4AIMA

Crystal structure of c. crescentus pnpase bound to rnase e recognition peptide
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
698
structure length
698
Chain Sequence
b'SPMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKIETINIPTDKIREVIGSGGKVIREIVATTGAKVDINDDGVVKVSASDGAKIKAAIDWIKSITDEAEIGKIYDGKVVKVVDFGAFVNFFGAKDGLVHVSQISNERVAKPSDVLKEGQMVKVKLLGFDDRGKTKLSMKVVDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase/peptide
total genus 168
structure length 698
sequence length 698
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aimA04
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aimA01
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aimA02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4aimA03
3GD7A 2WAQE 3PUYA 4LFCQ 1S40A 4QJFA 4Y52H 3K7AH 1N9WA 4DV1Q 1MKHA 4BXXH 3Q8DA 2F4VQ 4GN5A 4HIOA 3CPWA 3VDYA 1Q81C 1N33Q 2NVYH 4OX9L 2JVZA 2ZTDA 2ID0A 5JJIA 4WANA 4DV0Q 1UDOA 1VQBA 4O0AA 4Y7NH 1N34Q 5JEAB 2ZM6L 5M5XH 3CMAA 2OQ0A 3KJOA 5C0XE 5C4JH 1BBUA 1MJEA 1IBLL 4GKJQ 1ZTGA 1UDQA 3B6YA 4JOIA 5IY0A 2PO2B 4LFBL 2NN6D 2K5NA 1UDSA 2RF4A 3OW2A 2AKWB 2RHQB 2YTYA 2IHEA 3GTOH 2LXKA 3EBEA 4GOPB 1VQCA 4A3BH 4GS3A 3HOVH 4JC0A 1GKHA 1O7IA 2K75A 2E2IH 4B3TQ 1VQKA 1XPOA 1OYPA 2P2RA 2HH2A 2JE6A 1QUQA 4NBQA 2NN6I 1HNZL 3AEVB 2UXCQ 2B29A 3J80i 1GVPA 1XTDA 1L1OC 3PV0A 1B7YB 4LFCL 4IFDJ 1PH4A 3CC7A 1DTJA 1VIHA 4GLVB 2I5LX 4LF9L 2NN6E 1EC6A 1ASYA 4A3MG 4BA1A 2F4VL 3FP9A 1HZAA 1PYSB 1WE8A 3CCLA 2C38B 3HOWG 5JEAA 1VQIA 1N34L 2NVTH 4JV5Q 4R4IA 4JBWA 3DD6A 1UE5A 4A75A 4YWKA 1TWGH 2MQHA 4X64Q 4YCWA 4JVYA 1H95A 2JJQA 2MJHA 5JEAC 4OWXB 4DR4Q 1OXXK 1XJVA 3TS2A 3HOUG 2VS1A 4IPCA 2D0OA 3HKZE 1K83H 1G6PA 2K5VA 2LXJA 1KC8C 2YU9H 4B3TL 4PG3A 3K80C 3AEVA 3F2BA 1V43A 4GOPC 2NVQH 2KCMA 3M7NA 2N49A 3RNUA 3ICEA 1PHJA 2VQEQ 3KF8B 2CWPA 2OPVA 3S17H 2B63G 4LUVA 1FJGQ 3M3YH 1M90C 3S1QH 3OYYA 2D0PA 2NN6G 4RG1A 4B3RQ 5JEAD 3ULLA 4JV5L 3DLLA 2MO0A 3I4MH 1CSQA 1PA6A 4DV6L 2Y0SE 4IPHA 2EQSA 1GO3E 3U1KA 4A3IH 2N78A 2ALYB 1CKNA 4DR4L 1U0LA 4GN4B 1SFOH 4DR6L 4AQYQ 2UXDQ 3M85A 2PMZE 2MNAA 4HJAA 4FDBA 5M3MH 4POFA 1J5EL 3HKZG 4IJLA 4L5SA 3UE0A 4GN3B 3UDIA 3E9HA 4IJHA 2BA1D 5M3FH 2VQFQ 3A5ZB 4DV3L 1FL0A 1X4MA 1NE3A 3J81i 1L0WA 5IP9G 3W1GA 1X55A 5K36E 2VQEL 1E22A 3S15H 2KHJA 4BY1H 1HR0W 2I0QA 4LF7L 1FJGL 4JVHA 1Y1WH 2XGTA 5J3BA 4DR7Q 4DR3Q 3CCUA 5C0XB 1YHAA 4J15A 1J6QA 4B3RL 4A3GH 1Y1VG 2UUCQ 4BBSG 2CTKA 4A4IA 2GVBA 2Q2HA 1YI2A 4LF8Q 1XPUA 1VQ4A 1XMQQ 2Y0SG 3CMEA 4YHHL 1JMCA 3M85D 4R4QA 4BY7H 2JEAB 1Q46A 2HHHQ 5HGQA 1VQEA 1IXRA 3H0GH 2PY9A 4BBRG 4HIKA 3KOJA 5DLQE 1E1TA 3STBC 2R92H 1C9OA 3GTMH 3CCRA 4H02A 5JEAG 3ULPA 4KLKA 4DR5L 3GMEA 3I55A 3TQYA 4DKAC 4BXXG 3NELA 4LFAL 4IFDA 4NXNL 4OONA 1ZZKA 1IBMQ 1UE1A 2GVAA 4DV2Q 4NXMQ 2I5HA 3CCVA 3U4VA 2ZJQA 1X6OA 3T1HQ 1CKMA 3CCEA 1HNXQ 4GLXA 5IYCH 5AJ3L 4QMFB 5C0XF 5C0XC 5C3EH 3TS0A 2OCEA 1AH9A 2AWNA 3PF5A 1X9NA 2BA1G 1PH8A 4LWCA 4GLAC 5JJKA 1HJPA 1R6MA 2RHSB 5FLMH 1YVCA 2YTVA 1I50H 2BH8A 4A3BG 4WALA 3HOVG 1QVCA 1K8AC 3BJUA 4X62L 3J7A5 2QA4A 1EYGA 1GM5A 2A19A 4OWWB 4JI0L 4A3JH 1Q1EA 1HNWQ 3PGZA 3PSIA 4O2DA 1SMXA 1VQHA 3CCSA 2WP8J 2NN6F 2NN6C 2PO0A 1Q1BA 5C44H 2QNDA 3LGJA 2Q2IA 4K0KQ 2JE6B 5BR8Q 2L15A 4IFDD 5C0XD 2V1CC 3M85G 3RLFA 3J80c 1ASZA 5E7NA 3G6EA 4HJ9A 4GNXB 5GAGC 2FXQA 4R4CA 3RZOH 3GDEA 5M5YH 2OQKA 4BA1B 4YCUA 2CTFA 4IFDI 5C0XI 3JC66 2Z6KC 1FVIA 3CF5A 4DUZQ 1WFQA 3TREA 4GKKQ 1I6HH 3GTQH 3GTKH 2CTMA 4OO1A 4IFDE 3UE1A 1HZ9A 1GD7A 4AIDA 4KHPQ 5K36B 3AFPA 3TRZA 2JEAI 2MFIA 1EUJA 3RLNA 4LIJA 1PVOA 1EOVA 1C7YA 3M4OH 2JA5H 3B4TA 2MO1A 1SN8A 3S2HH 5ELOA 1UEBA 4A3FH 4DNIA 3NENA 3AQQA 3BZKA 4JOIC 4YCVA 3HOYH 3A0JA 4X6AH 1PH9A 4K0KL 5BR8L 3H3VH 4DR1L 1NY4A 2NVXH 3I4NH 2DUDA 3GTJH 4A3CH 2WB1E 3SGIA 4GNXA 4AYBE 2ASBA 4JI2Q 2C39A 3I4MG 5M5WH 2DGRA 4DV1L 3CXCA 2PI2A 1EQRA 2WAQG 1TWFH 1N33L 1WCMH 4DUZL 3VKEA 3PF4A 4A3IG 4DV0L 4B3MQ 4GKKL 1NTGA 4JI6Q 4JI1Q 3GO5A 2A8VA 3ULJA 4JCVE 4C3JH 3S16H 5M3MG 3FHWA 4GKJL 2JA6H 1OYSA 2RCNA 2H5XA 5K36A 4A3LH 1YZ6A 3KDFA 1WJJA 3CCQA 4KHPL 1PH5A 4JYAQ 5JEAF 3H1CA 4IFDG 5C0XG 1CKNB 1KAWA 1UDNA 1MIUA 2PQAB 2HT1A 1BBWA 2D62A 1N36Q 1YEZA 5M3FG 1QVFA 1VQDA 3ER0A 1CUKA 2CTEA 2JQOA 1WYDA 5LMNQ 3RR5A 4C3IH 4IOCA 4DAMA 3M4QA 4BY1G 4DAYB 5EAYA 1Y1WG 2UXCL 4A3KH 3S24A 4OO1E 1DT4A 1VQLA 3J81c 4LF6Q 1J4WA 4A3GG 4YWMA 2Q2UA 1IL2A 2QGQA 1EWIA 3FKIH 4X66Q 4JI2L 4EX5A 2WB1G 4TVAB 1XNRQ 3J7ZC 3F8TA 1X3FA 2R6GA 2JE6I 3RLOA 1X56A 1E1OA 1BKBA 1Q12A 4B3ML 4JI6L 1C0AA 2NZHA 1AE3A 4JI1L 3PIOA 4LUZA 3PO2H 4BY7G 1KXLA 1I94Q 4JI4Q 4BA1I 3H0GG 3HKSA 1M1KC 4X64L 4LF5Q 2F52A 2UUBQ 4X65Q 5K36D 1PH3A 4JYAL 2PQAA 3L7ZB 3AYHB 2R92G 1N36L 2PI2E 2E5LQ 1QVGA 3CPFA 2HIXA 1OXSC 4JBKA 1E24A 5C4XH 1P8LA 4P73A 2AXYA 3WWVA 1PFSA 1KL9A 3F2DA 3M7ND 3S1RH 4AM3A 1LTLA 4LF6L 1I3QH 4X66L 3HOZH 2GN5A 2R7FA 2VW9A 1XNRL 1OTCA 5LMUQ 4AH6A 4DV7Q 4P71A 5IYCG 4QY7A 5C3EG 1LM0A 4JI3Q 5IT9c 2HH3A 4IFDB 1A63A 3HKMA 1PH6A 2PNZB 4JI5Q 3A74A 5FLMG 1I94L 4UP9A 3KJPA 4DV5Q 1EIYB 1E7ZA 2OPUA 3KF6B 4UY8C 3D31A 1FGUA 5IP7H 4DUYQ 4LF5L 2ZJRA 1YHBA 4X65L 1W2BA 1XNQQ 1MJCA 1KD1C 4HJ5A 1VQGA 3L7ZA 3MXNB 3H3VI 4LF4Q 3T1YQ 4AQYL 1XPRA 2UXDL 1L2FA 4IOAA 5JEAJ 5GQOA 4A3JG 3JAMi 1CKOA 1Q7YC 4UP8A 1VQFA 5IYDH 3PUZA 1A0IA 3G71A 5C44G 2UXBQ 2VQFL 1X54A 5IYBH 2E8GA 1HZCA 1PH2A 1VQAA 5FJ8H 4BA2A 3U50C 4DPGA 2ATWA 2JA7H 3ERSX 2NZOA 3RN5A 2EXDA 3CQZH 1I5FA 2R93H 5K36G 2KCTA 4JI7Q 1YNXA 2PO0B 4DR7L 3RZDH 1R9TH 4DR3L 2CCZA 3U4ZA 1TUAA 2UUAQ 2DGYA 1SR3A 2FMRA 2PNZA 4L5TA 2UUCL 3PUXA 3PIPA 4MZ9A 4JI5L 2YQRA 1VCIA 4HJ8A 4ALPA 3KF6A 1XMOQ 1UE6A 4DK3C 3EN2A 4LF8L 1IZ6A 4HIMA 4IFDF 4IFDC 1XMQL 1RL2A 3S14H 4APVA 2A1AA 3M7NG 4B3SQ 3T1YL 5FLXc 1PH7A 4C3HH 1JT8A 4AIMA 3GTPH 2HHHL 4YY3Q 1YJNA 1YJWA 4NB3A 1E3PA 2JA5G 4OX9Q 4OO1B 2UU9Q 2R7DA 3L2PA 4A3FG 3J81j 2PNHA 2PO1A 1K73C 3UDGA 1V9PA 2JEBB 2IY5B 2K14A 3HOYG 3HOXH 1YBYA 3I4NG 1IBLQ 4A3CG 1K9MC 2BR2B 2HIVA 2VY3A 4PZ8A 4A3DH 4LFBQ 3S2DH 2ANNA 1WVNA 4JI8Q 1ZZIA 3CAMA 4JI7L 2R7ZH 1IBML 2UUAL 1PYBA 1WCMG 4DV2L 2WFWA 2PQUA 4P72A 4NXML 5IE8A 1D8LA 1Y14B 1VQ7A 3T1HL 2C39B 1XMOL 2E2HH 1HNXL 1S72A 2QEXA 5GROA 4A3EH 2JA6G 1VQNA 3KFUA 4A3LG 5HY6A 3NBHB 4B3SL 3S1MH 3KYHC 4LF9Q 4YY3L 2YTXA 3PO3H 2UU9L 2YYZA 2JEBA 3KDFB 4L5RC 3BU2A 3G4SA 3E9IA 2C35B 1KQSA 5ELNA 4QL5A 1X65A 2IX0A 4A3KG 2VUMH 1HNWL 4OO1F 4HIDA 1TWCH 1V1QA 4OO1C 4XIGS 1OXVA 1G291 3EIVA 2BR2A 3I56A 4A93H 1JJ2A 3FKIG 2KBNA 4KHZA 2WNRB 4JI8L 3CCMA 1E3HA 1DGSA 2AMCB 4R4TA 4MNOA 2KHIA 2ZTCA 1Q86C 4PZ6A 1L1OA 2JZXA 3HFZB 1Q82C 3U58A 3GTGH 4P74A 2CPQA 3V69A 4PMWA 3PO2G 3K8AA 2F3IA 3MEFA 3TEHB 2BA0A 1TWAH 2CTLA 1G51A 3S1NH 5IWAQ 4GNXC 5C0XJ 4WJ4A 1OXTA 1N8RC 1SROA 4OO1D 2B3GA 2LSSA 1JJCB 4RMFA 1IYJB 1R6LA 1Z9FA 4C2MH 1VQ9A 4TQUS 3PUWA 1X4NA 5C4XG 2K50A 4DV6Q 1HR0Q 4OO1I 3DM3A 2N8NA 1VQOA 5K36F 2PO2A 5K36C 3K0XA 2K5HA 2WNRA 3HOZG 4DR6Q 1K8GA 3OTOQ 2JEBI 1UWVA 1YITA 4GOPA 3F1ZA 2IX1A 1A8VA 1EFWA 4IPDA 1HH2P 4XTCS 1J5EQ 5GADC 4LNQA 1IBKQ 2WP8B 3GLLA 2OTLA 4NPSA 3M4PA 4MTNA 2BA1A 1PV4A 4AYBG 4DV3Q 4HJ7A 2BA0D 2AHOB 4KI0A 5IP7G 3CDIA 3CD6A 2OWOA 5IWAL 1YJ9A 1VQ5A 3W1BA 1B8AA 3CDJA 4JG2A 3KLWA 4LF7Q 1YIJA 3KRNA 1Z47A 2C38A 2JA9A 2ANRA 1KRSA 3I2ZA 1LUZA 2CQOA 1EQQA 1X3GA 3F2CA 4R1JA 5IYDG 4QIWE 5H1SE 1VQJA 1J5KA 4A3MH 1KHMA 4EQ5A 1HR0L 1X3EA 2CTJA 5IYBG 2HQLA 2EIFA 1EIFA 1TWHH 5FJ8G 1YHQA 3UDFA 1KIXA 3JAMc 3HOWH 2JA7G 5LMNL 4JBJA 3M9BA 3OTOL 4YHHQ 1RIPA 2R93G 1NMFA 3I7FA 2WP8A 1NMGA 2OTJA 3RN2A 1IBKL 4BA2B 4L5QA 1NJIC 5JEAE 1U5KA 4OO1G 1KHIA 2KENA 3PUVA 3HOUH 2C37B 2CKZB 1JE5A 4DR5Q 1TXYA 3CCJA 3L0OA 1K0RA 3H15A 2VZAA 1SE8A 3G48A 3W5OA 3NEMA 5JJLA 4LFAQ 3I4OA 4JI4L 4NXNQ 5LMNW 2UUBL 1CSPA 1K3RA 2VNUD 3A5UA 1NBWA 2B63H 2K52A 1WOCA 1S3OA 1K1GA 4YWLA 3HOXG 4IO9A 3UDXA 2CFMA 5AJ3Q 3GTLH 2E5LL 3CP0A 2ES2A 4LW1A 4OWTB 1ZZJA 2BA0G 1OXUA 4A3DG 3L7ZC 3GCMA 2E2JH 2PO1B 4LUOA 4DK6C 1LYLA 3K81C 2JK8A 3D0FA 2BL5A 2JA8G 2R7ZG 4DV4Q 3CC2A 5GAHC 4OXPA 1N32Q 1VQ6A 4X62Q 4DR2Q 1BVSA 4JBMA 5LMUL 2C37A 4QQBX 1PH1A 4DV7L 2ZJPA 2NN6B 4JI0Q 3ZJYC 4PZ7A 2I5MX 4JI3L 2Z0SA 2Q2TA 4A3EG 4R4OA 3BZCA 4UPAA 1T9HA 1VQMA 1UE7A 4DV5L 1SLJA 4POGA 5C0XA 2YV5A 4DUYL 4ME3A 1WI5A 1OYRA 3PO3G 5IP9H 4IPGA 1XNQL 1JJGA 3CW2C 1JB7A 4LF4L 2ZTEA 3PCOB 2VUMG 2XTIA 1VQ8A 3E0EA 2E3UA 1VQPA 1HZBA 1Y1VH 3K7UC 4A93G 4BBSH 3STBD 2JEAA 1Q8KA 5GAEC 2ZM6Q 1QZHA 2UXBL 1B70B 4WJ3M 3IRBA 1A62A 2VL6A 4DV4L 4UP7A 2N3SA 1W3SA 1N32L 4P75A 4DR2L 1SRUA 1D7QA 2CWAA 4QGUA 2NN6A 2IT1A 1VIGA 1P16A 4A76A 4BBRH 2JA8H 4BA2I 3AFQA 4B8TA 1AE2A 2IHFA 1L1OB 2BH2A 1QZGA 1KRTA 1QUQB 2AWOA 1HNZQ 4DR1Q 1VS0A 2Z6KA 3CC4A 2K4KA
chains in the Genus database with same CATH superfamily
1F77A 4LF6I 5LMNE 2RSNA 1D5ZC 1IW7D 3GD7A 3OTOE 2WAQE 3PUYA 4X66I 3T53B 2B2YA 4OX9H 4LFCQ 1S40A 3Q6MA 2FPHX 4QJFA 1XNRI 2UU9H 1LT4D 4Y52H 4K5WA 4K5VA 1VF7A 2J65A 3K7AH 1N9WA 4DV1Q 4H8AA 3VR5A 4BBRB 1MKHA 2JA8B 4BXXH 3OIPA 3CHBD 4U3BA 3Q8DA 2F4VQ 4GN5A 4HIOA 3KK7A 3CPWA 3VDYA 3PYGA 1Q81C 2EJGC 1N33Q 1IBKE 1A2TA 3D4DA 2NVYH 4LF6E 4OX9L 2JVZA 2ZTDA 2ID0A 5JJIA 4WANA 4DV0Q 1F9SA 1QNKA 1UDOA 4DNRB 2GO3A 1VQBA 4O0AA 4Y7NH 4B8CD 1N34Q 5JEAB 2ZM6L 5E3FA 4HCSA 5JPNC 1I94I 5M5XH 4RFBA 1H7UA 1E2ZA 3CMAA 4KHVA 5CV5A 4RGMA 4FF4A 4JI4I 2OQ0A 3ZZ0A 1X0AA 4JI8H 3KJOA 5A2QC 4LF5I 2UUBI 5C0XE 4IZJB 5C4JH 1BBUA 3HGBA 1MJEA 1IBLL 4GKJQ 1PTOD 2EY6A 2R42A 4X65I 1EU3A 3NCVA 1TY2A 2SNMA 1ZTGA 1UDQA 4P52A 1PFBA 4IZKA 1B3AA 4OL7A 3X3MA 3B6YA 3K7AB 4H0LC 4JOIA 4RH6A 4X3UA 5IY0A 5KNCA 2PO2B 4N8FA 4LFBL 2NN6D 2UXDI 1NZ0A 2F0FA 2K5NA 1UDSA 2RF4A 4LPFA 3OW2A 2AKWB 1BF4A 4HACB 4JI4E 4LJZC 1XX8A 2RHQB 2E5LI 2YTYA 2IHEA 3TMEA 2LXKA 3BDLA 3EBEA 4GOPB 3GTOH 2UUBE 1VQCA 4KY7A 4A3BH 1G6ZA 4GS3A 3HOVH 3GONA 4Y7NB 3FPUB 1GKHA 4JC0A 4N3OA 3BVZA 4ZQ3A 3V2UC 1O7IA 2K75A 2E2IH 4B3TQ 1VQKA 2EY2A 5M5XB 1XPOA 1UEKA 3NXWA 5K5PA 1OYPA 2P2RA 2EYFA 2HH2A 3KDKA 1RD9D 2JE6A 1QUQA 4NBQA 5C4JB 2NN6I 3KDGA 1V9NA 3KUPA 3NP8A 1FWLA 2E5LE 5IIFA 1HNZL 3AEVB 2CHBD 2UXCQ 4LF9H 4FWDA 2FMMA 4J8QA 1EZ8A 2B29A 3J81L 3IL8A 2HCCA 2TSSA 3J80i 1GVPA 2E74C 1XTDA 2J4XA 1L1OC 3PV0A 5E4XA 1B7YB 1DOLA 4LFCL 1PYWD 4CDFC 3VYSA 2PNMA 4IFDJ 2A6ED 2RQXA 1PH4A 3CC7A 1DTJA 1VIHA 5LMUI 3QO2A 4GLVB 4QB4A 3GTOB 4DV7I 2I5LX 4LF9L 2NN6E 1EC6A 1ASYA 4A3BB 4LMQD 4A3MG 4BA1A 2Z5BB 2F4VL 3FP9A 1HZAA 4ODGA 5IGGA 1PYSB 2EYOA 4DR3I 2EOTA 2E2IB 4JI3I 1Y8NB 3MA2B 2QF7A 3D4WA 3EROA 1WE8A 3CCLA 2C38B 3HOWG 4H44C 1NHIA 2F03A 1TR5A 4P7AA 5JEAA 1VQIA 1HA5A 2OF1A 1N34L 1STNA 4R4IA 2NVTH 4JV5Q 4ZVIA 4JI5I 4JBWA 5LMUE 3KLRA 4DV7E 2V2VA 1SNPA 1ENAA 3DD6A 4FF3A 3HS0C 4DV5I 1UE5A 2NWGA 1Z0VA 4BS9A 4A75A 4DUYI 2LFNA 4YWKA 3A56A 5HGTA 4JI3E 4RCOA 3VR4A 1TWGH 2MQHA 4X64Q 1WTRA 5DAUA 1XNQI 4J6HA 4YCWA 1SE4A 4OD6A 4HCEA 4DPXA 1U2RA 4YIJA 1H95A 4JVYA 2JJQA 2MJHA 5JEAC 4O42A 4OWXB 4DR4Q 4LF4I 1OXXK 1XJVA 3T1YI 4HACA 3TS2A 1Z0GA 1SNMA 3NK9A 3HOUG 2VS1A 4DV5E 3I73A 1ML0D 4IPCA 2D0OA 4J1MA 1UUPA 1H9MA 1EYCA 4DUYE 3HKZE 1K83H 1GHJA 3C1EA 1WVLA 2SDFA 1L0YB 2F1DA 1ILQA 1XNQE 5CBAE 5J39A 2NVTB 2ICIA 2E76C 1G6PA 2K5VA 2LXJA 1KC8C 2YU9H 2BE5C 5E4WC 2XIWA 4B3TL 4PG3A 4WUDA 3I3CA 4LF4E 3BVGA 1QJOA 3T1YE 2WKDA 5IWAH 3K80C 2FFMA 4RWSC 1TWGB 3AEVA 3F2BA 1PRTD 1V43A 2F3VA 3C46A 4URLA 2WIIB 2XSCA 4GOPC 2NVQH 1EEID 2KCMA 2O1UA 3M7NA 2N49A 1S5FD 4M1UB 4MIUA 4U68A 5ELFA 3TZUA 1B4OA 4EVOA 3RNUA 1QOHA 3ICEA 4NW2A 1Y4UA 1PHJA 2VQEQ 1TS3A 3KF8B 3K17A 5FO9B 2CWPA 3VR6A 1K83B 2OPVA 3S17H 2B63G 4USMA 1H74A 3HULA 4LUVA 2UXBE 1FJGQ 1O7ZA 3M3YH 4F88A 4JI7I 1M90C 5KEEA 1S20A 2LTMA 2RDFA 2YU9B 3SR1A 5BN5A 3S1QH 1IBMI 3OYYA 2UUAI 2D0PA 2NN6G 1HR0H 4RG1A 2D9UA 1N32E 3L9AX 5DNLA 4PNYA 4DR2E 3GP7A 4B3RQ 4NKLA 1FI4A 5JEAD 1AEXA 3ULLA 4JV5L 4FO2A 3DLLA 2NVQB 4DPUA 2MO0A 4XTJA 3I4MH 2G8YA 4QF4A 3MHBA 1CSQA 1XMOI 1D1KA 4DR6H 4HMJA 3ERQA 1H9SB 1PA6A 3OTOH 1NAPA 4DV6L 4IZJD 2Y0SE 2FINB 1PQXA 2HFUA 2Z5CA 1B50A 2G9DA 5KYLA 4IPHA 2EQSA 3TN2A 2AQ2B 1GO3E 2XRQD 3U1KA 2XVSA 4U3DA 3S17B 2BE5D 2MP1A 4A3IH 2N78A 2ALYB 1DCZA 3NBIA 3QG1A 1CKNA 4DR4L 1EFID 2AQ3B 3M3YB 5FLXQ 4B3SI 2HK2A 1IBKH 1U0LA 2L11A 4GN4B 1Z2IA 1SFOH 4DR6L 4ZAIA 2EJFC 4NDXA 1RF2D 4AQYQ 2UXDQ 3M85A 4O1NA 1PZKD 2PMZE 1SJED 4FW3A 3S1QB 3Q24A 2PZUA 4YY3I 2XRSD 4N9TA 2MNAA 4NZRM 4PRVA 4HJAA 1HXYD 4FDBA 2A68C 1JWSD 4UDUC 5M3MH 4WUBA 1EYAA 4POFA 1J5EL 2VF3A 2K28A 4OX9I 3H6MA 1WHRA 3I91A 2WINB 3S9WA 4DPWA 4FJSA 2UU9I 3HKZG 1C48A 1ENFA 4IJLA 4IFDH 4DAYA 5DNFA 5C0XH 5AFWA 4L5SA 4A3MB 2WAQB 4L6TB 4FXGC 3LTOA 3UE0A 4GN3B 1CM9A 2D2CC 3UDIA 1LTBD 3E9HA 2EY5A 4IJHA 4K2LA 3MXUA 3NWSA 2BA1D 3RF2A 1TWHB 5NUCA 3JAMC 5M3FH 1DXMA 1KTKA 3A5ZB 2VQFQ 4DV3L 2MUYA 1FL0A 4A3IB 1AZQA 1IBLI 1X4MA 4OX9E 1QILA 5JVH3 1NE3A 3J81i 5CV8A 1EEFD 1EA6A 1L0WA 5IP9G 3W1GA 1SFOB 2KUMA 4JI4H 1X55A 4Z9CB 5GMEA 3LPSA 5K36E 3KF8A 2VQEL 1UNSA 1E22A 4Q0FA 1SE3A 1LO5D 1HQMC 3NTHA 3S15H 2ZM6E 5FKAC 3FMCA 3G6JB 3K58A 2KHJA 3DMUA 4BY1H 4JI8I 1HR0W 5M3MB 2I0QA 4LF7L 1HCZA 1FJGL 4JVHA 5KNBA 1H72C 1Y1WH 1FD7D 4HTHA 2XGTA 4MU3A 5J3BA 5L37A 4DR7Q 1IBLE 4DR3Q 3CCUA 2F4IA 4FW5A 5C0XB 4WUCA 1YHCA 1YHAA 3Q6SA 4FW9A 4J15A 1J6QA 4B3RL 4A3GH 1JOKA 1Y1VG 2EE1A 3I70A 2UUCQ 4BBSG 4LFBE 5M3FB 2CTKA 3D4RA 4A4IA 3C2PA 1CK1A 1QWYA 1ILPA 3R2TA 2GVBA 2XWJB 2RKSA 1H73A 5EPKA 2Q2HA 4YHHH 1YI2A 5IT9C 4HEDA 2A68D 4LF8Q 1VQ4A 1XPUA 1B1ZA 1EZ6A 1F2YA 1A3VA 1MU5A 1N0UA 1F9QA 1XMQQ 4DF7A 3S15B 2F0VA 1KIJA 3K57A 5ELEA 4K6DA 5I6WA 4BY1B 1RR9A 2Y0SG 2F0JA 2Z8LA 2B2TA 3CMEA 1Y1WB 1BDOA 2PCFB 2PYKA 1EY4A 4DGZA 4YHHL 4LF9I 2O1VA 4JG4A 1JMCA 3M85D 2ZQEA 4R4QA 4BY7H 2JEAB 1BCPB 1BO0A 1C4QA 2OEOA 1Q46A 1DOMA 3PYDA 5LL6S 2HHHQ 5HGQA 1VQEA 2DN8A 3J81E 3T13A 1IXRA 1QG7A 3H0GH 2RCFA 4ME5A 4TKOB 1HRJA 2PY9A 5KNDA 4A3GB 4DV7H 1TU2B 4BBRG 1AZPA 4HIKA 2LF0A 1EY0A 2WB1B 3KOJA 4DR5H 4H7BA 3A8JE 5DLQE 1B53A 1E1TA 3STBC 4LF9E 4XT1B 2R92H 2ZBKB 1C9OA 2F4VE 2O1TA 1JE4A 3IKJA 1KDCA 3GTMH 4RPFA 2M8WA 3CCRA 4H02A 1ENCA 5JEAG 2A6HD 3CC4A 5FWKA 3Q1QA 2VKCA 2BDOA 1R4PB 2EYHA 3ULPA 4KLKA 4DR5L 1BR9A 1HK7A 4LFAH 1MD2D 1LT5D 4DUYH 3K0YA 4IURA 2F0WA 1N34E 1DM0B 5I9OA 1XNQH 3GMEA 5BN3A 5I2XA 3I55A 3H0GB 4DXGA 3B78A 1SYGA 3NTKA 3TQYA 4DKAC 2K1HA 4OCHA 3OMCA 4BXXG 4FP5D 4CKEA 1EL0A 4LF4H 3NELA 1BBXC 4LFAL 5JOBA 4IFDA 2L0CA 1TIID 4NXNL 4OONA 1LABA 3D4JA 1ZZKA 1IBMQ 3VR2A 4USKA 1UE1A 3J80L 2GVAA 4FXKC 4DV2Q 1MG7A 1O80A 2V34A 2R92B 4XT3B 3DWQA 2I5HA 4NXMQ 3D8GA 3GTMB 3CCVA 4EQNA 2MHVA 2F0OA 3MVVA 3U4VA 3F2UA 2ZJQA 2CGEA 3VA7A 2K1BA 1X6OA 3T1HQ 1CKMA 2K6AA 4DU8A 2JSOA 3CCEA 1HNXQ 4GLXA 4HYMA 5IYCH 2A2CA 5AJ3L 2NTSA 4QMFB 4UTGA 5C0XF 4RKBA 5C0XC 1XXGA 2KOLA 3VA5A 5C3EH 3TS0A 2OCEA 2UXBH 4B3TE 2K7VA 2C5CA 1AH9A 2AWNA 5IWAI 5JVG3 3PF5A 1X9NA 2BA1G 4JVZA 1PH8A 4LWCA 1IW7C 3ZM7A 4GLAC 5IGDA 2ICEC 1QB5D 1H9JA 4DV4H 5JJKA 1HJPA 1R6MA 1WTPA 1N32H 2RHSB 5FLMH 1YVCA 3A7LA 4PMCA 4X62H 5DEHA 4DR2H 3K85A 3K1JA 2YTVA 1I50H 3OETA 2BH8A 2EFGA 3MXGA 2KECA 4A3BG 4WALA 1ESFA 4JI0H 1F9RA 3HOVG 2Z4HA 2F0HA 1QVCA 2WACA 1K8AC 1CQFA 3BJUA 2F0GA 4X62L 3J7A5 3EVQA 1V8QA 4IZKB 1BCPF 4RGNA 1BCPC 1KAAA 4EMDA 2PW7A 5C3EB 2QCPX 2QA4A 1EYGA 1GM5A 1CFMA 1HR0I 2A19A 4OWWB 4JI0L 3J80W 4A3JH 1Q1EA 2CWFA 1EY7A 3NE5B 1HNWQ 3PGZA 3PSIA 5G3LD 1W6KA 4PDBA 4O2DA 1PFNA 1PTOF 2HCIA 5J22A 1SMXA 1PTOC 4MN3A 2RSOA 5ELCA 5EJWA 1SNOA 4I3HA 2ZT9C 2ZITA 4DR6I 1VQHA 5M9OA 3OTOI 3CCSA 2WP8J 3VR3A 4DU7A 1JWMD 5IGEA 1J9OA 1I50B 1C8CA 5LL6R 2NN6F 4EC5A 2NN6C 2PO0A 1Q1BA 4DV6E 5C44H 2QNDA 3LGJA 2Q2IA 4RAUC 4K0KQ 2JE6B 5BR8Q 1O78A 4ZYSA 2L15A 4IFDD 5C0XD 1J5EI 3W2DA 4RCNA 2V1CC 1PMRA 3AMUA 1IBKI 3M85G 3RD4A 4CJ2C 3RLFA 4DR4E 4NMZA 1KTVA 3J80c 1ASZA 1CI3M 5E7NA 4DR6E 3G6EA 3TP5A 4KQVA 1UEAB 4IUTA 4HJ9A 2A74C 4GNXB 1IL8A 2RA4A 3TZDA 5GAGC 2AQ1B 2FXQA 4A3JB 4R4CA 4KTAA 3RZOH 1WTJA 3GKUA 3GABA 3EQLC 5K36H 1TS2A 2PMZB 3CWVA 2ZM6H 3GDEA 5M5YH 1J5EE 2OQKA 4BA1B 2B2VC 4YCUA 2CTFA 4IFDI 5C0XI 3JC66 2Z6KC 1FVIA 3DWPA 3CF5A 3QD7X 2NTTA 1F2MA 4F87A 5IOCA 4DUZQ 3AU7A 3HEJA 1K47A 1WFQA 3TREA 1DJRD 2PT7G 1IBLH 5CR3A 4GKKQ 1EI1A 5C44B 1Z0EA 1R4QB 1B9NA 1I6HH 2B2YC 2PPBC 1HFGA 1BCPD 2A6EC 3GTQH 1CTMA 3OW7A 1SYFA 3GTKH 1WD0A 3WU4A 3Q0AA 2BOSA 1Z0BA 1H7SA 4DV3E 2CTMA 5IGBA 1WTHA 4FW7A 2IPKD 5L3JA 4LFBH 4OO1A 1D5XC 1PFMA 4IFDE 1Y69U 1WTQA 4HXZA 1GHKA 2HK3A 3OHXC 3OPOA 3UE1A 3B8HA 1HZ9A 1GD7A 4AIDA 5EBCA 3RZOB 4KHPQ 5K36B 1B3QA 3AFPA 4LF7E 4Q5VA 3VYTA 4FF1A 1FJGE 2IERA 1MI2A 3MAQA 3TRZA 2JEAI 2MFIA 1EUJA 2DNEA 5FO7B 3RLNA 4LIJA 3A7AB 1PVOA 3EZJA 1EOVA 2GO4A 1GUGA 1C7YA 3M4OH 2NVYB 2Z5EA 3JAMQ 5LHY1 2JA5H 1TKWB 1EIGA 3B4TA 2MO1A 4K8JA 4B3RE 1HNZH 1I6HB 1SN8A 3S2HH 4LOMA 5ELOA 1UEBA 2B8GA 3GTKB 1FYCA 2NUCA 4A3FH 1WUUA 4IZ8A 3WU3A 4DNIA 4YHHI 3NENA 3AQQA 1X9ZA 4KKSA 1X3PA 3BZKA 4JOIC 5I4DA 3PQIA 4NZTM 4YCVA 3HOYH 4LFCH 3A0JA 3PYEA 4X6AH 1PH9A 4RKLA 3BYTB 4K0KL 5BR8L 3H3VH 2V2ZA 1HTPA 1NY4A 3R8BA 4DR1L 2NVXH 3I4NH 4DV1H 2DUDA 4K14A 4LCFA 3SK4A 3GTJH 2F4VH 4A3CH 2WB1E 3T16A 1HUMA 2A73B 1MX0A 1U4RA 3SGIA 4GNXA 3FVQA 5IODA 4AYBE 5A35A 1BNZA 4YHHE 1A3TA 2ASBA 4JI2Q 2C39A 5I9PA 2CG9A 5BN4A 4DV0H 3M4OB 4UT4A 3I4MG 3DHQA 2JA5B 5M5WH 4GZYC 2CZ9A 2DGRA 4DV1L 5DRQA 3CXCA 1U9RA 2WV6D 2PI2A 1PRTF 1N34H 1EQRA 1NUCA 1PRTC 3HOVB 2WAQG 5CV9A 3S2HB 2GA4B 1TWFH 4PU9A 4DR5I 2K5QA 5IT9Q 1N33L 3H94A 1GOZA 4OHJA 4RGOS 4A3FB 1WCMH 4DUZL 3VKEA 4TRDA 1V1PB 3PF4A 4A3IG 1U4MA 4DV0L 1EY5A 1RHPA 2Z4IA 4B3MQ 3HOYB 1JOOA 4GKKL 1NTGA 1ZM2A 4JI6Q 1LV9A 1RREA 4JI1Q 3GO5A 2A8VA 5DNXA 2EDGA 5D65A 5T1GA 2NVXB 3I4NB 2CW0C 3ULJA 4JCVE 1I4HA 4C3JH 1OJ4A 3S16H 4BWGB 3GTJB 4LFAI 1XWEA 2Q8IB 4JW0A 4DR5E 2I46A 1ICFB 5M3MG 3FHWA 3X3NA 2Z9HA 3CKIB 4GKJL 2JA6H 2Z5CB 1OYSA 2RCNA 4ID6A 2H5XA 1A3UA 1FGBD 5K36A 4A3LH 2MJ8A 1YZ6A 2F0TA 1WJJA 3KDFA 3CCQA 5M5WB 4KHPL 1PH5A 4JYAQ 1GUWA 5C4ZA 1LTID 5JEAF 3H1CA 4IFDG 3QWNA 5C0XG 3DM1A 4V0BA 1J8IA 1CKNB 1KAWA 4B3TH 1IKMA 1UDNA 1TWFB 3A55A 2EJMA 3OWFA 1MIUA 2PQAB 2HT1A 1BBWA 3UOEA 1G2SA 1Z0TA 1EY6A 4LFAE 2D62A 1N36Q 3J81W 1K8MA 1FR3A 1WCMB 2CVRA 1YEZA 4DU9A 5M3FG 1QVFA 4NXNE 1VQDA 2C9OA 2B2WA 3J80E 2QDBA 2F1MA 3HP3A 5EPLA 1JB3A 1Q3LA 2OXPA 3ER0A 3HRZC 4XQJA 1CUKA 1RKNA 2M2LA 2CTEA 3URYA 2JQOA 3I72A 1Z0WA 1WYDA 5LMNQ 4C3JB 3RR5A 4C3IH 3IAYA 1PXUA 4IOCA 4DAMA 3M4QA 4BY1G 4DAYB 1A15A 5ISRA 5CYUA 5EAYA 2JA6B 2UXBI 1D1IA 1XRHA 1Y1WG 1MSHA 1KDBA 1ZYRC 3N6RA 2UXCL 2F0QA 4A3KH 3S24A 2QEJC 1LTTD 4KY6A 2R61A 2B2WC 2Y3MA 4OO1E 2KA7A 1XHKA 3MFGA 3N52A 1DT4A 4DV4I 4R8NA 5GMDA 1VQLA 1H9KA 4KK7A 4HN7A 3J81c 3D3RA 4LF6Q 1N32I 1W6JA 1I4QA 1J4WA 3IFDA 4A3GG 4X62I 4DR2I 3WDNA 4YWMA 2Q2UA 2K03A 2QGQA 1EWIA 3FKIH 4X66Q 4JI2L 1XYIA 1IL2A 4CDEC 4EX5A 2WB1G 4TVAB 1S5ED 1XNRQ 3J7ZC 2CW0D 1PZJD 3F8TA 2PO4A 4JV5H 3QB3A 3FPPA 4JI0I 1X3FA 3K59A 2R6GA 1WTVA 2JE6I 2DEIA 5IT9L 4U673 3RLOA 4YY3H 2LJPA 1U4PA 1V1PA 1X56A 4HMIA 4C3IB 4OIKA 3PMFA 1E1OA 1Y6ZA 1BKBA 4DV4E 4DV6H 1VMCA 4FNFA 5CV4A 1K8OA 1CA6A 1PDQA 4LCHA 4X64H 1Q12A 4B3ML 2X36A 4X62E 4JI6L 1C0AA 2NZHA 5C4HA 1JICA 1AE3A 4JI1L 1Q90A 4X3TA 4MQYA 3V96A 4A3KB 3PS1A 1JOQA 3WU5A 3PIOA 1I6UA 4ZLTF 4DR4H 4LUZA 3PO2H 4BY7G 4JI0E 1KXLA 1I94Q 1Z6HA 5JAVA 1MHWC 4XQQA 4BA1I 4JI4Q 5LL6b 4FWGA 3H0GG 3HKSA 1M1KC 4X64L 4LF5Q 2EYPA 2F52A 2UUBQ 3WOFA 2DY8A 3FKIB 4X65Q 5K36D 1PH3A 1AN8A 4JYAL 1J5EH 4CBVA 3H3VC 4ILWA 1MSZA 2PQAA 3NSWA 5ELBA 1GUOA 3L7ZB 4RHSA 3AYHB 1HTLD 2R92G 4ZRZA 3TP6A 1N36L 2PI2E 1ZYRD 2XN9C 5CMDA 1D6TA 4KN4C 2E5LQ 1XXEA 3KLSA 2MGSA 2KEDA 4N8X1 2L1BA 1KKHA 3BYYB 4DV3H 3Q22A 1SYBA 3MC0B 3PYFA 3I4MB 1QE6A 3CPFA 3SE0A 1QVGA 5CV7A 2HIXA 3PO2B 1OXSC 5DT9A 4TSSA 4WFN3 4EGVA 2ZM6I 2EYMA 4B08A 2ENBA 4JBKA 4KN7C 5IT9W 2VQEH 1E24A 5C4XH 1LACA 1P8LA 4P73A 5I2YA 2AXYA 3WWVA 4MU1A 1PFSA 1KL9A 2JT2A 1O7YA 4MU0A 5EQ0A 3F2DA 4LF7H 3M7ND 1FJGH 4DNTB 2E1RA 3PRYA 3S1RH 3EJIA 1PZID 1GUSA 4AM3A 2NPFA 3AB9A 1FNUA 2D5DA 1LTLA 4LF6L 4MHEA 1HFNA 3P1HA 1I3QH 4X66L 3HOZH 2GN5A 2R7FA 2EVBA 2O4CA 4LFBI 2VW9A 4S3SA 1XNRL 4B3RH 1OTCA 5LMUQ 4AH6A 3P06A 5CBEE 4DV7Q 2CPMA 3DEPA 3D6WA 4P71A 5IYCG 3QIAA 1SNQA 2A6HC 3DXJC 1RCVD 4QY7A 5C3EG 4FN5A 2CH4W 1LM0A 4JI3Q 4FJUA 5IT9c 2HH3A 4IFDB 2JXMB 4RGTA 1A63A 3HKMA 5C4XB 1E2VA 1PH6A 3MZ5A 2A5HA 2PNZB 2EY1A 4JI5Q 1NR2A 3A74A 4C1NI 1BXTA 5FLMG 1I94L 3S1RB 4UP9A 1PKPA 3KJPA 4DV5Q 1EIYB 1E7ZA 3VYUA 1Z5BA 1HNZI 4DR1I 4DXLA 2OPUA 3KF6B 3D31A 4ZCKA 4C1NK 4UY8C 1FGUA 2LS01 2Q2EB 1ZM4A 5IP7H 4DUYQ 1G2TA 2BCOA 4PMBA 4LF5L 4H13C 3J7AF 2ZJRA 1I3QB 1YHBA 5A2QQ 1BOSA 3NTIA 3ND8A 4X65L 1W2BA 1XNQQ 3HOZB 3F0NA 3PIO3 3J7AV 3GQBA 1MJCA 2HUGA 1KD1C 4R9WA 4LFCI 2IJ0A 4HJ5A 1VQGA 5FLXL 1SSOA 3T4AC 3L7ZA 3G7LA 2V4DA 3MXNB 4B9XA 3H3VI 1EWHA 4LF4Q 4DV1I 3T1YQ 4AQYL 1XPRA 2UXDL 1L2FA 4K0KE 5BR8E 4IOAA 3T51B 4MTKA 1HNZE 2F4VI 4ZUJA 1CT1D 4DR1E 5JEAJ 4XYQA 5T1IA 5GQOA 4I65A 2IX3A 1KVKA 1N33I 4A3JG 3JAMi 4N9PA 3RUZA 2VQFH 4ED4A 1CKOA 1S5DD 1Q7YC 5ELWA 4DV0I 2F0PA 3PS3A 1LTGD 4UP8A 1VQFA 5IYDH 4LFCE 2IW3A 2J7KA 1N34I 3UI2A 1Z0CA 1Y8OB 3SK8A 3PUZA 4AYBB 1RTNA 1JORA 1MGSA 1KLGD 2B2TC 1SMYC 4DV1E 4QUCA 1A0IA 3G71A 3A8IE 1DYQA 4I7ZC 5C44G 2UXBQ 2WKCA 1X54A 2VQFL 3E3XA 3C1FA 5IYBH 2E8GA 1N33E 2O5IC 1HZCA 1PH2A 1H9RA 1VQAA 4DUZE 5FJ8H 4BA2A 1D6EC 3U50C 4DPGA 2MPMA 4FYDA 4ZUIA 2RDHA 2ATWA 2JA7H 4EQPA 2FJ2A 4DV0E 4DR7H 3I8ZA 2X7IA 3E0JA 4GKKE 2Z1CA 3ERSX 3NQTA 4IN3A 1X32A 2NZOA 4NXNH 3QJYA 4ZKBB 4BY7B 2B2UA 3SB1A 3RN5A 2EXDA 2NBFA 3CQZH 1I5FA 3GV6A 3SEBA 2AE8A 2UUCH 2R93H 4IUNA 5K36G 2KCTA 1JC7A 4FW4A 4JI7Q 2EPBA 1YNXA 2PO0B 3ITPA 4DR7L 4GKJE 3RZDH 1R9TH 4DR3L 5G3LF 2CCZA 3U4ZA 1O7LA 5FLXW 2Z6BA 4QNKA 1STYA 1TUAA 2F0SA 2UUAQ 4LF8H 1S5BD 2DGYA 1FWKA 4KHPE 1SR3A 4B3TI 2FMRA 2PNZA 1XMQH 4L5TA 3H09A 2UUCL 3ZKDA 2F0IA 3PUXA 3PIPA 2D9IA 4MZ9A 4OO1H 4JI5L 2YQRA 1VCIA 2J0TD 5C3WA 1DARA 1STEA 4HJ8A 1T5EA 3KF6A 4ALPA 2KQ3A 4FWHA 3KLSX 4CHTB 1UE6A 4DK3C 1XMOQ 3EN2A 2JA7B 4LF8L 4AQYH 1IZ6A 1TT2A 4HIMA 2IOQA 4IFDF 4P2CB 4IFDC 1YH8A 5A2QL 2HHHH 1XMQL 4XXEA 1EQTA 1ET9A 1RL2A 3S14H 3CQZB 3FRPB 4LCGA 3A8KE 3MXNA 2A1AA 4APVA 1NR4A 2R93B 2M6QA 3M7NG 3J7AK 4B3SQ 1SMYD 3C3LA 3NZKA 3T1YL 3MWYW 5FLXc 1PH7A 4C3HH 3RZDB 1R9TB 4EQOA 1JT8A 4AIMA 3GTPH 2UXCE 2HHHL 2KCNA 4YY3Q 1YJNA 3P3EA 1YJWA 4NB3A 4DPTA 1E3PA 2JA5G 5C5LA 4OEMB 4OX9Q 5DROA 4OO1B 2L4NA 2UU9Q 4JI2E 2R7DA 4KV6A 4JV5I 3L2PA 2EXZA 3J81j 4A3FG 2KEEA 2NYZD 2PNHA 2PO1A 1F9PA 3UDGA 1V9PA 1K73C 2JEBB 2IY5B 2K14A 4Z7YA 4G08A 3HOYG 2HDLA 3HOXH 1S16A 1S5CD 1ZKOA 5IT9E 4DV6I 4JK1C 3S14B 2AUKA 4X64I 1YBYA 2K04A 3I4NG 3P7JA 1SYEA 1A6XA 1IBLQ 5DM73 4A3CG 2XWBB 4B3ME 1K9MC 2K5DA 2VESA 4JI6E 1DZ1A 4DR4I 4JI1E 4C3HB 4JV5E 4DV2H 2OI2A 1DOKA 3GTPB 2BR2B 2HIVA 2VY3A 4PZ8A 4A3DH 3K5LA 1S03G 1IYUA 4K6LA 4DK0A 4LFBQ 2FFKB 3S2DH 1WVNA 2KCCA 2ANNA 4JI8Q 1YNNC 1ZZIA 1LTSD 5A2QW 3CAMA 4JI7L 3LNUA 1NHJA 4X64E 2HKJA 3T1HH 1STHA 3QR8A 1HNXH 1CHQD 2R7ZH 1IBML 3UHMA 4G7HC 2UUAL 1PYBA 4R1FA 1WCMG 5C6AA 4DV2L 2V2QA 2WFWA 4DAPA 3BZDB 1SJHD 2PQUA 5FO8B 1TS4A 1HUNA 1FKAH 4P72A 1RDPD 4KD3A 1NNXA 5IE8A 3HOXB 4NXML 1D8LA 4QMGA 4B9WA 1Y14B 3ZYYX 1VQ7A 4I7AA 2F3WA 4K5XA 1N36E 3T1HL 4HSVA 4C3JG 1XMOL 2C39B 2E2HH 3B82A 1KLUD 1WD1A 1HNXL 4DV3I 1S72A 2QEXA 5GROA 1D2BA 1QNUA 5LL6X 4A3EH 3K5MA 2JA6G 4A3DB 1VQNA 2LKVA 3FEWX 3KFUA 3S2DB 4A3LG 5DRRA 2VQEI 2LTLA 5HY6A 3NBHB 3OIQA 1B2TA 4B3SL 4OGQC 1WTXA 3S1MH 3KYHC 4LF7I 2IWHA 1FJGI 4LF9Q 1DONA 1IKLA 3DWAA 5D3DA 1FNVA 2R7ZB 4YY3L 4MYTA 3LNNA 2EYJA 1JWUD 1E2WA 4KJNA 2YTXA 3J80C 3PO3H 1WTOA 3TP7A 3TP8A 2ZXRA 1VI7A 3H4LA 1HNWH 3RMHA 3NPPA 2UU9L 2DEJA 4IUQA 2VQEE 4X66E 4B3RI 2VB3X 1ZM9A 2KVMA 4CKCA 1ZM3A 2QW7A 2YYZA 4KJOA 4C3IG 2E2HB 2JEBA 1XNRE 3KDFB 1CHPD 4L5RC 4X3SA 3J7AG 3BU2A 2IOPA 4OZEA 3G4SA 3E9IA 2C35B 1YNND 4X3KA 5M5YB 2PQEA 5FK9C 1VF5C 1KQSA 5ELNA 4A3EB 4QL5A 1X65A 2I07B 3W3AA 2IX0A 4A3KG 2VUMH 1F2LA 1HNWL 1ET6A 4ISAA 4OO1F 4HIDA 1TWCH 1V1QA 4OO1C 2PW5A 4K0KH 4XIGS 5BR8H 1OXVA 3BDOA 1BKNA 4ZKCB 4DR1H 3TSSA 1G291 4KD4A 3S1MB 3EIVA 3GTQB 2BR2A 3I56A 1VMPA 3NQIA 4A93H 1JJ2A 2CQAA 2O5JC 1B44D 3FKIG 2KBNA 4AQYI 4KHZA 1QZRA 1I94E 2WNRB 4JI8L 5JJZA 3CCMA 1E3HA 3LX0A 3GR5A 3PO3B 5EKIA 1DGSA 2AMCB 4E6IA 4LF5E 4R4TA 4MNOA 4ZK9B 3NWTA 1KDAA 2H4OA 3R2IA 4DPYA 4X65E 2KHIA 3OSSD 3QT6A 2ZTCA 1Q86C 3K5OA 4PZ6A 4HY1A 1L1OA 2JZXA 2BM0A 1JQYD 3HFZB 2RBMA 3TDQA 5FLXE 1Q82C 1N33H 1EY8A 3U58A 4QNJA 1EU4A 4MYUA 3GTGH 4DUZH 3M6AA 2X6GA 4AQYE 2UXDE 4P74A 3OWEB 2CPQA 2VUMB 3V69A 4OELB 1SNDA 4PMWA 4GKKH 1TWCB 3PO2G 3K8AA 3L3OC 2VQFI 2F3IA 3MEFA 3TBIB 1EY9A 2Q8TA 3TEHB 2BA0A 1EYDA 3PS2A 4NP5A 5FOBB 1DD2A 2FHTA 2LMCB 4L8JA 4CDDC 4A93B 2PZTA 1TWAH 1Z59A 2CTLA 1G51A 1HPCA 3NBHA 3S1NH 4IUUA 2AJ4A 5EPJA 5IWAQ 5ELDA 5F2DA 1ZEQX 4DN4M 4GKJH 4GNXC 4LK1C 5C0XJ 1B62A 4WJ4A 1I4XA 1MBYA 1LTRD 1RJTA 4J3DA 4Z7CA 1OXTA 4KHPH 1N8RC 1CQVA 1LT6D 2GS8A 2VQFE 3M4YA 1LLRD 1SROA 4IQZA 1CZGA 4OIJA 1MSGA 1GUTA 1QCBD 5IGFA 4XDXA 1A2UA 4DR7I 1V1OA 2QKIC 1Y5YA 4NXNI 4OO1D 3HG9A 1S4ZA 2B3GA 1PVGA 2LSSA 3M7GA 4KMUC 3GTGB 1JJCB 1CA5A 4RMFA 1IYJB 4KY5A 2UUCI 1R6LA 3P3GA 5C5MA 3KBXA 1Z9FA 4C2MH 1VQ9A 4TQUS 3PUWA 3P3CA 1X4NA 1SAPA 1WTWA 5C4XG 2K50A 4LF8I 4IZJA 1TWAB 4DR7E 4DV6Q 1HR0Q 4DR3E 3JAML 3S1NB 1K0SA 1XMQI 2VB2X 2F0DA 5EKWA 1PIEA 1SDFA 1Z5CA 4OO1I 3DM3A 2UXCH 4MDTA 4E9JA 2UUCE 2N8NA 1VQOA 2DJFC 2F0EA 5K36F 5KRUA 4HAEA 2PO2A 3P76A 4IS9A 4JI5E 5K36C 1ODHA 3K0XA 3V2TA 2K5HA 2WNRA 3S16B 3K6OA 3HOZG 4DR6Q 1SYCA 1LT3D 1K8GA 3OTOQ 2JEBI 1UWVA 4KKUA 1YITA 2XEXA 1ONLA 2HHHI 3SHLA 4GOPA 3F1ZA 4LF8E 2IESA 4JI2H 2IX1A 1A8VA 4XQNA 4IPDA 4KKTA 4M8AA 1EFWA 1HH2P 5A2QE 3K5NA 1XMQE 3MXPA 4XTCS 1J5EQ 5GADC 2PNRC 2O4XA 1TY0A 1IBKQ 1M8AA 4LNQA 1HHVA 4C2MB 2WP8B 3GLLA 1KNEA 2OTLA 1F0XA 3H91A 4K8IA 2JYOA 4NPSA 1Y4SA 5KYIA 3M4PA 2K05A 1ELOA 4MTNA 4B3MH 2HHHE 4JI6H 1G91A 2BA1A 4RA8A 1PV4A 4JI1H 4AYBG 3BS1A 2O3ZA 4DV3Q 1EWCA 4HJ7A 2AHOB 2BA0D 4KI0A 5IP7G 2F0NA 2XNAC 1TVXA 3CDIA 4JPBW 4G7ZC 2DNCA 3CD6A 2OWOA 1K28A 5D3IB 2RVLA 5IWAL 1YJ9A 1VQ5A 4HR7B 3W1BA 1B8AA 4DK1A 3CDJA 1NSNS 3BDCA 3QOLA 4JG2A 3SVMA 3KLWA 2Z5BA 3A54A 4LF7Q 1YIJA 4FW6A 1HQRD 4FVMA 3JAMW 3CRKC 5EKKA 4JYAH 3KRNA 1II3A 1HA6A 3FDTA 3J81C 1Z47A 1D5MC 2C38A 2JA9A 2ANRA 1KRSA 1N36H 3I2ZA 4DV2I 4OKGA 1LUZA 3LWEA 2IL8A 3QT8A 1FNMA 5COYA 2CQOA 1EQQA 3D6CA 1X3GA 1JR0D 4NXMI 3F2CA 4R1JA 4UAIA 5IYDG 4QIWE 4QUFA 3DEOA 2L12A 1IYVA 2JN4A 5H1SE 3VYRA 3EFXD 2F0UA 3T1HI 1Z7TA 5JPMC 5LMNH 1VQJA 2B8FA 2F0MA 4JI7E 1KNAA 1HNXI 1J5KA 4A3MH 1KHMA 4EQ5A 1HR0L 1X3EA 2CTJA 2AUJD 2FMCA 2HKEA 3E5SA 5IYBG 2HQLA 2EIFA 1IBME 3OSOA 2UUAE 2N55A 1EIFA 4DV2E 1TWHH 5FJ8G 1YHQA 3UDFA 1I6VC 1KIXA 3JAMc 2M00A 3HOWH 2JA7G 2CVEA 2CWHA 4NXME 4RHRA 5LMNL 1B9MA 4JBJA 3U9SA 3M9BA 4G57A 5TSSA 3OTOL 3I4LA 4K2KA 4YHHQ 3T1HE 3LWUA 4LF6H 1XMOE 1RIPA 1PLFA 1HNXE 3ZZTA 2R93G 4X66H 1FNWA 2X69A 1NMFA 4CKBA 4XYOA 1XNRH 1NXUA 3I7FA 1NCVA 1OO9B 1BQQT 1Y8PB 4WORA 1FKAE 2WP8A 1NMGA 2OTJA 4HSPA 3RN2A 1IBKL 3R93A 4F8MA 1IHZA 1I4PA 4BA2B 4L5QA 3SXHA 4B3SE 1NJIC 4C56C 5JEAE 3DUZA 4UHVA 1ZXMA 2E2DC 1U5KA 4OO1G 2P5ZX 1KHIA 2KENA 3PUVA 3HOUH 4YY3E 3WOEA 4CJ0B 4DAVA 2C37B 1Y60A 2CKZB 3HOWB 1HNWI 1JE5A 1STAA 2ZXPA 1AN7A 1I94H 4DR5Q 1TXYA 2UU9E 1UAPA 3CCJA 4DA2A 5EKLA 1VBIA 1SXTA 3L0OA 4LF5H 2UUBH 1TQOA 2L5TA 1SEIA 2J7ZA 3ONAB 2X6LA 4X65H 2SNSA 1K0RA 1S4EA 3H15A 2VZAA 4C3HG 1SE8A 2BV3A 3G48A 3W5OA 5KIXA 4K0KI 3NEMA 5BR8I 1HNWE 5JJLA 1YNJC 4LFAQ 3SDZA 3I4OA 4JI4L 2UXDH 4CGYB 4NXNQ 4CDCC 3OOCA 5LMNW 2UUBL 1P42A 2A2DA 3J80Q 2K5WA 1CSPA 5J1ZA 2E5LH 1XTCD 1K3RA 2LY7A 2OT2A 2V8PA 2VNUD 3HOUB 3EA6A 4LAAA 2X06A 3HZXA 1AW7A 3A5UA 1NBWA 4JI8E 4G7OC 3GV3A 2B63H 2K52A 1PTOH 1WOCA 1S3OA 1H9SA 3ZZUA 1K1GA 4YWLA 3MFYA 1T5XD 2G9HD 1X3QA 2GQ0A 3OMGA 3HOXG 4IO9A 3UDXA 2LRRA 2CFMA 5AJ3Q 3GTLH 5EGTA 2E5LL 5CGKA 3V5RA 1EQVA 2NN6H 4DUZI 4R8IA 3MEHA 3CRLC 2CH4A 3CP0A 2QDLA 4WJWA 2ES2A 4LW1A 3KBGA 3IFTA 4GKKI 4OWTB 5EL9A 1ZZJA 2BA0G 1OXUA 4QCLA 1E0BA 4A3DG 3L7ZC 2K01A 3GCMA 1VISA 2E2JH 2H1EA 2PO1B 4LUOA 1GXDC 4DK6C 5LMUH 1LYLA 1STBA 2N88A 3K81C 2JK8A 3D0FA 2BL5A 1RODA 4GKJI 2JA8G 2R7ZG 2B63B 1EIHA 2PZWA 3SK6A 1PTOB 4DV4Q 1BUVT 3CC2A 4KHPI 1ICWA 5GAHC 3NHHA 4OXPA 2R3VA 4DR3H 3ND9A 1N0VC 4JI3H 1N32Q 1RHYA 1VQ6A 4X62Q 4DR2Q 1GUNA 2NB0A 3GTLB 1ESRA 1BVSA 4JBMA 5LMUL 2C37A 4PV1C 1PH1A 4QQBX 4DV7L 2ZJPA 2NN6B 2SEBD 4PRXA 4JI5H 2BDNA 4JI0Q 1YNJD 1SE2A 1A6FA 1ZXNA 3ZKBA 3ZJYC 4PZ7A 2I5MX 2F0KA 4V190 1RTOA 1SNCA 1L0XB 4DV5H 4G4KA 2Z0SA 4JI3L 2Q2TA 4A3EG 3J7AM 4L63B 4R4OA 4F7XA 1SEBD 3BZCA 3E6ZX 2A1SA 5D14A 1ZXTA 5I6YA 2E2JB 4UPAA 1T9HA 5EBDA 1VQMA 2B2UC 3I0PA 1G8ZD 2JP1A 2SOBA 2TMPA 2A69C 1UE7A 2KHSA 3JAME 4DV5L 1SLJA 3QT5A 1UG8A 2HD3A 2UXCI 3T1YH 4POGA 5C0XA 2B39A 2YV5A 2DY7A 4DUYL 4ME3A 1WI5A 2R3ZA 1OYRA 1KABA 3PO3G 2L55A 5IP9H 4IPGA 1XNQL 1JJGA 3CW2C 1JB7A 3P75A 1SBBB 4DXFA 3J7YW 2RDGA 4JI2I 3R3OA 1CZWA 4LF4L 2ZTEA 2E75C 3PCOB 3O13A 4IUVA 1F2ZA 2QILA 1GJXA 2K33A 1U4LA 3QOJA 4WRDA 3BG3A 3Q23A 3HKZB 2HFSA 2VUMG 2XTIA 3P20A 5CC4A 1VDZA 1VQ8A 2VXWA 3E0EA 2E3UA 3BVMA 3MTSA 1VQPA 1AP0A 3Q6NA 1HZBA 4B3MI 1Q8IA 1Y1VH 4JI6I 3K7UC 4A93G 3STBD 1K3BC 4BBSH 4JI1I 3U1YA 2JEAA 1Q8KA 5C3XA 5GAEC 2ZM6Q 1QZHA 1TS5A 1JCKB 2L9HA 1Z5AA 1NHHA 1AFPA 1SYDA 2UXBL 5E1FA 1B70B 4WJ3M 2G5DA 3IRBA 2Q8RE 1A62A 2KJXA 1STGA 3T56B 2VL6A 4JI7H 5IWAE 4M1KA 4DV4L 4UP7A 3V05A 2N3SA 1W3SA 5FLXC 4JYAI 3SK5A 1N32L 4P75A 1IBMH 4DR2L 2UUAH 3FAUA 2O1WA 1SRUA 1D7QA 2EYLA 1LTAD 3I90A 5CORA 4MU4A 2CWAA 1B63A 3HJCA 4QGUA 2NN6A 2PNLA 4GQUA 2A69D 3QT7A 1N36I 4NXMH 3WU6A 5IGCA 5HURA 1V8CA 2IT1A 1VIGA 2HQEA 1P16A 4A76A 4DFAA 2BM1A 1Y1VB 1XMOH 4BBRH 4ULLA 4FXDA 5DRPA 2JA8H 4BBSB 5CV6A 2M9VA 4BA2I 3AFQA 1I4RA 4IUPA 4JYAE 4B8TA 5LMNI 3NUCA 4CJ1B 2O2LD 1AE2A 4FF2A 1EOTA 2IHFA 1L1OB 4IALA 3U9OA 2HDMA 4QIWB 2EZVA 5DM63 2WW4A 2NZ1D 1M4VA 2K32A 2ZXOA 4PQXA 2BH2A 1HR0E 5KGUA 1QZGA 2F0LA 4ABNA 1I4GA 1KRTA 4B3SH 1QUQB 5JEAH 2AWOA 1PRTB 1HNZQ 4DR1Q 1VS0A 2B2VA 1USVA 2Y0SB 2Z6KA 3CU7A 3J81Q 1USUA 2DJGC 2K4KA 3PIP3
chains in the Genus database with same CATH topology
3GD7A 2WAQE 3PUYA 4LFCQ 1S40A 4QJFA 4Y52H 3K7AH 1N9WA 4DV1Q 1MKHA 4BXXH 3Q8DA 2F4VQ 4GN5A 4HIOA 3CPWA 3VDYA 1Q81C 1N33Q 2NVYH 4OX9L 2JVZA 2ZTDA 2ID0A 5JJIA 4WANA 4DV0Q 1UDOA 1VQBA 4O0AA 4Y7NH 1N34Q 5JEAB 2ZM6L 5M5XH 3CMAA 2OQ0A 3KJOA 5C0XE 5C4JH 1BBUA 1MJEA 1IBLL 4GKJQ 1ZTGA 1UDQA 3B6YA 4JOIA 5IY0A 2PO2B 4LFBL 2NN6D 2K5NA 1UDSA 2RF4A 3OW2A 2AKWB 2RHQB 2YTYA 2IHEA 3GTOH 2LXKA 3EBEA 4GOPB 1VQCA 4A3BH 4GS3A 3HOVH 4JC0A 1GKHA 1O7IA 2K75A 2E2IH 4B3TQ 1VQKA 1XPOA 1OYPA 2P2RA 2HH2A 2JE6A 1QUQA 4NBQA 2NN6I 1HNZL 3AEVB 2UXCQ 2B29A 3J80i 1GVPA 1XTDA 1L1OC 3PV0A 1B7YB 4LFCL 4IFDJ 1PH4A 3CC7A 1DTJA 1VIHA 4GLVB 2I5LX 4LF9L 2NN6E 1EC6A 1ASYA 4A3MG 4BA1A 2F4VL 3FP9A 1HZAA 1PYSB 1WE8A 3CCLA 2C38B 3HOWG 5JEAA 1VQIA 1N34L 2NVTH 4JV5Q 4R4IA 4JBWA 3DD6A 1UE5A 4A75A 4YWKA 1TWGH 2MQHA 4X64Q 4YCWA 4JVYA 1H95A 2JJQA 2MJHA 5JEAC 4OWXB 4DR4Q 1OXXK 1XJVA 3TS2A 3HOUG 2VS1A 4IPCA 2D0OA 3HKZE 1K83H 1G6PA 2K5VA 2LXJA 1KC8C 2YU9H 4B3TL 4PG3A 3K80C 3AEVA 3F2BA 1V43A 4GOPC 2NVQH 2KCMA 3M7NA 2N49A 3RNUA 3ICEA 1PHJA 2VQEQ 3KF8B 2CWPA 2OPVA 3S17H 2B63G 4LUVA 1FJGQ 3M3YH 1M90C 3S1QH 3OYYA 2D0PA 2NN6G 4RG1A 4B3RQ 5JEAD 3ULLA 4JV5L 3DLLA 2MO0A 3I4MH 1CSQA 1PA6A 4DV6L 2Y0SE 4IPHA 2EQSA 1GO3E 3U1KA 4A3IH 2N78A 2ALYB 1CKNA 4DR4L 1U0LA 4GN4B 1SFOH 4DR6L 4AQYQ 2UXDQ 3M85A 2PMZE 2MNAA 4HJAA 4FDBA 5M3MH 4POFA 1J5EL 3HKZG 4IJLA 4L5SA 3UE0A 4GN3B 3UDIA 3E9HA 4IJHA 2BA1D 5M3FH 2VQFQ 3A5ZB 4DV3L 1FL0A 1X4MA 1NE3A 3J81i 1L0WA 5IP9G 3W1GA 1X55A 5K36E 2VQEL 1E22A 3S15H 2KHJA 4BY1H 1HR0W 2I0QA 4LF7L 1FJGL 4JVHA 1Y1WH 2XGTA 5J3BA 4DR7Q 4DR3Q 3CCUA 5C0XB 1YHAA 4J15A 1J6QA 4B3RL 4A3GH 1Y1VG 2UUCQ 4BBSG 2CTKA 4A4IA 2GVBA 2Q2HA 1YI2A 4LF8Q 1XPUA 1VQ4A 1XMQQ 2Y0SG 3CMEA 4YHHL 1JMCA 3M85D 4R4QA 4BY7H 2JEAB 1Q46A 2HHHQ 5HGQA 1VQEA 1IXRA 3H0GH 2PY9A 4BBRG 4HIKA 3KOJA 5DLQE 1E1TA 3STBC 2R92H 1C9OA 3GTMH 3CCRA 4H02A 5JEAG 3ULPA 4KLKA 4DR5L 3GMEA 3I55A 3TQYA 4DKAC 4BXXG 3NELA 4LFAL 4IFDA 4NXNL 4OONA 1ZZKA 1IBMQ 1UE1A 2GVAA 4DV2Q 4NXMQ 2I5HA 3CCVA 3U4VA 2ZJQA 1X6OA 3T1HQ 1CKMA 3CCEA 1HNXQ 4GLXA 5IYCH 5AJ3L 4QMFB 5C0XF 5C0XC 5C3EH 3TS0A 2OCEA 1AH9A 2AWNA 3PF5A 1X9NA 2BA1G 1PH8A 4LWCA 4GLAC 5JJKA 1HJPA 1R6MA 2RHSB 5FLMH 1YVCA 2YTVA 1I50H 2BH8A 4A3BG 4WALA 3HOVG 1QVCA 1K8AC 3BJUA 4X62L 3J7A5 2QA4A 1EYGA 1GM5A 2A19A 4OWWB 4JI0L 4A3JH 1Q1EA 1HNWQ 3PGZA 3PSIA 4O2DA 1SMXA 1VQHA 3CCSA 2WP8J 2NN6F 2NN6C 2PO0A 1Q1BA 5C44H 2QNDA 3LGJA 2Q2IA 4K0KQ 2JE6B 5BR8Q 2L15A 4IFDD 5C0XD 2V1CC 3M85G 3RLFA 3J80c 1ASZA 5E7NA 3G6EA 4HJ9A 4GNXB 5GAGC 2FXQA 4R4CA 3RZOH 3GDEA 5M5YH 2OQKA 4BA1B 4YCUA 2CTFA 4IFDI 5C0XI 3JC66 2Z6KC 1FVIA 3CF5A 4DUZQ 1WFQA 3TREA 4GKKQ 1I6HH 3GTQH 3GTKH 2CTMA 4OO1A 4IFDE 3UE1A 1HZ9A 1GD7A 4AIDA 4KHPQ 5K36B 3AFPA 3TRZA 2JEAI 2MFIA 1EUJA 3RLNA 4LIJA 1PVOA 1EOVA 1C7YA 3M4OH 2JA5H 3B4TA 2MO1A 1SN8A 3S2HH 5ELOA 1UEBA 4A3FH 4DNIA 3NENA 3AQQA 3BZKA 4JOIC 4YCVA 3HOYH 3A0JA 4X6AH 1PH9A 4K0KL 5BR8L 3H3VH 4DR1L 1NY4A 2NVXH 3I4NH 2DUDA 3GTJH 4A3CH 2WB1E 3SGIA 4GNXA 4AYBE 2ASBA 4JI2Q 2C39A 3I4MG 5M5WH 2DGRA 4DV1L 3CXCA 2PI2A 1EQRA 2WAQG 1TWFH 1N33L 1WCMH 4DUZL 3VKEA 3PF4A 4A3IG 4DV0L 4B3MQ 4GKKL 1NTGA 4JI6Q 4JI1Q 3GO5A 2A8VA 3ULJA 4JCVE 4C3JH 3S16H 5M3MG 3FHWA 4GKJL 2JA6H 1OYSA 2RCNA 2H5XA 5K36A 4A3LH 1YZ6A 3KDFA 1WJJA 3CCQA 4KHPL 1PH5A 4JYAQ 5JEAF 3H1CA 4IFDG 5C0XG 1CKNB 1KAWA 1UDNA 1MIUA 2PQAB 2HT1A 1BBWA 2D62A 1N36Q 1YEZA 5M3FG 1QVFA 1VQDA 3ER0A 1CUKA 2CTEA 2JQOA 1WYDA 5LMNQ 3RR5A 4C3IH 4IOCA 4DAMA 3M4QA 4BY1G 4DAYB 5EAYA 1Y1WG 2UXCL 4A3KH 3S24A 4OO1E 1DT4A 1VQLA 3J81c 4LF6Q 1J4WA 4A3GG 4YWMA 2Q2UA 1IL2A 2QGQA 1EWIA 3FKIH 4X66Q 4JI2L 4EX5A 2WB1G 4TVAB 1XNRQ 3J7ZC 3F8TA 1X3FA 2R6GA 2JE6I 3RLOA 1X56A 1E1OA 1BKBA 1Q12A 4B3ML 4JI6L 1C0AA 2NZHA 1AE3A 4JI1L 3PIOA 4LUZA 3PO2H 4BY7G 1KXLA 1I94Q 4JI4Q 4BA1I 3H0GG 3HKSA 1M1KC 4X64L 4LF5Q 2F52A 2UUBQ 4X65Q 5K36D 1PH3A 4JYAL 2PQAA 3L7ZB 3AYHB 2R92G 1N36L 2PI2E 2E5LQ 1QVGA 3CPFA 2HIXA 1OXSC 4JBKA 1E24A 5C4XH 1P8LA 4P73A 2AXYA 3WWVA 1PFSA 1KL9A 3F2DA 3M7ND 3S1RH 4AM3A 1LTLA 4LF6L 1I3QH 4X66L 3HOZH 2GN5A 2R7FA 2VW9A 1XNRL 1OTCA 5LMUQ 4AH6A 4DV7Q 4P71A 5IYCG 4QY7A 5C3EG 1LM0A 4JI3Q 5IT9c 2HH3A 4IFDB 1A63A 3HKMA 1PH6A 2PNZB 4JI5Q 3A74A 5FLMG 1I94L 4UP9A 3KJPA 4DV5Q 1EIYB 1E7ZA 2OPUA 3KF6B 4UY8C 3D31A 1FGUA 5IP7H 4DUYQ 4LF5L 2ZJRA 1YHBA 4X65L 1W2BA 1XNQQ 1MJCA 1KD1C 4HJ5A 1VQGA 3L7ZA 3MXNB 3H3VI 4LF4Q 3T1YQ 4AQYL 1XPRA 2UXDL 1L2FA 4IOAA 5JEAJ 5GQOA 4A3JG 3JAMi 1CKOA 1Q7YC 4UP8A 1VQFA 5IYDH 3PUZA 1A0IA 3G71A 5C44G 2UXBQ 2VQFL 1X54A 5IYBH 2E8GA 1HZCA 1PH2A 1VQAA 5FJ8H 4BA2A 3U50C 4DPGA 2ATWA 2JA7H 3ERSX 2NZOA 3RN5A 2EXDA 3CQZH 1I5FA 2R93H 5K36G 2KCTA 4JI7Q 1YNXA 2PO0B 4DR7L 3RZDH 1R9TH 4DR3L 2CCZA 3U4ZA 1TUAA 2UUAQ 2DGYA 1SR3A 2FMRA 2PNZA 4L5TA 2UUCL 3PUXA 3PIPA 4MZ9A 4JI5L 2YQRA 1VCIA 4HJ8A 4ALPA 3KF6A 1XMOQ 1UE6A 4DK3C 3EN2A 4LF8L 1IZ6A 4HIMA 4IFDF 4IFDC 1XMQL 1RL2A 3S14H 4APVA 2A1AA 3M7NG 4B3SQ 3T1YL 5FLXc 1PH7A 4C3HH 1JT8A 4AIMA 3GTPH 2HHHL 4YY3Q 1YJNA 1YJWA 4NB3A 1E3PA 2JA5G 4OX9Q 4OO1B 2UU9Q 2R7DA 3L2PA 4A3FG 3J81j 2PNHA 2PO1A 1K73C 3UDGA 1V9PA 2JEBB 2IY5B 2K14A 3HOYG 3HOXH 1YBYA 3I4NG 1IBLQ 4A3CG 1K9MC 2BR2B 2HIVA 2VY3A 4PZ8A 4A3DH 4LFBQ 3S2DH 2ANNA 1WVNA 4JI8Q 1ZZIA 3CAMA 4JI7L 2R7ZH 1IBML 2UUAL 1PYBA 1WCMG 4DV2L 2WFWA 2PQUA 4P72A 4NXML 5IE8A 1D8LA 1Y14B 1VQ7A 3T1HL 2C39B 1XMOL 2E2HH 1HNXL 1S72A 2QEXA 5GROA 4A3EH 2JA6G 1VQNA 3KFUA 4A3LG 5HY6A 3NBHB 4B3SL 3S1MH 3KYHC 4LF9Q 4YY3L 2YTXA 3PO3H 2UU9L 2YYZA 2JEBA 3KDFB 4L5RC 3BU2A 3G4SA 3E9IA 2C35B 1KQSA 5ELNA 4QL5A 1X65A 2IX0A 4A3KG 2VUMH 1HNWL 4OO1F 4HIDA 1TWCH 1V1QA 4OO1C 4XIGS 1OXVA 1G291 3EIVA 2BR2A 3I56A 4A93H 1JJ2A 3FKIG 2KBNA 4KHZA 2WNRB 4JI8L 3CCMA 1E3HA 1DGSA 2AMCB 4R4TA 4MNOA 2KHIA 2ZTCA 1Q86C 4PZ6A 1L1OA 2JZXA 3HFZB 1Q82C 3U58A 3GTGH 4P74A 2CPQA 3V69A 4PMWA 3PO2G 3K8AA 2F3IA 3MEFA 3TEHB 2BA0A 1TWAH 2CTLA 1G51A 3S1NH 5IWAQ 4GNXC 5C0XJ 4WJ4A 1OXTA 1N8RC 1SROA 4OO1D 2B3GA 2LSSA 1JJCB 4RMFA 1IYJB 1R6LA 1Z9FA 4C2MH 1VQ9A 4TQUS 3PUWA 1X4NA 5C4XG 2K50A 4DV6Q 1HR0Q 4OO1I 3DM3A 2N8NA 1VQOA 5K36F 2PO2A 5K36C 3K0XA 2K5HA 2WNRA 3HOZG 4DR6Q 1K8GA 3OTOQ 2JEBI 1UWVA 1YITA 4GOPA 3F1ZA 2IX1A 1A8VA 1EFWA 4IPDA 1HH2P 4XTCS 1J5EQ 5GADC 4LNQA 1IBKQ 2WP8B 3GLLA 2OTLA 4NPSA 3M4PA 4MTNA 2BA1A 1PV4A 4AYBG 4DV3Q 4HJ7A 2BA0D 2AHOB 4KI0A 5IP7G 3CDIA 3CD6A 2OWOA 5IWAL 1YJ9A 1VQ5A 3W1BA 1B8AA 3CDJA 4JG2A 3KLWA 4LF7Q 1YIJA 3KRNA 1Z47A 2C38A 2JA9A 2ANRA 1KRSA 3I2ZA 1LUZA 2CQOA 1EQQA 1X3GA 3F2CA 4R1JA 5IYDG 4QIWE 5H1SE 1VQJA 1J5KA 4A3MH 1KHMA 4EQ5A 1HR0L 1X3EA 2CTJA 5IYBG 2HQLA 2EIFA 1EIFA 1TWHH 5FJ8G 1YHQA 3UDFA 1KIXA 3JAMc 3HOWH 2JA7G 5LMNL 4JBJA 3M9BA 3OTOL 4YHHQ 1RIPA 2R93G 1NMFA 3I7FA 2WP8A 1NMGA 2OTJA 3RN2A 1IBKL 4BA2B 4L5QA 1NJIC 5JEAE 1U5KA 4OO1G 1KHIA 2KENA 3PUVA 3HOUH 2C37B 2CKZB 1JE5A 4DR5Q 1TXYA 3CCJA 3L0OA 1K0RA 3H15A 2VZAA 1SE8A 3G48A 3W5OA 3NEMA 5JJLA 4LFAQ 3I4OA 4JI4L 4NXNQ 5LMNW 2UUBL 1CSPA 1K3RA 2VNUD 3A5UA 1NBWA 2B63H 2K52A 1WOCA 1S3OA 1K1GA 4YWLA 3HOXG 4IO9A 3UDXA 2CFMA 5AJ3Q 3GTLH 2E5LL 3CP0A 2ES2A 4LW1A 4OWTB 1ZZJA 2BA0G 1OXUA 4A3DG 3L7ZC 3GCMA 2E2JH 2PO1B 4LUOA 4DK6C 1LYLA 3K81C 2JK8A 3D0FA 2BL5A 2JA8G 2R7ZG 4DV4Q 3CC2A 5GAHC 4OXPA 1N32Q 1VQ6A 4X62Q 4DR2Q 1BVSA 4JBMA 5LMUL 2C37A 4QQBX 1PH1A 4DV7L 2ZJPA 2NN6B 4JI0Q 3ZJYC 4PZ7A 2I5MX 4JI3L 2Z0SA 2Q2TA 4A3EG 4R4OA 3BZCA 4UPAA 1T9HA 1VQMA 1UE7A 4DV5L 1SLJA 4POGA 5C0XA 2YV5A 4DUYL 4ME3A 1WI5A 1OYRA 3PO3G 5IP9H 4IPGA 1XNQL 1JJGA 3CW2C 1JB7A 4LF4L 2ZTEA 3PCOB 2VUMG 2XTIA 1VQ8A 3E0EA 2E3UA 1VQPA 1HZBA 1Y1VH 3K7UC 4A93G 4BBSH 3STBD 2JEAA 1Q8KA 5GAEC 2ZM6Q 1QZHA 2UXBL 1B70B 4WJ3M 3IRBA 1A62A 2VL6A 4DV4L 4UP7A 2N3SA 1W3SA 1N32L 4P75A 4DR2L 1SRUA 1D7QA 2CWAA 4QGUA 2NN6A 2IT1A 1VIGA 1P16A 4A76A 4BBRH 2JA8H 4BA2I 3AFQA 4B8TA 1AE2A 2IHFA 1L1OB 2BH2A 1QZGA 1KRTA 1QUQB 2AWOA 1HNZQ 4DR1Q 1VS0A 2Z6KA 3CC4A 2K4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GD7 A;  2WAQ E;  3PUY A;  4LFC Q;  1S40 A;  4QJF A;  4Y52 H;  3K7A H;  1N9W A;  4DV1 Q;  1MKH A;  4BXX H;  3Q8D A;  2F4V Q;  4GN5 A;  4HIO A;  3CPW A;  3VDY A;  1Q81 C;  1N33 Q;  2NVY H;  4OX9 L;  2JVZ A;  2ZTD A;  2ID0 A;  5JJI A;  4WAN A;  4DV0 Q;  1UDO A;  1VQB A;  4O0A A;  4Y7N H;  1N34 Q;  5JEA B;  2ZM6 L;  5M5X H;  3CMA A;  2OQ0 A;  3KJO A;  5C0X E;  5C4J H;  1BBU A;  1MJE A;  1IBL L;  4GKJ Q;  1ZTG A;  1UDQ A;  3B6Y A;  4JOI A;  5IY0 A;  2PO2 B;  4LFB L;  2NN6 D;  2K5N A;  1UDS A;  2RF4 A;  3OW2 A;  2AKW B;  2RHQ B;  2YTY A;  2IHE A;  3GTO H;  2LXK A;  3EBE A;  4GOP B;  1VQC A;  4A3B H;  4GS3 A;  3HOV H;  4JC0 A;  1GKH A;  1O7I A;  2K75 A;  2E2I H;  4B3T Q;  1VQK A;  1XPO A;  1OYP A;  2P2R A;  2HH2 A;  2JE6 A;  1QUQ A;  4NBQ A;  2NN6 I;  1HNZ L;  3AEV B;  2UXC Q;  2B29 A;  3J80 i;  1GVP A;  1XTD A;  1L1O C;  3PV0 A;  1B7Y B;  4LFC L;  4IFD J;  1PH4 A;  3CC7 A;  1DTJ A;  1VIH A;  4GLV B;  2I5L X;  4LF9 L;  2NN6 E;  1EC6 A;  1ASY A;  4A3M G;  4BA1 A;  2F4V L;  3FP9 A;  1HZA A;  1PYS B;  1WE8 A;  3CCL A;  2C38 B;  3HOW G;  5JEA A;  1VQI A;  1N34 L;  2NVT H;  4JV5 Q;  4R4I A;  4JBW A;  3DD6 A;  1UE5 A;  4A75 A;  4YWK A;  1TWG H;  2MQH A;  4X64 Q;  4YCW A;  4JVY A;  1H95 A;  2JJQ A;  2MJH A;  5JEA C;  4OWX B;  4DR4 Q;  1OXX K;  1XJV A;  3TS2 A;  3HOU G;  2VS1 A;  4IPC A;  2D0O A;  3HKZ E;  1K83 H;  1G6P A;  2K5V A;  2LXJ A;  1KC8 C;  2YU9 H;  4B3T L;  4PG3 A;  3K80 C;  3AEV A;  3F2B A;  1V43 A;  4GOP C;  2NVQ H;  2KCM A;  3M7N A;  2N49 A;  3RNU A;  3ICE A;  1PHJ A;  2VQE Q;  3KF8 B;  2CWP A;  2OPV A;  3S17 H;  2B63 G;  4LUV A;  1FJG Q;  3M3Y H;  1M90 C;  3S1Q H;  3OYY A;  2D0P A;  2NN6 G;  4RG1 A;  4B3R Q;  5JEA D;  3ULL A;  4JV5 L;  3DLL A;  2MO0 A;  3I4M H;  1CSQ A;  1PA6 A;  4DV6 L;  2Y0S E;  4IPH A;  2EQS A;  1GO3 E;  3U1K A;  4A3I H;  2N78 A;  2ALY B;  1CKN A;  4DR4 L;  1U0L A;  4GN4 B;  1SFO H;  4DR6 L;  4AQY Q;  2UXD Q;  3M85 A;  2PMZ E;  2MNA A;  4HJA A;  4FDB A;  5M3M H;  4POF A;  1J5E L;  3HKZ G;  4IJL A;  4L5S A;  3UE0 A;  4GN3 B;  3UDI A;  3E9H A;  4IJH A;  2BA1 D;  5M3F H;  2VQF Q;  3A5Z B;  4DV3 L;  1FL0 A;  1X4M A;  1NE3 A;  3J81 i;  1L0W A;  5IP9 G;  3W1G A;  1X55 A;  5K36 E;  2VQE L;  1E22 A;  3S15 H;  2KHJ A;  4BY1 H;  1HR0 W;  2I0Q A;  4LF7 L;  1FJG L;  4JVH A;  1Y1W H;  2XGT A;  5J3B A;  4DR7 Q;  4DR3 Q;  3CCU A;  5C0X B;  1YHA A;  4J15 A;  1J6Q A;  4B3R L;  4A3G H;  1Y1V G;  2UUC Q;  4BBS G;  2CTK A;  4A4I A;  2GVB A;  2Q2H A;  1YI2 A;  4LF8 Q;  1XPU A;  1VQ4 A;  1XMQ Q;  2Y0S G;  3CME A;  4YHH L;  1JMC A;  3M85 D;  4R4Q A;  4BY7 H;  2JEA B;  1Q46 A;  2HHH Q;  5HGQ A;  1VQE A;  1IXR A;  3H0G H;  2PY9 A;  4BBR G;  4HIK A;  3KOJ A;  5DLQ E;  1E1T A;  3STB C;  2R92 H;  1C9O A;  3GTM H;  3CCR A;  4H02 A;  5JEA G;  3ULP A;  4KLK A;  4DR5 L;  3GME A;  3I55 A;  3TQY A;  4DKA C;  4BXX G;  3NEL A;  4LFA L;  4IFD A;  4NXN L;  4OON A;  1ZZK A;  1IBM Q;  1UE1 A;  2GVA A;  4DV2 Q;  4NXM Q;  2I5H A;  3CCV A;  3U4V A;  2ZJQ A;  1X6O A;  3T1H Q;  1CKM A;  3CCE A;  1HNX Q;  4GLX A;  5IYC H;  5AJ3 L;  4QMF B;  5C0X F;  5C0X C;  5C3E H;  3TS0 A;  2OCE A;  1AH9 A;  2AWN A;  3PF5 A;  1X9N A;  2BA1 G;  1PH8 A;  4LWC A;  4GLA C;  5JJK A;  1HJP A;  1R6M A;  2RHS B;  5FLM H;  1YVC A;  2YTV A;  1I50 H;  2BH8 A;  4A3B G;  4WAL A;  3HOV G;  1QVC A;  1K8A C;  3BJU A;  4X62 L;  3J7A 5;  2QA4 A;  1EYG A;  1GM5 A;  2A19 A;  4OWW B;  4JI0 L;  4A3J H;  1Q1E A;  1HNW Q;  3PGZ A;  3PSI A;  4O2D A;  1SMX A;  1VQH A;  3CCS A;  2WP8 J;  2NN6 F;  2NN6 C;  2PO0 A;  1Q1B A;  5C44 H;  2QND A;  3LGJ A;  2Q2I A;  4K0K Q;  2JE6 B;  5BR8 Q;  2L15 A;  4IFD D;  5C0X D;  2V1C C;  3M85 G;  3RLF A;  3J80 c;  1ASZ A;  5E7N A;  3G6E A;  4HJ9 A;  4GNX B;  5GAG C;  2FXQ A;  4R4C A;  3RZO H;  3GDE A;  5M5Y H;  2OQK A;  4BA1 B;  4YCU A;  2CTF A;  4IFD I;  5C0X I;  3JC6 6;  2Z6K C;  1FVI A;  3CF5 A;  4DUZ Q;  1WFQ A;  3TRE A;  4GKK Q;  1I6H H;  3GTQ H;  3GTK H;  2CTM A;  4OO1 A;  4IFD E;  3UE1 A;  1HZ9 A;  1GD7 A;  4AID A;  4KHP Q;  5K36 B;  3AFP A;  3TRZ A;  2JEA I;  2MFI A;  1EUJ A;  3RLN A;  4LIJ A;  1PVO A;  1EOV A;  1C7Y A;  3M4O H;  2JA5 H;  3B4T A;  2MO1 A;  1SN8 A;  3S2H H;  5ELO A;  1UEB A;  4A3F H;  4DNI A;  3NEN A;  3AQQ A;  3BZK A;  4JOI C;  4YCV A;  3HOY H;  3A0J A;  4X6A H;  1PH9 A;  4K0K L;  5BR8 L;  3H3V H;  4DR1 L;  1NY4 A;  2NVX H;  3I4N H;  2DUD A;  3GTJ H;  4A3C H;  2WB1 E;  3SGI A;  4GNX A;  4AYB E;  2ASB A;  4JI2 Q;  2C39 A;  3I4M G;  5M5W H;  2DGR A;  4DV1 L;  3CXC A;  2PI2 A;  1EQR A;  2WAQ G;  1TWF H;  1N33 L;  1WCM H;  4DUZ L;  3VKE A;  3PF4 A;  4A3I G;  4DV0 L;  4B3M Q;  4GKK L;  1NTG A;  4JI6 Q;  4JI1 Q;  3GO5 A;  2A8V A;  3ULJ A;  4JCV E;  4C3J H;  3S16 H;  5M3M G;  3FHW A;  4GKJ L;  2JA6 H;  1OYS A;  2RCN A;  2H5X A;  5K36 A;  4A3L H;  1YZ6 A;  3KDF A;  1WJJ A;  3CCQ A;  4KHP L;  1PH5 A;  4JYA Q;  5JEA F;  3H1C A;  4IFD G;  5C0X G;  1CKN B;  1KAW A;  1UDN A;  1MIU A;  2PQA B;  2HT1 A;  1BBW A;  2D62 A;  1N36 Q;  1YEZ A;  5M3F G;  1QVF A;  1VQD A;  3ER0 A;  1CUK A;  2CTE A;  2JQO A;  1WYD A;  5LMN Q;  3RR5 A;  4C3I H;  4IOC A;  4DAM A;  3M4Q A;  4BY1 G;  4DAY B;  5EAY A;  1Y1W G;  2UXC L;  4A3K H;  3S24 A;  4OO1 E;  1DT4 A;  1VQL A;  3J81 c;  4LF6 Q;  1J4W A;  4A3G G;  4YWM A;  2Q2U A;  1IL2 A;  2QGQ A;  1EWI A;  3FKI H;  4X66 Q;  4JI2 L;  4EX5 A;  2WB1 G;  4TVA B;  1XNR Q;  3J7Z C;  3F8T A;  1X3F A;  2R6G A;  2JE6 I;  3RLO A;  1X56 A;  1E1O A;  1BKB A;  1Q12 A;  4B3M L;  4JI6 L;  1C0A A;  2NZH A;  1AE3 A;  4JI1 L;  3PIO A;  4LUZ A;  3PO2 H;  4BY7 G;  1KXL A;  1I94 Q;  4JI4 Q;  4BA1 I;  3H0G G;  3HKS A;  1M1K C;  4X64 L;  4LF5 Q;  2F52 A;  2UUB Q;  4X65 Q;  5K36 D;  1PH3 A;  4JYA L;  2PQA A;  3L7Z B;  3AYH B;  2R92 G;  1N36 L;  2PI2 E;  2E5L Q;  1QVG A;  3CPF A;  2HIX A;  1OXS C;  4JBK A;  1E24 A;  5C4X H;  1P8L A;  4P73 A;  2AXY A;  3WWV A;  1PFS A;  1KL9 A;  3F2D A;  3M7N D;  3S1R H;  4AM3 A;  1LTL A;  4LF6 L;  1I3Q H;  4X66 L;  3HOZ H;  2GN5 A;  2R7F A;  2VW9 A;  1XNR L;  1OTC A;  5LMU Q;  4AH6 A;  4DV7 Q;  4P71 A;  5IYC G;  4QY7 A;  5C3E G;  1LM0 A;  4JI3 Q;  5IT9 c;  2HH3 A;  4IFD B;  1A63 A;  3HKM A;  1PH6 A;  2PNZ B;  4JI5 Q;  3A74 A;  5FLM G;  1I94 L;  4UP9 A;  3KJP A;  4DV5 Q;  1EIY B;  1E7Z A;  2OPU A;  3KF6 B;  4UY8 C;  3D31 A;  1FGU A;  5IP7 H;  4DUY Q;  4LF5 L;  2ZJR A;  1YHB A;  4X65 L;  1W2B A;  1XNQ Q;  1MJC A;  1KD1 C;  4HJ5 A;  1VQG A;  3L7Z A;  3MXN B;  3H3V I;  4LF4 Q;  3T1Y Q;  4AQY L;  1XPR A;  2UXD L;  1L2F A;  4IOA A;  5JEA J;  5GQO A;  4A3J G;  3JAM i;  1CKO A;  1Q7Y C;  4UP8 A;  1VQF A;  5IYD H;  3PUZ A;  1A0I A;  3G71 A;  5C44 G;  2UXB Q;  2VQF L;  1X54 A;  5IYB H;  2E8G A;  1HZC A;  1PH2 A;  1VQA A;  5FJ8 H;  4BA2 A;  3U50 C;  4DPG A;  2ATW A;  2JA7 H;  3ERS X;  2NZO A;  3RN5 A;  2EXD A;  3CQZ H;  1I5F A;  2R93 H;  5K36 G;  2KCT A;  4JI7 Q;  1YNX A;  2PO0 B;  4DR7 L;  3RZD H;  1R9T H;  4DR3 L;  2CCZ A;  3U4Z A;  1TUA A;  2UUA Q;  2DGY A;  1SR3 A;  2FMR A;  2PNZ A;  4L5T A;  2UUC L;  3PUX A;  3PIP A;  4MZ9 A;  4JI5 L;  2YQR A;  1VCI A;  4HJ8 A;  4ALP A;  3KF6 A;  1XMO Q;  1UE6 A;  4DK3 C;  3EN2 A;  4LF8 L;  1IZ6 A;  4HIM A;  4IFD F;  4IFD C;  1XMQ L;  1RL2 A;  3S14 H;  4APV A;  2A1A A;  3M7N G;  4B3S Q;  3T1Y L;  5FLX c;  1PH7 A;  4C3H H;  1JT8 A;  4AIM A;  3GTP H;  2HHH L;  4YY3 Q;  1YJN A;  1YJW A;  4NB3 A;  1E3P A;  2JA5 G;  4OX9 Q;  4OO1 B;  2UU9 Q;  2R7D A;  3L2P A;  4A3F G;  3J81 j;  2PNH A;  2PO1 A;  1K73 C;  3UDG A;  1V9P A;  2JEB B;  2IY5 B;  2K14 A;  3HOY G;  3HOX H;  1YBY A;  3I4N G;  1IBL Q;  4A3C G;  1K9M C;  2BR2 B;  2HIV A;  2VY3 A;  4PZ8 A;  4A3D H;  4LFB Q;  3S2D H;  2ANN A;  1WVN A;  4JI8 Q;  1ZZI A;  3CAM A;  4JI7 L;  2R7Z H;  1IBM L;  2UUA L;  1PYB A;  1WCM G;  4DV2 L;  2WFW A;  2PQU A;  4P72 A;  4NXM L;  5IE8 A;  1D8L A;  1Y14 B;  1VQ7 A;  3T1H L;  2C39 B;  1XMO L;  2E2H H;  1HNX L;  1S72 A;  2QEX A;  5GRO A;  4A3E H;  2JA6 G;  1VQN A;  3KFU A;  4A3L G;  5HY6 A;  3NBH B;  4B3S L;  3S1M H;  3KYH C;  4LF9 Q;  4YY3 L;  2YTX A;  3PO3 H;  2UU9 L;  2YYZ A;  2JEB A;  3KDF B;  4L5R C;  3BU2 A;  3G4S A;  3E9I A;  2C35 B;  1KQS A;  5ELN A;  4QL5 A;  1X65 A;  2IX0 A;  4A3K G;  2VUM H;  1HNW L;  4OO1 F;  4HID A;  1TWC H;  1V1Q A;  4OO1 C;  4XIG S;  1OXV A;  1G29 1;  3EIV A;  2BR2 A;  3I56 A;  4A93 H;  1JJ2 A;  3FKI G;  2KBN A;  4KHZ A;  2WNR B;  4JI8 L;  3CCM A;  1E3H A;  1DGS A;  2AMC B;  4R4T A;  4MNO A;  2KHI A;  2ZTC A;  1Q86 C;  4PZ6 A;  1L1O A;  2JZX A;  3HFZ B;  1Q82 C;  3U58 A;  3GTG H;  4P74 A;  2CPQ A;  3V69 A;  4PMW A;  3PO2 G;  3K8A A;  2F3I A;  3MEF A;  3TEH B;  2BA0 A;  1TWA H;  2CTL A;  1G51 A;  3S1N H;  5IWA Q;  4GNX C;  5C0X J;  4WJ4 A;  1OXT A;  1N8R C;  1SRO A;  4OO1 D;  2B3G A;  2LSS A;  1JJC B;  4RMF A;  1IYJ B;  1R6L A;  1Z9F A;  4C2M H;  1VQ9 A;  4TQU S;  3PUW A;  1X4N A;  5C4X G;  2K50 A;  4DV6 Q;  1HR0 Q;  4OO1 I;  3DM3 A;  2N8N A;  1VQO A;  5K36 F;  2PO2 A;  5K36 C;  3K0X A;  2K5H A;  2WNR A;  3HOZ G;  4DR6 Q;  1K8G A;  3OTO Q;  2JEB I;  1UWV A;  1YIT A;  4GOP A;  3F1Z A;  2IX1 A;  1A8V A;  1EFW A;  4IPD A;  1HH2 P;  4XTC S;  1J5E Q;  5GAD C;  4LNQ A;  1IBK Q;  2WP8 B;  3GLL A;  2OTL A;  4NPS A;  3M4P A;  4MTN A;  2BA1 A;  1PV4 A;  4AYB G;  4DV3 Q;  4HJ7 A;  2BA0 D;  2AHO B;  4KI0 A;  5IP7 G;  3CDI A;  3CD6 A;  2OWO A;  5IWA L;  1YJ9 A;  1VQ5 A;  3W1B A;  1B8A A;  3CDJ A;  4JG2 A;  3KLW A;  4LF7 Q;  1YIJ A;  3KRN A;  1Z47 A;  2C38 A;  2JA9 A;  2ANR A;  1KRS A;  3I2Z A;  1LUZ A;  2CQO A;  1EQQ A;  1X3G A;  3F2C A;  4R1J A;  5IYD G;  4QIW E;  5H1S E;  1VQJ A;  1J5K A;  4A3M H;  1KHM A;  4EQ5 A;  1HR0 L;  1X3E A;  2CTJ A;  5IYB G;  2HQL A;  2EIF A;  1EIF A;  1TWH H;  5FJ8 G;  1YHQ A;  3UDF A;  1KIX A;  3JAM c;  3HOW H;  2JA7 G;  5LMN L;  4JBJ A;  3M9B A;  3OTO L;  4YHH Q;  1RIP A;  2R93 G;  1NMF A;  3I7F A;  2WP8 A;  1NMG A;  2OTJ A;  3RN2 A;  1IBK L;  4BA2 B;  4L5Q A;  1NJI C;  5JEA E;  1U5K A;  4OO1 G;  1KHI A;  2KEN A;  3PUV A;  3HOU H;  2C37 B;  2CKZ B;  1JE5 A;  4DR5 Q;  1TXY A;  3CCJ A;  3L0O A;  1K0R A;  3H15 A;  2VZA A;  1SE8 A;  3G48 A;  3W5O A;  3NEM A;  5JJL A;  4LFA Q;  3I4O A;  4JI4 L;  4NXN Q;  5LMN W;  2UUB L;  1CSP A;  1K3R A;  2VNU D;  3A5U A;  1NBW A;  2B63 H;  2K52 A;  1WOC A;  1S3O A;  1K1G A;  4YWL A;  3HOX G;  4IO9 A;  3UDX A;  2CFM A;  5AJ3 Q;  3GTL H;  2E5L L;  3CP0 A;  2ES2 A;  4LW1 A;  4OWT B;  1ZZJ A;  2BA0 G;  1OXU A;  4A3D G;  3L7Z C;  3GCM A;  2E2J H;  2PO1 B;  4LUO A;  4DK6 C;  1LYL A;  3K81 C;  2JK8 A;  3D0F A;  2BL5 A;  2JA8 G;  2R7Z G;  4DV4 Q;  3CC2 A;  5GAH C;  4OXP A;  1N32 Q;  1VQ6 A;  4X62 Q;  4DR2 Q;  1BVS A;  4JBM A;  5LMU L;  2C37 A;  4QQB X;  1PH1 A;  4DV7 L;  2ZJP A;  2NN6 B;  4JI0 Q;  3ZJY C;  4PZ7 A;  2I5M X;  4JI3 L;  2Z0S A;  2Q2T A;  4A3E G;  4R4O A;  3BZC A;  4UPA A;  1T9H A;  1VQM A;  1UE7 A;  4DV5 L;  1SLJ A;  4POG A;  5C0X A;  2YV5 A;  4DUY L;  4ME3 A;  1WI5 A;  1OYR A;  3PO3 G;  5IP9 H;  4IPG A;  1XNQ L;  1JJG A;  3CW2 C;  1JB7 A;  4LF4 L;  2ZTE A;  3PCO B;  2VUM G;  2XTI A;  1VQ8 A;  3E0E A;  2E3U A;  1VQP A;  1HZB A;  1Y1V H;  3K7U C;  4A93 G;  4BBS H;  3STB D;  2JEA A;  1Q8K A;  5GAE C;  2ZM6 Q;  1QZH A;  2UXB L;  1B70 B;  4WJ3 M;  3IRB A;  1A62 A;  2VL6 A;  4DV4 L;  4UP7 A;  2N3S A;  1W3S A;  1N32 L;  4P75 A;  4DR2 L;  1SRU A;  1D7Q A;  2CWA A;  4QGU A;  2NN6 A;  2IT1 A;  1VIG A;  1P16 A;  4A76 A;  4BBR H;  2JA8 H;  4BA2 I;  3AFQ A;  4B8T A;  1AE2 A;  2IHF A;  1L1O B;  2BH2 A;  1QZG A;  1KRT A;  1QUQ B;  2AWO A;  1HNZ Q;  4DR1 Q;  1VS0 A;  2Z6K A;  3CC4 A;  2K4K A; 
#chains in the Genus database with same CATH topology
 1F77 A;  4LF6 I;  5LMN E;  2RSN A;  1D5Z C;  1IW7 D;  3GD7 A;  3OTO E;  2WAQ E;  3PUY A;  4X66 I;  3T53 B;  2B2Y A;  4OX9 H;  4LFC Q;  1S40 A;  3Q6M A;  2FPH X;  4QJF A;  1XNR I;  2UU9 H;  1LT4 D;  4Y52 H;  4K5W A;  4K5V A;  1VF7 A;  2J65 A;  3K7A H;  1N9W A;  4DV1 Q;  4H8A A;  3VR5 A;  4BBR B;  1MKH A;  2JA8 B;  4BXX H;  3OIP A;  3CHB D;  4U3B A;  3Q8D A;  2F4V Q;  4GN5 A;  4HIO A;  3KK7 A;  3CPW A;  3VDY A;  3PYG A;  1Q81 C;  2EJG C;  1N33 Q;  1IBK E;  1A2T A;  3D4D A;  2NVY H;  4LF6 E;  4OX9 L;  2JVZ A;  2ZTD A;  2ID0 A;  5JJI A;  4WAN A;  4DV0 Q;  1F9S A;  1QNK A;  1UDO A;  4DNR B;  2GO3 A;  1VQB A;  4O0A A;  4Y7N H;  4B8C D;  1N34 Q;  5JEA B;  2ZM6 L;  5E3F A;  4HCS A;  5JPN C;  1I94 I;  5M5X H;  4RFB A;  1H7U A;  1E2Z A;  3CMA A;  4KHV A;  5CV5 A;  4RGM A;  4FF4 A;  4JI4 I;  2OQ0 A;  3ZZ0 A;  1X0A A;  4JI8 H;  3KJO A;  5A2Q C;  4LF5 I;  2UUB I;  5C0X E;  4IZJ B;  5C4J H;  1BBU A;  3HGB A;  1MJE A;  1IBL L;  4GKJ Q;  1PTO D;  2EY6 A;  2R42 A;  4X65 I;  1EU3 A;  3NCV A;  1TY2 A;  2SNM A;  1ZTG A;  1UDQ A;  4P52 A;  1PFB A;  4IZK A;  1B3A A;  4OL7 A;  3X3M A;  3B6Y A;  3K7A B;  4H0L C;  4JOI A;  4RH6 A;  4X3U A;  5IY0 A;  5KNC A;  2PO2 B;  4N8F A;  4LFB L;  2NN6 D;  2UXD I;  1NZ0 A;  2F0F A;  2K5N A;  1UDS A;  2RF4 A;  4LPF A;  3OW2 A;  2AKW B;  1BF4 A;  4HAC B;  4JI4 E;  4LJZ C;  1XX8 A;  2RHQ B;  2E5L I;  2YTY A;  2IHE A;  3TME A;  2LXK A;  3BDL A;  3EBE A;  4GOP B;  3GTO H;  2UUB E;  1VQC A;  4KY7 A;  4A3B H;  1G6Z A;  4GS3 A;  3HOV H;  3GON A;  4Y7N B;  3FPU B;  1GKH A;  4JC0 A;  4N3O A;  3BVZ A;  4ZQ3 A;  3V2U C;  1O7I A;  2K75 A;  2E2I H;  4B3T Q;  1VQK A;  2EY2 A;  5M5X B;  1XPO A;  1UEK A;  3NXW A;  5K5P A;  1OYP A;  2P2R A;  2EYF A;  2HH2 A;  3KDK A;  1RD9 D;  2JE6 A;  1QUQ A;  4NBQ A;  5C4J B;  2NN6 I;  3KDG A;  1V9N A;  3KUP A;  3NP8 A;  1FWL A;  2E5L E;  5IIF A;  1HNZ L;  3AEV B;  2CHB D;  2UXC Q;  4LF9 H;  4FWD A;  2FMM A;  4J8Q A;  1EZ8 A;  2B29 A;  3J81 L;  3IL8 A;  2HCC A;  2TSS A;  3J80 i;  1GVP A;  2E74 C;  1XTD A;  2J4X A;  1L1O C;  3PV0 A;  5E4X A;  1B7Y B;  1DOL A;  4LFC L;  1PYW D;  4CDF C;  3VYS A;  2PNM A;  4IFD J;  2A6E D;  2RQX A;  1PH4 A;  3CC7 A;  1DTJ A;  1VIH A;  5LMU I;  3QO2 A;  4GLV B;  4QB4 A;  3GTO B;  4DV7 I;  2I5L X;  4LF9 L;  2NN6 E;  1EC6 A;  1ASY A;  4A3B B;  4LMQ D;  4A3M G;  4BA1 A;  2Z5B B;  2F4V L;  3FP9 A;  1HZA A;  4ODG A;  5IGG A;  1PYS B;  2EYO A;  4DR3 I;  2EOT A;  2E2I B;  4JI3 I;  1Y8N B;  3MA2 B;  2QF7 A;  3D4W A;  3ERO A;  1WE8 A;  3CCL A;  2C38 B;  3HOW G;  4H44 C;  1NHI A;  2F03 A;  1TR5 A;  4P7A A;  5JEA A;  1VQI A;  1HA5 A;  2OF1 A;  1N34 L;  1STN A;  4R4I A;  2NVT H;  4JV5 Q;  4ZVI A;  4JI5 I;  4JBW A;  5LMU E;  3KLR A;  4DV7 E;  2V2V A;  1SNP A;  1ENA A;  3DD6 A;  4FF3 A;  3HS0 C;  4DV5 I;  1UE5 A;  2NWG A;  1Z0V A;  4BS9 A;  4A75 A;  4DUY I;  2LFN A;  4YWK A;  3A56 A;  5HGT A;  4JI3 E;  4RCO A;  3VR4 A;  1TWG H;  2MQH A;  4X64 Q;  1WTR A;  5DAU A;  1XNQ I;  4J6H A;  4YCW A;  1SE4 A;  4OD6 A;  4HCE A;  4DPX A;  1U2R A;  4YIJ A;  1H95 A;  4JVY A;  2JJQ A;  2MJH A;  5JEA C;  4O42 A;  4OWX B;  4DR4 Q;  4LF4 I;  1OXX K;  1XJV A;  3T1Y I;  4HAC A;  3TS2 A;  1Z0G A;  1SNM A;  3NK9 A;  3HOU G;  2VS1 A;  4DV5 E;  3I73 A;  1ML0 D;  4IPC A;  2D0O A;  4J1M A;  1UUP A;  1H9M A;  1EYC A;  4DUY E;  3HKZ E;  1K83 H;  1GHJ A;  3C1E A;  1WVL A;  2SDF A;  1L0Y B;  2F1D A;  1ILQ A;  1XNQ E;  5CBA E;  5J39 A;  2NVT B;  2ICI A;  2E76 C;  1G6P A;  2K5V A;  2LXJ A;  1KC8 C;  2YU9 H;  2BE5 C;  5E4W C;  2XIW A;  4B3T L;  4PG3 A;  4WUD A;  3I3C A;  4LF4 E;  3BVG A;  1QJO A;  3T1Y E;  2WKD A;  5IWA H;  3K80 C;  2FFM A;  4RWS C;  1TWG B;  3AEV A;  3F2B A;  1PRT D;  1V43 A;  2F3V A;  3C46 A;  4URL A;  2WII B;  2XSC A;  4GOP C;  2NVQ H;  1EEI D;  2KCM A;  2O1U A;  3M7N A;  2N49 A;  1S5F D;  4M1U B;  4MIU A;  4U68 A;  5ELF A;  3TZU A;  1B4O A;  4EVO A;  3RNU A;  1QOH A;  3ICE A;  4NW2 A;  1Y4U A;  1PHJ A;  2VQE Q;  1TS3 A;  3KF8 B;  3K17 A;  5FO9 B;  2CWP A;  3VR6 A;  1K83 B;  2OPV A;  3S17 H;  2B63 G;  4USM A;  1H74 A;  3HUL A;  4LUV A;  2UXB E;  1FJG Q;  1O7Z A;  3M3Y H;  4F88 A;  4JI7 I;  1M90 C;  5KEE A;  1S20 A;  2LTM A;  2RDF A;  2YU9 B;  3SR1 A;  5BN5 A;  3S1Q H;  1IBM I;  3OYY A;  2UUA I;  2D0P A;  2NN6 G;  1HR0 H;  4RG1 A;  2D9U A;  1N32 E;  3L9A X;  5DNL A;  4PNY A;  4DR2 E;  3GP7 A;  4B3R Q;  4NKL A;  1FI4 A;  5JEA D;  1AEX A;  3ULL A;  4JV5 L;  4FO2 A;  3DLL A;  2NVQ B;  4DPU A;  2MO0 A;  4XTJ A;  3I4M H;  2G8Y A;  4QF4 A;  3MHB A;  1CSQ A;  1XMO I;  1D1K A;  4DR6 H;  4HMJ A;  3ERQ A;  1H9S B;  1PA6 A;  3OTO H;  1NAP A;  4DV6 L;  4IZJ D;  2Y0S E;  2FIN B;  1PQX A;  2HFU A;  2Z5C A;  1B50 A;  2G9D A;  5KYL A;  4IPH A;  2EQS A;  3TN2 A;  2AQ2 B;  1GO3 E;  2XRQ D;  3U1K A;  2XVS A;  4U3D A;  3S17 B;  2BE5 D;  2MP1 A;  4A3I H;  2N78 A;  2ALY B;  1DCZ A;  3NBI A;  3QG1 A;  1CKN A;  4DR4 L;  1EFI D;  2AQ3 B;  3M3Y B;  5FLX Q;  4B3S I;  2HK2 A;  1IBK H;  1U0L A;  2L11 A;  4GN4 B;  1Z2I A;  1SFO H;  4DR6 L;  4ZAI A;  2EJF C;  4NDX A;  1RF2 D;  4AQY Q;  2UXD Q;  3M85 A;  4O1N A;  1PZK D;  2PMZ E;  1SJE D;  4FW3 A;  3S1Q B;  3Q24 A;  2PZU A;  4YY3 I;  2XRS D;  4N9T A;  2MNA A;  4NZR M;  4PRV A;  4HJA A;  1HXY D;  4FDB A;  2A68 C;  1JWS D;  4UDU C;  5M3M H;  4WUB A;  1EYA A;  4POF A;  1J5E L;  2VF3 A;  2K28 A;  4OX9 I;  3H6M A;  1WHR A;  3I91 A;  2WIN B;  3S9W A;  4DPW A;  4FJS A;  2UU9 I;  3HKZ G;  1C48 A;  1ENF A;  4IJL A;  4IFD H;  4DAY A;  5DNF A;  5C0X H;  5AFW A;  4L5S A;  4A3M B;  2WAQ B;  4L6T B;  4FXG C;  3LTO A;  3UE0 A;  4GN3 B;  1CM9 A;  2D2C C;  3UDI A;  1LTB D;  3E9H A;  2EY5 A;  4IJH A;  4K2L A;  3MXU A;  3NWS A;  2BA1 D;  3RF2 A;  1TWH B;  5NUC A;  3JAM C;  5M3F H;  1DXM A;  1KTK A;  3A5Z B;  2VQF Q;  4DV3 L;  2MUY A;  1FL0 A;  4A3I B;  1AZQ A;  1IBL I;  1X4M A;  4OX9 E;  1QIL A;  5JVH 3;  1NE3 A;  3J81 i;  5CV8 A;  1EEF D;  1EA6 A;  1L0W A;  5IP9 G;  3W1G A;  1SFO B;  2KUM A;  4JI4 H;  1X55 A;  4Z9C B;  5GME A;  3LPS A;  5K36 E;  3KF8 A;  2VQE L;  1UNS A;  1E22 A;  4Q0F A;  1SE3 A;  1LO5 D;  1HQM C;  3NTH A;  3S15 H;  2ZM6 E;  5FKA C;  3FMC A;  3G6J B;  3K58 A;  2KHJ A;  3DMU A;  4BY1 H;  4JI8 I;  1HR0 W;  5M3M B;  2I0Q A;  4LF7 L;  1HCZ A;  1FJG L;  4JVH A;  5KNB A;  1H72 C;  1Y1W H;  1FD7 D;  4HTH A;  2XGT A;  4MU3 A;  5J3B A;  5L37 A;  4DR7 Q;  1IBL E;  4DR3 Q;  3CCU A;  2F4I A;  4FW5 A;  5C0X B;  4WUC A;  1YHC A;  1YHA A;  3Q6S A;  4FW9 A;  4J15 A;  1J6Q A;  4B3R L;  4A3G H;  1JOK A;  1Y1V G;  2EE1 A;  3I70 A;  2UUC Q;  4BBS G;  4LFB E;  5M3F B;  2CTK A;  3D4R A;  4A4I A;  3C2P A;  1CK1 A;  1QWY A;  1ILP A;  3R2T A;  2GVB A;  2XWJ B;  2RKS A;  1H73 A;  5EPK A;  2Q2H A;  4YHH H;  1YI2 A;  5IT9 C;  4HED A;  2A68 D;  4LF8 Q;  1VQ4 A;  1XPU A;  1B1Z A;  1EZ6 A;  1F2Y A;  1A3V A;  1MU5 A;  1N0U A;  1F9Q A;  1XMQ Q;  4DF7 A;  3S15 B;  2F0V A;  1KIJ A;  3K57 A;  5ELE A;  4K6D A;  5I6W A;  4BY1 B;  1RR9 A;  2Y0S G;  2F0J A;  2Z8L A;  2B2T A;  3CME A;  1Y1W B;  1BDO A;  2PCF B;  2PYK A;  1EY4 A;  4DGZ A;  4YHH L;  4LF9 I;  2O1V A;  4JG4 A;  1JMC A;  3M85 D;  2ZQE A;  4R4Q A;  4BY7 H;  2JEA B;  1BCP B;  1BO0 A;  1C4Q A;  2OEO A;  1Q46 A;  1DOM A;  3PYD A;  5LL6 S;  2HHH Q;  5HGQ A;  1VQE A;  2DN8 A;  3J81 E;  3T13 A;  1IXR A;  1QG7 A;  3H0G H;  2RCF A;  4ME5 A;  4TKO B;  1HRJ A;  2PY9 A;  5KND A;  4A3G B;  4DV7 H;  1TU2 B;  4BBR G;  1AZP A;  4HIK A;  2LF0 A;  1EY0 A;  2WB1 B;  3KOJ A;  4DR5 H;  4H7B A;  3A8J E;  5DLQ E;  1B53 A;  1E1T A;  3STB C;  4LF9 E;  4XT1 B;  2R92 H;  2ZBK B;  1C9O A;  2F4V E;  2O1T A;  1JE4 A;  3IKJ A;  1KDC A;  3GTM H;  4RPF A;  2M8W A;  3CCR A;  4H02 A;  1ENC A;  5JEA G;  2A6H D;  3CC4 A;  5FWK A;  3Q1Q A;  2VKC A;  2BDO A;  1R4P B;  2EYH A;  3ULP A;  4KLK A;  4DR5 L;  1BR9 A;  1HK7 A;  4LFA H;  1MD2 D;  1LT5 D;  4DUY H;  3K0Y A;  4IUR A;  2F0W A;  1N34 E;  1DM0 B;  5I9O A;  1XNQ H;  3GME A;  5BN3 A;  5I2X A;  3I55 A;  3H0G B;  4DXG A;  3B78 A;  1SYG A;  3NTK A;  3TQY A;  4DKA C;  2K1H A;  4OCH A;  3OMC A;  4BXX G;  4FP5 D;  4CKE A;  1EL0 A;  4LF4 H;  3NEL A;  1BBX C;  4LFA L;  5JOB A;  4IFD A;  2L0C A;  1TII D;  4NXN L;  4OON A;  1LAB A;  3D4J A;  1ZZK A;  1IBM Q;  3VR2 A;  4USK A;  1UE1 A;  3J80 L;  2GVA A;  4FXK C;  4DV2 Q;  1MG7 A;  1O80 A;  2V34 A;  2R92 B;  4XT3 B;  3DWQ A;  2I5H A;  4NXM Q;  3D8G A;  3GTM B;  3CCV A;  4EQN A;  2MHV A;  2F0O A;  3MVV A;  3U4V A;  3F2U A;  2ZJQ A;  2CGE A;  3VA7 A;  2K1B A;  1X6O A;  3T1H Q;  1CKM A;  2K6A A;  4DU8 A;  2JSO A;  3CCE A;  1HNX Q;  4GLX A;  4HYM A;  5IYC H;  2A2C A;  5AJ3 L;  2NTS A;  4QMF B;  4UTG A;  5C0X F;  4RKB A;  5C0X C;  1XXG A;  2KOL A;  3VA5 A;  5C3E H;  3TS0 A;  2OCE A;  2UXB H;  4B3T E;  2K7V A;  2C5C A;  1AH9 A;  2AWN A;  5IWA I;  5JVG 3;  3PF5 A;  1X9N A;  2BA1 G;  4JVZ A;  1PH8 A;  4LWC A;  1IW7 C;  3ZM7 A;  4GLA C;  5IGD A;  2ICE C;  1QB5 D;  1H9J A;  4DV4 H;  5JJK A;  1HJP A;  1R6M A;  1WTP A;  1N32 H;  2RHS B;  5FLM H;  1YVC A;  3A7L A;  4PMC A;  4X62 H;  5DEH A;  4DR2 H;  3K85 A;  3K1J A;  2YTV A;  1I50 H;  3OET A;  2BH8 A;  2EFG A;  3MXG A;  2KEC A;  4A3B G;  4WAL A;  1ESF A;  4JI0 H;  1F9R A;  3HOV G;  2Z4H A;  2F0H A;  1QVC A;  2WAC A;  1K8A C;  1CQF A;  3BJU A;  2F0G A;  4X62 L;  3J7A 5;  3EVQ A;  1V8Q A;  4IZK B;  1BCP F;  4RGN A;  1BCP C;  1KAA A;  4EMD A;  2PW7 A;  5C3E B;  2QCP X;  2QA4 A;  1EYG A;  1GM5 A;  1CFM A;  1HR0 I;  2A19 A;  4OWW B;  4JI0 L;  3J80 W;  4A3J H;  1Q1E A;  2CWF A;  1EY7 A;  3NE5 B;  1HNW Q;  3PGZ A;  3PSI A;  5G3L D;  1W6K A;  4PDB A;  4O2D A;  1PFN A;  1PTO F;  2HCI A;  5J22 A;  1SMX A;  1PTO C;  4MN3 A;  2RSO A;  5ELC A;  5EJW A;  1SNO A;  4I3H A;  2ZT9 C;  2ZIT A;  4DR6 I;  1VQH A;  5M9O A;  3OTO I;  3CCS A;  2WP8 J;  3VR3 A;  4DU7 A;  1JWM D;  5IGE A;  1J9O A;  1I50 B;  1C8C A;  5LL6 R;  2NN6 F;  4EC5 A;  2NN6 C;  2PO0 A;  1Q1B A;  4DV6 E;  5C44 H;  2QND A;  3LGJ A;  2Q2I A;  4RAU C;  4K0K Q;  2JE6 B;  5BR8 Q;  1O78 A;  4ZYS A;  2L15 A;  4IFD D;  5C0X D;  1J5E I;  3W2D A;  4RCN A;  2V1C C;  1PMR A;  3AMU A;  1IBK I;  3M85 G;  3RD4 A;  4CJ2 C;  3RLF A;  4DR4 E;  4NMZ A;  1KTV A;  3J80 c;  1ASZ A;  1CI3 M;  5E7N A;  4DR6 E;  3G6E A;  3TP5 A;  4KQV A;  1UEA B;  4IUT A;  4HJ9 A;  2A74 C;  4GNX B;  1IL8 A;  2RA4 A;  3TZD A;  5GAG C;  2AQ1 B;  2FXQ A;  4A3J B;  4R4C A;  4KTA A;  3RZO H;  1WTJ A;  3GKU A;  3GAB A;  3EQL C;  5K36 H;  1TS2 A;  2PMZ B;  3CWV A;  2ZM6 H;  3GDE A;  5M5Y H;  1J5E E;  2OQK A;  4BA1 B;  2B2V C;  4YCU A;  2CTF A;  4IFD I;  5C0X I;  3JC6 6;  2Z6K C;  1FVI A;  3DWP A;  3CF5 A;  3QD7 X;  2NTT A;  1F2M A;  4F87 A;  5IOC A;  4DUZ Q;  3AU7 A;  3HEJ A;  1K47 A;  1WFQ A;  3TRE A;  1DJR D;  2PT7 G;  1IBL H;  5CR3 A;  4GKK Q;  1EI1 A;  5C44 B;  1Z0E A;  1R4Q B;  1B9N A;  1I6H H;  2B2Y C;  2PPB C;  1HFG A;  1BCP D;  2A6E C;  3GTQ H;  1CTM A;  3OW7 A;  1SYF A;  3GTK H;  1WD0 A;  3WU4 A;  3Q0A A;  2BOS A;  1Z0B A;  1H7S A;  4DV3 E;  2CTM A;  5IGB A;  1WTH A;  4FW7 A;  2IPK D;  5L3J A;  4LFB H;  4OO1 A;  1D5X C;  1PFM A;  4IFD E;  1Y69 U;  1WTQ A;  4HXZ A;  1GHK A;  2HK3 A;  3OHX C;  3OPO A;  3UE1 A;  3B8H A;  1HZ9 A;  1GD7 A;  4AID A;  5EBC A;  3RZO B;  4KHP Q;  5K36 B;  1B3Q A;  3AFP A;  4LF7 E;  4Q5V A;  3VYT A;  4FF1 A;  1FJG E;  2IER A;  1MI2 A;  3MAQ A;  3TRZ A;  2JEA I;  2MFI A;  1EUJ A;  2DNE A;  5FO7 B;  3RLN A;  4LIJ A;  3A7A B;  1PVO A;  3EZJ A;  1EOV A;  2GO4 A;  1GUG A;  1C7Y A;  3M4O H;  2NVY B;  2Z5E A;  3JAM Q;  5LHY 1;  2JA5 H;  1TKW B;  1EIG A;  3B4T A;  2MO1 A;  4K8J A;  4B3R E;  1HNZ H;  1I6H B;  1SN8 A;  3S2H H;  4LOM A;  5ELO A;  1UEB A;  2B8G A;  3GTK B;  1FYC A;  2NUC A;  4A3F H;  1WUU A;  4IZ8 A;  3WU3 A;  4DNI A;  4YHH I;  3NEN A;  3AQQ A;  1X9Z A;  4KKS A;  1X3P A;  3BZK A;  4JOI C;  5I4D A;  3PQI A;  4NZT M;  4YCV A;  3HOY H;  4LFC H;  3A0J A;  3PYE A;  4X6A H;  1PH9 A;  4RKL A;  3BYT B;  4K0K L;  5BR8 L;  3H3V H;  2V2Z A;  1HTP A;  1NY4 A;  3R8B A;  4DR1 L;  2NVX H;  3I4N H;  4DV1 H;  2DUD A;  4K14 A;  4LCF A;  3SK4 A;  3GTJ H;  2F4V H;  4A3C H;  2WB1 E;  3T16 A;  1HUM A;  2A73 B;  1MX0 A;  1U4R A;  3SGI A;  4GNX A;  3FVQ A;  5IOD A;  4AYB E;  5A35 A;  1BNZ A;  4YHH E;  1A3T A;  2ASB A;  4JI2 Q;  2C39 A;  5I9P A;  2CG9 A;  5BN4 A;  4DV0 H;  3M4O B;  4UT4 A;  3I4M G;  3DHQ A;  2JA5 B;  5M5W H;  4GZY C;  2CZ9 A;  2DGR A;  4DV1 L;  5DRQ A;  3CXC A;  1U9R A;  2WV6 D;  2PI2 A;  1PRT F;  1N34 H;  1EQR A;  1NUC A;  1PRT C;  3HOV B;  2WAQ G;  5CV9 A;  3S2H B;  2GA4 B;  1TWF H;  4PU9 A;  4DR5 I;  2K5Q A;  5IT9 Q;  1N33 L;  3H94 A;  1GOZ A;  4OHJ A;  4RGO S;  4A3F B;  1WCM H;  4DUZ L;  3VKE A;  4TRD A;  1V1P B;  3PF4 A;  4A3I G;  1U4M A;  4DV0 L;  1EY5 A;  1RHP A;  2Z4I A;  4B3M Q;  3HOY B;  1JOO A;  4GKK L;  1NTG A;  1ZM2 A;  4JI6 Q;  1LV9 A;  1RRE A;  4JI1 Q;  3GO5 A;  2A8V A;  5DNX A;  2EDG A;  5D65 A;  5T1G A;  2NVX B;  3I4N B;  2CW0 C;  3ULJ A;  4JCV E;  1I4H A;  4C3J H;  1OJ4 A;  3S16 H;  4BWG B;  3GTJ B;  4LFA I;  1XWE A;  2Q8I B;  4JW0 A;  4DR5 E;  2I46 A;  1ICF B;  5M3M G;  3FHW A;  3X3N A;  2Z9H A;  3CKI B;  4GKJ L;  2JA6 H;  2Z5C B;  1OYS A;  2RCN A;  4ID6 A;  2H5X A;  1A3U A;  1FGB D;  5K36 A;  4A3L H;  2MJ8 A;  1YZ6 A;  2F0T A;  1WJJ A;  3KDF A;  3CCQ A;  5M5W B;  4KHP L;  1PH5 A;  4JYA Q;  1GUW A;  5C4Z A;  1LTI D;  5JEA F;  3H1C A;  4IFD G;  3QWN A;  5C0X G;  3DM1 A;  4V0B A;  1J8I A;  1CKN B;  1KAW A;  4B3T H;  1IKM A;  1UDN A;  1TWF B;  3A55 A;  2EJM A;  3OWF A;  1MIU A;  2PQA B;  2HT1 A;  1BBW A;  3UOE A;  1G2S A;  1Z0T A;  1EY6 A;  4LFA E;  2D62 A;  1N36 Q;  3J81 W;  1K8M A;  1FR3 A;  1WCM B;  2CVR A;  1YEZ A;  4DU9 A;  5M3F G;  1QVF A;  4NXN E;  1VQD A;  2C9O A;  2B2W A;  3J80 E;  2QDB A;  2F1M A;  3HP3 A;  5EPL A;  1JB3 A;  1Q3L A;  2OXP A;  3ER0 A;  3HRZ C;  4XQJ A;  1CUK A;  1RKN A;  2M2L A;  2CTE A;  3URY A;  2JQO A;  3I72 A;  1Z0W A;  1WYD A;  5LMN Q;  4C3J B;  3RR5 A;  4C3I H;  3IAY A;  1PXU A;  4IOC A;  4DAM A;  3M4Q A;  4BY1 G;  4DAY B;  1A15 A;  5ISR A;  5CYU A;  5EAY A;  2JA6 B;  2UXB I;  1D1I A;  1XRH A;  1Y1W G;  1MSH A;  1KDB A;  1ZYR C;  3N6R A;  2UXC L;  2F0Q A;  4A3K H;  3S24 A;  2QEJ C;  1LTT D;  4KY6 A;  2R61 A;  2B2W C;  2Y3M A;  4OO1 E;  2KA7 A;  1XHK A;  3MFG A;  3N52 A;  1DT4 A;  4DV4 I;  4R8N A;  5GMD A;  1VQL A;  1H9K A;  4KK7 A;  4HN7 A;  3J81 c;  3D3R A;  4LF6 Q;  1N32 I;  1W6J A;  1I4Q A;  1J4W A;  3IFD A;  4A3G G;  4X62 I;  4DR2 I;  3WDN A;  4YWM A;  2Q2U A;  2K03 A;  2QGQ A;  1EWI A;  3FKI H;  4X66 Q;  4JI2 L;  1XYI A;  1IL2 A;  4CDE C;  4EX5 A;  2WB1 G;  4TVA B;  1S5E D;  1XNR Q;  3J7Z C;  2CW0 D;  1PZJ D;  3F8T A;  2PO4 A;  4JV5 H;  3QB3 A;  3FPP A;  4JI0 I;  1X3F A;  3K59 A;  2R6G A;  1WTV A;  2JE6 I;  2DEI A;  5IT9 L;  4U67 3;  3RLO A;  4YY3 H;  2LJP A;  1U4P A;  1V1P A;  1X56 A;  4HMI A;  4C3I B;  4OIK A;  3PMF A;  1E1O A;  1Y6Z A;  1BKB A;  4DV4 E;  4DV6 H;  1VMC A;  4FNF A;  5CV4 A;  1K8O A;  1CA6 A;  1PDQ A;  4LCH A;  4X64 H;  1Q12 A;  4B3M L;  2X36 A;  4X62 E;  4JI6 L;  1C0A A;  2NZH A;  5C4H A;  1JIC A;  1AE3 A;  4JI1 L;  1Q90 A;  4X3T A;  4MQY A;  3V96 A;  4A3K B;  3PS1 A;  1JOQ A;  3WU5 A;  3PIO A;  1I6U A;  4ZLT F;  4DR4 H;  4LUZ A;  3PO2 H;  4BY7 G;  4JI0 E;  1KXL A;  1I94 Q;  1Z6H A;  5JAV A;  1MHW C;  4XQQ A;  4BA1 I;  4JI4 Q;  5LL6 b;  4FWG A;  3H0G G;  3HKS A;  1M1K C;  4X64 L;  4LF5 Q;  2EYP A;  2F52 A;  2UUB Q;  3WOF A;  2DY8 A;  3FKI B;  4X65 Q;  5K36 D;  1PH3 A;  1AN8 A;  4JYA L;  1J5E H;  4CBV A;  3H3V C;  4ILW A;  1MSZ A;  2PQA A;  3NSW A;  5ELB A;  1GUO A;  3L7Z B;  4RHS A;  3AYH B;  1HTL D;  2R92 G;  4ZRZ A;  3TP6 A;  1N36 L;  2PI2 E;  1ZYR D;  2XN9 C;  5CMD A;  1D6T A;  4KN4 C;  2E5L Q;  1XXE A;  3KLS A;  2MGS A;  2KED A;  4N8X 1;  2L1B A;  1KKH A;  3BYY B;  4DV3 H;  3Q22 A;  1SYB A;  3MC0 B;  3PYF A;  3I4M B;  1QE6 A;  3CPF A;  3SE0 A;  1QVG A;  5CV7 A;  2HIX A;  3PO2 B;  1OXS C;  5DT9 A;  4TSS A;  4WFN 3;  4EGV A;  2ZM6 I;  2EYM A;  4B08 A;  2ENB A;  4JBK A;  4KN7 C;  5IT9 W;  2VQE H;  1E24 A;  5C4X H;  1LAC A;  1P8L A;  4P73 A;  5I2Y A;  2AXY A;  3WWV A;  4MU1 A;  1PFS A;  1KL9 A;  2JT2 A;  1O7Y A;  4MU0 A;  5EQ0 A;  3F2D A;  4LF7 H;  3M7N D;  1FJG H;  4DNT B;  2E1R A;  3PRY A;  3S1R H;  3EJI A;  1PZI D;  1GUS A;  4AM3 A;  2NPF A;  3AB9 A;  1FNU A;  2D5D A;  1LTL A;  4LF6 L;  4MHE A;  1HFN A;  3P1H A;  1I3Q H;  4X66 L;  3HOZ H;  2GN5 A;  2R7F A;  2EVB A;  2O4C A;  4LFB I;  2VW9 A;  4S3S A;  1XNR L;  4B3R H;  1OTC A;  5LMU Q;  4AH6 A;  3P06 A;  5CBE E;  4DV7 Q;  2CPM A;  3DEP A;  3D6W A;  4P71 A;  5IYC G;  3QIA A;  1SNQ A;  2A6H C;  3DXJ C;  1RCV D;  4QY7 A;  5C3E G;  4FN5 A;  2CH4 W;  1LM0 A;  4JI3 Q;  4FJU A;  5IT9 c;  2HH3 A;  4IFD B;  2JXM B;  4RGT A;  1A63 A;  3HKM A;  5C4X B;  1E2V A;  1PH6 A;  3MZ5 A;  2A5H A;  2PNZ B;  2EY1 A;  4JI5 Q;  1NR2 A;  3A74 A;  4C1N I;  1BXT A;  5FLM G;  1I94 L;  3S1R B;  4UP9 A;  1PKP A;  3KJP A;  4DV5 Q;  1EIY B;  1E7Z A;  3VYU A;  1Z5B A;  1HNZ I;  4DR1 I;  4DXL A;  2OPU A;  3KF6 B;  3D31 A;  4ZCK A;  4C1N K;  4UY8 C;  1FGU A;  2LS0 1;  2Q2E B;  1ZM4 A;  5IP7 H;  4DUY Q;  1G2T A;  2BCO A;  4PMB A;  4LF5 L;  4H13 C;  3J7A F;  2ZJR A;  1I3Q B;  1YHB A;  5A2Q Q;  1BOS A;  3NTI A;  3ND8 A;  4X65 L;  1W2B A;  1XNQ Q;  3HOZ B;  3F0N A;  3PIO 3;  3J7A V;  3GQB A;  1MJC A;  2HUG A;  1KD1 C;  4R9W A;  4LFC I;  2IJ0 A;  4HJ5 A;  1VQG A;  5FLX L;  1SSO A;  3T4A C;  3L7Z A;  3G7L A;  2V4D A;  3MXN B;  4B9X A;  3H3V I;  1EWH A;  4LF4 Q;  4DV1 I;  3T1Y Q;  4AQY L;  1XPR A;  2UXD L;  1L2F A;  4K0K E;  5BR8 E;  4IOA A;  3T51 B;  4MTK A;  1HNZ E;  2F4V I;  4ZUJ A;  1CT1 D;  4DR1 E;  5JEA J;  4XYQ A;  5T1I A;  5GQO A;  4I65 A;  2IX3 A;  1KVK A;  1N33 I;  4A3J G;  3JAM i;  4N9P A;  3RUZ A;  2VQF H;  4ED4 A;  1CKO A;  1S5D D;  1Q7Y C;  5ELW A;  4DV0 I;  2F0P A;  3PS3 A;  1LTG D;  4UP8 A;  1VQF A;  5IYD H;  4LFC E;  2IW3 A;  2J7K A;  1N34 I;  3UI2 A;  1Z0C A;  1Y8O B;  3SK8 A;  3PUZ A;  4AYB B;  1RTN A;  1JOR A;  1MGS A;  1KLG D;  2B2T C;  1SMY C;  4DV1 E;  4QUC A;  1A0I A;  3G71 A;  3A8I E;  1DYQ A;  4I7Z C;  5C44 G;  2UXB Q;  2WKC A;  1X54 A;  2VQF L;  3E3X A;  3C1F A;  5IYB H;  2E8G A;  1N33 E;  2O5I C;  1HZC A;  1PH2 A;  1H9R A;  1VQA A;  4DUZ E;  5FJ8 H;  4BA2 A;  1D6E C;  3U50 C;  4DPG A;  2MPM A;  4FYD A;  4ZUI A;  2RDH A;  2ATW A;  2JA7 H;  4EQP A;  2FJ2 A;  4DV0 E;  4DR7 H;  3I8Z A;  2X7I A;  3E0J A;  4GKK E;  2Z1C A;  3ERS X;  3NQT A;  4IN3 A;  1X32 A;  2NZO A;  4NXN H;  3QJY A;  4ZKB B;  4BY7 B;  2B2U A;  3SB1 A;  3RN5 A;  2EXD A;  2NBF A;  3CQZ H;  1I5F A;  3GV6 A;  3SEB A;  2AE8 A;  2UUC H;  2R93 H;  4IUN A;  5K36 G;  2KCT A;  1JC7 A;  4FW4 A;  4JI7 Q;  2EPB A;  1YNX A;  2PO0 B;  3ITP A;  4DR7 L;  4GKJ E;  3RZD H;  1R9T H;  4DR3 L;  5G3L F;  2CCZ A;  3U4Z A;  1O7L A;  5FLX W;  2Z6B A;  4QNK A;  1STY A;  1TUA A;  2F0S A;  2UUA Q;  4LF8 H;  1S5B D;  2DGY A;  1FWK A;  4KHP E;  1SR3 A;  4B3T I;  2FMR A;  2PNZ A;  1XMQ H;  4L5T A;  3H09 A;  2UUC L;  3ZKD A;  2F0I A;  3PUX A;  3PIP A;  2D9I A;  4MZ9 A;  4OO1 H;  4JI5 L;  2YQR A;  1VCI A;  2J0T D;  5C3W A;  1DAR A;  1STE A;  4HJ8 A;  1T5E A;  3KF6 A;  4ALP A;  2KQ3 A;  4FWH A;  3KLS X;  4CHT B;  1UE6 A;  4DK3 C;  1XMO Q;  3EN2 A;  2JA7 B;  4LF8 L;  4AQY H;  1IZ6 A;  1TT2 A;  4HIM A;  2IOQ A;  4IFD F;  4P2C B;  4IFD C;  1YH8 A;  5A2Q L;  2HHH H;  1XMQ L;  4XXE A;  1EQT A;  1ET9 A;  1RL2 A;  3S14 H;  3CQZ B;  3FRP B;  4LCG A;  3A8K E;  3MXN A;  2A1A A;  4APV A;  1NR4 A;  2R93 B;  2M6Q A;  3M7N G;  3J7A K;  4B3S Q;  1SMY D;  3C3L A;  3NZK A;  3T1Y L;  3MWY W;  5FLX c;  1PH7 A;  4C3H H;  3RZD B;  1R9T B;  4EQO A;  1JT8 A;  4AIM A;  3GTP H;  2UXC E;  2HHH L;  2KCN A;  4YY3 Q;  1YJN A;  3P3E A;  1YJW A;  4NB3 A;  4DPT A;  1E3P A;  2JA5 G;  5C5L A;  4OEM B;  4OX9 Q;  5DRO A;  4OO1 B;  2L4N A;  2UU9 Q;  4JI2 E;  2R7D A;  4KV6 A;  4JV5 I;  3L2P A;  2EXZ A;  3J81 j;  4A3F G;  2KEE A;  2NYZ D;  2PNH A;  2PO1 A;  1F9P A;  3UDG A;  1V9P A;  1K73 C;  2JEB B;  2IY5 B;  2K14 A;  4Z7Y A;  4G08 A;  3HOY G;  2HDL A;  3HOX H;  1S16 A;  1S5C D;  1ZKO A;  5IT9 E;  4DV6 I;  4JK1 C;  3S14 B;  2AUK A;  4X64 I;  1YBY A;  2K04 A;  3I4N G;  3P7J A;  1SYE A;  1A6X A;  1IBL Q;  5DM7 3;  4A3C G;  2XWB B;  4B3M E;  1K9M C;  2K5D A;  2VES A;  4JI6 E;  1DZ1 A;  4DR4 I;  4JI1 E;  4C3H B;  4JV5 E;  4DV2 H;  2OI2 A;  1DOK A;  3GTP B;  2BR2 B;  2HIV A;  2VY3 A;  4PZ8 A;  4A3D H;  3K5L A;  1S03 G;  1IYU A;  4K6L A;  4DK0 A;  4LFB Q;  2FFK B;  3S2D H;  1WVN A;  2KCC A;  2ANN A;  4JI8 Q;  1YNN C;  1ZZI A;  1LTS D;  5A2Q W;  3CAM A;  4JI7 L;  3LNU A;  1NHJ A;  4X64 E;  2HKJ A;  3T1H H;  1STH A;  3QR8 A;  1HNX H;  1CHQ D;  2R7Z H;  1IBM L;  3UHM A;  4G7H C;  2UUA L;  1PYB A;  4R1F A;  1WCM G;  5C6A A;  4DV2 L;  2V2Q A;  2WFW A;  4DAP A;  3BZD B;  1SJH D;  2PQU A;  5FO8 B;  1TS4 A;  1HUN A;  1FKA H;  4P72 A;  1RDP D;  4KD3 A;  1NNX A;  5IE8 A;  3HOX B;  4NXM L;  1D8L A;  4QMG A;  4B9W A;  1Y14 B;  3ZYY X;  1VQ7 A;  4I7A A;  2F3W A;  4K5X A;  1N36 E;  3T1H L;  4HSV A;  4C3J G;  1XMO L;  2C39 B;  2E2H H;  3B82 A;  1KLU D;  1WD1 A;  1HNX L;  4DV3 I;  1S72 A;  2QEX A;  5GRO A;  1D2B A;  1QNU A;  5LL6 X;  4A3E H;  3K5M A;  2JA6 G;  4A3D B;  1VQN A;  2LKV A;  3FEW X;  3KFU A;  3S2D B;  4A3L G;  5DRR A;  2VQE I;  2LTL A;  5HY6 A;  3NBH B;  3OIQ A;  1B2T A;  4B3S L;  4OGQ C;  1WTX A;  3S1M H;  3KYH C;  4LF7 I;  2IWH A;  1FJG I;  4LF9 Q;  1DON A;  1IKL A;  3DWA A;  5D3D A;  1FNV A;  2R7Z B;  4YY3 L;  4MYT A;  3LNN A;  2EYJ A;  1JWU D;  1E2W A;  4KJN A;  2YTX A;  3J80 C;  3PO3 H;  1WTO A;  3TP7 A;  3TP8 A;  2ZXR A;  1VI7 A;  3H4L A;  1HNW H;  3RMH A;  3NPP A;  2UU9 L;  2DEJ A;  4IUQ A;  2VQE E;  4X66 E;  4B3R I;  2VB3 X;  1ZM9 A;  2KVM A;  4CKC A;  1ZM3 A;  2QW7 A;  2YYZ A;  4KJO A;  4C3I G;  2E2H B;  2JEB A;  1XNR E;  3KDF B;  1CHP D;  4L5R C;  4X3S A;  3J7A G;  3BU2 A;  2IOP A;  4OZE A;  3G4S A;  3E9I A;  2C35 B;  1YNN D;  4X3K A;  5M5Y B;  2PQE A;  5FK9 C;  1VF5 C;  1KQS A;  5ELN A;  4A3E B;  4QL5 A;  1X65 A;  2I07 B;  3W3A A;  2IX0 A;  4A3K G;  2VUM H;  1F2L A;  1HNW L;  1ET6 A;  4ISA A;  4OO1 F;  4HID A;  1TWC H;  1V1Q A;  4OO1 C;  2PW5 A;  4K0K H;  4XIG S;  5BR8 H;  1OXV A;  3BDO A;  1BKN A;  4ZKC B;  4DR1 H;  3TSS A;  1G29 1;  4KD4 A;  3S1M B;  3EIV A;  3GTQ B;  2BR2 A;  3I56 A;  1VMP A;  3NQI A;  4A93 H;  1JJ2 A;  2CQA A;  2O5J C;  1B44 D;  3FKI G;  2KBN A;  4AQY I;  4KHZ A;  1QZR A;  1I94 E;  2WNR B;  4JI8 L;  5JJZ A;  3CCM A;  1E3H A;  3LX0 A;  3GR5 A;  3PO3 B;  5EKI A;  1DGS A;  2AMC B;  4E6I A;  4LF5 E;  4R4T A;  4MNO A;  4ZK9 B;  3NWT A;  1KDA A;  2H4O A;  3R2I A;  4DPY A;  4X65 E;  2KHI A;  3OSS D;  3QT6 A;  2ZTC A;  1Q86 C;  3K5O A;  4PZ6 A;  4HY1 A;  1L1O A;  2JZX A;  2BM0 A;  1JQY D;  3HFZ B;  2RBM A;  3TDQ A;  5FLX E;  1Q82 C;  1N33 H;  1EY8 A;  3U58 A;  4QNJ A;  1EU4 A;  4MYU A;  3GTG H;  4DUZ H;  3M6A A;  2X6G A;  4AQY E;  2UXD E;  4P74 A;  3OWE B;  2CPQ A;  2VUM B;  3V69 A;  4OEL B;  1SND A;  4PMW A;  4GKK H;  1TWC B;  3PO2 G;  3K8A A;  3L3O C;  2VQF I;  2F3I A;  3MEF A;  3TBI B;  1EY9 A;  2Q8T A;  3TEH B;  2BA0 A;  1EYD A;  3PS2 A;  4NP5 A;  5FOB B;  1DD2 A;  2FHT A;  2LMC B;  4L8J A;  4CDD C;  4A93 B;  2PZT A;  1TWA H;  1Z59 A;  2CTL A;  1G51 A;  1HPC A;  3NBH A;  3S1N H;  4IUU A;  2AJ4 A;  5EPJ A;  5IWA Q;  5ELD A;  5F2D A;  1ZEQ X;  4DN4 M;  4GKJ H;  4GNX C;  4LK1 C;  5C0X J;  1B62 A;  4WJ4 A;  1I4X A;  1MBY A;  1LTR D;  1RJT A;  4J3D A;  4Z7C A;  1OXT A;  4KHP H;  1N8R C;  1CQV A;  1LT6 D;  2GS8 A;  2VQF E;  3M4Y A;  1LLR D;  1SRO A;  4IQZ A;  1CZG A;  4OIJ A;  1MSG A;  1GUT A;  1QCB D;  5IGF A;  4XDX A;  1A2U A;  4DR7 I;  1V1O A;  2QKI C;  1Y5Y A;  4NXN I;  4OO1 D;  3HG9 A;  1S4Z A;  2B3G A;  1PVG A;  2LSS A;  3M7G A;  4KMU C;  3GTG B;  1JJC B;  1CA5 A;  4RMF A;  1IYJ B;  4KY5 A;  2UUC I;  1R6L A;  3P3G A;  5C5M A;  3KBX A;  1Z9F A;  4C2M H;  1VQ9 A;  4TQU S;  3PUW A;  3P3C A;  1X4N A;  1SAP A;  1WTW A;  5C4X G;  2K50 A;  4LF8 I;  4IZJ A;  1TWA B;  4DR7 E;  4DV6 Q;  1HR0 Q;  4DR3 E;  3JAM L;  3S1N B;  1K0S A;  1XMQ I;  2VB2 X;  2F0D A;  5EKW A;  1PIE A;  1SDF A;  1Z5C A;  4OO1 I;  3DM3 A;  2UXC H;  4MDT A;  4E9J A;  2UUC E;  2N8N A;  1VQO A;  2DJF C;  2F0E A;  5K36 F;  5KRU A;  4HAE A;  2PO2 A;  3P76 A;  4IS9 A;  4JI5 E;  5K36 C;  1ODH A;  3K0X A;  3V2T A;  2K5H A;  2WNR A;  3S16 B;  3K6O A;  3HOZ G;  4DR6 Q;  1SYC A;  1LT3 D;  1K8G A;  3OTO Q;  2JEB I;  1UWV A;  4KKU A;  1YIT A;  2XEX A;  1ONL A;  2HHH I;  3SHL A;  4GOP A;  3F1Z A;  4LF8 E;  2IES A;  4JI2 H;  2IX1 A;  1A8V A;  4XQN A;  4IPD A;  4KKT A;  4M8A A;  1EFW A;  1HH2 P;  5A2Q E;  3K5N A;  1XMQ E;  3MXP A;  4XTC S;  1J5E Q;  5GAD C;  2PNR C;  2O4X A;  1TY0 A;  1IBK Q;  1M8A A;  4LNQ A;  1HHV A;  4C2M B;  2WP8 B;  3GLL A;  1KNE A;  2OTL A;  1F0X A;  3H91 A;  4K8I A;  2JYO A;  4NPS A;  1Y4S A;  5KYI A;  3M4P A;  2K05 A;  1ELO A;  4MTN A;  4B3M H;  2HHH E;  4JI6 H;  1G91 A;  2BA1 A;  4RA8 A;  1PV4 A;  4JI1 H;  4AYB G;  3BS1 A;  2O3Z A;  4DV3 Q;  1EWC A;  4HJ7 A;  2AHO B;  2BA0 D;  4KI0 A;  5IP7 G;  2F0N A;  2XNA C;  1TVX A;  3CDI A;  4JPB W;  4G7Z C;  2DNC A;  3CD6 A;  2OWO A;  1K28 A;  5D3I B;  2RVL A;  5IWA L;  1YJ9 A;  1VQ5 A;  4HR7 B;  3W1B A;  1B8A A;  4DK1 A;  3CDJ A;  1NSN S;  3BDC A;  3QOL A;  4JG2 A;  3SVM A;  3KLW A;  2Z5B A;  3A54 A;  4LF7 Q;  1YIJ A;  4FW6 A;  1HQR D;  4FVM A;  3JAM W;  3CRK C;  5EKK A;  4JYA H;  3KRN A;  1II3 A;  1HA6 A;  3FDT A;  3J81 C;  1Z47 A;  1D5M C;  2C38 A;  2JA9 A;  2ANR A;  1KRS A;  1N36 H;  3I2Z A;  4DV2 I;  4OKG A;  1LUZ A;  3LWE A;  2IL8 A;  3QT8 A;  1FNM A;  5COY A;  2CQO A;  1EQQ A;  3D6C A;  1X3G A;  1JR0 D;  4NXM I;  3F2C A;  4R1J A;  4UAI A;  5IYD G;  4QIW E;  4QUF A;  3DEO A;  2L12 A;  1IYV A;  2JN4 A;  5H1S E;  3VYR A;  3EFX D;  2F0U A;  3T1H I;  1Z7T A;  5JPM C;  5LMN H;  1VQJ A;  2B8F A;  2F0M A;  4JI7 E;  1KNA A;  1HNX I;  1J5K A;  4A3M H;  1KHM A;  4EQ5 A;  1HR0 L;  1X3E A;  2CTJ A;  2AUJ D;  2FMC A;  2HKE A;  3E5S A;  5IYB G;  2HQL A;  2EIF A;  1IBM E;  3OSO A;  2UUA E;  2N55 A;  1EIF A;  4DV2 E;  1TWH H;  5FJ8 G;  1YHQ A;  3UDF A;  1I6V C;  1KIX A;  3JAM c;  2M00 A;  3HOW H;  2JA7 G;  2CVE A;  2CWH A;  4NXM E;  4RHR A;  5LMN L;  1B9M A;  4JBJ A;  3U9S A;  3M9B A;  4G57 A;  5TSS A;  3OTO L;  3I4L A;  4K2K A;  4YHH Q;  3T1H E;  3LWU A;  4LF6 H;  1XMO E;  1RIP A;  1PLF A;  1HNX E;  3ZZT A;  2R93 G;  4X66 H;  1FNW A;  2X69 A;  1NMF A;  4CKB A;  4XYO A;  1XNR H;  1NXU A;  3I7F A;  1NCV A;  1OO9 B;  1BQQ T;  1Y8P B;  4WOR A;  1FKA E;  2WP8 A;  1NMG A;  2OTJ A;  4HSP A;  3RN2 A;  1IBK L;  3R93 A;  4F8M A;  1IHZ A;  1I4P A;  4BA2 B;  4L5Q A;  3SXH A;  4B3S E;  1NJI C;  4C56 C;  5JEA E;  3DUZ A;  4UHV A;  1ZXM A;  2E2D C;  1U5K A;  4OO1 G;  2P5Z X;  1KHI A;  2KEN A;  3PUV A;  3HOU H;  4YY3 E;  3WOE A;  4CJ0 B;  4DAV A;  2C37 B;  1Y60 A;  2CKZ B;  3HOW B;  1HNW I;  1JE5 A;  1STA A;  2ZXP A;  1AN7 A;  1I94 H;  4DR5 Q;  1TXY A;  2UU9 E;  1UAP A;  3CCJ A;  4DA2 A;  5EKL A;  1VBI A;  1SXT A;  3L0O A;  4LF5 H;  2UUB H;  1TQO A;  2L5T A;  1SEI A;  2J7Z A;  3ONA B;  2X6L A;  4X65 H;  2SNS A;  1K0R A;  1S4E A;  3H15 A;  2VZA A;  4C3H G;  1SE8 A;  2BV3 A;  3G48 A;  3W5O A;  5KIX A;  4K0K I;  3NEM A;  5BR8 I;  1HNW E;  5JJL A;  1YNJ C;  4LFA Q;  3SDZ A;  3I4O A;  4JI4 L;  2UXD H;  4CGY B;  4NXN Q;  4CDC C;  3OOC A;  5LMN W;  2UUB L;  1P42 A;  2A2D A;  3J80 Q;  2K5W A;  1CSP A;  5J1Z A;  2E5L H;  1XTC D;  1K3R A;  2LY7 A;  2OT2 A;  2V8P A;  2VNU D;  3HOU B;  3EA6 A;  4LAA A;  2X06 A;  3HZX A;  1AW7 A;  3A5U A;  1NBW A;  4JI8 E;  4G7O C;  3GV3 A;  2B63 H;  2K52 A;  1PTO H;  1WOC A;  1S3O A;  1H9S A;  3ZZU A;  1K1G A;  4YWL A;  3MFY A;  1T5X D;  2G9H D;  1X3Q A;  2GQ0 A;  3OMG A;  3HOX G;  4IO9 A;  3UDX A;  2LRR A;  2CFM A;  5AJ3 Q;  3GTL H;  5EGT A;  2E5L L;  5CGK A;  3V5R A;  1EQV A;  2NN6 H;  4DUZ I;  4R8I A;  3MEH A;  3CRL C;  2CH4 A;  3CP0 A;  2QDL A;  4WJW A;  2ES2 A;  4LW1 A;  3KBG A;  3IFT A;  4GKK I;  4OWT B;  5EL9 A;  1ZZJ A;  2BA0 G;  1OXU A;  4QCL A;  1E0B A;  4A3D G;  3L7Z C;  2K01 A;  3GCM A;  1VIS A;  2E2J H;  2H1E A;  2PO1 B;  4LUO A;  1GXD C;  4DK6 C;  5LMU H;  1LYL A;  1STB A;  2N88 A;  3K81 C;  2JK8 A;  3D0F A;  2BL5 A;  1ROD A;  4GKJ I;  2JA8 G;  2R7Z G;  2B63 B;  1EIH A;  2PZW A;  3SK6 A;  1PTO B;  4DV4 Q;  1BUV T;  3CC2 A;  4KHP I;  1ICW A;  5GAH C;  3NHH A;  4OXP A;  2R3V A;  4DR3 H;  3ND9 A;  1N0V C;  4JI3 H;  1N32 Q;  1RHY A;  1VQ6 A;  4X62 Q;  4DR2 Q;  1GUN A;  2NB0 A;  3GTL B;  1ESR A;  1BVS A;  4JBM A;  5LMU L;  2C37 A;  4PV1 C;  1PH1 A;  4QQB X;  4DV7 L;  2ZJP A;  2NN6 B;  2SEB D;  4PRX A;  4JI5 H;  2BDN A;  4JI0 Q;  1YNJ D;  1SE2 A;  1A6F A;  1ZXN A;  3ZKB A;  3ZJY C;  4PZ7 A;  2I5M X;  2F0K A;  4V19 0;  1RTO A;  1SNC A;  1L0X B;  4DV5 H;  4G4K A;  2Z0S A;  4JI3 L;  2Q2T A;  4A3E G;  3J7A M;  4L63 B;  4R4O A;  4F7X A;  1SEB D;  3BZC A;  3E6Z X;  2A1S A;  5D14 A;  1ZXT A;  5I6Y A;  2E2J B;  4UPA A;  1T9H A;  5EBD A;  1VQM A;  2B2U C;  3I0P A;  1G8Z D;  2JP1 A;  2SOB A;  2TMP A;  2A69 C;  1UE7 A;  2KHS A;  3JAM E;  4DV5 L;  1SLJ A;  3QT5 A;  1UG8 A;  2HD3 A;  2UXC I;  3T1Y H;  4POG A;  5C0X A;  2B39 A;  2YV5 A;  2DY7 A;  4DUY L;  4ME3 A;  1WI5 A;  2R3Z A;  1OYR A;  1KAB A;  3PO3 G;  2L55 A;  5IP9 H;  4IPG A;  1XNQ L;  1JJG A;  3CW2 C;  1JB7 A;  3P75 A;  1SBB B;  4DXF A;  3J7Y W;  2RDG A;  4JI2 I;  3R3O A;  1CZW A;  4LF4 L;  2ZTE A;  2E75 C;  3PCO B;  3O13 A;  4IUV A;  1F2Z A;  2QIL A;  1GJX A;  2K33 A;  1U4L A;  3QOJ A;  4WRD A;  3BG3 A;  3Q23 A;  3HKZ B;  2HFS A;  2VUM G;  2XTI A;  3P20 A;  5CC4 A;  1VDZ A;  1VQ8 A;  2VXW A;  3E0E A;  2E3U A;  3BVM A;  3MTS A;  1VQP A;  1AP0 A;  3Q6N A;  1HZB A;  4B3M I;  1Q8I A;  1Y1V H;  4JI6 I;  3K7U C;  4A93 G;  3STB D;  1K3B C;  4BBS H;  4JI1 I;  3U1Y A;  2JEA A;  1Q8K A;  5C3X A;  5GAE C;  2ZM6 Q;  1QZH A;  1TS5 A;  1JCK B;  2L9H A;  1Z5A A;  1NHH A;  1AFP A;  1SYD A;  2UXB L;  5E1F A;  1B70 B;  4WJ3 M;  2G5D A;  3IRB A;  2Q8R E;  1A62 A;  2KJX A;  1STG A;  3T56 B;  2VL6 A;  4JI7 H;  5IWA E;  4M1K A;  4DV4 L;  4UP7 A;  3V05 A;  2N3S A;  1W3S A;  5FLX C;  4JYA I;  3SK5 A;  1N32 L;  4P75 A;  1IBM H;  4DR2 L;  2UUA H;  3FAU A;  2O1W A;  1SRU A;  1D7Q A;  2EYL A;  1LTA D;  3I90 A;  5COR A;  4MU4 A;  2CWA A;  1B63 A;  3HJC A;  4QGU A;  2NN6 A;  2PNL A;  4GQU A;  2A69 D;  3QT7 A;  1N36 I;  4NXM H;  3WU6 A;  5IGC A;  5HUR A;  1V8C A;  2IT1 A;  1VIG A;  2HQE A;  1P16 A;  4A76 A;  4DFA A;  2BM1 A;  1Y1V B;  1XMO H;  4BBR H;  4ULL A;  4FXD A;  5DRP A;  2JA8 H;  4BBS B;  5CV6 A;  2M9V A;  4BA2 I;  3AFQ A;  1I4R A;  4IUP A;  4JYA E;  4B8T A;  5LMN I;  3NUC A;  4CJ1 B;  2O2L D;  1AE2 A;  4FF2 A;  1EOT A;  2IHF A;  1L1O B;  4IAL A;  3U9O A;  2HDM A;  4QIW B;  2EZV A;  5DM6 3;  2WW4 A;  2NZ1 D;  1M4V A;  2K32 A;  2ZXO A;  4PQX A;  2BH2 A;  1HR0 E;  5KGU A;  1QZG A;  2F0L A;  4ABN A;  1I4G A;  1KRT A;  4B3S H;  1QUQ B;  5JEA H;  2AWO A;  1PRT B;  1HNZ Q;  4DR1 Q;  1VS0 A;  2B2V A;  1USV A;  2Y0S B;  2Z6K A;  3CU7 A;  3J81 Q;  1USU A;  2DJG C;  2K4K A;  3PIP 3; 
#chains in the Genus database with same CATH homology
 3GD7 A;  2WAQ E;  3PUY A;  4LFC Q;  1S40 A;  4QJF A;  4Y52 H;  3K7A H;  1N9W A;  4DV1 Q;  1MKH A;  4BXX H;  3Q8D A;  2F4V Q;  4GN5 A;  4HIO A;  3CPW A;  3VDY A;  1Q81 C;  1N33 Q;  2NVY H;  4OX9 L;  2JVZ A;  2ZTD A;  2ID0 A;  5JJI A;  4WAN A;  4DV0 Q;  1UDO A;  1VQB A;  4O0A A;  4Y7N H;  1N34 Q;  5JEA B;  2ZM6 L;  5M5X H;  3CMA A;  2OQ0 A;  3KJO A;  5C0X E;  5C4J H;  1BBU A;  1MJE A;  1IBL L;  4GKJ Q;  1ZTG A;  1UDQ A;  3B6Y A;  4JOI A;  5IY0 A;  2PO2 B;  4LFB L;  2NN6 D;  2K5N A;  1UDS A;  2RF4 A;  3OW2 A;  2AKW B;  2RHQ B;  2YTY A;  2IHE A;  3GTO H;  2LXK A;  3EBE A;  4GOP B;  1VQC A;  4A3B H;  4GS3 A;  3HOV H;  4JC0 A;  1GKH A;  1O7I A;  2K75 A;  2E2I H;  4B3T Q;  1VQK A;  1XPO A;  1OYP A;  2P2R A;  2HH2 A;  2JE6 A;  1QUQ A;  4NBQ A;  2NN6 I;  1HNZ L;  3AEV B;  2UXC Q;  2B29 A;  3J80 i;  1GVP A;  1XTD A;  1L1O C;  3PV0 A;  1B7Y B;  4LFC L;  4IFD J;  1PH4 A;  3CC7 A;  1DTJ A;  1VIH A;  4GLV B;  2I5L X;  4LF9 L;  2NN6 E;  1EC6 A;  1ASY A;  4A3M G;  4BA1 A;  2F4V L;  3FP9 A;  1HZA A;  1PYS B;  1WE8 A;  3CCL A;  2C38 B;  3HOW G;  5JEA A;  1VQI A;  1N34 L;  2NVT H;  4JV5 Q;  4R4I A;  4JBW A;  3DD6 A;  1UE5 A;  4A75 A;  4YWK A;  1TWG H;  2MQH A;  4X64 Q;  4YCW A;  4JVY A;  1H95 A;  2JJQ A;  2MJH A;  5JEA C;  4OWX B;  4DR4 Q;  1OXX K;  1XJV A;  3TS2 A;  3HOU G;  2VS1 A;  4IPC A;  2D0O A;  3HKZ E;  1K83 H;  1G6P A;  2K5V A;  2LXJ A;  1KC8 C;  2YU9 H;  4B3T L;  4PG3 A;  3K80 C;  3AEV A;  3F2B A;  1V43 A;  4GOP C;  2NVQ H;  2KCM A;  3M7N A;  2N49 A;  3RNU A;  3ICE A;  1PHJ A;  2VQE Q;  3KF8 B;  2CWP A;  2OPV A;  3S17 H;  2B63 G;  4LUV A;  1FJG Q;  3M3Y H;  1M90 C;  3S1Q H;  3OYY A;  2D0P A;  2NN6 G;  4RG1 A;  4B3R Q;  5JEA D;  3ULL A;  4JV5 L;  3DLL A;  2MO0 A;  3I4M H;  1CSQ A;  1PA6 A;  4DV6 L;  2Y0S E;  4IPH A;  2EQS A;  1GO3 E;  3U1K A;  4A3I H;  2N78 A;  2ALY B;  1CKN A;  4DR4 L;  1U0L A;  4GN4 B;  1SFO H;  4DR6 L;  4AQY Q;  2UXD Q;  3M85 A;  2PMZ E;  2MNA A;  4HJA A;  4FDB A;  5M3M H;  4POF A;  1J5E L;  3HKZ G;  4IJL A;  4L5S A;  3UE0 A;  4GN3 B;  3UDI A;  3E9H A;  4IJH A;  2BA1 D;  5M3F H;  2VQF Q;  3A5Z B;  4DV3 L;  1FL0 A;  1X4M A;  1NE3 A;  3J81 i;  1L0W A;  5IP9 G;  3W1G A;  1X55 A;  5K36 E;  2VQE L;  1E22 A;  3S15 H;  2KHJ A;  4BY1 H;  1HR0 W;  2I0Q A;  4LF7 L;  1FJG L;  4JVH A;  1Y1W H;  2XGT A;  5J3B A;  4DR7 Q;  4DR3 Q;  3CCU A;  5C0X B;  1YHA A;  4J15 A;  1J6Q A;  4B3R L;  4A3G H;  1Y1V G;  2UUC Q;  4BBS G;  2CTK A;  4A4I A;  2GVB A;  2Q2H A;  1YI2 A;  4LF8 Q;  1XPU A;  1VQ4 A;  1XMQ Q;  2Y0S G;  3CME A;  4YHH L;  1JMC A;  3M85 D;  4R4Q A;  4BY7 H;  2JEA B;  1Q46 A;  2HHH Q;  5HGQ A;  1VQE A;  1IXR A;  3H0G H;  2PY9 A;  4BBR G;  4HIK A;  3KOJ A;  5DLQ E;  1E1T A;  3STB C;  2R92 H;  1C9O A;  3GTM H;  3CCR A;  4H02 A;  5JEA G;  3ULP A;  4KLK A;  4DR5 L;  3GME A;  3I55 A;  3TQY A;  4DKA C;  4BXX G;  3NEL A;  4LFA L;  4IFD A;  4NXN L;  4OON A;  1ZZK A;  1IBM Q;  1UE1 A;  2GVA A;  4DV2 Q;  4NXM Q;  2I5H A;  3CCV A;  3U4V A;  2ZJQ A;  1X6O A;  3T1H Q;  1CKM A;  3CCE A;  1HNX Q;  4GLX A;  5IYC H;  5AJ3 L;  4QMF B;  5C0X F;  5C0X C;  5C3E H;  3TS0 A;  2OCE A;  1AH9 A;  2AWN A;  3PF5 A;  1X9N A;  2BA1 G;  1PH8 A;  4LWC A;  4GLA C;  5JJK A;  1HJP A;  1R6M A;  2RHS B;  5FLM H;  1YVC A;  2YTV A;  1I50 H;  2BH8 A;  4A3B G;  4WAL A;  3HOV G;  1QVC A;  1K8A C;  3BJU A;  4X62 L;  3J7A 5;  2QA4 A;  1EYG A;  1GM5 A;  2A19 A;  4OWW B;  4JI0 L;  4A3J H;  1Q1E A;  1HNW Q;  3PGZ A;  3PSI A;  4O2D A;  1SMX A;  1VQH A;  3CCS A;  2WP8 J;  2NN6 F;  2NN6 C;  2PO0 A;  1Q1B A;  5C44 H;  2QND A;  3LGJ A;  2Q2I A;  4K0K Q;  2JE6 B;  5BR8 Q;  2L15 A;  4IFD D;  5C0X D;  2V1C C;  3M85 G;  3RLF A;  3J80 c;  1ASZ A;  5E7N A;  3G6E A;  4HJ9 A;  4GNX B;  5GAG C;  2FXQ A;  4R4C A;  3RZO H;  3GDE A;  5M5Y H;  2OQK A;  4BA1 B;  4YCU A;  2CTF A;  4IFD I;  5C0X I;  3JC6 6;  2Z6K C;  1FVI A;  3CF5 A;  4DUZ Q;  1WFQ A;  3TRE A;  4GKK Q;  1I6H H;  3GTQ H;  3GTK H;  2CTM A;  4OO1 A;  4IFD E;  3UE1 A;  1HZ9 A;  1GD7 A;  4AID A;  4KHP Q;  5K36 B;  3AFP A;  3TRZ A;  2JEA I;  2MFI A;  1EUJ A;  3RLN A;  4LIJ A;  1PVO A;  1EOV A;  1C7Y A;  3M4O H;  2JA5 H;  3B4T A;  2MO1 A;  1SN8 A;  3S2H H;  5ELO A;  1UEB A;  4A3F H;  4DNI A;  3NEN A;  3AQQ A;  3BZK A;  4JOI C;  4YCV A;  3HOY H;  3A0J A;  4X6A H;  1PH9 A;  4K0K L;  5BR8 L;  3H3V H;  4DR1 L;  1NY4 A;  2NVX H;  3I4N H;  2DUD A;  3GTJ H;  4A3C H;  2WB1 E;  3SGI A;  4GNX A;  4AYB E;  2ASB A;  4JI2 Q;  2C39 A;  3I4M G;  5M5W H;  2DGR A;  4DV1 L;  3CXC A;  2PI2 A;  1EQR A;  2WAQ G;  1TWF H;  1N33 L;  1WCM H;  4DUZ L;  3VKE A;  3PF4 A;  4A3I G;  4DV0 L;  4B3M Q;  4GKK L;  1NTG A;  4JI6 Q;  4JI1 Q;  3GO5 A;  2A8V A;  3ULJ A;  4JCV E;  4C3J H;  3S16 H;  5M3M G;  3FHW A;  4GKJ L;  2JA6 H;  1OYS A;  2RCN A;  2H5X A;  5K36 A;  4A3L H;  1YZ6 A;  3KDF A;  1WJJ A;  3CCQ A;  4KHP L;  1PH5 A;  4JYA Q;  5JEA F;  3H1C A;  4IFD G;  5C0X G;  1CKN B;  1KAW A;  1UDN A;  1MIU A;  2PQA B;  2HT1 A;  1BBW A;  2D62 A;  1N36 Q;  1YEZ A;  5M3F G;  1QVF A;  1VQD A;  3ER0 A;  1CUK A;  2CTE A;  2JQO A;  1WYD A;  5LMN Q;  3RR5 A;  4C3I H;  4IOC A;  4DAM A;  3M4Q A;  4BY1 G;  4DAY B;  5EAY A;  1Y1W G;  2UXC L;  4A3K H;  3S24 A;  4OO1 E;  1DT4 A;  1VQL A;  3J81 c;  4LF6 Q;  1J4W A;  4A3G G;  4YWM A;  2Q2U A;  1IL2 A;  2QGQ A;  1EWI A;  3FKI H;  4X66 Q;  4JI2 L;  4EX5 A;  2WB1 G;  4TVA B;  1XNR Q;  3J7Z C;  3F8T A;  1X3F A;  2R6G A;  2JE6 I;  3RLO A;  1X56 A;  1E1O A;  1BKB A;  1Q12 A;  4B3M L;  4JI6 L;  1C0A A;  2NZH A;  1AE3 A;  4JI1 L;  3PIO A;  4LUZ A;  3PO2 H;  4BY7 G;  1KXL A;  1I94 Q;  4JI4 Q;  4BA1 I;  3H0G G;  3HKS A;  1M1K C;  4X64 L;  4LF5 Q;  2F52 A;  2UUB Q;  4X65 Q;  5K36 D;  1PH3 A;  4JYA L;  2PQA A;  3L7Z B;  3AYH B;  2R92 G;  1N36 L;  2PI2 E;  2E5L Q;  1QVG A;  3CPF A;  2HIX A;  1OXS C;  4JBK A;  1E24 A;  5C4X H;  1P8L A;  4P73 A;  2AXY A;  3WWV A;  1PFS A;  1KL9 A;  3F2D A;  3M7N D;  3S1R H;  4AM3 A;  1LTL A;  4LF6 L;  1I3Q H;  4X66 L;  3HOZ H;  2GN5 A;  2R7F A;  2VW9 A;  1XNR L;  1OTC A;  5LMU Q;  4AH6 A;  4DV7 Q;  4P71 A;  5IYC G;  4QY7 A;  5C3E G;  1LM0 A;  4JI3 Q;  5IT9 c;  2HH3 A;  4IFD B;  1A63 A;  3HKM A;  1PH6 A;  2PNZ B;  4JI5 Q;  3A74 A;  5FLM G;  1I94 L;  4UP9 A;  3KJP A;  4DV5 Q;  1EIY B;  1E7Z A;  2OPU A;  3KF6 B;  4UY8 C;  3D31 A;  1FGU A;  5IP7 H;  4DUY Q;  4LF5 L;  2ZJR A;  1YHB A;  4X65 L;  1W2B A;  1XNQ Q;  1MJC A;  1KD1 C;  4HJ5 A;  1VQG A;  3L7Z A;  3MXN B;  3H3V I;  4LF4 Q;  3T1Y Q;  4AQY L;  1XPR A;  2UXD L;  1L2F A;  4IOA A;  5JEA J;  5GQO A;  4A3J G;  3JAM i;  1CKO A;  1Q7Y C;  4UP8 A;  1VQF A;  5IYD H;  3PUZ A;  1A0I A;  3G71 A;  5C44 G;  2UXB Q;  2VQF L;  1X54 A;  5IYB H;  2E8G A;  1HZC A;  1PH2 A;  1VQA A;  5FJ8 H;  4BA2 A;  3U50 C;  4DPG A;  2ATW A;  2JA7 H;  3ERS X;  2NZO A;  3RN5 A;  2EXD A;  3CQZ H;  1I5F A;  2R93 H;  5K36 G;  2KCT A;  4JI7 Q;  1YNX A;  2PO0 B;  4DR7 L;  3RZD H;  1R9T H;  4DR3 L;  2CCZ A;  3U4Z A;  1TUA A;  2UUA Q;  2DGY A;  1SR3 A;  2FMR A;  2PNZ A;  4L5T A;  2UUC L;  3PUX A;  3PIP A;  4MZ9 A;  4JI5 L;  2YQR A;  1VCI A;  4HJ8 A;  4ALP A;  3KF6 A;  1XMO Q;  1UE6 A;  4DK3 C;  3EN2 A;  4LF8 L;  1IZ6 A;  4HIM A;  4IFD F;  4IFD C;  1XMQ L;  1RL2 A;  3S14 H;  4APV A;  2A1A A;  3M7N G;  4B3S Q;  3T1Y L;  5FLX c;  1PH7 A;  4C3H H;  1JT8 A;  4AIM A;  3GTP H;  2HHH L;  4YY3 Q;  1YJN A;  1YJW A;  4NB3 A;  1E3P A;  2JA5 G;  4OX9 Q;  4OO1 B;  2UU9 Q;  2R7D A;  3L2P A;  4A3F G;  3J81 j;  2PNH A;  2PO1 A;  1K73 C;  3UDG A;  1V9P A;  2JEB B;  2IY5 B;  2K14 A;  3HOY G;  3HOX H;  1YBY A;  3I4N G;  1IBL Q;  4A3C G;  1K9M C;  2BR2 B;  2HIV A;  2VY3 A;  4PZ8 A;  4A3D H;  4LFB Q;  3S2D H;  2ANN A;  1WVN A;  4JI8 Q;  1ZZI A;  3CAM A;  4JI7 L;  2R7Z H;  1IBM L;  2UUA L;  1PYB A;  1WCM G;  4DV2 L;  2WFW A;  2PQU A;  4P72 A;  4NXM L;  5IE8 A;  1D8L A;  1Y14 B;  1VQ7 A;  3T1H L;  2C39 B;  1XMO L;  2E2H H;  1HNX L;  1S72 A;  2QEX A;  5GRO A;  4A3E H;  2JA6 G;  1VQN A;  3KFU A;  4A3L G;  5HY6 A;  3NBH B;  4B3S L;  3S1M H;  3KYH C;  4LF9 Q;  4YY3 L;  2YTX A;  3PO3 H;  2UU9 L;  2YYZ A;  2JEB A;  3KDF B;  4L5R C;  3BU2 A;  3G4S A;  3E9I A;  2C35 B;  1KQS A;  5ELN A;  4QL5 A;  1X65 A;  2IX0 A;  4A3K G;  2VUM H;  1HNW L;  4OO1 F;  4HID A;  1TWC H;  1V1Q A;  4OO1 C;  4XIG S;  1OXV A;  1G29 1;  3EIV A;  2BR2 A;  3I56 A;  4A93 H;  1JJ2 A;  3FKI G;  2KBN A;  4KHZ A;  2WNR B;  4JI8 L;  3CCM A;  1E3H A;  1DGS A;  2AMC B;  4R4T A;  4MNO A;  2KHI A;  2ZTC A;  1Q86 C;  4PZ6 A;  1L1O A;  2JZX A;  3HFZ B;  1Q82 C;  3U58 A;  3GTG H;  4P74 A;  2CPQ A;  3V69 A;  4PMW A;  3PO2 G;  3K8A A;  2F3I A;  3MEF A;  3TEH B;  2BA0 A;  1TWA H;  2CTL A;  1G51 A;  3S1N H;  5IWA Q;  4GNX C;  5C0X J;  4WJ4 A;  1OXT A;  1N8R C;  1SRO A;  4OO1 D;  2B3G A;  2LSS A;  1JJC B;  4RMF A;  1IYJ B;  1R6L A;  1Z9F A;  4C2M H;  1VQ9 A;  4TQU S;  3PUW A;  1X4N A;  5C4X G;  2K50 A;  4DV6 Q;  1HR0 Q;  4OO1 I;  3DM3 A;  2N8N A;  1VQO A;  5K36 F;  2PO2 A;  5K36 C;  3K0X A;  2K5H A;  2WNR A;  3HOZ G;  4DR6 Q;  1K8G A;  3OTO Q;  2JEB I;  1UWV A;  1YIT A;  4GOP A;  3F1Z A;  2IX1 A;  1A8V A;  1EFW A;  4IPD A;  1HH2 P;  4XTC S;  1J5E Q;  5GAD C;  4LNQ A;  1IBK Q;  2WP8 B;  3GLL A;  2OTL A;  4NPS A;  3M4P A;  4MTN A;  2BA1 A;  1PV4 A;  4AYB G;  4DV3 Q;  4HJ7 A;  2BA0 D;  2AHO B;  4KI0 A;  5IP7 G;  3CDI A;  3CD6 A;  2OWO A;  5IWA L;  1YJ9 A;  1VQ5 A;  3W1B A;  1B8A A;  3CDJ A;  4JG2 A;  3KLW A;  4LF7 Q;  1YIJ A;  3KRN A;  1Z47 A;  2C38 A;  2JA9 A;  2ANR A;  1KRS A;  3I2Z A;  1LUZ A;  2CQO A;  1EQQ A;  1X3G A;  3F2C A;  4R1J A;  5IYD G;  4QIW E;  5H1S E;  1VQJ A;  1J5K A;  4A3M H;  1KHM A;  4EQ5 A;  1HR0 L;  1X3E A;  2CTJ A;  5IYB G;  2HQL A;  2EIF A;  1EIF A;  1TWH H;  5FJ8 G;  1YHQ A;  3UDF A;  1KIX A;  3JAM c;  3HOW H;  2JA7 G;  5LMN L;  4JBJ A;  3M9B A;  3OTO L;  4YHH Q;  1RIP A;  2R93 G;  1NMF A;  3I7F A;  2WP8 A;  1NMG A;  2OTJ A;  3RN2 A;  1IBK L;  4BA2 B;  4L5Q A;  1NJI C;  5JEA E;  1U5K A;  4OO1 G;  1KHI A;  2KEN A;  3PUV A;  3HOU H;  2C37 B;  2CKZ B;  1JE5 A;  4DR5 Q;  1TXY A;  3CCJ A;  3L0O A;  1K0R A;  3H15 A;  2VZA A;  1SE8 A;  3G48 A;  3W5O A;  3NEM A;  5JJL A;  4LFA Q;  3I4O A;  4JI4 L;  4NXN Q;  5LMN W;  2UUB L;  1CSP A;  1K3R A;  2VNU D;  3A5U A;  1NBW A;  2B63 H;  2K52 A;  1WOC A;  1S3O A;  1K1G A;  4YWL A;  3HOX G;  4IO9 A;  3UDX A;  2CFM A;  5AJ3 Q;  3GTL H;  2E5L L;  3CP0 A;  2ES2 A;  4LW1 A;  4OWT B;  1ZZJ A;  2BA0 G;  1OXU A;  4A3D G;  3L7Z C;  3GCM A;  2E2J H;  2PO1 B;  4LUO A;  4DK6 C;  1LYL A;  3K81 C;  2JK8 A;  3D0F A;  2BL5 A;  2JA8 G;  2R7Z G;  4DV4 Q;  3CC2 A;  5GAH C;  4OXP A;  1N32 Q;  1VQ6 A;  4X62 Q;  4DR2 Q;  1BVS A;  4JBM A;  5LMU L;  2C37 A;  4QQB X;  1PH1 A;  4DV7 L;  2ZJP A;  2NN6 B;  4JI0 Q;  3ZJY C;  4PZ7 A;  2I5M X;  4JI3 L;  2Z0S A;  2Q2T A;  4A3E G;  4R4O A;  3BZC A;  4UPA A;  1T9H A;  1VQM A;  1UE7 A;  4DV5 L;  1SLJ A;  4POG A;  5C0X A;  2YV5 A;  4DUY L;  4ME3 A;  1WI5 A;  1OYR A;  3PO3 G;  5IP9 H;  4IPG A;  1XNQ L;  1JJG A;  3CW2 C;  1JB7 A;  4LF4 L;  2ZTE A;  3PCO B;  2VUM G;  2XTI A;  1VQ8 A;  3E0E A;  2E3U A;  1VQP A;  1HZB A;  1Y1V H;  3K7U C;  4A93 G;  4BBS H;  3STB D;  2JEA A;  1Q8K A;  5GAE C;  2ZM6 Q;  1QZH A;  2UXB L;  1B70 B;  4WJ3 M;  3IRB A;  1A62 A;  2VL6 A;  4DV4 L;  4UP7 A;  2N3S A;  1W3S A;  1N32 L;  4P75 A;  4DR2 L;  1SRU A;  1D7Q A;  2CWA A;  4QGU A;  2NN6 A;  2IT1 A;  1VIG A;  1P16 A;  4A76 A;  4BBR H;  2JA8 H;  4BA2 I;  3AFQ A;  4B8T A;  1AE2 A;  2IHF A;  1L1O B;  2BH2 A;  1QZG A;  1KRT A;  1QUQ B;  2AWO A;  1HNZ Q;  4DR1 Q;  1VS0 A;  2Z6K A;  3CC4 A;  2K4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...