2ODWA 1QHYA 2CNWA 1J8YF 2FF7A 2BM1A 2W2VA 5FOUA 2ZYTX 1SVSA 3U3KA 3TSWA 2B8TA 4M53A 4M1OA 5F98A 4ASUA 5EP2A 5FBRB 1WXQA 4W7SA 2IYRA 1G7CA 2P5SA 3TAUA 4Q47A 2X1VA 4XVRA 1YZUA 1E2LA 5HKKD 2IBMA 5DHAA 4UJ3A 4D6PA 1SGWA 3ADDA 5BXQC 4DLRA 3I3SR 3AF4A 4LHVA 1R7RA 3UATA 1XDBA 4MRRA 3LQRA 1PVOA 3FKSA 4ZCLA 4BZPA 5FTMA 3SBDA 4C2UA 1ODFA 2ZJBA 5FTKA 4JVLA 3ZVNA 1A5TA 2GZAA 2WM9B 1US8B 3IEUA 5FI1B 2C9CA 5L3QB 1S2MA 1S0UA 4JLAA 4QBGB 4TT3D 4D4KA 4Q00A 4B6EA 5GVSA 2YWHA 5TY0A 2ZRAA 4NCNA 4BWYA 1GKUB 1NJFA 4DB4A 4LZZA 2D74A 5FL7D 2XTMA 2ZE7A 2Z6VA 4E03A 1KI7A 3B1XA 3QIAA 4B3BA 2AX4A 2ZVPX 3RSOA 2AN9A 3C8UA 3QKTA 4CEIA 3CUEF 1LNZA 4HB2A 2ZE6A 3RRNA 1E2PA 4LPKA 1YR8A 1P61B 1KSFX 5H8WA 3AKDA 4O25A 4ARZB 4DXAA 1YE8A 3U60B 3VR2A 1E9EA 1NSTA 1XZQA 4O0MA 1XTJA 4Q1CA 4TYNA 1NN5A 2IYUA 1QDEA 3KTAB 1PZNA 5FBQB 1OXUA 1E2KA 1VCIA 1ZUNB 1K5GA 1ZM2A 4MRNA 1J7KA 1G5TA 2NMVA 4YDHB 4LBZA 5SZHB 1K5DA 3ASZA 5EE0A 1XU4A 2XB4A 5ELXA 1G1MA 4ZI2A 1QHHB 4GRAA 5EP3A 4S35A 1P2UA 1Q20A 1EFUA 1ZNZA 4PTLA 1G20E 5CLLA 4UXIA 2O0JA 2PLRA 3UMFA 3MLEA 1XF9A 3GMTA 4OI0A 1HQCA 3IBGA 1RKBA 4B32A 2OLJA 4M22A 2VTKA 2KB0A 1GUAA 2GJ9A 3R20A 4O2RA 3LDAA 3K9LA 1P5ZB 1OXSC 4DJTA 4RD4A 1N5JA 5BN4A 4M0LA 2ZI5A 3FPAA 4DB2A 1L8QA 1KSGA 4HUQB 4PPNA 2GBLC 4DSOA 2CLCX 3OE7D 2I3BA 3EPHA 1N25A 1U8AA 1VTKA 5FOWA 1BYUA 2P5TB 1U99A 3IO3A 3PUWA 5JRJA 4EFLA 1YVDA 3ZD6A 5DGXA 1SKQA 2ZYVX 8OHMA 2QU8A 4M2LA 4JLJA 3AVYA 3TVTA 2ANCA 4HAUA 4WAUA 1UBGA 1JJVA 5DI3B 3BAFA 2BJWA 4PXAA 1S96A 1NI3A 1YZLA 3X1YA 2EU8A 2ZU6A 3BFKA 3U7FB 4EPYA 4PSAA 5EXPA 5IF9A 1KZGB 3LBNA 4OHXA 2OCBA 1EFRD 2ZSFA 2ZITA 2XNDA 1NBMD 4GP7A 2H92A 2ZJAA 4KFRA 2JLZA 4CEHB 2HXYA 1UADA 2BMJA 1OFUX 4KJZA 5HR5A 2FE4A 4LC0A 4QHSA 2HJVA 3BFVA 1IJFA 2UVQA 2GEUA 4PQRA 3B85A 3U44A 3Q3JB 2C77A 1UF9A 4OBEA 1IXRC 3N5CA 4V0LA 3RRZA 4KYUA 3MWKA 4E22A 4DDUA 1S4QA 4PQYA 3U6KA 3OZXA 1R0YA 1Z6AA 3QKRB 4KHZA 4DKXA 5FTNA 5CIWA 1SZPA 4G5QA 1G8PA 4TMXA 2YOFA 3TIFA 3TMKA 5CITA 1T5LA 5KDDA 4N3NA 3F0TA 4Q9JA 3GJ5A 3P26A 1G6OA 3R9IA 4B34A 3MGCA 2QGZA 5FPHA 1F6BA 1T8TA 2CVHA 2PT5A 3B2EA 4QBFA 5L3VA 1RRCA 3SNHA 3SYNA 3A6PC 4PC2A 4II7A 1WDTA 3KQHA 4UQOA 2VP4A 2VP6A 121PA 1TQDA 2F1IA 3BXZA 1DG3A 4DSTA 3CBQA 5JJKA 4HLUC 3ZZ0A 5DE3A 3KKQA 4QOSA 4WOPA 4TL9A 1U9IC 2QRZA 1Z6GA 1II8A 3TE6A 2QNRA 4JT4A 1W36D 4Z1MD 4BLOA 3IPXA 1CJMA 2O8DA 4PHTA 3DDCA 5F3WB 4EIWA 2Y8EA 4NYIR 2D62A 2QPOA 4JJZA 2BMFA 3MCAA 1SQ5A 1Z06A 1TX4B 2FJUA 3QKUA 2V7QA 2XSZD 3RWMB 3ADCA 2ZS7A 4PC1A 4GZMA 1Z5ZA 3D7MA 1Q3TA 2JDIA 5F9HA 2W58A 2G6BA 1FPMA 3X1ZA 2OAP1 3THXA 1R5OA 2PEZA 2G77B 4RZXA 3WYAA 3J81k 1KI6B 3O8CA 5KHOC 3IEVA 1OJLA 4HAVA 2R65A 2YHSA 4ERNA 3RSLA 1Z08A 5DIFA 2CL0X 2J0QA 4LYJA 2C8VA 1A1VA 2QL6A 1YR9A 2OFOA 2JLXA 1KO1A 4CRWB 1Q3HA 1UJ2A 1IY0A 4KODA 3UG7A 3ZH9B 1W47A 1E0KA 1JAIA 2JLSA 3CNNA 3EWSA 1KDTA 3AQ4A 4Q19A 3TK1A 4CVNA 1GG2A 1XX6A 4JKYA 1T4GA 3B1VA 3KJIA 1Q1EA 1M34E 3CKLA 4LJ9A 4DDTA 1E2FA 3VQTA 1T91A 2ODBA 3U44B 1KI1A 4BPBA 3QVVA 4U00A 4FD2A 2C78A 1F5NA 2TMKA 1NRJB 5FL3A 3SC3A 2WWXA 3GLFB 3AKEA 1CKEA 4TZ6A 1Z8FA 3LXRA 4FW9A 3AF2A 4BZXA 1P6XA 4QJ5A 1ZM3A 2RHMA 2ZRPA 1KNQA 2A5JA 4TMTA 3VNUA 3Q7PA 2XXAA 2C9YA 4R71A 4QHTA 1S8FA 1UEJA 2FDCA 1M7GA 4RD0A 4DZZA 3C41J 3Q72A 1R10A 4KITB 4V0MA 1DAIA 4BZQA 4OYHA 4M1TA 1O3YA 2C04A 3I72A 4HB3A 1EFCA 1KKLA 3A4MA 1ZM4A 3KKMA 1N0VC 2IYQA 3LW7A 1OHHD 4JS0A 3GFPA 3GJ8A 1T8UA 2WSMA 2BHRA 2IT1A 4LBVA 4NYJR 3V4RA 1OH6A 4LV5B 3BH6A 2HEIA 1DAEA 3PJRA 4FMDF 3AEZA 5K8TA 3KJGA 2XGJA 2Z83A 2PCJA 4B73A 5JFGA 4HUTA 4DIDA 4OI1A 4A2QA 2QUZA 5CDFE 5EZ5A 2VP0A 4A82A 1W0KA 3T5DA 4C0HA 2VP9A 4IEEA 4AI6A 4JL5A 4QGAA 3HJNA 1VECA 1C1YA 4M1WA 4EKDA 5KYKA 4AKEA 3ONWA 1F60A 1Q22A 1UEIA 4HB4A 4P33A 3KQKA 1HTWA 2UZ3A 4TZ0A 1ZNYA 2KI5A 4B3FX 5TV2A 3V00A 4V03A 1OB5A 1HYQA 1XPUA 1GL9B 5C1BA 3ZGXA 1PUIA 3PQCA 1I2DA 4Q02A 2R62A 4KFUA 2P2LA 3DOFA 4A15A 2GILA 2A30A 4Q9HA 3M6AA 2DFKB 1GAJA 2IYSA 2J59A 2J7PA 2ZRLA 4XTCS 3WP1B 2X19A 3IDQA 2O5VA 3CB4A 3GJ6A 4B75A 1DBSA 1G9XA 2REXB 5EXTA 3SFZA 2ECKA 3PV0A 2V4ZA 4R2HA 3A1VA 5LBIA 2HT1A 3AVTA 2O8FB 2FPLA 4BECA 3GPLA 3OAAD 1LF0A 4BRUA 2FG5A 3C16C 2LKDA 1E2EA 2A2ZA 3T1VA 2Z0MA 4LK2A 4CDGA 4MKFA 2RMKA 5DHFA 3AGQA 2FSFA 1SVMA 4P32A 3ZIAA 4DWJA 1J8MF 1DS6A 1LV7A 4AG6A 4CGZA 1EK0A 1G4AE 4GMXA 2XXAB 1R0WA 1TQ6A 1F2TB 2JIZA 5TXGA 1JXOA 3CW2A 1P3JA 4IDOA 1G3RA 2F55A 3NEYA 2IEZA 4LSGA 2IHBA 2D2EA 3GEEA 3TBKA 3BS4A 1Q1QA 1TUEA 1IAQA 4RFVA 1N2CE 2QQEA 2YINC 2YVUA 4TYPA 5AK0A 5HE9A 2OEPA 3RNLA 1ZCAA 4ZI3A 4UNNA 4LHXA 2SHKA 2BBSA 1XJ0A 2BWJA 4WXRA 3ZVRA 1OE0A 4F4CA 3UPUA 2AXPA 2QT0A 2PCLA 3CH5A 4BEJA 1HY3A 4NONA 1MO4A 3MAAC 2QN6A 4URZR 5EQTA 1G19A 1AIPA 1M7HA 1VG9B 3K53A 1CIPA 4Q4HB 2GXSA 1ZVQA 2ZRFA 1J90A 2BCGY 4K46A 3K8YA 3LXXA 1HT1E 1FQKA 4IVRA 5LD2B 1SXJC 2CNWD 2WSSD 3IBYA 4IDHA 4DDVA 2NO0A 1NMXA 2F3TA 3K9GA 4QKQA 2BDTA 3R9XA 1XPRA 2KSQA 1XNJA 1W49A 3C4JA 1M74A 4ASUD 1GL6A 5CK4A 1FTNA 2PMKA 1W4CA 4MH0R 4OJKA 4EDHA 1X1RA 4HSEA 4HAWA 4PZYA 4RZ3A 1VKJA 4HAZA 3AVOA 2GETA 3F5FA 3VU9B 3W34A 2DPXA 1G3MA 2J0SA 2FFQA 3GP8A 3U7HB 1P62B 4Q1DA 3SN6A 5KSYA 3GLGB 2X2EA 3FKSD 1KK3A 2HCJB 4B2LA 5GJCA 3GLIE 2I1VB 1GM5A 4LGMA 3SE0A 4NBSA 1DAKA 2G3YA 1T3SA 3HU3A 2ZRBA 3IO5A 3PENA 1VCOA 2BVNA 1R5BA 1G8YA 4D26A 3VX4A 1Q1ZA 1TF5A 4TL8A 2ZE8A 3G5UA 3D3QA 3NBFA 4TN1A 3Q8XB 1NMZA 2ODNA 3NBXX 4MYUA 4Q9IA 1E2QA 1IXZA 3RHFA 5KPDA 2QT1A 5JJIA 3AH8A 2C95A 2IWRA 2WIAA 1KNXA 1E9RA 4OQFA 1P75A 4YXWA 4KVAA 5AJWA 3TKLA 4AK9A 1XJQA 3HDTA 4B43A 2QP4A 2YV5A 2QAGB 1ZW6A 1XEXB 3QOFA 3VHXA 3QXCA 1N6IA 5J4YA 2GJSA 1YR6A 1E3MA 2GA8A 2AD5A 2R6CA 4TQUS 4CW7A 3VMFA 1GITA 3QI2A 1FNMA 3K09A 5JLJA 1G16A 1VCMA 1N6KA 5E95A 3PG5A 1JNYA 1Z63A 4QC2A 2IK8A 1H8HD 2IEYA 2ZYWX 4JBWA 1W36C 2WICA 3MWLA 3GLHB 5FH9A 2OZEA 2J0UA 4B76A 5L3RA 4L15A 4DLYA 3I32A 4RD1A 2RGDA 2MMGA 5KDOA 1WA5A 4A92A 5K8IA 1ZU5A 2FPMA 2F1RA 3K0AA 1P72A 1O87A 3Q85A 1P4SA 3SS8A 5JECA 3B78A 3UK6A 4WXPA 3L0OA 1S1MA 1HQYE 1RC8A 3BOSA 1KSHA 2XOKA 2QI9C 3BBPA 2JJ2D 2PH1A 4PSKA 2OBLA 2QP9X 3OFND 1CBUA 2RGNC 1AGRA 2C9OA 2N42A 3CRW1 4DDWA 1XTSA 3N70A 1UKZA 4LHYA 3NDPA 1DPFA 4A8JC 4FIDA 4G01B 1A2BA 4A0RA 3B13B 2QPAA 1KO8A 4HLQB 1ZC3A 2G0NA 4ZCIA 1N5KA 2WJYA 2GJAA 2I1QA 3FVQA 5AJVB 4DIEA 3C15C 1BOFA 4HATA 1N6LA 1Z0DA 2RHDA 3QXHA 3SFVA 2ZRMA 2K5UA 2VQSA 5CB8A 1P9WA 4F7WA 1EXMA 4ILEA 2OLKA 1G8FA 2A78A 2XTNA 4NCIA 5AR1A 1G3QA 1VYVA 3B9PA 3REFA 3V4FA 1RJ9A 5JHGB 3B1YA 3BH7A 3ZS9A 1R2QA 2EWWA 1OIVA 4YMTA 5AJZA 1GFIA 2F9MA 2YNMA 3MWYW 4OQLA 1C9KA 4PFSA 4C0KA 2IYZA 1JPJA 1Q21A 3P27A 5BWMA 4AURA 5FTLA 1KI2A 3WYGA 4LV6A 2DR3A 2XNDD 2Z43A 4RD3A 4GDFA 1XBTA 4E5UA 3LVRE 4KSBA 4R2IA 3K09C 2H8KA 4JJKA 5IRCD 4Q66C 5CM9C 5IK2A 2EFDB 3SQXA 2ZETA 1R4AA 4Y0AA 2ZI3A 1OYYA 3BD9A 4B3GA 3AP3A 4B74A 1E94E 2EVWX 1RYHA 5GJVC 1GL7A 1OH7A 2AWNA 2ZU0C 4WIAA 3NVAA 4ZV4A 4PAMA 3PXGA 3PEWA 1DOAA 3T1OA 1YRBA 1E2DA 5DISB 4LBYA 2IXFA 3O8DA 1NP6A 2RB4A 4QGHA 1ZNXA 1Z28A 3B5JA 4URUR 5LB4A 1DAGA 2HV8A 2BOVA 1RZ3A 2ZTSA 3O47A 2CE2X 5CJ2A 4G3XA 4ZCMA 4IEIA 2JJ8A 1FUUA 1OLOA 2J0UB 4NCHA 4X8HA 2YC2C 4FWTA 3X1WA 1WF3A 3K9HA 5JI3E 3QUSA 1JEEA 4IXNA 2LKCA 3K0AB 4W5HA 1TEVA 1CU1A 2QZ4A 2BEJA 1Z6XA 2AHOA 4PAQA 4BGDA 2FEOA 1SHZA 5KNCA 3U6BA 1CR4A 4BFWA 2ZUBA 3VFDA 5CDFA 3WY9A 4LX0A 1MABB 1NL3A 3LLMA 3AF3A 4LHZA 1S9HA 2J9RA 4KYIB 3A36A 2OSBA 3LH5A 3MJRA 4BFUA 2XZOA 4US0R 3RC3A 4LPSA 1EG7A 1U90A 2VF7A 3QPUA 4B3XA 1CRPA 3TUIC 2P3SA 4OHVA 3RS0A 2KBFA 1W4BA 3KQNA 3ZQ6A 1JXMA 5M04A 1Z0AA 3FMPB 4JVMA 3R9WA 4UNSA 4NKRA 1MO3A 2V7QD 2F3RA 4WBSA 4MRVA 3VX3A 3CH4B 1ZCBA 2ZS9A 3O8RA 3KXLA 2WAYA 3CO5A 3MUFA 5EXXA 1SXJE 2ZAMA 1E9AA 2JASA 2G1KA 5CM8B 3ZS8A 1XMJA 1WB9A 2JDID 2MSDB 4D4MA 4HDQB 2GBLA 4DCUA 1JQJC 3HWSA 5DN6D 2EFGA 1YJ5A 4PHFA 3SJCA 3ZDQA 1P9NA 1S3GA 1W2GA 2OO7A 4TQAA 4X8MA 4N0EA 4CZ2A 3P32A 4Q4JA 1OT3A 2D06A 5J4HA 3CRRA 4I81A 3RS7A 4C0QC 4D82A 4GOXA 4TL6A 1SKYE 3ZVLA 1NBME 3SBEA 2BM0A 2IXEA 4V0OA 4XVQA 2EQBA 4IDQA 1RRPA 1CJTC 3WRXC 3X1XA 3H1TA 1BO6A 2H57A 2XAUA 2GZHA 1XD8A 4RKFA 3QJYA 3GJ3A 2YWFA 3KJEA 4HDOB 1G17A 3KL4A 2CXXA 3Q7QA 2ODEA 3RWOA 2FZLA 3AVWA 3TQCA 3TR5A 2EWVA 2IUTA 3JVVA 4HEJA 3RS2A 1Z47A 2OUKA 5KPJA 3OIVA 5JEDA 3GJXC 3M0EA 3CR8A 2CL6X 3NHAA 2Z5FA 5TDHA 5DO9A 4QFMA 3R8FA 4ZDJA 2MSCB 3E5HA 1R8SA 4MUAA 2F6RA 3EPJA 3QBVA 4PQFA 4MRPA 4EFMA 1EWRA 1TL7C 4LRWA 5C4GB 1KMHA 4M1MA 1Q1BA 4L9SA 1KGDA 1GVNB 2ZRCA 2F7SA 1KO4A 2QE7D 3W3ZB 4D0LB 4XD7D 4YMVA 5C18A 1GILA 3I8SA 4NU0A 4XJXA 3W90A 4C4PA 1KI9A 3KX2A 3QF4A 1Z2CA 1LFDB 4RJLA 3EZ9A 4Q7LA 3ZQJA 4MA4A 1G18A 5FI0B 5B58C 2H17A 3MSXA 4B47A 1IJEA 2YZ2A 4Q1FA 1ZNWA 2HXSA 3ND9A 3SDZA 2OESA 4CT5A 1IM2A 3ICQB 5BN3A 3SI7A 1IN6A 4HLUA 2LWIA 4Q4LA 3DKVA 4W9MC 4ACAA 1Z0FA 1U9IA 3IUYA 4FINA 3KUDA 2A7QA 3LA6A 4A4DA 3T15A 2ZROA 2Q3HA 3VR6A 5D3MA 3KDSE 4DT1A 4TLBA 4LYHA 3P4YA 3NIBA 3BIFA 2GCNA 2V3CC 3CZQA 3GEHA 5CIQA 1UKYA 1HH4A 2HF8A 3C5HA 3EA0A 4LC1A 1TAGA 2OCAA 1W46A 3EC2A 5BYJA 4EPRA 1NG9A 4RFSA 4IVQA 2WOOA 2J1LA 1CR0A 3CR7A 3B1ZA 4KLZA 4Q4JB 4CEJA 2R44A 1XXHE 2BBOA 2VHUA 2XNSA 3GLIA 4CEIB 3T34A 3N2EA 3OESA 4Q5IA 3CRQA 4L4UA 2GXUA 1AJEA 1KY3A 2ZIAA 1COWA 4Q4AA 2B8WA 3NTUA 2CBZA 2ZSAA 1AKYA 1R5NA 2DFTA 4Y0VA 1Q0UA 3UKDA 3VR4A 1I2MA 1IN8A 3UMSA 1JR3E 1QHSA 3GJ7A 1GRRA 2JAQA 3MRSA 5FFMA 4GI7A 1YQTA 1P60A 3OEHA 5L3SA 4ABYA 1EGAA 2P6RA 4QBHA 6Q21A 2JLQA 3DM5A 4NE2A 3HU2A 4B48A 1PLJA 3GFTA 3ETLA 2VF8A 2Q6TA 4JKIA 2ZRIA 1Z0KA 2H7VA 3B60A 3I5YA 2ZXUA 4IOMA 3U3MA 1KK2A 3OEEA 1W48A 3PUYA 2WPDD 2J46A 3ZIAD 4M9ZA 3UWOA 2QG6A 1G21E 3LX5A 3B9QA 3IHLA 3AP1A 4PO8A 5J40A 5B57C 2QBYA 1CJKC 1E9FA 4A9AA 4FMCF 3JVUA 2PBRA 4M8NE 1KMHB 4R98A 1VG0B 5E7MA 3A1UA 1E2IA 3HPRA 4LOAA 1FQJA 3CPHA 2VHCA 3EZ7A 3TW4A 5EE3A 4MKIA 4HI0E 4Z8YA 1YKSA 4KU4A 5FR1A 1OV4A 1E69A 1XCGB 2X8AA 2ZUCA 1KAGA 3BFXA 1II9A 4FCWA 1E1RD 1S3SA 4UXHA 2NPIA 5DYIA 4B3DA 3SJZA 1UM8A 1P9RA 4LCBA 1W0JA 2D3WA 2W6JA 4RZUA 5FUWA 4EFNA 3VTKA 1F48A 1N0WA 3FMIA 5K8UA 1GKIA 2WWGA 3I92A 2QAJA 3TNFA 1TADA 3UXMA 4DLVA 2ZRKA 4A2WA 4ZPXA 2G88A 2G83A 2QSYA 2IS1A 3BB1A 1UDWA 5D3MB 4P4SA 4DT1B 4XOIA 1EWQA 2PZEA 4JT2A 4TTPA 5TB5A 4TMZA 2YKGA 1E9BA 3AKYA 5B64A 5HKKA 3DOEA 1Z07A 4NZYA 5FBWB 3K70B 4TYWA 4IRUB 5DYGA 3SJBA 2QSZA 1MOZA 1AM4D
chains in the Genus database with same CATH superfamily
1CP3A 3T5CA 2VJOA 4EITA 4EY3A 2EKZA 4NCBA 1KJ8A 2C5GA 1ZH4A 2OL4A 2WU0A 3BFJA 4HAXA 3ABZA 1SC6A 3PNQA 2C8KA 3E3LA 2HWYA 2W83A 4WLVA 4M86A 4MW4A 2G1PA 1F8GA 1L4YA 5FNZA 4EEZA 1RYNA 4F5YA 2CMGA 4FT4A 4RCVA 1WDMA 2ORWA 4WFIA 3RSFA 3V7YA 2J6BA 4M7OA 5HCNA 1SHKA 4FLFA 3MJTA 4OQMA 2QX8A 3MCUA 4C3ZA 2BGWA 4NENA 4D0SA 3MWDB 2VDWA 2GI4A 1MA3A 3L3BA 3P9YA 4G0YA 4ZO4A 4D4LA 5ADWA 4YP9A 3NP7A 1HX7A 4JP1A 2VXYA 3L0ZA 2YZNA 3R7NA 2GXQA 1OSNA 2XE7A 5GOTA 4BIIA 5JH7F 2O8NA 4U7TB 8ATCA 1H4QA 2CLSA 2XWSA 3EAGA 5G0TA 1FMTA 2RAFA 3B5IA 5LMCA 4E4TA 1Z75A 4Y9UA 5JZMA 4AS1A 3H8WA 5EQJB 3FJYA 3KSBC 3HA2A 4L0MA 5B30A 2P77A 4TLAA 2QAIA 2CE7A 5FBHA 1ZLXA 1NVFA 5JCPA 3AX6A 1AK9A 2DHQA 4X93A 1J06A 1ND6A 1FX0A 3HKBA 1HE1C 4NARA 4HLDA 4MWSA 4DLKA 1DJMA 5DGCA 3GCZA 4DHWA 3C3PA 3RFXA 1KJWA 3HDQA 1QG6A 4H7DA 2QBYB 1ZJ6A 5JASA 3OH8A 1HV8A 2XLCA 3BZBA 3OZAA 4UPVA 3IUEA 3V48A 4PNPA 1EFKA 4MW0A 3A8TA 1RWKA 4QRDA 4V24A 5EUMA 4BQEA 4F1WA 2Q9CA 5THQA 2ACWA 3NWJA 5BWBA 2I6SA 2ZRDA 3QU5A 2V54A 4F92B 1EZ4A 1MHPA 3WFIA 1FFBA 1XQ9A 2WF9A 5D7BA 1Q50A 2C58A 4DG8A 2IHNA 2ZXFA 4ZVLA 4MP6A 4INJA 3HFJA 4N40A 2VDQB 1A88A 1CY2A 2OBMA 4YUYA 3SZUA 2O8DB 1DWQA 3STYA 4KWTA 4HXGA 1CRZA 1PKEA 1ZCFA 3K92A 2FUEA 1PBNA 3QTLA 1G4UR 3UC5A 3HV0A 2IPNA 3QWAA 4JR0A 1W6UA 4YO7A 3X1DA 3D8UA 4KFTA 1NVUQ 2EKDA 2R1UA 3K7EA 3M6MD 1IULA 1IN4A 4XTRA 5BSUA 5K2MA 3K0CC 3FGZA 3ZJ4A 4C0BA 3DAPA 4ZIRA 1EYZA 1L5MA 2IPOA 3HN2A 2P8JA 1N3IA 3R4VA 5LB2A 3SLGA 3ZXSA 3WMGA 2OFWA 2FMFA 4MEJA 1EFVB 4D25A 1TAUA 3TQTA 1G0NA 1QH1B 1WDKA 4IJMA 3CF2A 2Q1YA 1DI0A 3R5SA 5DNEA 5FLYA 1RXIA 3TJRA 3NG1A 1C3EA 3LUJA 1SVLA 5FUXA 3N59A 5ILQA 2GNPA 3QHAA 4E07A 1RPZA 1T6NA 3QYAA 1AUVA 3RSSA 5L4LA 2QN9A 3LGSA 2HLDD 3LPMA 3T9BA 4EZEA 2L69A 2ZUDA 2XT9A 4UXJA 1ZJJA 4YMHA 5CLFA 1GTMA 1P45A 5IX8A 1BFKA 2NUTA 4C4ZA 1P2TA 4E70A 4H6PA 3BJMA 5FAXA 1QYXA 1W19A 1J21A 2BEUB 4IHQA 4PZLA 2IBTA 2XYQA 1OX6A 3PC4A 4D3SA 1FIUA 1RRFA 5HQTA 4ZEOA 3QLVC 5EQFA 3EAQA 4UDYX 1Y3AA 3I6IA 3S68A 1C7QA 3SM3A 4R1LA 3A9SA 3WB9A 3T7RA 4NOJA 1YMVA 3EUFA 1UJ4A 2DH6A 2YNMD 3N8DA 5EWJB 1ICEA 1JT2A 1SZJG 3IILA 4NOLA 1XMVA 3IR5A 1IBMB 1H05A 1NDQA 2EFHB 2ZBRA 4HB0A 1ZI6A 5FWXA 2OV3A 3M33A 1J2EA 4QX6A 1K6EA 2GHIA 2DR0A 4OI4A 3GGJA 4IUDS 3M4YA 1P1HA 1SB9A 2GNOA 3PDUA 2QTNA 2PUWA 2W2KB 3GB9A 3GVHA 3EOAI 2O07A 3K5IA 3OM9A 1XA0A 4JAVC 1XJ5A 1QHEA 1U2DA 2G67A 3MZ0A 4L0CA 5COQA 5E0OA 2WYOA 2WF6A 5JMOA 4F7DA 5BURA 2VDRB 1D0IA 3L0DA 3GHHA 2H1IA 1ZM7A 2C29D 2OCXA 1WBDA 1F1BA 1UWLA 2CUKA 2I22A 3UYKA 1XWFA 1DINA 1GU0A 1QOQB 3D6JA 1NOIA 4EO7A 1EFPA 6ABPA 5FQOA 1DDOA 3BX1A 3LC0A 4X3CA 1EJ2A 4JYBA 2ORED 1V2HE 2DYKA 2HQRA 3PXCX 4FEGA 1QCCA 2V8OA 1S7GA 3H1PA 1PFWA 1QG4A 2F17A 4NTZA 4OATA 2X7HA 5F2KA 4IYJA 1JKJB 1EGQA 5CXQA 3P9PA 1GKYA 4BMVA 4DMKA 4IH1A 4MB6A 2VPWA 3N6RA 1FUEA 3P2YA 1FRNA 4N03A 2OHVA 3V8MA 1PWZA 4O4LB 3CUUA 2R6GA 1M5TA 3HRHA 1YHZA 2COUA 3QVJA 4HYYA 3DC2A 3R8XA 1ULUA 3ZHXA 5T7BA 4L85A 5EEHA 1B1CA 1SXGA 2OSVA 1NQWA 4ZODA 4LZJA 3GD7A 4IH9A 3VGPA 4Z4HA 3OD1A 1OWLA 1U9CA 2VCYA 3IKVA 5AKGA 1NDUA 4AD8A 1MW8X 3K96A 1J2TA 3D7LA 2NPFA 4RTNA 3D3EA 2PFSA 1KYTA 3I5XA 2BT4A 1JIXA 1Z35A 1Z4LA 3N74A 3VO2A 5ICCA 4LJYA 4D8YA 1EGVB 4KRGA 4DQVA 3P20A 2RI1A 4IOJA 1DCFA 1KFJB 2DVMA 5JO9A 5JNWA 1XEFA 1Y4AE 3T9DA 2VDPB 1SXJB 3SEFA 3WIBA 1H9AA 3NHWA 4ZCPA 3O7MA 1A4IA 4EB6B 1DZIA 2JIDA 4HDNA 4JWKA 4O3MA 3QEOA 1PR2A 1KU6A 3LQYA 4MWTA 4ZXPA 3BWYA 2J3IA 4UM5A 3AHEA 4ZAFA 2RAPA 2FY8A 2VA8A 1QIHA 2FNAA 4LNUB 4GX0A 2QSUA 1XXHA 5MDHA 3TXYA 3NHFA 4PYMA 1EDBA 4CF4A 4Q7EA 5A6SB 2V8BA 1NQAO 4G1BA 3RUPA 4AS2A 1VG1A 4MYTA 2QORA 3VPCA 3HI6A 1ISHA 1YZFA 5FPSA 3RYIB 1T1IA 5MHTA 3VJKA 4ZQGA 2OB2A 4W1PA 1BHSA 1NUUA 5EWLA 3S44A 4E08A 3AVPA 1TB4A 3D7RA 4X1IA 5J2UB 3WDLA 4OL0A 3T3DA 1AUPA 4U0JA 3OJLA 4HNVA 2I76A 5KUTA 1FW6A 1NVBA 2NUPA 3TNJA 4S1VA 3VR2D 3VNSA 2YBDA 4W4TA 2C4KA 4LVOA 1JQEA 2I4IA 4U2FA 1NUPA 2ZB2A 5DASA 4ZU6X 1SUPA 2ZTVA 3C7KA 1TAQA 3FDXA 1JG4A 2B7BA 3N6XA 3T5MA 4AKSA 4ROTA 4NPAA 3WSWA 1OI3A 2X4LA 1M6YA 3K2BA 4D98A 4TTVA 1Y42X 4A8HA 1ZGAA 1OIWA 3BMQA 3GWGA 1RPTA 4IOLA 3T7TA 1P4RA 1YS4A 2VHQA 3ETJA 1D6NA 1X8XA 1YRAA 2QTLA 2WIJA 4XPZA 2WWRA 2GFIA 1A9XA 1K97A 3IIMA 2JH9A 5ELMA 3UB2A 2JHAA 4OQEA 1FDRA 4JXJA 1GZ6A 1LTKA 1E9CA 3DE5X 3Q1LA 3KUUA 5EA2A 4G5SA 2ZANA 3V4OA 3V8PA 4EG1A 1OHHA 1T5HX 1D2EA 3D2CA 4ZTBA 3FRHA 1W5BA 5T3UA 5EINA 3E6AA 5KOYA 4BJ1A 4OLHA 2DWPA 3VOAA 4FBMA 3ZWVA 3BJEA 4EVRA 4KMOA 4XDYA 2GK6A 4PLWA 3I12A 3PGKA 1HE4A 1YB5A 1JBEA 2G4VA 5AKHA 5IUKC 4KE8A 3SZ3A 3FUCA 2Y6UA 3L8ZA 5HRUA 3CRVA 4WLOA 3KTDA 3WNVA 4PPGA 1NAHA 1V6CA 4PCVA 4RKYA 4IHKA 1EQ2A 3CNLA 4U9IS 2Q6LA 2GK4A 3L2OB 2B61A 3LA8A 3O5AA 4N54A 4OIMA 3GO4A 4GZLA 5C80A 2XY4A 4P36A 2XZLA 3QQPA 3AW9A 3MUEA 4O08A 3MGBA 2OKCA 4MTLA 2C2OA 1V6SA 4QEDA 5AVSA 3AFOA 1LLFA 4NMHA 2IUUA 4CQLB 3KV3O 4QWWA 1LQUA 3GT3A 1LSUA 1LDYA 1VMKA 3BGOS 3FPCA 1RRMA 3PVSA 4KTVE 1T0JB 4D80A 1PBTA 3UJ6A 3S70A 4R5MA 5KEIA 3PFKA 3ILYA 3LFTA 1Z68A 2PJZA 4N7BA 5TMBA 4YYEA 3KQLA 1WZ2A 3N2KB 4ZJYA 4A8JB 1BFDA 1UC8A 4C5BA 4JYMA 1V3VA 4BKRA 3G2JA 4BEBA 1M0TA 4MW2A 4DNOA 5FX2A 4P4LA 3ZZMA 5CDTA 1E89A 3DP9A 2Q4OA 3UXYA 4BQFA 1E1MA 4DSUA 5A4KA 5HZGA 2KX7A 2HFJA 2IEAA 2OYSA 1EDDA 2HH9A 1KAHA 2XH8A 3ILSA 4GOKA 4UREA 2Z30A 3KAJA 3RUAA 9GPBA 3LBYA 1ZAYA 5E4YA 3O92A 3WVNA 4JP2A 5L3QA 3HY4A 3BE6A 1GSHA 3NH9A 1U7DA 4UHEA 1IOVA 1JJ7A 1U7WA 1DCKA 1COWD 1R64A 1X9GA 4IFBA 3C7DB 4IW3B 2YWCA 3RC2A 5JMTA 1DGQA 2CHVA 2VT3A 1BXGA 2N0SA 3CNOA 4X3PA 3W6NA 3R24A 3UJ3X 2LV8A 1L7RA 3SHTA 3BQ9A 2C2YA 3NYRA 1DRJA 4U2EA 1CJUC 1K86A 2E5WA 2FE1A 3ED1A 4DSAA 4F93B 4A36A 4X7MA 5AM4A 5GJBA 4N8DA 3PI6A 2CHQA 4H7HA 4ZP1A 2W8BA 4KPFC 1OC4A 3U0BA 4L51A 3THOA 1IU9A 1FBTA 1SCKA 1RWNA 1XAJA 2OGTA 2Z2KA 4XCXA 4X60A 5KSOA 1FNNA 5B4VA 1H1TA 1RHRA 1MB9A 3AEXA 1YOVA 1NY6A 3BRWD 4JSYA 1ORIA 1G21B 4LY0A 4DCJA 3VVCA 4BVBA 2DECA 2C5LA 3CNBA 5ALKA 2UZ1B 1GGJA 3R0IA 4PNEA 5HF9A 4CFYA 4HDCA 4LA4A 4XM1A 5C1IA 2VQFB 2C84A 4QNRA 1FNSA 1NVKA 2GARA 3BZWA 3RVNA 1I7SB 1V11B 3DZIA 4BAZA 4X44A 4X41A 2BFFA 1MZPA 1MEJA 3TKAA 2EF0A 4WCFC 1FCJA 4EA7A 4LRUA 1P0QA 4L5AA 3T1YB 2ZT7A 5AXDA 4I4LA 3ULKA 4G23A 1JDBB 4PS0A 4RCZA 1G98A 1P4HA 4UBJA 4UUAA 3WV5A 3OP4A 4Q37A 1AS0A 4D0NA 3W8EA 4KWIA 1JXQA 2YXPX 1EHYA 1CE8A 1GT6A 1ZIXA 1E6WA 1VI6A 1K5HA 2X4GA 2NZUG 4MW5A 4RDIA 4BFSA 1XPOA 2A92A 3AP2A 3BD8A 3UJPA 1CYDA 2FLWA 4H16A 1DZ3A 1ZPDA 2DFLA 2KBEA 2XRFA 2DQYA 2GA9A 1UDAA 1XZJA 3GRUA 2O2ZA 2AS0A 1D5CA 2WT9A 3E22A 3E7PA 4IZOA 4O4LF 2GASA 1G55A 3EG9B 5T4BA 2HNKA 1W4AA 1LV8A 2R5FA 2A1UB 2XJ9A 3A4NA 4KTTE 2IDKA 3R2JA 3CZPA 4EF4A 5LIRA 3H11A 5A3VA 3BRQA 3OY7A 1BEZA 1IWBB 5HK8A 1YULA 5H1YA 5HK9A 1FLVA 1R0LA 1XMQB 2GVNA 4WEOA 1BCSB 1V4VA 3HKDA 5T4HA 4W99A 4LF6B 4A1FA 4A10A 4CKCA 5HIKA 2PQ2A 1H2FA 1OGIA 3HLKA 4LW8A 4IP0A 4X1KB 3NXSA 5E7QA 2CEKA 1REQA 2OBXA 3F4KA 4MRMB 5FJIA 2RH9B 4HUQA 4DCCA 5B7QA 3I64A 1E1QA 2UYGA 3ND8A 3QPBA 2AFVA 4LI3X 3F8TA 2ZAIA 1T2VA 1EXWA 1RJGA 4ZT3A 5T8KA 1RKUA 1K7XB 3VPDA 2FG6C 1T0HB 1B1AA 1FSGA 3VNAA 3CNHA 4GVXA 5SZJA 4BTVA 2AF3C 3HDHA 3L4BA 1IOWA 3DHEA 4GSYA 4CF3A 4GBMA 5HSGA 3FJOA 3A27A 5DFAA 3EARA 1BKSB 4KKXB 4PYRA 5DI3A 3X0DA 1H1LA 3U7EB 3ZY4A 1MF7A 3GLGE 2VH2A 2MYTA 3QVUA 3ZHSA 3LT0A 4K9MA 2AF4C 2H07A 4BNLA 2NU6B 4LC9A 3FBGA 3LUBA 1P0CA 4IDPA 3VR3A 4B3HA 2ZTHA 2TSYB 3HYCA 4HNAA 1TXGA 2V97A 4P0TA 4L8FA 1EP2B 2G5PA 2N47A 2R60A 3CE6A 3KR2A 1G7TA 3KZMA 4KAAA 3TMAA 3V1KA 1IEWA 4E21A 1E4YA 2NV2B 2ZWVA 2PH7A 4GMDA 3LXMA 2XDAA 3RAEC 3SSOA 4L9RA 2HA6A 2SNIE 3L46A 3PR3A 4LZNA 2KWIA 4L27A 4NPCA 4YJGA 3SZMA 4E46A 2HQBA 4B5LA 4N49A 3U1VA 2GYUA 4MPRA 3JAKA 3QQ5A 5CIYA 1LZLA 5J2UF 3AUYA 3ECSA 4DHEA 4KPEC 1FRQA 2QMUA 1JLKA 2QZPA 5C46F 1U8EA 1UQUA 3JD4A 2JD2A 2VP2A 5ICMA 1BC5A 3GGDA 5NULA 2ZJ6A 4Z0NA 1QFZA 2H48A 1Y5RA 5SV2A 1ZEMA 3FTFA 4CFSA 3VOTA 1QIGA 4MGKR 3W2FA 5DIZA 2VYFA 3SQLA 4IGFA 5D6OA 1X6VA 3FSGD 2A5YB 4XA8A 5J5AA 2J5RA 3RABA 1EKXA 1QRAA 2FGKA 2HU5A 1YL6A 2WNSA 1YB6A 3UFXA 4EUEA 1X3SA 2UUBB 1RI1A 1MAVA 1ZMXA 1LB1B 1U5BB 3CEHA 3FTCA 3D5EA 3MCTA 4UKDA 3EZYA 1KEEA 5AIBA 3GVXA 1R0SA 2CB0A 4E4YA 2X8JA 3KL2A 3HN6A 3R0VA 4WLEA 5EP4A 3WSVA 3X2FA 5C8XA 5CBPA 3UK1A 2JFWA 4RV9A 4AWXA 4C2TA 2JJ1D 2XVXA 1RLIA 1XRMA 2VR1A 3SS7X 2FSIA 5C7LO 4UVGA 5KCZA 2BKLA 4K7JA 2GDJA 4LWZA 2F3PA 2Q5IA 3BF7A 1VL6A 3D8HA 3G9UA 2YQ4A 3HXPA 3JASB 4KQXA 4MULA 4MWZA 1P2DA 4OJTA 4MI6A 3ADBA 3AR9A 5BWCA 3K9NA 2QTVA 4TX1A 2FUCA 3AIIA 4GP9A 5F1YA 3RS3A 3K9FC 1NRIA 1RFGE 4GECA 1OLSA 4G0QA 4ND7A 3TSYA 2XCRB 1NMQA 3PHCA 1OPRA 2O2HA 4TT8A 2PSDA 1QGUB 1IB0A 1VE6A 2GQ0A 4UEQA 1XZEA 5KYXA 2J0VA 3JVIA 4LVNA 2HY7A 3HKEB 3ZWWA 3ANXA 3H19A 3CUYA 4R8VA 1CUVA 2WZCA 2W2LA 3S99A 1RQXA 3ZC3A 4BNZA 5TIIA 4MDFA 4FI3C 4MI1A 1R0BA 1MEOA 1N0UA 3PT5A 3FPEA 3PS9A 2PJUA 2Q3DA 1ADFA 1K9SA 1P77A 1ZRSA 4GL4A 4MOWA 4ZARA 2W5UA 3U13A 1M2FA 1NN1A 4AX8A 5ARBA 3I9KA 2RGCA 5CURA 1GOTA 1BE6A 4AG3A 4DDMA 2WR8A 1EBBA 1Q57A 1EBUA 4Q01A 3EVTA 4KMSA 4BVEA 1G5PA 2AKYA 1A4RA 2QRGA 4O2LA 5FWDA 1SXJD 3A25A 1KI4A 2OXEA 2N1MA 1QVRA 2SKCA 1HUQA 1TT7A 2ZJ2A 5JNRA 4JUIA 3HB0A 4B84A 1FMFA 1T5DX 1SCUA 3C6MA 3HJBA 4NYIQ 3KKOA 1DHRA 1K5PA 4BMDA 4BNVA 4S3MA 2EW1A 1UPFA 3LYAA 5K0EA 3THWB 1XTKA 1YBMA 4AL4A 1U5CA 5LZ9A 3ESDA 4R2WA 1CEYA 1VZ3A 5TGTA 2JGIA 4TSFD 3L0YA 1JG2A 2H1LA 5JNUA 1GPDG 3PRYA 3T06B 2VCHA 5JZOA 1FJXA 2B6HA 2HA2A 2WWHA 1EGMB 1B6RA 3H8SA 1LUAA 4RA6A 5IJ0B 2ZI9A 1H2HA 1Q83A 3PFFA 1F17A 5H59A 5M29A 2O8BB 3VSEA 1SVIA 1BKDR 4MGYR 3VKHA 3PNPA 2I6TA 1YQQA 1A5AB 2FVXA 4C14A 1HI9A 1V5IA 3PE4A 4YMSA 5DX0A 3DUFB 2CLDX 3KHSA 1DADA 3L5KA 2I3GA 4KX3A 2JIZD 1FP7A 2C83A 2HJSA 2QB5A 4P6VF 4WUTA 3B3QA 1SCDA 1S8OA 1N2CB 1QB8A 2ECQA 1VMAA 2YXBA 3NPMA 5ITVA 5JW6A 1E4VA 4AWBA 3GA0A 3UMCA 4NBNA 4MR9B 3G1TA 2P79A 2ZAOA 3THYA 4TTSA 2WB4A 5TMEA 2DBRA 3DDZX 1VP9A 2UV8A 4L50A 4EF6A 1B6SA 1EE2A 2OD9A 2WHEA 2XF8A 3LVQE 4B7CA 5EIOA 2FWIA 5H9VA 3WGTA 2PL1A 5AJYA 3S1AA 1KSJA 5ICGA 2Z2ZA 3CWQA 4ZTZB 4F1JA 4OY3A 2GZDA 5BN3B 5F7OA 3T1HB 1Q7CA 4P81A 4KQWA 2P6OA 5ERYA 3TQFA 3FCSB 2YIJA 4DBLC 4PXYA 2OMEA 3LT2A 1BVHA 4FYJA 1NJGA 1MZVA 2C1XA 2VJMB 4QECA 3ZWAA 5FP0A 1KJIA 2AR7A 1DKMA 2VH5R 1VIDA 3CLUC 3PR1A 2X7XA 4JLVA 4W1QA 1QF9A 1DIRA 1JJIA 1E1DA 3H9BA 3QUQA 4IIYA 4JJAA 4JLDA 4NMLA 3IV6A 1QFXA 3LUHA 2Q3FA 5D51S 2FZCA 4YJ2A 4Q6WA 2NZ2A 1T9HA 1L7PA 4MUXA 3ZBTA 3K70C 4UARA 3HUFA 2NYVA 3K0CA 5EE9A 3L79A 1AQIA 4KO1S 4OXXA 1X1DA 3KP1A 4BQSA 2NYAA 4BLUA 4CEJB 2Y1CA 3FR7A 3GLIB 1YZQA 3WNDA 3DD5A 4L02A 5BWLA 3KJHA 4IO0A 4DA9A 1IBRA 2PG3A 5DN6A 3UAZA 4DMUB 1I6LA 1OOEA 4PLTA 3KPYA 4IICA 5IKMA 4RK4A 4Y2QA 3FYHA 4FN5A 4GC9A 5ALLA 4PHHA 1GZDA 5KYYA 1WOYA 3RYTC 3U09A 2Q1TA 2YYZA 1IUNA 2OT3B 1S4MA 2EZ4A 3KKKA 5L3SB 2HRRA 3AXTA 4RACA 4QA9A 1Z56C 5KVVA 4FK8A 3A6EA 3PBKA 3FWHA 2GK3A 2H63A 4RQUA 5BV0A 2YMQA 3OO0A 4UEOA 4ZRMA 4G5RA 4C0LA 2CLEB 2QYOA 2Q45A 1KJYA 2PKXA 3M8KA 4WBNA 3GAFA 2W90A 3CEPB 1BGVA 3Q7IA 2VWGA 4RIIA 3QLVA 4CF6A 3Q9LA 4B4KA 3OMWA 1WUYA 4HDKB 4PLPA 1MRZA 3OQMA 1C3JA 1ZK1A 1WJGA 1E98A 2K2QB 2CLMB 3FKJA 4H59A 3F5SA 1AKMA 4HFMA 4IIEA 2IS2A 2E2WA 3WQQA 1VL2A 3QE4A 4ENUA 5KQPA 1UPTA 1J9EA 2Z5GA 4WHMA 4XX1A 5KS2A 4KQEA 2DLCX 1LQTA 2VAWA 1X8LA 4U39A 2VHYA 1FVXA 1GYPA 1ZZGA 1PNTA 2HZ7A 4RDCA 5J4LA 3TFOA 4KUHA 4RTSA 1B0AA 4JLPA 4HRXA 5DW3A 1TPZA 4PYNA 4HX9A 2PRZA 1E9SA 1DKQA 2ZI4A 3MN1A 4GX1A 3CJRA 4O02B 3WLSA 5I7VA 5JSQA 2CB9A 5LQNA 3UJ8A 3NLLA 1L4KA 5DB4A 3I8OA 1N6NA 1AGYA 2QTMA 2WMYA 4CCYB 4KLNA 2RKWA 2GPAA 4EABA 3KJZA 3EGDA 1KTIA 3KR1A 5C1PA 4QXAA 5FTWA 4EMUA 3H2ZA 1X2BA 1O97C 3OA0A 4HNGA 1JE0A 2IZZA 2X0IA 2A0WA 3FWKA 5CK5A 3FH0A 5G4KB 1X0VA 2CXQA 1PJZA 1PQYA 2B1QA 3B48A 1RJEA 3U7QA 3DWGA 3GK3A 5K7SA 5JNSA 3QF7A 4PX2A 4DV1B 2HDWA 3ECCA 4RVGA 5HRCA 4H2DA 2O2SA 3MD0A 3WYBA 2BCEA 2QMHA 2VSNA 1N57A 1TKAA 2FP4B 1NE7A 2BGJA 3U7GA 1RPNA 2QUJA 3EEYA 3OI7A 4WA7A 3TAHA 4EY8A 3BWDD 3EZXA 2AOTB 3FBWA 5JCXA 3U7JA 5B7NA 1VLHA 3C3YA 4A6PA 5LQJA 4XYMA 5KJFA 3FI9A 1FP2A 1HEIA 3DVLA 5EHNA 1GJRA 2XCOA 1RYDA 3X1MA 3RVPA 4KZPA 1R4NA 3HJFA 3H5IA 4CM6A 3H05A 1AE1A 2F43B 1GCOA 3EQZA 1FFXB 1RE1A 4X3OA 1ZM9A 3LLUA 3MQ4A 1PUJA 3NHUA 1NW5A 4NAUA 4BO3A 4D9IA 1OKKD 3G6KA 3DDOA 4G4SO 1MO6A 4NBTA 4AZTA 4Q9NA 2F8SA 2WD8A 4MV9A 4AECA 1CDOA 2WVJA 4B6JA 5CBKA 5FI5A 3GG9A 4WY5A 1WE2A 1U98A 3GZJA 1E32A 4BCBA 2NTJA 1KS9A 1W93A 1ZH8A 1EFRA 2DCUA 4N41A 4X24A 1BIFA 5I3CA 2V7GA 2IZ0A 3HFGA 4E09A 3A70A 3L41A 1UQTA 3EXG1 4XB2A 1L9KA 1QP8A 5J9FA 1KYQA 1DTWB 1HDRA 1ZWKA 2A33A 2B4RO 2AYXA 5JTTA 2E1RA 3VU9A 3BGDA 2QRVA 2GFQA 1E8NA 2JB9A 1JDNA 1YVEI 2FW9A 1EINA 5DXAA 3PUKA 2X5NA 2UZ0A 3B2NA 4H7KA 4CV2A 1V7QA 5IAAA 3GLGA 5BSVA 1DP4A 4N39A 4QVKA 4LJ7A 1RBMA 3EXIB 3ZV3A 1Z0JA 1FC0A 3CX8A 4K6KA 4HWSA 5EHQA 2WUWE 4ATNA 4EGQA 4BCDA 3VNVA 1J0CA 1VE9A 2B1IA 3EIHA 2DUWA 4ZXFA 1M54A 2E18A 1EPUA 3CZ9A 3G0CA 4O2BA 1S89A 2YMMA 5H83A 4QDKA 3ZD9A 3IIKA 2OFXA 1B8UA 4M1KA 2XCLA 5CYFA 1M2KA 2BAGA 2RGEA 2Z1NA 2MTBA 3T94A 1Z0ZA 4A73A 3E7FA 5G0VA 4DEYA 3CRZA 3U3OA 3I62A 5JYEA 3RTGA 3KZVA 3RRXA 3ET5A 4CV1A 1ZR4A 4HLCA 4EJSB 3ISTA 2R3SA 2QYSA 4LTMA 3T9CA 2BC9A 3SNKA 2A3RA 4FOSA 4QDTA 2H1OA 1QBGA 2AW5A 2EP7A 3BYZA 4HQRA 3IKJA 1WCIB 4U02A 5AKJA 3C3KA 5AKXA 1V96A 1XEXA 3B3JA 1XKLA 2P9GA 3C8DA 1XD2B 4MS1A 4IEFB 2WD7B 4Q21A 3GN1A 4Q3CA 5IPFA 2DPMA 4DWVA 1JL3A 1XZMA 3KCNA 3TJMA 1JS1X 4AG5A 4NULA 4PC6A 4BLSA 5JADA 1G64A 2H1RA 3N0VA 4IIJF 4P31A 5E7JA 4MYCA 3RR2A 4D8XA 4YRTA 2C5AA 3QVSA 4RS3A 2OHHA 2O57A 4E5VA 3QELA 3CPJB 3AKZA 4Q1AA 5ITSA 3TLZA 1JQDA 1PFYA 2IXTA 2SCUB 1SCJA 1U7ZA 1YVUA 1CS4C 1M2OB 2NOAA 3PD7A 4RGBA 4ZYVA 1ZEJA 5BWNA 1D2NA 5C2JB 1NSFA 4K03A 5F3DA 4HZUB 4EEKA 5LOVB 4JZYA 3V7FA 1R8YA 2AE1A 3P0FA 1B43A 1YUMA 1R66A 2E49A 3WA6A 2RJOA 2J9FA 1EVZA 3RFFA 3GNSA 2ZRJA 4JSTA 1I6MA 1UPCA 2H18A 3R5KA 1GWNA 3M1LA 1R9MA 1GRNA 4K8OA 1Z2AA 1CYEA 3V55A 1Q7EA 5DMXA 5F9HA 3D4BA 1I9GA 1H5NA 1S6YA 5C8YB 5JD6A 2FEPA 4EFDA 1CNEA 1FTSA 1U1DA 3ZI4A 2VS1A 5D84A 2B2XA 3OKFA 3V33A 3VR4H 5KTPA 2WWYA 1L4GA 2GEDA 2VUUA 5J1TB 4F5EA 1W0CA 3N53A 2FUG1 1D4AA 3T4PA 1KZHA 1E59A 2FSUA 5B6PA 2I66A 2BEWA 1RWMA 2KQUA 2W00A 2IXDA 2F90A 2RHCA 1TJNA 3IRUA 3N2ZB 1XZCA 4ID9A 4RHUA 3WG9A 4KBGA 4MA0A 2WFZA 5I8PA 2YQ5A 2X1HA 3AHCA 2IYYA 1J70A 2IVZA 4L95C 5DPMA 4DWOA 4IXMA 4Q1BA 2GK7A 2RK4A 3FYUC 2V3VA 2WJAA 1WZNA 1JQ3A 1GR0A 4JNCA 3VAAA 1BGXT 4RQBA 3AHHA 3ON5A 4P22A 2UVPA 4A2PA 1JDSA 1WHTB 3UNXA 3SLKA 4JT8A 5A0FA 4YEDA 1W76A 5DNYB 3EF0A 3KZKA 1W4LA 1ST2A 4WVFA 4X7BA 4JI3B 3SR3A 2BEVB 2CUTA 2O0MA 2C3UA 4AKHA 3H2JA 4BB5A 3JVEA 2J6CA 1AVTA 1QP4A 1SUAA 2V6MA 1QIJA 1W5SA 1DEKA 2YWEA 4A0FA 1IVSA 3BIWA 1CIJA 5U4QA 1HDOA 1A9TA 3PCXA 4O4JF 4JBYA 3NV9A 1OLUB 1ZQ9A 2YOGA 1YR7A 2A59A 1TTHA 1FPQA 2RK3A 1JYFA 3X2EA 4BX3A 3BH0A 3PRHA 3PNBA 1H5QA 3H5WA 4OHWA 4HVAA 3OG9A 1UC9A 3B3AA 2AG8A 3I58A 3LBHA 2IE8A 3KKNA 3HDGA 4H31A 3BDVA 1O08A 3NUZA 2BE9A 1RLMA 5G3ZA 4KO2S 1XCBA 3NJ4A 4QOJA 1TCAA 2PVCA 1E0DA 2D1SA 4TRMA 3O83A 2CXOA 3PNMA 3PPYA 1UXHA 3GEPA 4RVUA 4N8SA 4S2EA 2O8CA 5DXJA 1I3LA 2UUCB 2GAAA 4DCSA 4R9UC 4NBVA 4ZQBA 3TVDA 2C20A 1E58A 1VHQA 1P74A 2C4UA 3E35A 4BB6A 1U2PA 2PMEA 4KFSA 5D85A 4GLOA 1FTGA 4DMGA 2ODAA 4IJQA 2CHUA 4IVPA 2RG7A 4OB7A 1AZSC 3SC2B 4QE3A 3G82C 1FS6A 1VKHA 2R48A 4FHGA 4P3KA 1F6WA 4B3SB 2XADA 3A9TA 5ALIA 4CKWA 4WCFA 2VHWA 2JLUA 2CLFB 3RWBA 3V5NA 3PFCA 3AF0A 4UOEA 4MHOA 2A9OA 1E8MA 3RT9A 2P0YA 4CM9D 4V0NA 4RPHA 3HRIA 3N2NA 3K72B 5EIBC 1RKVA 3MTAA 5AI4A 1UBHS 5AKLA 3PI7A 1E61A 1PJ8A 1LI7A 3BZUA 5JXJA 2ZVQX 2MDTA 1EFTA 3TR6A 1GZSA 1MABA 3VR6D 2Z9DA 5AVYA 5MN5A 3AM1A 4C0JA 4CODB 3L4KA 5HMMA 2Y0CA 4PYLA 3CLRD 2OHGA 3IPLA 4W5WA 4YRCA 4F7WA 4WOJA 4LV8B 2FRDC 5DK4A 2DPHA 1QDUA 1I36A 1OPXA 2DF8A 2ETXA 4KOAA 3WJ7A 1QNFA 1XD9A 3FB4A 5K3DA 3ABIA 4LZPA 2AZMA 4TWBA 4U2CA 3H97A 4KGZA 1MW9X 4BFZA 4CLOA 1FFAA 1XEWY 4E32A 1KRXA 3WYFA 2G6TA 1TM3E 4EHFA 1ABEA 5G0UA 4FM9A 3NHMA 5AK6A 2XMQA 2QZ9A 1JR6A 1R8JA 1NV9A 1X7ZA 1U4SA 1ZXLA 4KH0A 1K8YB 4RDXA 2Q5FA 1JKFA 5F52A 2GEBA 5HF5A 3DQQA 3DKPA 1PLLA 2XHZA 4DC1A 3HWWA 1A9ZA 3RBVA 5ILGA 2WIBA 4JC5A 4A6EA 1TZ2A 2X76A 2SECE 2FQ1A 3BXGA 3J7AC 3UTDA 1PJSA 3T4UA 6NULA 1AURA 3AVQA 1ZRHA 4BU1A 1PWEA 3OEHD 1KL7A 2J3HA 1E5VA 2B4KA 5AK4A 5TEVA 2M6KA 3T7KA 3U40A 4BO4A 4CM8B 3P52A 4LI0A 4ARZA 1JALA 3QI7A 2MR6A 2P67A 4CLRB 5HTKA 1QAMA 3K4HA 3GDWA 5LBUA 5HE8A 3DOHA 3HO8A 1QHXA 1ZLYA 2K7ZA 3DA8A 4WLUA 3B20A 4I9HA 3RJTA 1C0PA 3J7TA 4AN4A 1GDHA 4G8CA 4XIIA 3SC4A 2HFKA 3SQNA 4ID3A 5KOJB 5KWIA 3SKVA 2AYYA 1XMSA 4AX4A 4YUVA 2VDNB 1XRPA 5E1DA 3A05A 4QULA 4C0XA 5AXAA 2GKSA 4LFAB 2ISCA 3DTVA 2Y1XA 3TLXA 4P4UA 3ZNNA 3HBJA 3WIUA 5TS2A 1NW8A 5IC5A 3FHTA 1YQGA 1SULA 2CDCA 1TM1E 1XJCA 2XMRA 1W1IA 3BKXA 3IV7A 3OOJA 4K6OA 1Y33E 3TZ6A 4L16A 1B41A 1M2EA 4G09A 4DUGD 1UKVY 2B5VA 4OGFA 1N5LA 1PW5A 1XYYA 1SURA 2A9JA 3FMOB 4DQXA 2ZREA 1KQGA 4BQNA 4Z51A 2HJWA 3SU8A 4X7PA 3JALA 4LDRA 3UWDA 1WETA 1VIAA 4OPMA 1TD9A 4BNDA 3D54D 4G5GA 1IM5A 4IR7A 3LC7O 1MQ8B 5EAIA 2ZYTX 1AXGA 3NX4A 1Z2NX 1OXKB 2PL5A 3U3KA 2B8TA 2BFPA 5F98A 5LOVF 4U63A 2C2WA 2Q27A 3GNQA 4ASUA 4AJLA 5FBRB 2JI8A 2V7TA 3EHEA 1G7CA 2P5SA 3TAUA 2YDYA 4H35A 2VRCA 2JHPA 3HO1A 2Q5EA 4MDHA 4DA0A 5ESWA 5DHAA 4BN0A 4UJ3A 2YN0A 2W43A 1SGWA 4ZOBA 5TNXA 4DLRA 4LDQA 1M8JA 3ZY5A 4YRPA 3QBJA 5CHEA 4B6OA 4P84A 2Q5HA 2Y2VA 5MGNA 2BR3A 1L1RA 3E3OA 3FKSA 3O2NA 4BC0A 1BHJA 4BZPA 1N7IA 2YNMC 4RGQA 5FTKA 4EKIA 1Y1TA 2XCSB 1GG5A 1Z4NA 2FLKA 2P30A 4N5HX 4QYTA 5JPCA 4G0VA 4CR8A 3WKDA 2ALJA 3IEUA 5FI1B 3PB3A 4I66A 1PWXA 4ADSG 1S2MA 1BH6A 1JWAB 1S0UA 4YN3A 3WGQA 4BWVA 4D4KA 1YFKA 4BWYA 1EJBA 4MV4A 2XKKA 3DE1X 4R0NA 1Z4IA 1XSEA 2YIVX 4E14A 1EUCB 2XYPA 2Z6VA 3ZGZA 3A4VA 2AX4A 3JQ6A 1L8OA 1D4FA 1L5ZA 2AN9A 4KXYA 4CEIA 3DZHA 3P19A 3K31A 2HKIA 4X6LA 4JLBA 3M6VA 1E2PA 1JG3A 1J7JA 1YR8A 4S1PA 1G8AA 1KSFX 2QJOA 7GPBA 3GBSA 4I3GA 3I2JA 4L4XA 5E9JA 2FN3A 3AJ8A 2AI1A 3PQ5A 3WLEA 3U60B 1AXEA 1M75A 5EHZA 5LQUA 5KNBH 1FFEA 1XTJA 2WW8A 1ZGBA 3RSHA 3L06A