4AIIA

Crystal structure of the rat rem2 gtpase - g domain bound to gdp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
144
Chain Sequence
b'DGVFKVMLLGESGVGKSTLAGTFGDTYERRIMVDKEEVTLIVYDDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN REM 2
publication title Structure of the Gdp-Bound G Domain of the Rgk Protein Rem2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Gtp-binding protein
total genus 51
structure length 144
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4aiiA00
4PXAA 1ODFA 3L0IB 2VHUA 2OO7A 2IUSA 3ETLA 4OBEA 1YVDA 5G3YA 1IXRC 1DAGA 1NN5A 2FOLA 2QT1A 2FJUA 4U00A 2O8CA 3RSLA 4B33A 5BWMA 2EFDB 1XD2A 2CE7A 5BXQC 1ZU5A 4DWJA 4NYJQ 1GNQA 3U4QB 1Y3AA 2QN6A 1CP2A 3CH5A 1TEVA 3LVQE 2IYVA 1FX0A 1QDEA 1IJFA 4LC1A 1FP6A 3LBNA 2ZYTX 3VHLB 5JJLA 3CRRA 3RVBA 3LXRA 4P32A 2ODWA 3NVAA 1B23P 5H70A 3K0FB 5M04A 1XXHE 2J1LA 2R65A 4V0MA 4CYMA 3SQWA 1KJYA 2NOAA 1E9DA 2J3EA 3SDZA 1KMHA 4QGGA 4F4JA 4Q9HA 4A15A 1XBTA 2D4HA 1C4OA 2JJ1D 3VNUA 1XMSA 4LK2A 4MUAA 2HDNB 3A1UA 2F6RA 4QNRA 4JSYA 2QENA 5AK0A 2ZSFA 3SR0A 2PX3A 2FZLA 4AY2A 4M1MA 3B7GA 2AFHE 1VIAA 4QGAA 1VHTA 3RRMA 4C0LA 5KTYA 3ICEA 2XB2A 4D82A 3TAUA 1G7CA 2GVZC 4DCSA 1E2GA 1YHNA 2V9PA 2IXFA 3RRNA 4LGMA 1W47A 2NO1A 4KSCA 2QPAA 1VMAA 4URWR 3Q5EA 4E07A 5FL7D 1OH8A 2ZEJA 2P6RA 4ASUA 4EQ6B 3RWMB 1KI4A 1VYTA 6Q21A 4TZ0A 2WJVA 3ZIAD 4B3BA 1Z8FA 3NBFA 1NBME 4HAYA 1RE0A 3PEYA 4GBMA 5JS7A 3LW8A 1CBUA 2VP5A 4BLTA 3K0CC 2ODNA 1Z22A 4TYYA 2VF7A 1IONA 4Q9IA 3U3RA 1OSNA 2O5VA 3AVWA 1RRFA 4OI0A 4FINA 2KB0A 4JBXA 2TMKA 3OIUA 2ZI3A 4LRWA 4WIAA 5CDFE 4BFUA 2HF8A 2LKCA 1NBMD 3LBHA 4L5BA 2QMEA 5EQTA 1OH7A 4LSGA 2YJTD 1P2UA 1G8GA 2UZ3A 5B58C 3PR1A 4DLXA 1TAGA 4JLPA 2A3RA 1E4VA 1GL7A 4Q01A 1NMYA 5DE3A 4RZ2A 1FUKA 1Q20A 3BORA 2QBYB 1BH2A 2AD1A 4CVNA 2ZRCA 1FQKA 5E7MA 3TGPA 2RHDA 3THWA 4OI4A 5KSOA 1MV5A 2WOJA 1AQUA 1S96A 1E9BA 1KY2A 1NJFA 1DG3A 1KJWA 1RRGA 1NSFA 1LS6A 3LNCA 4QXAA 3A4LA 1F5NA 4B47A 1KMQA 2GZAA 5C2JB 4M1KA 2ZANA 1KJZA 1N6PA 2XX3A 5TMPA 5HTKA 4Z8YA 1AN0A 1T5LA 2DPXA 5H1YA 2GCNA 2GF0A 1E1QA 3FFBA 1GUAA 1LY1A 2GF9A 3QEJA 2J7KA 4M1YA 5KU1A 1PUIA 2REOA 2QP3A 4RKFA 2PX0A 4QKQA 4PC6A 1FTSA 3IIKA 2E9SA 3GLFE 3NHAA 3U6KA 2CEAA 4MGZR 2A9KA 2PT5A 4CRWB 3TIFA 3OF5A 1GVNB 3R20A 1BYUA 3SE0A 1GM5A 3BB1A 1E0AA 2JATA 2XEXA 3L0PA 3SBEA 2G1KA 3V4RA 4IDHA 4TT3A 3LD9A 2W83A 1P2TA 3NEJA 2W6ID 4HB0A 5GJVC 4LYAA 4PHFA 1QZXA 3K0AB 1HT1E 2QRNA 4D80A 3HYRA 4QM7A 4AKIA 4R98A 2DHRA 3A8TA 1A4RA 1G7TA 1YZKA 4MKGA 2IYXA 4DDVA 2D62A 4OHVA 3AUXA 4HB4A 4B44A 3CNOA 3TW8B 2PH1A 1JJ7A 3S1AB 1BYIA 5KDDA 3QKRB 1GITA 1XNJA 4LJ4A 4Q7MB 1ZM4A 4WVFA 1DAKA 1QHGA 3KXLA 3I1FA 5DLQC 1CR4A 2AXPA 4MYTA 3KKNA 3PEWA 2HCJB 1GTVA 1M1YE 3GFOA 4DB4A 4P4TA 4M53A 2W2XA 3KJEA 3U61B 1T91A 5JSZB 5JMTA 4FMCF 2WM9B 2QAGB 5G40A 2VP6A 4JT4A 2QQEA 4WOPA 5JWRA 4A8JC 2REBA 3TRFA 4UXHA 4OQXA 3BXZA 2D3WA 2R2AA 2YOGA 1IM2A 5EXPA 5HKKA 5JWOA 4L9SA 3BB3A 1VTKA 4TL6A 4CEHA 1J8YF 1ZNZA 2A5FA 1W4RA 3C5HA 2CLSA 3PEUA 4M22A 4Q7JB 4X8HA 2YWHA 1N5IA 2CLDX 4AKHA 1G5TA 3CPEA 2GJ9A 1OLOA 2J9RA 4US1R 1E79D 2C8VA 4ERNA 2RMKA 2HF9A 2NTYC 2ZRMA 4J0QA 4UNSA 3BE4A 4RZUA 3DVLA 2ORWA 1Z6AA 1R4AA 3QKTA 4O25A 3P27A 3B8HA 3T06B 4RFSB 2IYQA 3PFIA 5CLLA 1G21E 3CNLA 3TE6A 1CU1A 3R7WA 1E2MA 4YMSA 2NPFA 1JR6A 1E2EA 1NLFA 4EAQA 1ZC4A 1HE8B 3VU9B 1DAMA 4MKFA 4MYHA 4TLCA 4MRNA 1Q12A 2QAGC 5F3WB 4RD4A 1VYVA 4KXFB 5E3HA 4A6XA 2XGJA 1YU9A 3ZD7A 1ZU4A 2JLZA 1XEFA 4IEEA 3B6EA 4D6PA 1J2JA 3N70A 1ZNWA 2IYRA 2WWGA 1R10A 1TF2A 2OXCA 1E0JA 1QHHB 4OYHA 3GLIE 4C7OB 3MGCA 1ZC3A 4PPGA 5DH9A 5KPDA 3BB4A 3M0EA 3GJ8A 2HLDA 3K70D 2ZSEA 2EYUA 3W3AA 3PXGA 3E1SA 2DWPA 2EWVA 3GJ5A 2ZRBA 1BIFA 2VQSA 1K5GA 3EZFA 3X1YA 3IEVA 3OEHD 2GDJA 2O8BA 1EFRD 3AUYA 1DAFA 2CDNA 2P6NA 3GJ4A 2WMOB 2DR3A 1F6BA 2CVFA 3PG5A 1EXMA 1LTQA 2XJ9A 5JBQA 3HU3A 4Q19A 1XEWX 1UBCA 3T35A 3VR1A 3QPVA 3RAPR 4G5GA 3KQKA 1G3UA 1N0WA 4HI0E 4C0AC 4Q66C 4HLUA 4JIMA 4UJ3A 5LDDC 2PL3A 3IIJA 3U7EB 1SVMA 1GRRA 1KI6B 1QHSA 3I73A 4LC0A 4EKDA 1OKKD 2ZU6A 4NONA 2CJWA 3G5UA 2FU5C 3EARA 4EPXA 2QTVB 2RGEA 4BZXA 2QAJA 3A58B 4A9AA 1IJEA 2PBRA 2QG6A 1Z63A 1IXZA 5E7JA 2JLYA 4BFVA 4BQSA 1FFHA 1Z5ZA 1B0UA 2ZRLA 3SEAA 2IUUA 3X2SA 2CL6X 5HPYB 2C9OA 2B8TA 5DI3B 4Q4HA 1KK3A 1XEXA 1G6OA 2Z6VA 4I81A 4NCIA 2G0NA 5LB2A 1BS1A 4JS0A 5DSZA 5L3QB 3TBKA 3K9LA 1F60A 1ONBA 4P4SB 3QG1A 1RJ9A 4ZI2A 5BN5A 4OHYA 5AR1A 5JHHB 3OIYA 3C15C 4KU4A 3KDSE 3CM0A 3GEIA 4XVRA 2OUKA 4B3CA 1RFLA 3DPUA 4TL7A 3CRQA 4DLSA 2HT1A 3KTAA 4GFDA 3ADCA 1E2LA 4LJ6A 4US2R 3IHLA 4PC2A 3U44B 1KAOA 4ESHA 3LAWA 4NH0A 1OHHD 4JLAA 1GNRA 3UPUA 3NDBB 1T0JB 4B6FA 1L8QA 2N42A 5CYOA 5JRJA 1ESMA 4QHTA 2ZYUX 3LDAA 4EJSB 5FBRB 2QE7A 1II0A 2OEPA 4Q7LA 1M8PA 3BS4A 2XTMA 5SZJA 3JVUA 1TEXA 3Q85A 2VSOA 3A1SA 2NZ8A 2YWEA 4LBWA 3MCAA 2A5YB 2CCGA 5BQ5A 5F9HA 1MKYA 4G3XA 1NKSA 2ZR7A 1DAHA 1KIMA 4DSOA 4HATA 1TPZA 2Z83A 2MSCB 4XTRA 2B7CA 4XOIA 4MYCA 1R5BA 1GSIA 1Q0UA 2J0UB 4EIWA 1OT3A 3W8NA 1N6NA 1IN4A 3MUFA 5FOXA 4P0TA 1KI8A 2BCJQ 3M4YA 2RHMA 4DIDA 1Z6YA 2UVQA 1R2QA 3DEFA 2J0QA 2WHXA 4RD0A 3SI7A 4YMUA 4LV5B 3GP8A 1EX6A 2QPTA 2R8RA 1Z0KA 1K8RA 4FMCB 2WAYA 3UMSA 1CKEA 3KKOA 3FKSD 5IK2D 2QSZA 2OCBA 5G53C 3UXMA 4DJTA 4GNKA 2Z43A 4IVQA 4KV9A 1XDBA 2DBYA 2WKQA 4OHZA 3BD9A 4DXAA 1W46A 5J4LA 4A82A 2C96A 5KSYA 2FG5A 3QUSA 4FIDA 1R8QA 2GESA 2IEZA 4QRHA 1JPJA 4DCTA 1G19A 3CWZA 3F5FA 2IK8A 4QHSA 5D3MA 4HDCA 3QXJA 3TK1A 2AFIE 1T8UA 3VR4A 3RS4A 4OQMA 4PSKA 2J59A 2V6IA 4F91B 1NL3A 4DLWA 5JS8A 4D81A 1KSFX 3EG5A 4Q5IA 4BE7B 1RYFA 4DSNA 2F55A 1G18A 2A5GA 2BDTA 1RW4A 2FDCA 1NP6A 5GVRA 3KL4A 3B1YA 4XJXA 3IDQA 3AP3A 4LJ7A 4LJYA 3QF4A 2F1RA 2BMDA 1GKUB 2WWXA 3EPLA 2VHQA 3M1IA 3WRYC 2ORVA 1UEJA 3KUCA 5EE3A 2BV3A 2ZI4A 5AUQA 3O8BA 1F2TA 2KWIA 3GD7A 4ZKEA 521PA 1WE2A 2WVJA 4JLDA 4LBZA 4IVRA 4P33A 1W5SA 2OFXA 4NCJA 3WRXC 2IYYA 4CGZA 4R2HA 1PV4A 2JLSA 3ASZA 2XTNA 4RD1A 3FHOA 1W44A 2H7VA 3GLHB 3BC1A 2GTPA 1NN3A 4LI0A 1FMLA 1N5LA 1R0YA 2ZITA 3PQCA 3RNLA 2PT7A 4QGHA 3CZQA 2WJGA 1G3IA 5CB8A 3THYA 1OFUX 4PZYA 4MYUA 2OFOA 3B9QA 3TUIC 1A2KC 4JMPA 5ANRB 2IYWA 3LQRA 1P73A 3SYNA 1O87A 4L8GA 2PLRA 1Q21A 5LBIA 1IY1A 4C0HA 1A1VA 3BFKA 1NN1A 3K0SA 1W0KD 4PC1A 3AH8A 2WIBA 3RDPA 4TQAA 1TL7C 1GP2A 1UF9A 1H65A 3EIQA 1GAJA 2OXRA 4ACAA 1P9NA 5J4VA 2D06A 3TLXA 1QVRA 5FTNA 1II9A 3IBYA 2X8AA 1KYIA 4XWAA 1P2SA 2PMDA 3HPRA 2XOKA 4A2PA 5DI9A 1TQDA 1VYUA 2ZAMA 2EFCB 1MABB 5FTMA 1DBSA 1XXHB 1KSHA 4H9GA 4D26A 1S1CA 4RFVA 1P6XA 2VTKA 1YZNA 2Z5FA 3PITA 4F4CA 1XTQA 3D6TB 1J8MF 5KSZA 5J40A 3A1TA 4POAA 3TSOA 4CF7A 4B48A 5KNBA 4LJ9A 1E94E 5AJXA 2RCNA 3FE2A 5HE8A 4RZXA 3U5ZB 3FHCB 3NBXX 2ZE8A 3FB4A 2OCAA 2IYSA 2VP2A 5AUNB 3A36A 3TNFA 3FHTA 1FZQA 4QG7A 3AB3A 3VHXA 2XXAB 1NY6A 1RIFA 5FBWB 2YHSA 1GIAA 4IRUB 3IPYA 1EGAA 4C9BA 2PCLA 2ZI7A 5FPHA 4JLKA 2DB3A 4QFMA 2FE4A 3CIOA 3EWSA 5JHGB 2GCOB 4TMTA 1N0UA 5EZ5A 4MA4A 3SFVA 5HKKD 4B2PA 2XZPA 3QF7A 4ZDKA 3QVVA 4AYTA 3ASYA 4A0HA 1QF9A 3W90A 1NLZA 4Q47A 5TVKA 1K5DA 4EPVA 4DT1B 421PA 3K0FA 5KNDA 1UKVY 2OAP1 2IYLD 4C30A 1FMJA 1NVXQ 1WQ1R 2CL0X 2VP4A 1Y63A 1CJKC 3QXSA 2QP9X 4DEYA 3PUZA 5GJBA 3IILA 4BRWA 2QPOA 2VA8A 1FUUA 2A2ZA 3H0KA 4DRZA 3OIVA 1OYWA 3T61A 1M7GA 1SULA 1N6KA 4URXR 1M7BA 1GILA 4KLZA 2H16A 4LUCA 3LBIA 4NHOA 4PFSA 5J5CA 4LPKA 2QQ0A 4ZKDA 5IF9A 5B2ZA 1S2MA 1ZM2A 2BBTA 4JKIA 4DUGA 2QMOA 3LV8A 3F0TA 4ZI3A 1D5CA 1A5TA 5EUQB 1E9RA 1R6BX 2ZJBA 3W8RA 1NF3A 1SHZA 4F93B 3DDCA 1EFCA 4M9XA 4BFXA 1ZD9A 2ZJYA 2GJSA 1S3GA 1DPFA 1Q44A 4EQ6A 3ZZTA 2OT3B 3HU2A 3R8FA 4PPFA 1AS0A 5KPJA 4Q9KA 3SYLA 5JECA 1XD9A 4YXWA 4NCNA 1GZSA 2H8KA 4WXPA 4FMDF 4DSUA 2GVDC 4TYNA 2OILA 2IXEA 1J70A 2R6GA 5ELXA 1W36C 3CH4B 3MJHA 3BAFA 3M6AA 5EXSA 5FOUA 3PENA 2ATVA 2FSGA 5SZKB 2FX3A 4GSYA 1Z2CA 3QKSB 2NO6A 4Z8XA 2QMHA 2GXAA 2KJQA 3NBYC 3OIWA 5L3RA 4JVMA 3AGPA 2IHYA 3GLFB 2A5DA 4GZMA 1G3RA 3IUYA 2LKDA 2FV8A 3GEEA 3I8XA 5GVSA 2QBYA 221PA 4BEJA 2RKOA 3CZPA 3D3QA 2BEJA 4ARZB 5DO9A 4Z51A 5JEEA 1SKYE 5FR1A 4AG6A 2HXYA 1SXJC 1D2MA 2MSEB 4LDJA 4RD3A 1G8YA 2LWIA 3NKVA 3RLFA 3BH6A 2A78A 2P2LA 3LX8A 3W5JA 2HYIC 3MJRA 3V4FA 2BIFA 3TQFA 5AJWA 1EWQA 3MMPA 3WBKA 4B3DA 2BKEA 4WW0A 2EFHB 1U0HC 1XU4A 1ZIPA 5DN6A 1RVDA 1EFHA 1Q3TA 2QU8A 2X77A 5FH9A 3QY0A 2ZJAA 2C78A 1QBKC 2H18A 4PTLA 4W5JA 2O8EA 1RKBA 3OFND 3CPJB 4LV8B 5SZHB 2WSMA 5IT5A 2D74A 5JWHA 4QJ3A 1VG8A 2ZUCA 4L9WA 4NYIR 2RGNA 3HPQA 2ZETA 3K0EA 2JIZA 4HSEA 3TKLA 4A8JA 4IFEA 1ZUHA 4LHXA 4PC3A 2KI5A 1IN8A 1W7AA 3AVYA 1T3LA 4JSTA 2FMXA 3RSOA 4NU0A 4BECA 3I62A 3Q7QA 1GG2A 2ZSAA 3G0HA 1ZM9A 2HXSA 3ZVRA 2D2EA 1JEEA 3K0AA 5DIFA 2OFWA 2GAOA 1QHNA 5DNYB 2ORIA 2O8DB 3NDPA 4PHGA 3QENA 1IN5A 1DAEA 5BYKA 4IDPA 4CEIB 1OH5A 4PQFA 4TSFD 5G41A 5UKDA 3FGNA 3DMNA 2J0SA 3VR2A 3BWDD 5FTKA 3S1AA 3QKRA 5FTLA 2JCSA 4EFMA 2JDIA 2CXXA 1SKQA 1KI7A 5EZ6B 4Q1EA 3AVPA 2C5LA 5DHFA 1M6NA 3WP1B 4AIIA 2QAGA 4B76A 5A5GA 4YONB 3CWQA 4A0FA 3K70B 3OHMA 1VCOA 1N6IA 2BM0A 2KSQA 2QP4A 121PA 3PUVA 5EP2A 4XVQA 2BMEA 4NMMA 3RYTC 4D25A 3K53A 1HUQA 1XCPA 2V55B 1MO3A 1VG9B 2V6JA 2W00A 3AGQA 3H84A 4ZCLA 3UIEA 1JPNA 3GLIB 4XSHA 2AKAB 2WZQA 3WMGA 1KNQA 1E9SA 1N5JA 2YOFA 4HB2A 4MGKR 4CEJA 3FKQA 2J0VA 2ANCA 4EFNA 1MOZA 1OXVA 5EXTA 2GEVA 3RS2A 1OH6A 1US8A 1OYYA 4TMVA 4US0R 2GNOA 4II7A 1G5RA 1KI2A 3HWSA 3EC1A 1ANKA 1W48A 1P3JA 4RFSA 4UNRA 3P4XA 4G5SA 2GJKA 4IVPA 3DMDA 2N1BA 2IS6A 1COWA 3CR8A 2E87A 2ZE5A 4B3XA 2WWWA 2WJHA 2ZU0C 1NG1A 2F1HA 2P3SA 2XITA 3LA6A 4ZIRB 1L2TA 3LRPA 3SC3A 4KVAA 3PV0A 3RWOA 3A1WA 2V7QD 2SHKA 3FPAA 3NIBA 4LHVA 3REFA 2WAXA 4P3YA 3OE7D 5IRCD 3GEHA 4GDFA 3FTQA 1DO0A 1V43A 3H1TA 3X1DA 1HY3A 4YDSA 4GL2A 2GBLC 2GK6A 1E98A 4TTPA 2WWFA 4Q4JB 2GK7A 3TUZC 1YRAA 3QIAA 4MRVA 5FBQB 2Q3FA 5C1BA 4CT5A 1TU3A 4BFWA 1G8FA 5DISB 1A2BA 1QHXA 2ZI5A 5FPTA 4B6EA 2DY1A 4D0LB 1KI3A 4OJQA 4TQ9A 4F92B 3AV0B 4ZCIA 1I2MA 2AK3A 5CYPA 3B5JA 2O8CB 2C9CA 1OB2A 4EUNA 2Q3HA 1GRQA 4KJZA 4DZZA 2XSZA 5EUMA 4F7WA 1LV7A 3N2EA 4DLTA 3P32A 3CRVA 3SNHA 4JLBA 4FXPA 4GMDA 2GXQA 3Q9LA 1E1RA 2ZRIA 1NIPA 3DM9B 4PHHA 1OFHA 4G0NA 2ZI9A 1XMJA 1KI6A 2X2FA 4JKYA 5AJZA 5FOSA 4DC9A 3QXHA 3RS3A 4H1VA 1E2JA 4Q21A 4Q4AB 4DSTA 3NG1A 2IF2A 4C0BA 4HAWA 1HQCA 1TMKA 1RZ3A 1XD8A 4PZLA 1GFIA 1KMHB 2UZIR 4HZUB 1WDTA 1KHTA 3LH5A 4I1VA 1TNDA 1BMFD 4ON9A 1AJEA 4F4IA 1J99A 1UADA 1I4LD 2RGNC 1JQJC 5DI3A 3EPHA 4N0EA 3FVQA 3AM1A 3BK7A 2GETA 4KFSA 4LHWA 1EX7A 4DEXA 1RC8A 1X8JA 2FWRA 4Q1AA 4NP6A 2BJWA 4P4SA 4UXJA 2ZROA 4M4SA 2OLJA 4MDEA 3EZ9A 2WWHA 1AGRA 2AK2A 2IT1A 2GHIA 4WZAE 1T9HA 4ILEA 2ZRAA 3K8YA 2BBOA 1GRNA 5AUPB 1EG7A 3U44A 4HAUA 1ZBDA 2VP9A 3KKMA 3SHFA 3EA5A 1RYHA 1PJRA 1GL6A 3B60A 4Z1MD 2ERYA 3DHWC 1H8EA 2VHJA 2XB4A 1AM4D 3T1QA 2G0TA 3T5DA 4D2IA 3U3JA 2ZE6A 4PQYA 3V00A 4EJSA 1T6NA 3DKVA 3MRSA 1GOTA 4XWKA 4URZR 4GT1A 3B2EA 2W0MA 2HT6A 1HYQA 1W4BA 2ZRKA 1KZ7B 3H2YA 4TLEA 1OIXA 1Q1EA 2OBNA 2NGRA 3EWAA 3LW7A 2DFKB 2FSIA 3QPWA 3D7MA 4AD8A 4E22A 4A0RA 3NWJA 5J4HA 1Z0JA 2DFNA 3T1TA 2A30A 3LLMA 1KDPA 2G3YA 1N6LA 1Z0FA 2P67A 2ZRDA 5A0FA 3I4LA 1XJCA 1TQ6A 5FBLB 3WNCA 3WXMA 1X1SA 2JJ2A 3MLEA 2VLIA 4UKDA 4R71A 1JI0A 2ZYWX 5DYIA 5HZKA 5KUTA 5KSPA 2IHBA 4U5XA 4UNPA 1KDTA 1OIVA 1Z06A 2YYZA 1F2UA 4FMBB 1CJUC 4B3GA 3LY5A 4DUGD 3NHBA 3DOEA 4I1UA 2QTFA 2QY9A 3AEZA 3RABA 5LD2B 2FH5B 3RS7A 4BFZA 4QBHA 1JB1A 4LX0A 2UKDA 2XNSA 3UMFA 2JLXA 4DLRA 3EX7C 2IEYA 1TQ4A 3TAHA 3X1ZA 2J45A 1LFDB 4YXWD 3B13B 3L8YA 4NYIQ 1Q1QA 2ZJ2A 3C7KA 4B2LA 1TX4B 5HCIA 3OEED 3KXIA 3ZVLA 2ATXA 2RGCA 4LBYA 4UJ5A 3KJIA 4TYPA 2RH5A 4HDOB 2YINC 3T1OA 5JZVA 2J7PA 1UDWA 1VHLA 3NTUA 1HE1C 4M21A 4QM6A 4DLYA 2OAQ1 1PLJA 3NEYA 4JBWA 3VX4A 4D4MA 3EPKA 3N2IA 3AVVA 1NIJA 5CK4A 4UQOA 4AKGA 2AN9A 1VCIA 3L0SA 3HYTA 4WZ6A 1VDZA 2ASEA 1DTSA 2ZJZA 1H8HA 4MKIA 3MFYA 5CJPA 1IN7A 1UAAA 2WICA 4URVR 1S4QA 4HAXA 4TYQA 1G9XA 3I72A 1G16A 3GCGA 1DEKA 1K6MA 3QXXA 1YRBA 4TZ6A 3GLHA 4A92A 2VHCA 2ZJ5A 3L43A 2GXSA 4HDQB 4DKXA 4A2WA 3FFAA 2RGXA 1OW3B 1YJ5A 2AWNA 2JAQA 1QRAA 1XEWY 1XRJA 3UWKA 4DLZA 1HA3A 1KKLA 2JGNA 1E2KA 3AVOA 4PSAA 2AKYA 3ZLJA 4PPQA 3GJ7A 2AX4A 1S8FA 4XTCS 4YC7A 4V0ME 2GA8A 1W1WA 4WAUA 2DFTA 2ONJA 5EP4A 4W5WA 1S0UA 5J4YA 3ZS9A 4OK5A 1I2DA 1RRCA 2JEOA 2JIZD 2I1VB 4C4PA 3H86A 2VSXA 2YC4C 5G3ZA 2ZAOA 4OL0A 1MT0A 2V1XA 4NCKA 2Y8EA 1L4YA 4TTQA 4DVGA 1N5KA 2FEOA 2V3CC 3VKHA 1D9XA 3W9YA 4MRSA 1KSJA 2C77A 2H1LA 3WNBA 5DHAA 4OK3A 2IS4A 1JR3A 2QI9C 4RZ3A 3UG7A 3VNVA 4JLJA 3IBGA 3DM5A 1KZGB 3QXCA 3U3MA 4PX9A 4DBLC 5FL7A 2F9LA 2W2VA 3B85A 2B7BA 3GLGA 5K8UA 2QORA 4D0GA 1U8ZA 2BMJA 2JDID 4S35A 4A2QA 3HP1A 1P72A 3WYGA 3VR5A 5JRZA 4EJSC 2FN4A 3GJ3A 3LWNA 4QJ4A 1OXUA 2NPIA 5FL3A 2ZXUA 1KNXA 1Q1ZA 1CRPA 2F1JA 3CX6A 3VR6A 1X6VA 3BGWA 4KCGA 2V8OA 1CTQA 1VCMA 4A4DA 4RJLA 4TYWA 4G5RA 5HCNA 1P2VA 1DOAA 3ONWA 1DG1G 5H8WA 4DT1A 2O8BB 4PO1A 2C04A 3IKJA 3KB1A 3UATA 1WXQA 2IWHA 1M74A 2YZ2A 2ZYVX 2J5XA 5CDFA 3LFUA 4E5UA 1DE0A 1WMSA 2QTHA 3SBDA 1NMXA 5SZIA 3LXXA 4LCBA 4RY2A 1T3HA 3WHLA 4N3NA 3ZVNA 2IYZA 3ZH9B 1P62B 2FFQA 2GJAA 3RANA 1COWD 3I5XA 3BFVA 1UJ2A 2OCPA 3AF3A 3KX2A 4IOLA 2O8FB 1DELA 2BEKA 5A4JA 2L0XA 1II8B 5TY0A 3UWOA 1CJVC 1SVSA 1IBRA 1ZM3A 1SXJA 1GKIA 2FFAA 4PC7A 4QBGB 4ZCMA 4JBYA 3UKDA 1GL9B 4KFUA 3NH9A 4Q4HB 3KQLA 4G01B 1AA9A 2BC9A 1PVOA 3MG9A 2O0KA 2F3TA 2ZPTX 1XPOA 2XAUA 3TSZA 1E1QD 1L7VC 2PMKA 2WBLC 2REXB 3Q7PA 2BHRA 1N6RA 3AF0A 3NC0C 4ZDJA 4Q48A 3KFVA 5J4KA 5L3VA 2ODBA 3PUXA 5FPKA 5K8TA 1RJ9B 3GPLA 1HURA 3C41J 4A0GA 1IQPA 2BKUA 3QKSA 4O3MA 2HEIA 2W6IA 2ZJOA 3I92A 2PZGA 2F3RA 4YMTA 2ODEA 3T34A 3GLFA 2BM1A 2VHTA 1HTWA 2R44A 1FL9A 4JL8A 1EK0A 3I8SA 1FNMA 1G3MA 2PLFA 3DZDA 3QOFA 4M2LA 4OJKA 3VKGA 3AQ4A 4OHXA 4TT3D 5EE0A 4M9QA 1XTRA 4AWXA 2XNDA 1U81A 3KJGA 3WYFA 3EPJA 3U2QA 1AS3A 1C1YA 4QHYA 4CW7A 3KUDA 3VX3A 1NG9A 3WHKA 1E1RD 2QZ4A 2IS2A 4PZZA 3BJIC 2VBCA 4RD6A 4V0OA 2CHQA 5KNCA 1QVAA 1Z29A 1R7RA 3K1JA 4QOSA 1ZINA 2AWOA 1G7RA 5FPSA 1G41A 4IHQA 2EQBA 2GRJA 621PA 1TUIA 4Q18A 3IEUA 1E99A 3EASA 5FOTA 1R5OA 1P5ZB 3E5HA 2PZFA 5HR5A 1OB5A 4BPBA 3RHFA 4C0QC 1LB1B 4IFBA 3U4QA 2WTUA 4PPNA 1KKMA 3JVVA 1E2HA 1NVVR 2OBMA 1WCV1 3QE0A 4EFLA 4AG5A 2K5UA 3T15A 4BLPA 2P0EA 2YOHA 1HV8A 1U2RA 3TJZA 1U94A 5K8LA 2YVUA 3U7GA 1I4TD 1S3SA 1T5IA 2IF0A 3HU1A 3OAAA 5L3SB 3P26A 4XSGA 5C4GB 4PQRA 2Z4RA 4I4LA 2QROA 1RPZA 2DWOA 4KITB 2AR7A 2O8DA 1DADA 2WKPA 1FNNA 3CBQA 4CEIA 1ZCAA 3ZD6A 3I3SR 1ZNYA 2ZSDA 2V54A 4JLVA 2ZVPX 1H8ED 3IIMA 4JJZA 1VKJA 3KKQA 2WIAA 4CDGA 4BRUA 4OQLA 1Z28A 3QF4B 1UBFA 1P9RA 2EW1A 4QNMA 3ADKA 4GP6A 1IN6A 4H1UA 3SJBA 4GZLA 2E1RA 1IY2A 3I61A 4X8OA 5K8IA 1U8YA 1TTTA 4L16A 3TR5A 1MO5A 3OESA 3ZGXA 1N2CE 1LF5A 1NJGA 4HB3A 1F2TB 1YR9A 2WSSA 4QC2A 4M9SA 3IQWA 2WJYA 2ZS9A 3CX7A 3A4MA 1EFUA 1DAIA 2I3BA 3P20A 4LYJA 2G1JA 1HEIA 1PUJA 4B34A 4BLSA 1Q57A 4TLBA 4FD2A 2OLKA 3OEHA 3DO6A 2D2FA 2B92A 1G4AE 3GLIA 3SS8A 2GBLA 2HLDD 2ZS7A 1XPRA 1U99A 3AP2A 4P4UA 1VG1A 4LYFA 2VF8A 1XCMA 4JL6A 3B9PA 3CPHA 2IC5A 2B6HA 3TUJC 3FMFA 4AYXA 3SOPA 3THYB 1OV4A 2V1UA 2GZDA 1MRNA 1FP7A 1G1MA 1P61B 1ZM7A 4KODA 4B71A 2WPDA 5EJEA 3TR0A 4JVNA 2C95A 4B32A 3EZ6A 5C4MA 3EZ7A 1IY0A 4XD7A 1ZP6A 3MWKA 1OKKA 2PEZA 3Q3JB 3W6OA 4XVUA 4V02A 4ZDIA 4OQNA 4AK9A 3BRWD 4M9ZA 2ZTSA 2G9NA 2Q9AA 3DOFA 2JLWA 2O0HA 4ZIRA 3QSYA 3PJRA 2G88A 2XZLA 4Q00A 3CX8A 1ZUNB 1Q3HA 3GJ0A 1YZLA 4K8OA 1JECA 3F8TA 4NE2A 4E03A 1UBGA 2J7PD 1XB2A 1UKZA 2J41A 1JAIA 4TMXA 2QEQA 3EW9A 3FMOB 4MITA 1R5NA 1SVKA 2C9YA 4I1OA 4TMWA 4XIGS 3R9WA 4FCVA 1Z6XA 3W34A 3UANA 4PAMA 4Q4JA 3K9NA 3ND8A 3W6PA 1G291 1H8HD 5H68A 1VCNA 2BBSA 2H17A 4IW3B 3EAQA 4IKEA 3AVQA 1NRJB 3ECCA 4B43A 1XTJA 1S1MA 4PR0A 3UG6A 3RS0A 3AKYA 2GEUA 1TF5A 4C0JA 4BUJA 1CF4A 1OHHA 2W0SA 1Z0DA 1KTVA 3AVTA 4LOAA 5EP3A 4ABYA 1XX6A 2YKGA 2RGBA 1ETUA 2Q9CA 5B57C 1G64A 4KVGA 1G6HA 4AKEA 4DCUA 3GMTA 5CM9C 2IWRA 2ZQ5A 1ZMXA 4N1AA 5JJKA 2XZOA 1E9EA 2O52A 2JLQA 1TU4A 1WP9A 2ZS8A 2MSDB 4BFSA 1O3YA 4ZV4A 2IS1A 4I99A 4DDUA 1OJLA 3BIFA 4LZZA 4Q4AA 2QE7D 2R9VA 2NZJA 2QNRA 2QGNA 4Y0VA 1UPTA 2EWWA 3W3ZB 2H92A 4HZUA 3W6NA 3KQNA 1JR3E 3U60B 3BBPA 1D2EA 4BGDA 4JVLA 1Q1BA 5JSZA 1CIPA 2PEYA 5HZHA 1A7JA 2BCGY 1XJQA 2AL7A 3KB2A 2GWHA 3SU8A 1UKYA 3GLGE 1U90A 4KLNA 3VFDA 4D4LA 1TUEA 2EFGA 4M1TA 2JLVA 2VH5R 1VECA 1F3OA 1E9CA 2OSBA 5KYKA 2P5TB 3FKSA 1QHIA 5IK2A 1NKTA 1JR3D 1JXOA 5D3QA 2HJGA 2F43B 4MGYR 1KI1A 3CUEF 1W0JA 5CM8B 4Q9JA 2WWYA 3QNUA 2ZRGA 3GJ6A 5JCZA 4L15A 4HUQB 2QT0A 4IOJA 3QI2A 2QUZA 4OHWA 2CMKA 5F2EA 3ICQB 4LJ8A 4WBSA 3F3YA 4PHTA 1HT2E 5LB4A 5B64A 1Z0AA 4RCYA 3DZ8A 1G7SA 5LPNA 3WBJA 1PLKA 4GI7A 4TL8A 1JALA 1E2DA 1CR2A 3BH7A 3CO5A 3SJAA 4D0NA 3VU9A 4GOXA 4EPTA 3WMFA 1YR7A 3CF0A 3MSXA 1QHYA 3UMRA 3MWLA 1NI3A 5BW8A 3K70C 2RGGA 1N6HA 3LQQA 4OK6A 5KDOA 3CF2A 2DWQA 4EPYA 1MO6A 1YZTA 4W5HA 2CVHA 3DL0A 2V4ZA 1W36D 2R6AA 3SQXA 3NBZC 3E70C 4DLUA 1OE0A 1QHHA 1D9ZA 3QKUA 2AD5A 4C7OA 3KFXA 4DCNA 3THXB 3CB4A 4OKSA 4LPSA 4TL9A 4AC9A 1SXJE 1Z08A 2Q3MA 3EA0A 1JEDA 3GJXC 3Q72A 4Q03A 4KO8A 5CIQA 2OCYC 3PEVA 4FCTA 1XJ0A 4MQBA 2IA5A 3QBTA 5GJWC 5KOYA 4S2EA 3SHWA 2VO1A 3A4NA 3BOSA 4YDHB 3Q5DA 3QEOA 2RGDA 4FMDB 1E0SA 4LV6A 4CZ2A 2GILA 4BZPA 2QL6A 5CLQA 1AZSC 1LS1A 2IX3A 2YV5A 3G82C 4KBGA 1SXJD 3B1VA 5E7IA 1W4CA 1W0KA 5GADl 1XD2B 2O8EB 3U7FB 5JLJA 2BJVA 1XMIA 2CNWA 1CJMA 1AIPA 1KI9A 1FX0B 1E2IA 1E2FA 1NVVQ 1IOZA 1YE8A 1TQ2A 4NPHA 4A8JB 4D4JA 3O8DA 5CB6A 1KO8A 3L82B 4BASA 1D8TA 2P5SA 3KXKA 4GPTA 3R9IA 4NBSA 1YQTA 3X1WA 4B35A 3I5YA 3T1VA 2EU8A 4TLAA 1T3SA 4V0KA 2AHOA 2W6JA 3WY9A 1NNEA 2EVWX 4PAOA 3BERA 1GKYA 2D7DA 2FF7A 1BO6A 4TWZA 1AKEA 4HAZA 1QG4A 1UM8A 3AKCA 4IDOA 4IDNA 4Z54A 2XOKD 1LNZA 2Q21A 4NCHA 4JL5A 2I4IA 1KO4A 4A6PA 3N5CA 2XNDD 2WV9A 4QJ5A 1SGWA 1CXZA 2R62A 1W2GA 5L3QA 2F1IA 1SVIA 1ZJ6A 2G83A 3OZXA 5BYJA 1ZYUA 2GCPA 2JLUA 3FMIA 1E9AA 4YMVA 2ZJ8A 3TVTA 2C03A 3EIEA 2IXGA 3C16C 1KAGA 1WRBA 1U9IA 4RVCA 1UEIA 2YWGA 1N3BA 2CK3A 5FPYA 1T4GA 5KDLA 1CR1A 4X8LA 1VG0B 3B78A 2X19A 1VIYA 2W2TA 3SJZA 4IOMA 3MD0A 4ASUD 1YZUA 4K81B 2WMNB 4ACBA 2GEDA 5JEDA 4PO8A 4BEBA 1QG2A 2LCFA 4LHZA 2FPMA 1AKYA 4CT4B 1WA5A 1GWNA 4XWOA 4HLCA 1KGDA 2ZR0A 3KQHA 1KY3A 1Z07A 2HJVA 3RS5A 1NN0A 4IDQA 4ESVA 4XH9B 5KHOC 2R6CA 3ZZ0A 1UKEA 2FFBA 3K9GA 1ELOA 4CEJB 4NYMR 3O47A 4N0DA 1US8B 1KK2A 3LX5A 4TMKA 3R8CA 3TSWA 4HYYA 2YC2C 4B73A 2J0UA 2NQ2C 1N25A 3PCRB 3OAAD 1YZQA 3ZDQA 4Q4LA 4LBVA 3THWB 4KYIB 5KO2A 1XP8A 4IXNA 1NMZA 5P21A 1CJTC 1XZPA 2J46A 4FN5A 2CCJA 4Q1DA 4WXRA 4P31A 3E2IA 4C0SA 4MH0R 1Z2AA 5FOWA 3D8BA 4O2LA 3MWYW 2JASA 2OE2A 3C4JA 5FUXA 1CULC 3AF2A 1E4YA 1OF1A 5IHPA 2ZRFA 3IO3A 2FNAA 2G6BA 2FZ4A 2IBMA 5EE1A 1KO1A 1G20E 2BOVA 1CLUA 4KSBA 3LLUA 4QGFA 3WP0A 4BLRA 4EPWA 4O0MA 4EDHA 3K9HA 1OFIA 4QBIA 1OXTA 1SVWA 1NY5A 2RAPA 4W7SA 3ZVMA 2WSSD 5AUOB 4NL4H 4M8NE 2NMVA 1XTKA 1FPMA 5FFMA 5FR2A 3U3KA 3U6BA 2WOOA 1Z47A 1OIWA 3KJHA 2PJZA 2PZEA 4NDZA 2QMUA 1A82A 3L2OB 3AF4A 2HYDA 3ND9A 4JLOA 1U98A 2GJ8A 5FI0B 2QM8A 2DYKA 4R7ZA 2Q6TA 4OQFA 2OESA 4LWZA 4PSVA 4BFYA 4LJAA 3X1XA 1WB9A 2WKRA 3T5GA 2OV2A 3K09A 3J81k 5C18A 2FPLA 4MGIR 3EZ2A 4M0LA 1HH4A 1OXXK 1KOFA 1AK2A 1X3SA 3O8CA 1SQ5A 2O0JA 2WPDD 2X2EA 4NZYA 1EFTA 2FPKA 3NH6A 4G5QA 2O8FA 5LD2C 4XD7D 5F9FA 2FFHA 2G77B 4B2IA 1XZQA 1II8A 2GZHA 2IL1A 3KKPA 3VMFA 8OHMA 2CCKA 1R0ZA 2R6FA 1L4UA 5FUYA 5AWFC 2NO7A 3D31A 2HUPA 3KQUA 1F48A 1FQJA 1ZD1A 4Y0AA 2VEDA 1PZNA 3QQ5A 5FTJA 1WBBA 4JLMA 1KO5A 3OFNA 3HJNA 2ZE7A 5HE9A 1EESA 2FEMA 3VR3A 4MDFA 3ZQJA 2QRZA 2Z0MA 4TN1A 4URYR 5DN6D 2ZR9A 4LHYA 1M2OB 3B1XA 4BFTA 2F7SA 2VSFA 4CEHB 1IHUA 1UDXA 4U7DA 1ZVQA 2W58A 2BBWA 4IXMA 5GJCA 1GDDA 1XTIA 4V03A 4PO9A 1AQYA 2MMCA 2OBLA 1FW6A 3IO5A 2ZSBA 3CF6R 3MAAC 1OFTA 5FUVA 2JJ1A 1P9WA 5B30A 3A37A 1D6JA 3IHWA 5IDVA 2QGZA 2HCBA 1C9KA 4URUR 4V0LA 3ADDA 4ZO4A 1MABA 3QJYA 1XXHA 4TSFA 5CITA 5JJIA 1BOFA 3R7WB 5BN4A 3AVUA 1U9IC 2YNMA 2VRWA 4LY6A 2ZUDA 3RRZA 2ZRJA 4AYWA 1ESNA 3A6PC 4HLDA 1BKDR 1KDOA 1ZD8A 5JI3E 1G4UR 4ITRC 2EFEB 2QSYA 4TQUS 2WJIA 4C2TA 1R8SA 2IUTA 4NKRA 1NVWQ 3I32A 3TMKA 3ZIAA 1LW7A 3SFZA 2FSHA 2XXAA 1UFQA 5JI2E 2OZEA 1KK0A 1KK1A 4M1WA 3ZJYA 4BWYA 4FCWA 4WA7A 4HZIA 5F98A 3ZS8A 1CR0A 2ZRHA 4K46A 1JQLB 1U8AA 2WWIA 4KFRA 1AGPA 4LJ5A 4NYJR 1P75A 5CJ2A 2IYTA 4HLQB 2GCOA 2CHGA 3CONA 2A5JA 3Q8XB 1NBMA 1G8HA 2DFLA 3CNNA 3EXAA 1F2UB 3DKPA 3EC2A 3SZRA 5AJVB 4HUTA 3GQBA 1CEEA 1DS6A 1CS4C 1EWRA 3CW2A 4CIDA 1W0JD 4A1FA 2ERXA 2P65A 1P7CA 4RKEA 5L3SA 3B1ZA 1ZIOA 1Z83A 4QL3A 4X8MA 5FI1B 4MKHA 5EE5B 1NLYA 2B8WA 1YZGA 2BMFA 4JYCA 4PANA 1CRQA 4Q9LA 4Q1BA 5TARA 3CRW1 4AI6A 4B75A 4RCZA 2JA1A 3IPXA 3W5IA 1JAHA 1JXMA 3U7HB 3PVSA 4FWIB 3AP1A 2GXUA 2V7QA 4Q1FA 1ZNXA 4U02A 4V0NA 4L4UA 4ZPXA 4KYUA 1E96A 4GRAA 2CBZA 2VL7A 3A1VA 3GFTA 3OE7A 1E9FA 2CJWB 3HR8A 1SKYB 2ZRNA 3C8UA 1X8LA 2ANBA 1HQYE 1J90A 1X1RA 1R0XA 3GFPA 5JCPA 2NG1A 1XFAA 4BLQA 4YMWA 1MH1A 2ONKA 2FGKA 1P60A 2MMGA 2XJ4A 1T8TA 4M1OA 1XEXB 4YQFA 3AVXA 4GOJA 1Q22A 1FOEB 2NO0A 4C2UA 3CKLA 2BVNA 4IJMA 1PLLA 1RRPA 2CLCX 2X1VA 4GP7A 1E69A 5CIWA 1G3QA 3VQTA 4B74A 1N0VC 4DDTA 1G8PA 1GNPA 4TMZA 2FA9A 3SYKA 2CHVA 3O8RA 1FTNA 2ZUBA 3K09C 4E09A 3H4MA 2B21A 2QA5A 4Q02A 5DYGA 2DCUA 3REGA 3KTAB 4HLUC 1ZCBA 1W2HA 3FOZA 1SHKA 1IXSB 2OHFA 4F38A 2WJJA 4UNQA 4ZDWA 5TB5A 3THOA 1U0LA 1OXSC 3KZ1E 1J7KA 2Z4SA 2XSZD 3RC8A 2PCJA 1W49A 1KSGA 5E95A 4ARZA 4C3ZA 3L8ZA 2GAAA 2VP0A 4DDWA 3IGFA 1E32A 1XWIA 2RGAA 2CNWD 1KDRA 2RB4A 4NYMQ 1XTSA 5CK5A 2C99A 1BMFA 1E6CA 1TADA 2D7CA 4Q7KA 2W6JD 3LVRE 1XF9A 4W9MC 3PIRA 4QBFA 1Z6GA 2IYUA 4FW9A 1Z0IA 1Z3IX 3TVDA 1E2PA 4JYBA 4M1SA 4NTZA 4RD2A 2ZM5A 3B1WA 4KFTA 1XPUA 1D2NA 1T0HB 2YWFA 1MRSA 1X8KA 4TLDA 3ZQ6A 4BZQA 2Q9BA 4A36A 1S9HA 3WNDA 1E79A 2PJRA 2A7QA 4EPRA 2ZREA 4RSGA 1WBDA 3GLGB 2H57A 3BFXA 4B3FX 3R9XA 2N46A 3ADBA 4I1SA 2NO9A 2Q0HA 4C0KA 2JJ8A 3CLVA 1IAQA 1MO4A 1TF7A 2C98A 1N6OA 4MUBA 2CK3D 2EYQA 3P1JA 3VAAA 1W5TA 1E2NA 4Z1MA 3UK6A 5C46F 4HEJA 5D3MB 1W4AA 2QM7A 4KAXA 3TH5A 4DIEA 2XTZA 3VTKA 4DLVA 5TDHA 3JZMA 2VPPA 3LO5A 4MRPA 3HDTA 1ZAKA 4G1UC 1MR3F 5BN3A 2CL7X 4KHZA 3SN6A 5E4FA 1AZTA 2J87A 3PUYA 4O2RA 3K0CA 1UBEA 3RRYA 1W36B 3CR7A 2GKSA 2ZI6A 721PA 4DCVA 4JZKA 1E3MA 2P6UA 1KO7A 1YR8A 2KE5A 3ZYCA 5L8VA 2FSFA 1NVUQ 3QG5A 1ZRHA 1JBKA 2FGJA 3L0OA 1DVRA 5JFGA 3NC1C 4DB2A 1DO2A 3EIHA 3PUWA 3RC3A 2HV8A 3TW4A 4GMXA 1ZW6A 1V5WA 2VYFA 3C5CA 5EXXA 4JJKA 3FDIA 1XCGB 1YKSA 5AJYA 4D4KA 4FI3C 3IQXA 4HAVA 4WZBE 1P4SA 3BH0A 1SVOA 1SVLA 2JJ2D 4KBFA 4TTRA 2R6DA 1EFRA 2F43A 4AURA 5FOVA 3AF1A 3V9PA 2AXNA 3QBVA 3WMEA 1LVGA 1G5PA 5DGXA 1JJVA 1S9DA 4OI2A 1SXJB 1NSTA 2VIIA 2ZIAA 3FYHA 4HUQA 5FBVB 2OG2A 3AKEA 4PAQA 5TV2A 2BWJA 1X86B 4FWTA 1OPXA 1LF0A 2F9MA 4JLNA 1M34E 1U0JA 4UNNA 2ECKA 4IOKA 3WYAA 3HR7A 5FUWA 4GOKA 1WF3A 3OEEA 4IEIA 1Z6TA 5EP1A 4R9UC 5TXGA 4JVSB 1R0WA 3T12A 2OM2A 2IW3A 2I1QA 4LYHA 2ZRPA 1G17A 2JLRA 3SJCA 1M7HA 1JNYA 3QPUA 2KBFA 1E2QA 3B82A 3QVUA 4R2IA 4OI1A 4BLOA 2H5EA 3FMPB 3VKWA 3NXSA 3ZZUA 4KI0A 3TQCA 1E0KA 2ZVQX 3U3OA 1DARA 2CE2X 4MRRA 4DHEA 3CRMA 2C2HA 4YLGA 3GLHE 2KBEA 3MWJA 1AS2A 3THXA 821PA 3P4YA 3FWYA 5J47A 1YR6A 3AKDA 2NIPA 4G5OA 5EE9A 1ZUIA 1XMVA 1SZPA 4UXIA 3C14C 1I4DD 4JT2A 3JZAA 4Q1CA 1VPLA
chains in the Genus database with same CATH superfamily
2PXCA 2I4LA 1ODFA 1V6AA 1JKMA 3O7MA 5CHYA 5FLEX 3VHXB 1CDEA 2EZ8A 3REQB 1IXRC 1Z82A 4JVOA 2PANA 1BAPA 2QT1A 1DLIA 4TMYA 4JQCA 1QGYA 1P0QA 1TOAA 3BGSA 3ORYA 3N0XA 2YXPX 4DMRA 1KZYC 1XD2A 4JP8A 4RYDA 1Q50A 1UQUA 3KQWA 5BXQC 1VJ1A 3G49A 5JW6A 4UFNA 1DT3A 4K2AA 3QEBZ 3RF7A 3ME5A 1Y3AA 1CP2A 2IYVA 3RVOA 3B3FA 4ZV9A 1MVOA 2ONCA 2QRJA 4LWOA 4FB5A 1IJFA 4LC1A 2GASA 3LBNA 4JLSA 5JJLA 2E18A 3RVBA 3UAZA 1POXA 2Q2WA 2XCOA 5BSWA 4P32A 2ODWA 5ICCA 1J0DA 5KYTA 1NA5A 3K0FB 2CC2A 1K5HA 4K6MA 2CNDA 3WZLA 4FP9A 4DRXB 3THSA 5BPHA 2YJNA 1OASA 4O4IA 1TCVA 2NTJA 4QGGA 3IULA 2IW1A 3FTPA 3QBDA 1JFVA 4Q9HA 2JJ1D 3ETGA 3JQ7B 1I4WA 4LK2A 1X1EA 4MUAA 3A1UA 4CCWA 2K7FA 3BYZA 2OV1A 1P7VA 4Q1VA 3STUA 2FZLA 3BIWA 4AY2A 4M1MA 1QG6A 1YJ8A 4TV8B 4Z9XA 1Y82A 3EHEA 2I78A 4QGAA 3RRMA 4DXHA 3FWHA 3PK0A 2BN4A 3ICEA 3F4BA 3B6KA 3CVVA 3IHKA 1GLVA 1E2GA 1SIUA 1YHNA 4KMRA 3NRCA 4NARA 4E07A 2BFFA 3W4KA 2PFGA 4ZT3A 5FL7D 3T7EA 3AVWA 5IT4A 3V6LA 2ZEJA 4CN8A 2ZXEA 4Y9UA 3S8EA 2P6RA 1F4PA 1LPPA 3FLAA 5I9TA 3RD5A 1OI7A 3G6KA 4NENB 3ZIAD 4AP6A 1A4UA 1VHDA 1JGTA 1XO1A 1Y7TA 1NBME 2AZXA 1K2VN 3STVA 5HFAA 4XE5A 5K51A 3VSCA 4QOEA 1U7WA 4JK3A 4P81A 4BLTA 1Q1AA 4CLOB 4RTSA 1G20B 4ISCA 1SBZA 1PJQA 3IBCA 4L7VA 1RRFA 2P4SA 3D6NB 1C41A 2OMEA 3F6RA 4ZZIA 3M5DA 1X8XA 4GC9A 4NY1A 3SCZA 1E5DA 1U1IA 3AL2A 4JBXA 2ZI3A 4RORA 3QVJA 5JISA 1JAXA 2IITA 3CB2A 4XEHA 1QC5B 4L5BA 2ZFUA 3GVIA 4CU5A 3UHOA 4LSGA 5TR9A 1G8GA 1T3TA 3UK0A 4JLPA 5L51A 3K2IA 3U5TA 4EOGA 4Q01A 4ZEWA 3HZRA 1NMYA 5DE3A 4RZ2A 3T38A 1FUKA 3BORA 4WFIA 1BH2A 1LXCA 1K6XA 2JRLA 3BJMA 3TL2A 2PPLA 1FSZA 4LSZA 2VDRB 1YOVB 2C3PA 1C0KA 2RHDA 3E7WA 3OLQA 4RNCA 1B6RA 2WOJA 4ZXFA 3B6MA 1K2WA 1NNUA 1KY2A 4JR0A 3ZWOA 4RY9A 3VU0A 1NJFA 5J43A 1ONOA 1DG3A 1KJWA 1RRGA 1YB5A 5FP0A 4BMOB 4YWJA 2B1IA 4EF5A 4F3CA 1LS6A 5IVPA 3A4LA 3DAGA 1NFRA 1DINA 3L7MA 4P5EA 3DAPA 2DHQA 4R5MA 4QPDA 2GI4A 3F5DA 1JAZA 5SY4A 3BMNA 3FI0A 5FJIA 1ZLXA 2EX4A 4G4SP 1AN0A 2RHRA 4FQ7A 3PWTA 5FBHA 5H1YA 4YMGA 1ML3A 1HFKA 1JDVA 3FFBA 4TS4A 1F14A 4KG7A 4Z49A 3FVTA 4JQOA 2QI9F 4EI2A 4N9QA 1PGQA 3L6RA 4M1YA 2NSYA 1EI9A 1T0IA 1GADO 2QP3A 3ZI0A 5BSMA 1KARA 1U0OC 2AJDA 3C1AA 1HWYA 5AM3A 1E61A 3OQBA 3IIKA 3R8XA 3PNVA 3T4PA 2WW8A 3N87A 5AJHA 3ZCRA 1DDGA 4MGZR 2A9KA 1MVNA 5D6NA 3OF5A 4WWHA 3R20A 5LP6C 2CXOA 4MI1A 4WCFC 3BB1A 3BWYA 3IOMA 2F59A 2QTBA 1BMQA 4JXKA 3KOOA 2ZUUA 4BQEA 4HFNA 2IUYA 1JZSA 1P2TA 1HO3A 3OT1B 1EBFA 2QVZX 1YDMA 2Q99A 4KQ1A 4D80A 3L7IA 1JJFA 2WLTA 1I6KA 2QD4A 1HF3A 3LUAA 4JA0A 4CKCA 3AUTA 1G60A 3NM5A 2RIPA 1ZMTA 4C4YA 3D0KA 1QZUA 1U7TA 1YZKA 1MB0A 3CZMA 2Y1CA 1JQEA 2QUKA 3DTNA 3E9EA 4NNOA 4OKIA 4EL0A 3ILSA 4HWRA 4JENA 4QJIA 4OHVA 1BDBA 5LVAA 3KJZA 4WJZA 4F96A 3TW8B 2PH1A 1JJ7A 3IB3A 2D8AA 3QKRB 4ZQFA 4PN7A 5C8YF 3OTIA 4P86A 3KXLA 1RQNA 3SZUA 3BG5A 2WU1A 5AHKA 2DECA 3ABSB 1F7VA 4U7TB 3JQFA 4S2UA 5ED0A 1QYCA 1RWNA 4P4TA 5JR3A 1EFKA 1LLDA 2C4WA 5KEIA 3KJEA 3WDSA 1NW8A 4LXYA 3K5PA 5DWVA 1VJCA 5JMTA 5G40A 1JTVA 2E5LB 4WOPA 4MYRA 4A8JC 1WDWB 3TRFA 3OTHA 3D5EA 2VDVE 3IJ5A 3L8CA 4A26A 5HKKA 4IWNA 4U2DA 1D7OA 4KXWA 4EYEA 2H29A 2QX7A 4MEAA 1V8DA 2A5FA 4UD6A 2UUCB 2IV2X 4JI3B 1W4RA 2XHZA 2CLSA 4X8HA 3IUPA 2C0PA 1UT8A 2CLDX 1OVMA 1QH8B 5IARA 3U7QA 2VN8A 1Q0RA 2QZZA 2HM7A 4NNJA 2GJ9A 2RAUA 1OLOA 3A1CA 2C8VA 2RJ3A 3KT0A 2F8SA 1G2PA 2YMQA 5CFPA 1R8YA 3SIWA 5EIXA 1J8FA 3DVLA 1TI7A 1U28C 1Z6AA 4XDYA 1T2VA 2EDAA 2VNJA 1PFWA 3U4CA 4AQDA 1ZAYA 1RXVA 1Z5UA 3CUYA 1ODTC 4CFSA 4EITA 1Y6RA 4RFSB 5E9WA 4YP0A 1T2NA 2HB6A 4X95A 1P80A 4GOND 3CLRD 1N3YA 2EJBA 4L5CA 1IXYA 1E2MA 2R47A 4YMSA 4TTIA 1PD1A 4UE2A 1JR6A 2FPPB 1E2EA 3I2YX 4Y98A 5IJXA 2YV4A 1KBQA 3HM2A 3N2GA 3I6IA 4MKFA 4WY2A 4MYHA 3VNAA 1EZZA 1Y8QA 3VXKA 4DQLA 3DQPA 3LPAA 3G0DA 1X74A 5JG7A 1VLZA 5DBEX 4L4SA 1HDIA 1TTQB 1MQ8B 3FROA 4LHEA 5E9JA 1Y9AA 3RARA 4BNJA 4DJJA 2VH2A 4E11A 1JHMA 2AJTA 2XCUA 3L79A 3RSGA 4CHTA 3B6EA 3DVQX 4GWLA 4D6PA 2WWGA 3C7AA 1R10A 3DEYX 4CQJA 1RCFA 2VWPA 3HBNA 1E0JA 2PKXA 5JFGA 1RJEA 3GLIE 4FZ3A 5DW0A 2NZUG 5FWAA 3PZRA 1B8UA 3IDAA 4EQZA 3BB4A 2HLDA 4XPIB 2ZSEA 5LUBA 5LMNB 1MNQA 5IF3A 2Q6OA 3O4IA 4FT4A 3DV2A 2P9EA 3LGAA 2EWVA 2V3VA 3GROA 1QHEA 3LVFO 4KPUB 3HV2A 3W5SA 2AG5A 4YJGA 5E3JA 1C0PA 1J1IA 4UUNA 1Z4PX 1OYOA 2JAWA 2VQSA 4H77A 5FXMA 5AHOA 4EGAA 5K0ZA 3R0VA 2DKOA 1ADJA 1AKUA 1MA3A 4LRUA 4P9NA 3S7TA 2XNJA 1DAFA 1F2DA 3SKXA 1TYCA 2JL1A 1J2TA 2WMOB 2DR3A 2JI8A 2IEIA 3HKEB 3RU9A 4ATNA 1LTQA 3JZIA 1EHIA 2XJ9A 3Q8MA 3ZDCA 5JBQA 1DWUA 3ABOB 3ANMA 4Q19A 2C4HA 1V16B 3QMPA 3LLSA 4BZPA 3B7PA 1QIGA 2FPWA 1N0WA 3EC7A 4TWRA 5AXCA 2IPNA 5HNKA 3PPWA 4UATA 1P1JA 2AZTA 1OXBB 2IE8A 4OV6B 2PL3A 5LDDC 1VL1A 1XNQB 2QLNA 1GG9A 2FR1A 2JH3A 3D8TA 3OZVA 1R0CA 1QHSA 3QVTA 4LC0A 3ZBQA 4EW6A 4YV2A 1OKKD 3RADC 4R41A 5TRTA 3NOVA 3CEPB 5EWMB 4XD2A 2I62A 4RMGA 4ZO8A 3TLEA 4URFA 3W04A 2FU5C 1JEJA 2ZW9A 2AF4C 2QTVB 4A2CA 2RGEA 4BZXA 2QAJA 1CB7A 3WLEA 4JGIA 3JAWB 4YA6A 1XVLA 2XD4A 4GPZA 4ZQBA 2CW5A 5E7JA 5KWEA 2IHKA 4BQSA 5HPYB 3A2MA 5LZ7A 1T1GA 5K0NA 1E6KA 1N7GA 2YBEA 2IUUA 3FPCA 3X2SA 3TFQA 4Q4HA 5D00A 4BQFA 5D01A 4OFXA 1CHNA 1E6LA 3PZBA 3UOWA 4WEOA 4L3OA 4R69A 5LB2A 3LUFA 1VB5A 2H4ZA 5DVZA 4B4KA 5L3QB 4HQ0A 3NBMA 3UT5A 1OZGA 1I0IA 2POQX 4LOKA 5FWXB 1FRVA 1EX9A 1WM1A 4KWCA 4BIMA 4OHYA 4B3HA 1XF1A 4KIGA 3OIYA 1V95A 4ZI7F 1IK6A 3KDSE 4IMPA 3CM0A 3H6KA 4NATA 2Q3EA 4K87A 1JHRA 3GPBA 3MT8A 3KL2A 4R3NA 4XVRA 2EQAA 3EFBA 3T0FA 1N8NA 1T2EA 3B3JA 4PYIA 2X0IA 3U44B 2JIOA 3GRUA 4UU0A 6REQA 4MAAA 1QAOA 3C7CB 2VTEA 4LJKA 4Q3CA 1QVZA 4HDKA 3VR0A 1L8QA 4DZRA 3L7CA 4QQ8A 4CDMA 3ROKA 3Q8LA 1VBFA 4OPMA 4WOKA 5A6SB 4R7TA 1NUQA 1FUEA 2QE7A 3NIGB 5AM2A 1YTLA 2OEPA 3EIXA 4OVKA 5SZJA 3PRYA 3UV7A 3VU8A 1ZXXA 3A1SA 4EVQA 2C1ZA 1KJIA 2A5YB 5EJ2A 2W2OA 3T1YB 5BQ5A 5CXUA 4N76A 4G3XA 4LI3X 4CLRB 2VZEA 5GP1A 2QRHA 4BNLA 1R6UA 2LBPA 1UPXA 2G1AA 2W6PA 4HATA 4OQZA 4UU1A 5IXYA 4LNAA 1A7KA 4XOIA 3BL6A 1JDPA 1QZZA 1GSIA 2QLMA 3S2IA 4WNYA 1OT3A 1RSZA 3V1NA 1QZ3A 4ZHQF 1T6XA 3U3ZA 4LF8B 2P35A 4IY1A 2HRQA 1VKZA 3FCXA 3WG9A 3UB3A 4ARSA 4HJXA 3IKVA 5DULA 4ZVVA 4QOJA 3MJSA 2W98A 2J0QA 4YMUA 5H9WA 1V71A 2H7XA 1EX6A 2PLNA 2R8RA 3I2IA 2HWXA 3NDJA 3U62A 4ZI5A 3KHSA 4ZAZA 3LSTA 3KM0A 3ZWYA 1CKEA 2F8TA 3ETHA 3AG6A 4HNAA 1NJ8A 2OCBA 3TDNA 3UXMA 2A9RA 5JY1A 3HV0A 2Z43A 4KV9A 5J4LA 2QM3A 4E5DA 4OBBA 4DXAA 1K8XB 5JS2A 1JDTA 4A82A 4BN0A 5B4TA 1YIOA 4RQUA 5KSYA 1H69A 4FYHA 2GESA 2IEZA 4B6QA 2BR5A 3GA7A 4G97A 1JPJA 3O3OB 4LMBA 4JOQA 1G19A 3F5FA 4QHSA 5D3MA 3S2EA 2AFIE 1T8UA 3LOQA 1OGIA 3L5KA 1EP9A 4EG5A 1I8TA 1K7CA 2JC3A 3NUZA 2NN3C 5JS8A 3UTDA 4Q5IA 2EZ4A 3GK3A 1WW8A 2C8JA 4HG2A 3VJMA 4DSNA 2D0IA 1CUYA 5BW4A 3G59A 1C8VB 1KY4A 1M34B 1V25A 2R85A 4IIHA 2FDCA 1Q0ZA 1KDYA 3E58A 3DB1A 3H11A 3OE4A 4LJ7A 2F64A 3MUNA 2PD4A 1JRLA 2BMDA 1EHYA 1ISGA 1GKUB 1LI5A 4E88A 1O5TA 2H11A 3OUUA 5I7UA 1PS0A 3VR5H 1GTMA 2ORVA 1REQB 1GHTA 1PJCA 3QWIA 5AUQA 1CUIA 3F6EX 3GYBA 3FCCA 3ZHRA 1NNSA 1OZ0A 4N4AA 3A6LA 3AERA 4QOGA 2WVJA 1ZOPA 5DN9A 3PWZA 4FFLA 3V8EA 5HZGA 4KNYA 4F4UA 5ITSA 3AYZB 1NJ2A 3MLAA 4KDFA 4NBWA 5BNTA 2I67A 1DUIA 2OV4A 3DQZA 2FEWB 1PV4A 3P5BA 2Y1WA 2HQBA 3ASZA 1OTYA 1WV1A 3I04M 5BORA 1MQAA 3FHOA 3GLHB 3VKVA 4YUZA 4DBVO 3RVQA 3ZE9A 4KXMA 4BE4A 3DNMA 1R0YA 3UGTA 4WKGA 3RNLA 1AF4A 4DGSA 1SD1A 2P9JA 3CZQA 3DOOA 1NQ5A 2JGEA 1QYXA 2Z3VA 3WICA 1JB9A 2IZ0A 3PA8A 4TRNA 5ANRB 3SLRA 1BCRB 3U4HA 2ODTX 4FKMA 2JKZA 3LQRA 1OTHA 1P73A 1VI6A 4REOA 2JCBA 1C9YA 1O87A 2BFNA 4L8GA 1Q21A 4MUFA 2A9FA 2LRHA 2WG0A 2CLMB 3MQFA 1I3LA 3BL8A 4OXNA 3RYFA 2YWJA 1BXZA 4CMKA 3OM1A 3D6HA 1EFVB 1GP2A 1TL7C 2BTQA 1H65A 2J33A 3EIQA 3SOZA 3EDRA 3SE7A 1DIBA 2VYCA 1GAJA 5ES4B 1RWVA 2OR3A 4KQEA 4LSMA 4XYBA 4LZAA 4D3XA 4FDVA 3CVUA 4AZVA 4UUQA 3VNQA 2X5XA 3WIBA 4BDSA 1RTKA 2PT6A 5A03A 1RZRA 4N8EA 4O5AA 2FHSA 1P2SA 3E82A 3VPDA 1PJAA 4RELA 5DI9A 3HO6A 1FMTA 1TQDA 1VYUA 4H35A 3V4PB 3NU1A 1XXHB 2PGIA 1S1CA 3AHCA 2Z5FA 4R68A 1I3NA 5BVHB 1FP4A 1FU8A 4P22A 3RVNA 5A9TA 3VNRA 1FMFA 4P58A 5SICE 1QK5A 1USIA 4CF3A 4LK3A 4LJ9A 1XHEA 1VOTA 3GAAA 4YRJA 3SJ7A 1SIOA 3KPVA 5HE8A 3EAFA 5J3JA 1UP7A 3FJOA 3MA0A 2AFHB 2J07A 4NMWA 3V4OA 1E1CB 3FHTA 1RMYA 1MRZA 4C6TA 3AB3A 3WGGA 3ZV3A 1RIFA 3QA9A 3H2GA 1I94B 4JI0B 1F0YA 1GIAA 4EA8A 1G0NA 4WNIA 3AEKB 5GOTA 3JWJA 1CE8B 4QSMA 3RS9A 1BFKA 3W5DA 1DIRA 4YB8A 4ER7A 3TFOA 4OMFG 3L7OA 3ROXA 1CUSA 3LY8A 3SXPA 5JMOA 5EZ5A 3ROEA 4FHCA 1SH7A 1RXUA 3EJWA 4MA4A 5HKKD 4XCQA 2XZPA 3QF7A 3W2TA 2X7JA 5CD9A 1NLZA 3Q3VA 3GFVA 1JH9A 4HDSB 1PS8A 3DEZA 1K5DA 1VPVA 4EPVA 2IPXA 3J7AC 2C2WA 1VI5A 4C30A 3SG0A 2CD9A 2CL0X 3EMVA 1Y63A 1ULUA 3S68A 4JI8B 3KUUA 3MN1A 1ITZA 4LY3A 1RD4A 2FDXA 2BLNA 3ADPA 3JR7A 4MLPA 5U4XA 5L40A 1JL3A 1KAHA 1Z4QA 4ID9A 2PRYA 4J4TA 2IVZA 5JFTA 1Y1LA 1JBEA 2ZATA 3HEAA 3T61A 1ZSYA 4B3GA 4AO6A 1YASA 1YI8A 2Y0BA 3E27A 1M7BA 3PGVA 5AM0A 2H16A 4N7MA 4ZKDA 4PFSA 1Q7TA 1C3OB 2Z4TA 4P53A 4BNDA 4KKXB 1JU3A 4DG9A 4DUGA 2QMOA 3KKZA 3F0TA 5B2FA 4EH1A 4EY8A 1GTRA 2P9HA 3FSGA 1UDAA 4FSHA 4PRLA 3G1WA 3JTMA 4RPGA 4IPTA 3HP4A 3UCEA 4F4DA 4MLDA 1TD1A 2IZ5A 3MOGA 5CG1A 4J0FA 4LTDA 4WVLA 2QRPA 1RQRA 1ZD9A 2GJSA 2JFQA 1Q44A 2WUDA 2ZJYA 4HDMB 3YASA 1FP2A 4RVNA 3ZZTA 3ENZA 3R8FA 2TRSB 5KPJA 1KH2A 2W6OA 4QOFA 3L5OA 3PDHA 5LC1A 4UTNA 4NCNA 2R6JA 2O2EA 1EWYA 4RDCA 3K15A 5BRNA 2IXEA 3T3OA 1MHPA 2NV0A 2DTXA 3AR3A 3G1UA 3TQSA 1W36C 3MJHA 3OCXA 1OOEA 3OKCA 4K1LA 3S40A 2FSGA 4MR7B 4U7WA 5SZKB 4AX4A 4D0RA 4IQ8A 4C5AA 1FQOA 1TUBA 2H9IA 2PX4A 2NO6A 2QMHA 4BO6A 3NBYC 1ADCA 3B2NA 5L3RA 1L1QA 4UDOA 1D03A 4B5LA 4ND6A 3GLFB 5FQOA 4D9HA 4RDIA 1K6IA 2FW6A 3MNFA 1G3RA 5FA5A 7AT1A 3ZXXA 2JHCA 2EBFX 1ZCZA 2G4LA 1WMAA 2C3YA 3KT3A 4C29A 5A5DA 5LP6A 1ZN8A 4L0DA 4WCFA 2IIQA 1PSDA 1V8PA 3TZCA 5FOQA 1U9CA 4UBIA 5D87A 1YQDA 2WIKA 1M1XB 1NNLA 2BEJA 1R27A 3CINA 4IRXA 4O8CA 2LR0A 2HXYA 2RHWA 2GGSA 1J4AA 1BTOA 1D2MA 2MSEB 4RD3A 4BQQA 1O58A 5CFLA 4JBGA 1XQWA 2HPZA 1DWPA 3PIDA 3QW2A 1PZGA 1A04A 1SCUA 3K8OE 1YVPA 1YH3A 1T9KA 1RXCA 3MJRA 1AKTA 5CGZA 3L05A 3A3OA 3E9MA 4WW0A 1YTUA 1F6DA 1WSWA 2L17A 2OP0A 3L8GA 3TI7A 3DEHA 4J0CA 2RHCA 1R64A 1ADYA 4QREA 5ALDA 5B1IA 5FH9A 2I91A 4MUEA 4JJFA 2H18A 2LVBA 4NH4A 1XSEA 4YQEA 4BAGA 1F9AA 2Y93A 1SXIA 2TYSB 2GEBA 4MIKA 1IDOA 3CLHA 3UJ8A 5JWHA 4MUIA 1UKCA 2JI7A 1U7DA 2P1ZA 2ZUCA 5L7YA 4YAEA 3K0EA 2ZETA 4LJRA 4A8JA 1N75A 2H54A 3O8OA 1OMOA 4FDMA 4WOBA 4BMSA 5JSKA 4W7IA 4IKPA 3MTGA 3S4YA 1F8GA 3NOOA 1K3UB 4GXTA 4ARIA 3TSAA 1AVTA 2JAUA 2RCYA 2BFCB 3BDAA 1GG2A 3GZJA 3IT2A 3W9SA 4DUYB 2D2EA 3K0AA 4L85A 3FOFC 4BKQA 1GY8A 4TROA 2ZWOA 3NATA 3DHEA 3PCXA 5EHGA 2GAOA 2JGLA 2ORIA 2PYIA 3NDPA 4FDLA 1IN5A 1GPMA 3PE4A 1YDGA 1U28A 5BYKA 2Z95A 3IAAA 4X1OA 1G2IA 2HJRA 2W2QA 1GZ7A 1JKXA 4IINA 3UJHA 3DYVA 4C87A 1PWXA 4TSFD 4DA9A 3QM1A 4EKIA 1HNNA 1KFJB 4MKZA 1GU0A 3VR2A 2RAFA 4KE7A 4R1OA 5HBGA 3SSMA 2O4UX 3KZCA 4J90A 3P0FA 4NAUA 2JCSA 4EFMA 1J97A 2H0RA 5ITZB 4GKKB 1UAYA 2CXXA 4OTZA 2PYDA 4PG6A 5EZ6B 4Z5XA 4CF5A 3VYSB 1HYBA 2O7RA 1CDOA 3HYNA 1M8GA 3AVPA 3A3YA 3N75A 4KQIA 5DHFA 3KEQA 4M89A 1OLUA 4WKNA 5IH3A 3AJ9A 3QFCA 2EX0A 3H2IA 1E18A 1KR2A 4B76A 3ZDEA 2FSPA 3CWQA 5F76A 5BWOA 5ISMA 3GLRA 3MOSA 3OHMA 3PDWA 1N2BA 4PNPA 3ZWNA 4M7OA 3PUVA 3LGSA 5EP2A 4MWSA 2QLFA 3BWMA 3JD0A 3Q0EA 4BATA 4DCMA 2UZ4A 2YL2A 1VIVA 4A16A 3S5UA 1HUQA 4FN4A 3VYVA 3SDBA 2V55B 4DSAA 3K9FC 2W00A 2JJMA 3T41A 4B6SA 5DBIA 1HEUA 1XE3A 2GBCA 1CZOA 4G1EB 4IGFA 2AKAB 1U3VA 5C4IA 1XQ6A 1ECJA 2J0VA 1U2PA 4Y1EA 2VDQB 2VAPA 5EXTA 4FB4A 3L1UA 1P5RA 2M6SA 5GZ1A 1OH6A 1OYYA 3I64A 4US0R 4O1IA 5GMOA 4II7A 1G5RA 1L4MA 1WOMA 3ASUA 3I9V1 1ANKA 1W48A 1IPEA 5DT9A 4HEA1 3C4QA 2WTNA 1MOSA 2EW8A 3D5QA 2HSJA 1RBZA 1XAIA 5AM5A 2E87A 4GVXA 3TFWA 4B3XA 1CCWA 3R0JA 2O20A 1ZI9A 3Q6NA 4INZA 4IQGA 3Q0TA 2Z5GA 3R4VA 3S2SA 4Z2AA 1NG1A 2P3SA 3PNYA 1T2UA 2CWWA 2NUAB 2D1QA 1L2TA 4FK8A 3T9CA 2VK8A 4E4RA 4ZICA 2X6QA 5DLYA 3PV0A 4OYRA 2BEWA 3AY6A 5JADA 4NI5A 4UZFA 5H4GA 5JNRA 4LHVA 2QS9A 3N7UA 5LQDA 4DMLA 3NKFA 3FWPA 4D0SA 2H8GA 1DO0A 1V43A 3IBSA 3L92A 1R9GA 4YDSA 2VAVA 2I22A 1NVAA 2AYXA 1CD5A 2IOFA 2DC1A 2VRCA 3TW6A 2WKSA 1TLLA 3KWFA 4JUDX 2FCRA 2BGTA 4EEXA 1T36A 4ER0A 4RC9A 5FBQB 5F7OA 2Q3FA 1D7AA 1RADA 2CVOA 3B70A 2C54A 3K8ZA 4CT5A 5AKJA 1WDMA 2PKQP 1A2BA 2ZI5A 4B6EA 1ZH4A 2B6NA 1ZGBA 2P3LA 3GFRA 4CLEA 1JIQA 3KZKA 2FE1A 3AI1A 3N76A 1V2HE 4F92B 1HNZB 2NU7A 3DSRA 4PIVA 4V0SA 3CW8X 1WUYA 3AV0B 4RGVA 4ZCIA 2IXBA 2QJTA 3NR2A 2J5KA 4DCCA 4GZ5A 5GPBA 4KNWA 1FVFA 5CYPA 3UAVA 5DBGA 4TV9A 2A57A 2XSZA 5EUMA 1RPNA 1P4RA 4DA0A 4YRBA 1LV7A 3N2EA 1BGVA 2O7VA 2Y1DA 4RDHA 1A95A 1T4CA 1VIDA 1WR8A 2WT4A 3G2HA 4FXPA 4JLBA 4Q15A 5JQGF 2F48A 3Q9LA 4EFDA 5LQAA 2ZRIA 1NIPA 4BWVA 5DPMA 4ND5A 3WAJA 3EQ9A 1JWAB 1W8DA 3DEIA 2AMLA 3AB8A 3UK7A 2W6NA 1JT2A 2IYOA 1F9EA 2OV8A 3VNBA 3FCYA 3UC9A 4DC9A 1EZ4A 1GPKA 1QGDA 3KFLA 1A7UA 4JB3A 3ID6C 1RWKA 3ENWA 3FY4A 5EHZA 1CS0A 3TEJA 4QUDA 1HFEL 5DTJA 3VPCA 1DBPA 1JZTA 4IZ6A 1U8TA 1UWVA 1RZ3A 3PVZA 2YQ5A 1WDTA 1KHTA 1JIVA 2AZ4A 3LH5A 4OJTA 4O4IB 1ULZA 4MQFA 1R6XA 1TNDA 1UFRA 2RDMA 3L02A 1RZRD 3FFXA 1JHAA 3AR8A 4GQIA 3IL2A 1JQJC 3MINB 3O9ZA 1UMBA 1N1DA 3QLEA 3V1LA 3WWZA 2CL5A 1UK8A 1H94A 2GETA 2HU2A 2OZLA 4AUNA 2B82A 4IJ6A 2Z2XA 1NUTA 1EX7A 2PG3A 4H3KB 3AETB 1Q95A 3RFXA 4Q1AA 5H59A 4YT8A 1H4QA 3BMQA 1X42A 1LDBA 1IEVA 1W30A 1TJ3A 1MIOA 3HMQA 1ISJA 2RBGA 1DKOA 3CWCA 3IPAA 3LDGA 4X61A 1TCBA 2OLJA 4RTOA 1Y4UA 1LGYA 1Y37A 3JQGA 1TJNA 2IT1A 1M67A 2JZOA 1DWQA 2CFCA 2WR8A 2QSJA 2Z8XA 3QSGA 4WKCA 3V9AA 4FHDA 2IXTA 2J6CA 3OECA 1TU0A 1Y6ZA 4FNMA 4ILEA 2XTAA 3UWPA 2VJCA 4PLYA 4UOEA 1XUOA 2VP9A 3A28A 1MORA 1UC5B 1EAYA 2X5NA 3HA2A 4EF6A 4XIYA 3SHFA 4RVUA 5HZMA 3BBLA 5IASA 2OFFA 1RYHA 1PJRA 1YDEA 2H0AA 3CISA 3IR5A 3HFSA 1P0FA 2VHJA 2XB4A 1NPTO 4BX8A 2RI1A 4PQYA 3L4EA 4EJSA 4Y2VA 3P2EA 2X7HA 3HBFA 1DRWA 2BMWA 2Y92A 1YS9A 2B3TA 3CZRA 4YUWA 5CD1A 4YRSA 3IDOA 2W0MA 4REQB 4MARA 3W8EA 5EXDA 4I3FA 2ZRKA 1KZ7B 3HN2A 2WD7B 3H2YA 3KCQA 4PZPA 5JZMA 4YUAA 4ILKA 2OBNA 4BJHB 4QFDA 4B6OA 3PNOA 2IHTA 3N2ZB 2FSIA 4AD8A 4A0RA 4JR2A 2X15A 3G2JA 4PSUA 2DFNA 1E3EA 3A25A 3HEMA 5F21A 5B7NA 3DO8A 4A6DA 1KHHA 1SCJA 1I01A 2ZRDA 4HDNA 3H97A 4NBRA 5CX4A 1TQ6A 1NBIA 1UBMS 2JJ2A 3MLEA 4WLOA 5EZYF 4QLAA 3SY8A 4Z7QB 4EUKA 1JI0A 2ZYWX 2AJBA 1QP8A 2ES4A 5GZ3A 5DM0A 2GK3A 2C2BA 3R5HA 2GERA 2IHBA 5EKTA 4F60A 4GOMD 3OCWA 4PX5A 1OIVA 3DMRA 1C7FA 4DUGD 5FFFA 3HB0A 4D41A 3PXXA 2QUJA 1GA6A 2QY9A 4G4SO 3AEZA 3RABA 4U39A 4BKOA 5LD2B 4QBHA 1CY1A 1FLAA 3EEYA 2UKDA 1CZUA 4QPCA 2XAAA 3G79A 4ZAWA 3UMFA 2JLXA 2PQ0A 2AMYA 1ULBA 3WGJA 4BOYA 4DLRA 5ALIA 1CUHA 1VA5A 1WUKS 4IZIA 1J33A 3WJAA 4CIYA 5LZ9A 3F6BX 3UEOA 3X1ZA 3HCOA 4RULA 5G1NA 3IE1A 1P29A 2C5FA 3ZCPA 4Z7OB 1EAMA 3NAZA 2ZJ2A 3B9BA 3CXUA 3LWZA 3OZUA 4RK7A 1T0BA 4B2LA 1HPLA 1TX4B 4DYDA 4RZHA 5KJCA 3AL0C 4ZVOA 3EXEA 3IAEA 3KLPX 3DTTA 5CVCA 4KTTE 5CCXA 4LF4B 1XKXA 3L46A 3Q88A 3OX3A 4DIKA 3T1OA 4DLAA 2J7PA 1JDJA 5FJJA 4QM6A 1IPFA 4HS4A 1AB6A 2HU5A 3UPDA 3QVGA 3WJ2A 4AIRA 2Q0SA 3OQPA 1EB9A 4TM7A 1PLJA 2HZBA 5KU7A 4B7CA 3HCAA 3EPKA 4N7BA 5CK4A 4MJXA 4BV9A 3BKXA 3P2OA 1H2RS 4XGIA 3L0SA 3MJ4A 2H3EA 4YTEA 3V7YA 3CNBA 1UT5A 3HDJA 4H17A 1CIVA 1EHCA 2HQOA 2W4QA 3PX3A 4Z9YA 2FLWA 3D1LA 2VWHA 3MFYA 5CJPA 1JPUA 5ER6A 1U0BB 1HRDA 1ZK0A 4OHRA 1Y4SA 3C8DA 2QGFA 1IHYA 3ZY4A 1K6MA 3K6SA 4TZ6A 1QOZA 2P4HX 3QPDA 2W2MA 3PJFA 4QYXA 4NQRA 2GXSA 4IUBS 4WHMA 3IXQA 1E0DA 4A2WA 3FFAA 3D81A 4MRMB 5TQJA 3O1JC 2AWNA 1QRAA 3MB5A 2OCXA 1MPXA 2Q4RA 4UVIA 1SU6A 5DKFA 3UWKA 2NZWA 2AI2A 2PO5A 3DDUA 4DILA 4F56A 1TAQA 4KPGA 4O0LA 1E2KA 4DAEA 5IWCA 2O2IA 4AAYA 3AVOA 4F0JA 5LKRA 5K3AA 3GJ7A 2AX4A 1S8FA 3JWGA 4V0ME 2O19A 1W1WA 3NEAA 4WAUA 3K2EA 3D02A 3U7QB 5IJZA 2F3UA 2QRQA 5T41A 5AOAA 2FP4A 2V4MA 3BTSA 5J4YA 3ZS9A 1WABA 1RRCA 2JEOA 1Q2XA 3QH4A 1JLMA 3A1DA 5JZ9A 3PNLA 2IIVA 1MT0A 5GONA 2HA2A 1PBTA 2Y8EA 4FNOA 4RNDB 1CJCA 3VPHA 2J9GA 1PYDA 1H42A 4UBLA 5H82A 4HXGA 4CTMA 2UVDA 2BHLA 3W77A 4O4LF 4J75A 3AWIA 5C8YB 3PDUA 3JATA 1DBWA 3KD2A 4GYJA 4YJ3A 5E4JA 2X0EA 4LZJA 5DHAA 4OK3A 3OPYA 3D3NA 2IS4A 3VNVA 3UG7A 3KQPA 4IF6A 1VBKA 4I6JA 3IBGA 4NOJA 1DCMA 3QXCA 3MK31 5JZSA 4B3RB 1TTPB 4I36A 4PX9A 2F9LA 4NOLA 5T8KA 2XUZA 1P44A 3VR2D 3RVDA 2JIQA 1RCUA 1WHTA 2QORA 2OO3A 1XLTC 1WP4A 5IFKA 1E1MA 2BMJA 2ZSIA 4A0QA 3G7SA 2VPIA 5D2CA 1SO8A 3I28A 4I46A 3H16A 4M38A 3DT9A 2RGRA 1OXUA 1OZAA 2GO1A 3EY4A 1VSVA 3AEYA 1L5HB 2JFUA 1Q1ZA 1QIKA 1L9KA 5CP8A 4EK9A 3M6MD 3DE4X 4MVCA 3N2KA 2JGAA 1CTQA 1E3JA 2XGMA 2CT8A 1PG0A 2NXJA 4XEUA 4TYWA 1X77A 3C6XA 4G5RA 3V1YA 2GKOA 4YJGB 1UOPA 3UPTA 3PNPA 2W6MA 1Z45A 2DBVO 1FX1A 1E7WA 1KETA 1YI0A 5ELLA 5JD6A 4RHTA 3FBTA 4AMZA 1ZNQO 4GYWA 1P2BA 1WEHA 4BQIA 4DT1A 2W2LA 1IWBB 4RPLA 3IKJA 1N2SA 4WKPA 3VMMA 1DC3A 1WXQA 3ABRB 5TE9A 4R81A 4P2BA 5H16A 2YZ2A 3DCNA 4XB2A 4CLXA 5F73A 5IM4A 5CDFA 1DE0A 1HOXA 3FTCA 3SBDA 1NMXA 5SZIA 4TX1A 4EYGA 2B1RA 3F6SA 4LCBA 3O1IC 1PSWA 1Y6JA 3E5NA 2IYZA 2JIMA 4QAJA 1JIIA 2D00A 1EFPA 1H1DA 2FWNA 2Q8NA 4D3SA 1O0CA 3G9ZA 2DOKA 1UJ2A 3BFVA 3OCZA 4WXYB 3ZKWA 4A73A 2FN7A 4GXRA 4IOLA 1HLGA 4KYTA 1U8FO 5IANA 4ZYTA 1VLQA 2VOEA 1II8B 2X76A 1WNFA 3JQDA 3PXDA 5A71A 1HFWA 1MP0A 5I8ZA 3UWOA 4EW3A 1SVSA 4TSKA 2ONZA 4IHJF 1GKIA 2IPAB 1VL8A 4PC7A 4QBGB 3CVYA 1XP5A 2PZ8A 1SA0B 1XZAA 4JBYA 4NV1A 3ZCUA 1J5EB 3LCCA 1GL9B 3VR4H 4YBZA 2B8JA 1RAEA 2X4DA 4GPIB 4Q4HB 1AHPA 3CF4G 2DLNA 1AA9A 2BC9A 3EE6A 3M5CA 4HEQA 4XQGA 4EHNA 2ZPTX 1XVIA 2XAUA 3HCRA 3M6XA 2PMKA 1L7VC 3RHSA 4UBOA 2YJ5A 4PPYA 5J4KA 4M7PA 2VRCD 3NC0C 4ZDJA 4MB6A 1L7DA 3KFVA 4Y1RA 3UT5B 4DJFC 5L3VA 1IVSA 2ODBA 3PUXA 2XMRA 3NP7A 5K8TA 1HURA 1IQPA 3QKSA 4LOHA 3M6VA 5IN4A 1BXGB 1HYGA 3QHQA 1Y9JA 8AT1A 3WA7A 5A7FA 8ABPA 4BP9A 1DQRA 2ODEA 1Z35A 1NI4A 2BM1A 4N54A 4DQDA 2YWXA 3RUPA 2H85A 2R7NA 3AZOA 4HQFA 2R44A 1DEOA 5ETJA 5IKOA 2R25B 2JAXA 1QNFA 3IAS1 4Z9AA 5FORA 3U4MA 1L4EA 1NW9B 2X9GA 1QKKA 2FXIA 2XMGA 3LX4A 4UE6A 5EE0A 1V1JA 1P1RA 2L19A 1QH0A 1FVHA 1ORDA 1U81A 2HY7A 5BN4B 1EIZA 1U4NA 2IOFK 4X7BA 4DXDA 3EPJA 1M2GA