4AIMA

Crystal structure of c. crescentus pnpase bound to rnase e recognition peptide
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
698
structure length
698
Chain Sequence
SPMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKIETINIPTDKIREVIGSGGKVIREIVATTGAKVDINDDGVVKVSASDGAKIKAAIDWIKSITDEAEIGKIYDGKVVKVVDFGAFVNFFGAKDGLVHVSQISNERVAKPSDVLKEGQMVKVKLLGFDDRGKTKLSMKVVDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase/peptide
total genus 168
structure length 698
sequence length 698
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aimA04
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aimA01
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aimA02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4aimA03
2OQKA 4OO1A 4A3IG 2Q2IA 1SRUA 1IBML 1X3EA 4X6AH 3STBD 3TS2A 2A8VA 4IFDA 1UWVA 3RLFA 2JA5H 5IWAQ 3U1KA 4OWTB 2R7DA 3UE1A 1I5FA 4KHPQ 1Q1EA 4P72A 5IYDG 1E24A 4NB3A 2HQLA 5IP9G 3U4ZA 3F2DA 4LFCQ 1YNXA 4B3RL 3S1NH 2UUBQ 4XTCS 3S14H 1N32L 2ZJPA 2CTMA 3MEFA 2MNAA 3PUYA 1V9PA 2WFWA 3OW2A 1YI2A 2Q2HA 1WI5A 5BR8L 4JI7Q 1B70B 2ANNA 2PQAB 1PH2A 1XNRQ 5M5XH 1GKHA 5JEAD 2Q2TA 3S1QH 3K8AA 4AIMA 3UE0A 5JEAE 1S40A 1GM5A 1N32Q 3CPWA 1QVCA 2AKWB 1NMFA 2N3SA 5M3FH 3CC4A 4DKAC 4ME3A 2BA0G 2AMCB 1Q7YC 4GNXC 5BR8Q 3GCMA 4JI0Q 1XNQL 1UEBA 1SN8A 1ASYA 1UE1A 2CWPA 1X3FA 2XTIA 1VQAA 2PNZB 4LF7Q 2B3GA 1NY4A 1X55A 4DK3C 1OYPA 5M3FG 3BZKA 1EUJA 2KENA 4A3LG 1HNWL 5IYCH 2JE6A 4A93G 4A75A 4IJHA 1ASZA 3ER0A 1Q1BA 3A74A 1GD7A 3K7UC 4JI6Q 1SMXA 4R4IA 1EIYB 1WVNA 4GLAC 1XNQQ 3RLOA 5IP7H 2QA4A 5FJ8H 3U4VA 1PYSB 1GO3E 2UXCQ 2HHHQ 4B3ML 5IYCG 4DR3L 1HNWQ 4EX5A 1HJPA 1JMCA 2C39B 4BA2I 2IT1A 2D0OA 5IP7G 3L0OA 3A0JA 5JEAF 2WP8B 4NXNQ 2QEXA 2QGQA 1ZTGA 2VZAA 2PQAA 4QL5A 3K0XA 2ZJQA 3GTJH 4IO9A 3CQZH 2IHFA 4MZ9A 4YCVA 1X56A 2PO1B 3STBC 3TREA 4B3MQ 2JA6G 3GLLA 4JBJA 4JI1L 4GKJL 2IHEA 4IJLA 5GROA 1K8GA 1VQBA 4PG3A 1VS0A 4P75A 2OPUA 2BA1D 2BH8A 3HOYH 1EIFA 3UDFA 1KXLA 1XPUA 4DNIA 3M85A 4DR5L 3NEMA 3G4SA 3M7NG 4X66L 4JBWA 3S24A 4FDBA 1HZBA 2NN6I 2NN6E 4B3TL 2ZTDA 2K5NA 4QQBX 2PNZA 3GTKH 1TWHH 4A3KH 4LF4Q 4A3BG 2ZTEA 4DV5L 1ZZJA 3MXNB 2CQOA 5JEAC 1OXSC 1VCIA 4A3FH 1I3QH 2YTYA 5K36G 4Y7NH 4DR5Q 3PIPA 4X66Q 4B8TA 3ZJYC 3JAMi 2MJHA 2ZJRA 3PO3H 1L1OC 1PH6A 4HJ8A 1YHAA 4DUYL 1H95A 5C0XD 1A8VA 1PH9A 4DV5Q 1JB7A 2BA0D 4A3JH 2JEBI 2L15A 3H3VH 1J5EL 3BU2A 3S2HH 4JVYA 3PV0A 2WP8A 3PO3G 4LF9L 1CSPA 4IPHA 4DV7L 4GKKL 3RNUA 1E3HA 1VQNA 1VQ9A 4GOPB 2BA0A 1YITA 4LF8L 1QVFA 3HFZB 1CKOA 2PO1A 3PCOB 3PIOA 4A3JG 3I55A 4A3GG 1NTGA 4JBKA 1IZ6A 1SR3A 2NN6F 3CP0A 1AE3A 2OQ0A 1J5EQ 1J5KA 4LF5L 3KJPA 1K0RA 4NPSA 2VUMG 1G291 1YJ9A 3RN5A 3DLLA 3KRNA 4YY3Q 4L5QA 4LF9Q 3EIVA 2E3UA 4C3JH 4LF8Q 3F1ZA 2AWNA 5K36B 1VIHA 4DUZL 1EQQA 3HOVH 1I6HH 3OYYA 2JEAI 4L5TA 2UUAL 3CCSA 4BA1B 2H5XA 4UP9A 5GADC 1CUKA 3PGZA 1A0IA 4LF5Q 3AFPA 4DR7L 4QIWE 4A3DH 2PI2E 1OYRA 4BBRH 4X65Q 3HOVG 3VDYA 2E5LL 2C38B 1B7YB 1JJ2A 3IRBA 1TUAA 4OONA 3L2PA 1X65A 4QGUA 1E22A 2CKZB 1YBYA 4A3CH 1WOCA 2JZXA 4LFBQ 1IBKL 4A3DG 1JE5A 3PO2G 2NVTH 4BBRG 4JCVE 3HOWH 5HGQA 2F3IA 4P74A 2K52A 4WANA 3NBHB 4DR7Q 2PNHA 3KF6A 1C0AA 2QNDA 2ANRA 4TQUS 1Y1VG 5AJ3Q 2PMZE 3L7ZC 4A3CG 1HZAA 2ZM6L 2IX1A 4GOPA 1HH2P 1VQ5A 4A3IH 3EBEA 1PH8A 3S17H 3M7NA 4OO1D 3HOWG 4JOIC 2PO2B 4LFCL 4IFDD 2JJQA 5M5YH 5GAGC 1IBKQ 3VKEA 4GLXA 2UUBL 5IYDH 4UP7A 4A4IA 5IP9H 5IYBG 5C0XC 2RCNA 2EIFA 5GAHC 4GN4B 4HIOA 4JI7L 2ZM6Q 1Q81C 1XNRL 3NELA 3J7ZC 5K36A 2KHJA 2JK8A 1PHJA 3GDEA 1X54A 1KIXA 1DT4A 4BA1A 4HIMA 3W5OA 1QZHA 5C0XJ 2ASBA 2HIVA 1UDNA 2NN6G 1OYSA 2BR2A 4MNOA 2CTLA 2WAQE 2Z0SA 1P16A 1BVSA 4HJAA 2C38A 1DGSA 3M9BA 4JI0L 4RG1A 2R6GA 2NZOA 3RLNA 4C3HH 3J7A5 3CDJA 4DK6C 4LFAQ 1QVGA 5ELNA 3H3VI 1EFWA 4LF7L 4IPDA 1KHMA 3I2ZA 4OWWB 4WJ3M 4DV3L 1VQ8A 4JV5L 3SGIA 3WWVA 2WNRB 1G6PA 4JI6L 4A3LH 2Z6KC 1JT8A 3RZOH 4A93H 3KLWA 1HR0Q 3KDFB 4YCWA 1WJJA 1K1GA 2Q2UA 2UXCL 5C3EH 3T1YQ 2HHHL 2PO2A 3KYHC 3HKMA 4YWLA 1YIJA 4JI3Q 4DV3Q 2GVAA 1WE8A 3E0EA 4JV5Q 2D0PA 1KAWA 3J80c 3NENA 3D0FA 3ERSX 2NVQH 4HJ7A 3UDIA 4LF6L 2NN6B 4NXNL 4O2DA 3GMEA 2V1CC 5C3EG 3M4OH 2UUCQ 2CTFA 4JVHA 1TXYA 2VQFL 1K3RA 1L0WA 2YTVA 2WB1E 4H02A 1PYBA 4DV2Q 2E2JH 1YHBA 4BY1H 1VQLA 4DR4Q 5JJLA 2RHSB 4OO1C 2JA6H 3LGJA 3GTMH 1E3PA 4IFDC 4PZ6A 1A62A 2K75A 4NBQA 4LF6Q 1TWAH 4BY7G 2XGTA 2MO1A 4XIGS 1JJGA 3AYHB 1WFQA 2NZHA 1SFOH 2LSSA 2VQFQ 3G48A 4BY1G 3A5ZB 2D62A 2FXQA 3CCLA 1FVIA 1NJIC 1VQKA 1VQOA 2ALYB 4LF4L 2JEBB 3M85D 2B63H 2VL6A 2AWOA 2R93G 3S15H 4IFDJ 4X64Q 1UE7A 3RN2A 1Y1WH 1XPRA 4A3BH 4UP8A 4LWCA 2R92G 1C9OA 2A19A 4R4CA 2WNRA 3M4PA 2OPVA 1OTCA 5M3MH 1PA6A 1XMQQ 4HIDA 2A1AA 2B63G 3KDFA 1N8RC 3E9IA 2KBNA 2JVZA 3GTOH 1E7ZA 1PFSA 4YWMA 1VQ4A 1Y1WG 1S72A 3I4MH 4DPGA 2YV5A 5M3MG 1N34Q 3HOXH 4LUOA 1OXXK 1N33L 2ID0A 1HZCA 2NN6A 4JI8L 2JA7H 4HJ5A 4NXMQ 1NBWA 5C44H 1MJEA 3U50C 3I4MG 3HKZE 2JEAB 3G6EA 3PF5A 3DD6A 5FLMH 2KCMA 3K7AH 1Z47A 3HOXG 1AH9A 1VQ7A 1SLJA 4YWKA 1K73C 3W1BA 4GNXB 4DR2Q 3JC66 3ULLA 3GTQH 2JA7G 5C0XI 4A3GH 5C44G 5C0XE 2C39A 3CC2A 1DTJA 5LMUQ 4IOCA 1VQJA 1N33Q 3UDGA 4POFA 4JI8Q 4YY3L 5FLMG 1KRSA 4R4TA 2OTLA 2CPQA 2VUMH 1IXRA 4BBSH 3H0GG 1VQPA 2WAQG 2I5HA 1X3GA 2JEBA 4O0AA 2K5HA 2K4KA 1R6LA 2ATWA 1CKNB 1ZZIA 1KC8C 2ZTCA 1WCMG 1YJWA 3KOJA 1O7IA 3AFQA 1Q82C 4DAMA 2KHIA 2YQRA 1PH4A 3I7FA 4X65L 2B29A 4BBSG 4AQYQ 5JEAG 1SE8A 2RF4A 4DAYB 4QMFB 3CW2C 4JI2Q 3V69A 3S2DH 5IE8A 4UPAA 4LFBL 2CWAA 3A5UA 4C2MH 3S1MH 1I94L 1IBLL 2MFIA 1HNZL 2YTXA 3CF5A 3PO2H 4UY8C 5AJ3L 1YJNA 5C0XF 1X9NA 4LUVA 2PY9A 3AEVB 1XMOL 3CCUA 1ZZKA 3J81i 1Y1VH 1VQIA 3CMAA 4P73A 4TVAB 3CCVA 2VW9A 1EOVA 3Q8DA 4GNXA 2PI2A 2PO0B 4POGA 2OCEA 1I94Q 2CTEA 5IY0A 5C4JH 1IBLQ 2WB1G 1FL0A 3M7ND 4L5SA 3FKIG 5IT9c 1HNZQ 2UU9Q 4JC0A 1VQFA 3FP9A 1QUQB 5IYBH 1OXTA 1XMOQ 2CTJA 3GD7A 1RIPA 1K83H 2JA9A 2F4VL 3PUVA 3ULPA 5JEAB 1V43A 3CXCA 3AQQA 1CKNA 1FJGL 4OO1I 3G71A 4OO1E 1E1OA 4A3MG 1PVOA 5K36D 4IFDI 1M90C 4IFDE 1UDOA 1VQMA 1CKMA 3J80i 1G51A 4DV4L 1L1OB 4WALA 5K36E 3H1CA 1YVCA 1IL2A 3KJOA 1MKHA 3HKSA 2MO0A 4X62Q 2JQOA 4AIDA 4PZ7A 2N78A 2YYZA 4BA1I 3TEHB 2F4VQ 2UXDQ 3E9HA 1EC6A 2BH2A 1Y14B 4B3SQ 4BXXG 4LFAL 1XJVA 2BA1G 5LMNL 2WP8J 4A3EH 1FJGQ 4JYAL 1LYLA 1YZ6A 1K8AC 3HOZH 1X6OA 3PUWA 2GN5A 4YHHL 4J15A 4DV4Q 4L5RC 2KCTA 1OXVA 3PUZA 1PH1A 4DV0Q 3T1HL 1EQRA 3AEVA 3J81c 4A3EG 1HR0L 3GTGH 1LTLA 2JA5G 3S1RH 3HOZG 2VY3A 1IBMQ 3T1YL 3BJUA 4GLVB 1EWIA 3CCQA 5LMNQ 5HY6A 5C4XH 4JYAQ 4BA2B 1NMGA 3HKZG 4JI3L 2PO0A 4YHHQ 4OX9L 2E2HH 4OO1F 4IPCA 1N9WA 2AXYA 4B3RQ 1V1QA 1R9TH 4R1JA 2EQSA 2UUCL 1QUQA 3T1HQ 3B4TA 4IFDF 3CCMA 2RHQB 5C0XG 5C4XG 1CSQA 5JEAA 5K36F 4LW1A 1XPOA 2JE6I 4QY7A 4DV2L 5GAEC 3U58A 4DR4L 2VNUD 1I50H 2Y0SE 2EXDA 2K14A 4OX9Q 4MTNA 3GTLH 1L1OA 1QZGA 1BBUA 4YCUA 4GOPC 3CCRA 4QJFA 2C37B 2MQHA 2HIXA 4DV1L 4HJ9A 4DR1L 1VQHA 1J6QA 2C35B 1W3SA 1LM0A 4BY7H 4GN5A 2YU9H 1X4NA 2N8NA 4WJ4A 2VQEL 4X64L 2FMRA 5J3BA 3L7ZB 1R6MA 5LMNW 2R93H 4AYBE 3BZCA 4R4QA 2CFMA 3FHWA 1FGUA 1S3OA 1XMQL 5K36C 3DM3A 4DV1Q 2DUDA 2R92H 4DR1Q 1TWFH 4PMWA 3J81j 1PV4A 4JBMA 5FJ8G 2NVXH 4AH6A 5C0XB 4DV6L 1Q86C 2VS1A 1WYDA 4BA2A 4LUZA 1HR0W 1VQCA 2VQEQ 1U5KA 1IYJB 1N34L 4EQ5A 1UE6A 1D8LA 4DR3Q 2OTJA 4NXML 2P2RA 5EAYA 1E1TA 3CCJA 3OTOL 3TRZA 2HH3A 3CAMA 3KFUA 1YEZA 2E8GA 2NN6D 3B6YA 4DV6Q 1Z9FA 1LUZA 3GTPH 4DR2L 1N36L 1UDQA 2GVBA 3M4QA 3S16H 3RZDH 2BA1A 1C7YA 5E7NA 5LMUL 3CPFA 3M3YH 4JI1Q 3I56A 4GKJQ 2E2IH 1HNXL 3HOYG 2DGYA 1YHQA 4OO1G 2C37A 2K5VA 1VIGA 2BL5A 3OTOQ 2N49A 4IFDG 1UE5A 4KI0A 3F2BA 1KQSA 3F8TA 2LXKA 2R7FA 3D31A 3F2CA 5GQOA 2ES2A 5FLXc 3UDXA 4A3KG 1VQEA 1PH3A 4K0KL 4LNQA 1N36Q 3H0GH 3L7ZA 4B3TQ 4PZ8A 1KHIA 1HNXQ 5JEAJ 1WCMH 4A3FG 1MJCA 2I0QA 1RL2A 4JOIA 2DGRA 2I5MX 4AQYL 4C3IH 1T9HA 1K9MC 4HIKA 1PH5A 4GS3A 3CD6A 1JJCB 4JI2L 3ULJA 3KF6B 1VQDA 1Q8KA 5C0XA 3K80C 1KD1C 4K0KQ 3I4OA 3K81C 4JI4L 3CDIA 2LXJA 1M1KC 4DUYQ 3PF4A 1VQ6A 2CCZA 4RMFA 3GO5A 1TWCH 3CCEA 1KL9A 4LIJA 2HH2A 3HOUH 4OWXB 3TS0A 2NVYH 4OO1B 1NE3A 3EN2A 1VQGA 4DV7Q 4GKKQ 5H1SE 4IFDB 1SROA 1KRTA 2F52A 1HZ9A 3PSIA 2IX0A 4ALPA 4JI4Q 4A76A 1TWGH 2UXBL 3HOUG 2IY5B 4Y52H 1BBWA 2UU9L 3TQYA 1Q12A 1XTDA 4JI5L 5M5WH 2JEAA 2BR2B 1J4WA 2Y0SG 3FKIH 1MIUA 5JJIA 2K50A 4KHZA 1W2BA 3KF8B 2AHOB 1U0LA 2JA8H 2Z6KA 3H15A 3JAMc 4AM3A 4JG2A 4P71A 1GVPA 2OWOA 2CTKA 4IOAA 4DUZQ 5ELOA 2UXBQ 1OXUA 2NN6C 2R7ZH 2UUAQ 1AE2A 1D7QA 4A3MH 4OXPA 3I4NH 4X62L 4JI5Q 2JA8G 4DR6L 3ICEA 3PUXA 5DLQE 2UXDL 1A63A 4AYBG 4KLKA 4B3SL 2HT1A 3RR5A 1Q46A 2E5LQ 1X4MA 1EYGA 2R7ZG 1UDSA 1L2FA 4APVA 5IWAL 4BXXH 2I5LX 4IPGA 3W1GA 3I4NG 4R4OA 3CMEA 4KHPL 1B8AA 4DV0L 3CC7A 1BKBA 1P8LA 3M85G 2JE6B 4DR6Q 4GN3B 1PH7A 5JJKA 2PQUA
chains in the Genus database with same CATH superfamily
1ZM4A 2OQKA 4OO1A 4A3IG 2X06A 1B4OA 2O1VA 1Z0GA 2Q2IA 1PTOB 1SRUA 1IBML 1XNQI 1X3EA 1BUVT 4X6AH 3OMGA 1XNQE 3STBD 1IYVA 4MU1A 3OPOA 2Y0SB 2I07B 3IKJA 2A8VA 3TS2A 5GMDA 3P7JA 4IFDA 1SMYD 2EOTA 1UWVA 4G4KA 3RLFA 2EYPA 1DM0B 4ZRZA 2JA5H 4X65H 3BDOA 5LL6X 4KJOA 2HHHI 5IWAQ 2HHHE 5C3XA 3U1KA 1BQQT 4OWTB 3R8BA 2R7DA 3UE1A 1I5FA 1TWGB 4KHPQ 1Q1EA 1PQXA 4P72A 5IYDG 3GABA 3TBIB 3O13A 1E24A 1HNWI 4NB3A 2HQLA 4MN3A 1HNWE 5IP9G 1K0SA 3U4ZA 3F2DA 4LFCQ 4HY1A 1YNXA 5EKIA 1HTLD 1HTPA 2GO4A 4B3RL 2XVSA 3S1NH 4CKEA 2UUBQ 4XTCS 3S14H 3GV3A 1N32L 4IZKB 4KV6A 4I7AA 2ZJPA 5E4WC 4NXNI 2CTMA 2Z1CA 4V190 1Y60A 1S20A 3JAMW 3DWPA 4UHVA 4NXNE 1I94H 3MEFA 2EZVA 2MNAA 4A3DB 3PUYA 1IBLH 1V9PA 3KF8A 2WFWA 1C8CA 4OL7A 3OW2A 2RDGA 3VA7A 1YI2A 2Q2HA 1WI5A 2JA8B 5JPMC 2HFUA 1TQOA 5BR8L 5C0XH 3K5NA 4JI7Q 1SNMA 3QD7X 1HNZH 1B70B 1PFMA 3KDKA 2CW0D 3SVMA 2PQAB 2ANNA 2O1TA 1PH2A 1XNRQ 3EA6A 1TS3A 4B3MI 4AYBB 3S9WA 4DR3I 4B3ME 1B1ZA 4XTJA 5M5XH 4DR3E 1UAPA 4XYOA 1XMOH 1GKHA 1FKAH 5A2QL 2PZWA 5JEAD 2Q2TA 3U9OA 2R7ZB 3S1QH 1Y69U 3K8AA 4S3SA 4AIMA 5G3LD 1LV9A 3UE0A 5JEAE 1IKMA 2IPKD 2TMPA 1S40A 1GM5A 3H94A 1N32Q 3CPWA 1EWCA 1QVCA 4M1KA 2AKWB 1MX0A 1NMFA 1BR9A 2N3SA 3TP6A 5M3FH 1Z0EA 3CC4A 1Z0BA 4DKAC 2Q8TA 1H72C 4ME3A 2BA0G 2AMCB 4U673 1Q7YC 4GNXC 1FNWA 1PVGA 5BR8Q 4FW7A 5T1IA 3KLSA 4QNKA 3GCMA 1QG7A 2DNCA 4JI0Q 4A3IB 4RH6A 1XNQL 3N6RA 1UEBA 3S17B 1SN8A 1U4PA 1ASYA 4IZJD 4JI1I 5C5LA 1UE1A 2CWPA 4HACA 4JI1E 4LF4I 2F0HA 1HRJA 4LF4E 1X3FA 2XTIA 5A2QQ 2Z4HA 1VQAA 3P75A 2PNZB 4LF7Q 2B3GA 1NY4A 1X55A 4DK3C 2F4VH 1OYPA 4UTGA 1X0AA 1NAPA 5M3FG 3R2IA 1TS2A 3BZKA 3NXWA 1EUJA 5I4DA 2KENA 4A3LG 1HNWL 1A2TA 1FJGH 3PMFA 4K5VA 5IYCH 4IZJA 5ISRA 2JE6A 1DJRD 2AUKA 2PT7G 4A93G 4A75A 4IJHA 1F9SA 1SNQA 1Z59A 3NCVA 2VB3X 5LL6R 4DR5I 2CHBD 4USMA 1ASZA 3ER0A 1MSHA 4KQVA 1Q1BA 4DR5E 3A74A 2CVRA 1LABA 3UI2A 1GD7A 3K7UC 4X66I 3PYFA 4JI6Q 1SE3A 4WFN3 4X66E 4DNRB 2K1HA 1SMXA 4ABNA 1WTHA 4R4IA 5IGFA 4FWHA 4DF7A 1EIYB 1LO5D 1DD2A 3WU6A 1WVNA 4DV4H 4UAIA 5EGTA 4B3TE 1LTRD 4GLAC 1LT5D 1HQRD 1M8AA 2XWJB 4Q0FA 1XNQQ 1F9RA 3RLOA 5IP7H 4B08A 2QA4A 2IERA 5C6AA 5FJ8H 4DA2A 3U4VA 1PYSB 2FINB 4QUCA 1GO3E 5IODA 3IFTA 1YNNC 3MEHA 2UXCQ 2EYJA 2HHHQ 5LL6S 2F3WA 5IYCG 4B3ML 4DV5I 4DR3L 4DV5E 1NXUA 2LKVA 4PDBA 5C5MA 1CZWA 1SJED 2B8GA 1YH8A 5J22A 4LFAH 5D3IB 2AQ2B 4ISAA 1D5XC 2O1UA 2CVEA 1HNWQ 4EX5A 5CYUA 2FJ2A 1S16A 5LMNH 1RODA 1HJPA 1JMCA 4JYAH 5D65A 4KMUC 4IZKA 2MGSA 4FW3A 2C39B 1X3PA 4BA2I 2IT1A 2D0OA 3NWSA 5IP7G 2N88A 3L0OA 3A0JA 2B2WA 1LTID 2WP8B 5JEAF 4NXNQ 4MIUA 2DJFC 3J80C 2QEXA 4E6IA 4YHHH 1JB3A 1Z7TA 2QGQA 1ZTGA 2VZAA 2PQAA 5HURA 3A7AB 3GQBA 1E2WA 4QL5A 3K0XA 5TSSA 4B3RH 3NTHA 1SYBA 2ZJQA 3GTJH 3OETA 1BXTA 3T1HH 4IO9A 3CQZH 2IHFA 2K7VA 4MZ9A 4YCVA 2CH4A 2G5DA 1FWLA 1X56A 2PO1B 1ODHA 1CK1A 3STBC 2MP1A 1HR0H 3TREA 4B3MQ 2JA6G 3GLLA 4JBJA 3S1QB 4JI1L 4M1UB 1SMYC 4GKJL 2IHEA 4IJLA 5GROA 5K5PA 1K8GA 1J5EI 3BVZA 1J5EE 1VQBA 5ELEA 4PG3A 2V2QA 1FD7D 1VS0A 5A2QW 5I6YA 1I4HA 4JI3H 5KYLA 4HCEA 4P75A 1KVKA 2OPUA 3W3AA 3SK8A 2BA1D 1H7UA 2BH8A 5M3FB 3HOYH 4LF9I 4DV7I 4LF9E 1EIFA 4DV7E 3UDFA 4OO1H 1CZGA 1IKLA 4XQJA 3RZOB 1KXLA 1XPUA 3C2PA 4DNIA 1PZKD 3M85A 4OX9H 2OEOA 2M2LA 4LF8I 1MGSA 3NEMA 4DR5L 4URLA 3G4SA 4OGQC 4GQUA 4LF8E 3M7NG 4A93B 4LCFA 4IFDH 4IN3A 2E1RA 5CV5A 4X66L 4JBWA 3S24A 4FDBA 1HZBA 2NN6I 2UUCH 3D3RA 2NN6E 4B3TL 2ZTDA 2K5NA 4QQBX 3MZ5A 5K36H 1PFBA 2PW5A 1TVXA 2Z5BB 4LOMA 2PNZA 3GTKH 1TWHH 4A3KH 3OWFA 2CG9A 4O42A 2J4XA 5IGCA 4LF4Q 2CW0C 4K5WA 4A3BG 3VYUA 1SAPA 2ZTEA 3G7LA 4LF5I 1PRTD 4DV5L 4LF5E 5CV4A 4DV2H 1ZZJA 1KDCA 4KY6A 2BDOA 1SNDA 3MXNB 4FNFA 2IOPA 2CQOA 5JEAC 4DR4H 1OXSC 1VCIA 2BOSA 2NVQB 4N9PA 4A3FH 1K8OA 4X65I 2O5JC 1SDFA 1HFGA 5DM73 4X65E 1R4QB 1I3QH 2YTYA 4J8QA 3BDLA 3K85A 1Z6HA 3BYYB 3LWUA 4H44C 5K36G 4Y7NH 4DR5Q 4ZQ3A 4FW9A 3PIPA 4DUZI 4X66Q 1SXTA 3Q6SA 1QB5D 1U4LA 1GJXA 4DUZE 3DUZA 1PXUA 1SSOA 4B8TA 1CA6A 3ZJYC 1BDOA 3JAMi 2MJHA 3QO2A 2ZJRA 3PO3H 1GUOA 4DV1H 4KKUA 1GUGA 1L1OC 4LFBI 3OSOA 1PH6A 4HSPA 4HJ8A 1J8IA 4LFBE 4DR1H 1YHAA 4DUYL 3A8JE 1H95A 5C0XD 1HA6A 1A8VA 3UHMA 2EPBA 1Q8IA 1HA5A 3KLSX 4DV5Q 1PH9A 1ILPA 1TY2A 1JB7A 2JA6B 4DR7I 2BA0D 4A3JH 4DR7E 1QZRA 2JEBI 5DT9A 2L15A 3H3VH 1J5EL 3GTMB 3BU2A 2VQEH 4X64H 3K5LA 2NUCA 3S2HH 3P20A 1CQVA 4N3OA 5FKAC 4JVYA 3PV0A 1DOMA 2VXWA 2WP8A 1TWAB 2XSCA 3PO3G 4LF9L 1CSPA 1I4QA 4IPHA 3Q6MA 4DV7L 5IT9E 3RNUA 4GKKL 1E3HA 2K6AA 1VQNA 1VQ9A 4GOPB 3GTJB 2A5HA 2BA0A 1Q90A 1YITA 4LF8L 3CU7A 4CDEC 1QVFA 3PRYA 3HFZB 2EDGA 1XMQH 1CKOA 1PKPA 1BO0A 4C1NI 2JP1A 3ITPA 2PO1A 2ICIA 3Q1QA 5FWKA 3PCOB 3PIOA 2CZ9A 5JOBA 1FNMA 1USUA 4A3JG 1IBKI 2K03A 3I55A 4A3GG 2OXPA 3NHHA 1IBKE 4NZRM 4WORA 1IW7D 1LTBD 1WHRA 3PIP3 1NZ0A 1NTGA 1STEA 3S15B 4JBKA 1IZ6A 1SR3A 2Z5EA 4OHJA 2NN6F 4DV6H 4IUVA 1XTCD 4PNYA 3SEBA 1Y1WB 1HQMC 1EZ8A 1JWUD 3H91A 1Y8NB 3CP0A 4GZYC 1AE3A 2OQ0A 1J5EQ 1J5KA 3R3OA 4A3BB 4LF5L 3KJPA 1K0RA 2EYOA 4NPSA 2VUMG 1FWKA 1N34H 1G291 1HFNA 4HYMA 3OMCA 3X3NA 1YJ9A 3RN5A 3DLLA 3KRNA 4L6TB 2ZM6I 5ELCA 1PTOH 5M3MB 4YY3Q 2ZM6E 3NTKA 3RF2A 1HPCA 4FF1A 4L5QA 4LF9Q 3EIVA 3PYGA 2A6ED 2E3UA 4GKJH 2HDLA 1G6ZA 4NDXA 1U2RA 4NXMH 4C3JH 4K6DA 1PRTF 3SK6A 2F1MA 2R61A 4LF8Q 3PS2A 3J7AM 3F1ZA 3GTOB 2AWNA 5K36B 1VIHA 4DUZL 5FK9C 1EQQA 3OTOH 1H9SB 4RHRA 1O80A 2EJMA 1U9RA 3HOVH 3A56A 3I4MB 1I6HH 3OYYA 1EA6A 2JEAI 2UUBI 4L5TA 2UUAL 1FI4A 3CCSA 3D4JA 1TKWB 4BA1B 2UUBE 1ENAA 2H5XA 4UP9A 4JVZA 5GADC 1CUKA 3C1FA 1V8CA 3EVQA 2RBMA 3PGZA 4MHEA 3M4YA 3MXNA 4R1FA 3GP7A 1A0IA 2EY5A 4LF5Q 1N36H 2AE8A 2V2ZA 3AFPA 2EYFA 4C3JG 1I3QB 4DR7L 4QIWE 4A3DH 3D4RA 4XQQA 2PI2E 3V05A 3NSWA 1BOSA 4H7BA 5LMUH 2JA7B 1OYRA 1XNRI 5J1ZA 4BBRH 4FXDA 5C44B 2QKIC 1XNRE 1ICWA 2MPMA 4X65Q 1PDQA 1U4MA 4PQXA 1HNXH 1XWEA 3HOVG 3LNUA 3VDYA 2E5LL 2C38B 3HULA 1B7YB 1FNUA 3QIAA 1JJ2A 3EZJA 3HG9A 3FMCA 3IRBA 1TUAA 1ZM2A 4PRXA 1W6KA 4LFAI 2G9HD 2SOBA 4OONA 3L2PA 2EYMA 4LFAE 1X65A 3PO3B 2M6QA 4QGUA 3J7AF 3J81E 3K7AB 1E22A 2F03A 2CKZB 3ZM7A 1YBYA 4A3CH 4DGZA 1WOCA 4RHSA 3LPSA 2JZXA 1HK7A 4LFBQ 1RR9A 1IBKL 4A3DG 1JE5A 3NBIA 3PO2G 3GTQB 2NVTH 4A3JB 4WUBA 4BBRG 1ELOA 4A3GB 4JCVE 3HOWH 2XWBB 2EJGC 4K0KH 4YIJA 5HGQA 3S2HB 1AW7A 1OJ4A 2F3IA 4QNJA 3D8GA 4P74A 2K52A 4WANA 3NBHB 4DR7Q 2PNHA 1E2VA 3WU4A 3I4LA 5EJWA 3KF6A 1NSNS 2WW4A 2KA7A 1C0AA 1PRTC 2FMCA 2QNDA 1EY5A 2RDFA 2ANRA 1EU4A 4TQUS 5DNFA 1Y1VG 4LCHA 5AJ3Q 2PMZE 3RUZA 1C4QA 2WINB 3L7ZC 1DYQA 4G7HC 1HZAA 1CA5A 4A3CG 2ZM6L 2VUMB 2KEEA 2IX1A 3FVQA 4GOPA 1HH2P 1VQ5A 4A3IH 3FDTA 3T1YI 1WTOA 5IT9Q 3EBEA 1PH8A 4AQYH 3T1YE 3S17H 4HMJA 4EVOA 2V2VA 2G8YA 3V96A 3NP8A 4IS9A 3M7NA 4EQNA 4OO1D 3SR1A 2BCOA 2AUJD 3HOWG 4JOIC 4PMCA 4K2KA 2PO2B 4DV3I 2HUGA 4DV3E 5I9PA 4LFCL 3DHQA 4JV5I 4LMQD 1FYCA 4IFDD 4FJSA 1HCZA 2JJQA 5M5YH 2F0EA 4JV5E 5GAGC 1IBKQ 3VKEA 4GLXA 2UUBL 4RGOS 3SK4A 5IYDH 1B44D 1MI2A 4UP7A 2SNMA 1WD1A 4A4IA 3H6MA 2KQ3A 5JVG3 1EYAA 3AB9A 5IP9H 3VYRA 5IYBG 5C0XC 3BYTB 2D9IA 2Z5CA 2F0QA 4JI4H 4JW0A 3J80E 4OEMB 1A15A 5JVH3 2RCNA 3ZKBA 2EIFA 5GAHC 1WTJA 4GN4B 4HIOA 4JI7L 1WD0A 2CWFA 2O5IC 5DRQA 3I8ZA 2ZM6Q 4C3JB 5IT9C 2UXCI 1Q81C 1XNRL 4IUQA 2UXCE 3NELA 2B39A 3J7ZC 4DV2I 1Y8OB 5K36A 1UEKA 4JG4A 4DV2E 1H9SA 3HOVB 2KHJA 2JK8A 2IESA 2RA4A 1I6HB 1PHJA 4XDXA 3U1YA 1JOKA 3GDEA 4CJ0B 1X54A 1KIXA 3C3LA 1DT4A 4BA1A 3J81L 3DXJC 4HIMA 2FPHX 1N0VC 3W5OA 1KLUD 1QZHA 5C0XJ 1AZPA 2XEXA 4F87A 2ASBA 1CQFA 2HIVA 3S1MB 4G08A 4ZLTF 1UDNA 2PNMA 2NN6G 1OYSA 2BR2A 2EJFC 2HCCA 3DWAA 1Y4UA 4LF6I 5DEHA 4CJ2C 4LF6E 4G57A 4MNOA 2F0PA 1IW7C 3PO2B 1PZID 1B50A 1SE2A 2CTLA 4BBRB 2UXBH 2WAQE 5IGGA 2VQFI 1V1PB 2NTSA 2Z0SA 5GMEA 2VQFE 1P16A 1BVSA 4HJAA 2UUAH 2C38A 1IYUA 5A35A 2UU9H 1DGSA 2JT2A 3M9BA 4JI0L 1EOTA 1CHQD 4RG1A 1K8MA 2R6GA 2NZOA 1EY6A 3RLNA 4JI5H 2PO4A 3A7LA 4C3HH 1Y1VB 4NMZA 3J7A5 3QT8A 3CDJA 4DK6C 1MHWC 2A6EC 2F3VA 4IUUA 5ELNA 4HMIA 4LFAQ 1QVGA 1EFWA 3H3VI 4ZKBB 5C4HA 4LF7L 4IPDA 4X64I 2L5TA 3J81Q 4OIJA 1KHMA 3FEWX 4L63B 3J7AK 3I2ZA 3IFDA 5IT9W 2N55A 4OWWB 2EFGA 1LT6D 2NVTB 1MBYA 3DEPA 4WJ3M 1QJOA 1EY8A 2MUYA 4DV3L 2E5LH 3HOWB 1LTGD 5C4JB 1VQ8A 2LF0A 1WVLA 4JV5L 4G7ZC 5I6WA 4OELB 2J65A 4DAPA 4MU0A 3NBHA 3SGIA 3MHBA 2BV3A 3WWVA 2WNRB 4C1NK 1G6PA 1WUUA 4JI6L 4A3LH 4M8AA 2Z6KC 1JT8A 3RZOH 4C3HG 3D6WA 2PYKA 3J80L 4A93H 1Z0CA 3MXGA 4KY5A 2FMMA 3KLWA 2QDLA 1ICFB 1BBXC 1HR0Q 4X62H 1K83B 2F0TA 3KDFB 3UOEA 1JC7A 4YCWA 1WJJA 1K1GA 5CR3A 2Q2UA 2UXCL 5C3EH 4DR6H 1F2LA 4FF4A 3T1YQ 1PTOD 2HHHL 2PO2A 3KYHC 3HKMA 3J81C 1ZXTA 4R8IA 4RCOA 5KYIA 2UXDH 1VI7A 4YWLA 1BCPB 1YIJA 1XYIA 4RGTA 1O7ZA 1PZJD 2F0NA 5M5YB 1Y6ZA 2HK2A 1N34I 1N34E 4B3SH 1TY0A 4JI3Q 4DV3Q 2GVAA 4N8X1 1WE8A 1HXYD 3E0EA 4JV5Q 2D0PA 1KAWA 2HD3A 3J80c 3BDCA 3NENA 1CT1D 3D0FA 2MJ8A 3ERSX 2NVQH 4HJ7A 4NXMI 5IWAH 1G2TA 3OWEB 3P06A 2JYOA 3P3CA 3PYDA 3UDIA 2F0LA 4KHPH 4QB4A 4ZYSA 1EY7A 1FGBD 4NXNL 4LF6L 4O2DA 2NN6B 3GMEA 2V1CC 5C3EG 3M4OH 3J80Q 2LMCB 3MAQA 2UUCQ 2CTFA 3T53B 4LFCH 1KNAA 4N8FA 1RD9D 2WACA 1XRHA 3C1EA 1TXYA 1D1IA 2BDNA 4RAUC 4JVHA 4I65A 2VQFL 1K3RA 1L0WA 4DV0H 2YTVA 2WB1E 1AP0A 4H02A 1B9NA 2X69A 4DN4M 3U9SA 2B2YA 3ERQA 1TU2B 4ME5A 1PYBA 4DR2I 4EQOA 2P5ZX 2PNRC 3P3EA 4DV2Q 4DR2E 2E2JH 4R8NA 2NB0A 4ILWA 1YHBA 2F0OA 3NQIA 1IBMH 2F0VA 2G9DA 4BY1H 4ZKCB 1VQLA 2V8PA 5LMUI 5FLXE 4DR4Q 2HCIA 4DU7A 5LMUE 2HQEA 3HOZB 1N33I 5JJLA 1N33E 2RHSB 4OO1C 2JA6H 3QB3A 3LGJA 4PU9A 1RJTA 4JI8I 1JORA 3GTMH 4B8CD 1RTNA 4JI8E 1E3PA 1EEFD 3J81W 4IFDC 4PZ6A 1KNEA 1CHPD 1A62A 2K75A 4NBQA 4LF6Q 1V1PA 1TWAH 4RCNA 2GA4B 4BY7G 2XGTA 1DZ1A 2MO1A 4V0BA 4XIGS 1JJGA 1KDAA 3ZZTA 3AYHB 1WFQA 1LACA 2NZHA 5G3LF 3J7AV 1SFOH 2LSSA 2VQFQ 2Z6BA 5IOCA 2E74C 3GTGB 1O7LA 3G48A 4BY1G 3A5ZB 4C3HB 1B3AA 3HGBA 1N32H 2D62A 2FXQA 5NUCA 3CCLA 1FVIA 1S4EA 1NJIC 1VQKA 1SJHD 3OW7A 2ALYB 3SK5A 5IGDA 1VQOA 4LF4L 2JEBB 2LJPA 3M85D 1AN8A 2VL6A 2B63H 5CMDA 1JOOA 2AWOA 1LTSD 3DMUA 5DROA 2R93G 1ZKOA 3S15H 5BR8H 4IFDJ 4X64Q 1EZ6A 2WKDA 2BM1A 2ZITA 1UE7A 3RN2A 4RGNA 1Y1WH 1UEAB 4XYQA 1VF7A 4YY3I 5BN3A 1XPRA 4A3BH 4YY3E 4UP8A 3WU5A 5KRUA 4LWCA 2R92G 1C9OA 2A19A 4R4CA 2WNRA 3M4PA 2OPVA 1OTCA 1MSGA 3QJYA 5M3MH 1PA6A 2J7KA 3RMHA 2C5CA 3C46A 4LF7H 3TZUA 1R9TB 1XMQQ 4HIDA 4JI2I 4NKLA 1CTMA 3NTIA 4JI2E 2A69D 2B2TA 2A1AA 2B63G 3VYSA 1ZXMA 1G8ZD 2XNAC 4DK0A 3KDFA 2X6GA 1N8RC 3E9IA 4XT1B 2F0UA 2KBNA 1A2UA 2SNSA 2JVZA 5EQ0A 3J7YW 3GTOH 5C3EB 1E7ZA 1PFSA 4YWMA 2R3VA 1VQ4A 2A6HD 1Y1WG 2EY2A 5ELWA 3J80W 1VMPA 1S72A 3I4MH 1S5CD 2IJ0A 3H3VC 1ML0D 4JI6H 4DPGA 2YV5A 1DONA 2V34A 5CORA 1B9MA 2M8WA 5M3MG 2QEJC 2R42A 1J9OA 1GHKA 2HKEA 1N34Q 3HOXH 1XNQH 3EFXD 4QCLA 4LUOA 2NBFA 4LF7I 1ENCA 1NNXA 1OXXK 1N33L 5DRPA 1H9JA 2ID0A 2GO3A 2RCFA 3HRZC 2A68D 1HZCA 3H4LA 2GQ0A 4JI8L 2NN6A 2HHHH 2JA7H 4HJ5A 3GKUA 4NXMQ 3M4OB 1NBWA 1NCVA 5C44H 3ND9A 1MJEA 3U50C 3I72A 3I4MG 1QOHA 1RDPD 2SDFA 2F0GA 3HKZE 1LTTD 2JEAB 3I0PA 3G6EA 1EY0A 1HNWH 1JWMD 3PF5A 2ZXRA 3DD6A 3OHXC 5FLMH 4BY7B 3I91A 5CBAE 2Q2EB 2KCMA 2F0MA 3K7AH 1Z47A 3HOXG 1AH9A 2E2JB 1P42A 1VQ7A 1SLJA 4YWKA 1K73C 2DNEA 1I94I 3W1BA 4BY1B 2DJGC 1DCZA 2YU9B 1I94E 1IBLI 1Y8PB 1IBLE 4NXNH 1NR2A 4GNXB 4Q5VA 4DR2Q 1HUNA 2ICEC 3EJIA 4EQPA 2EY6A 3JC66 3ULLA 3GTQH 1SYCA 2JA7G 5C0XI 4DR2H 4KD3A 1HNZI 4A3GH 5C44G 1MG7A 5C0XE 2C39A 1PTOC 3QWNA 1HNZE 5FLXQ 3CC2A 1DTJA 5LMUQ 3X3MA 4IOCA 3E6ZX 1VQJA 1N33Q 1K28A 2X7IA 4DU8A 3AMUA 2R93B 3UDGA 4POFA 2KUMA 1STGA 1SEIA 4JI8Q 4YY3L 1XMOI 1F2MA 4B3MH 1G91A 1XMOE 5FLMG 4DR3H 4U3DA 1FKAE 2WKCA 1KRSA 4R4TA 4Z9CB 1O7YA 2OTLA 4HCSA 2B2VA 1SFOB 2VUMH 2R92B 2CPQA 3CRKC 4EMDA 3VR6A 2L55A 1IXRA 1KTKA 4WUDA 3WOFA 1D1KA 4DXLA 4BBSH 2NVXB 3H0GG 1EY9A 1VQPA 1F9PA 2WAQG 2NPFA 1Z2IA 4TRDA 1GUNA 2I5HA 3VA5A 1X3GA 2JEBA 2B63B 4O0AA 2CPMA 2K5HA 5C4ZA 2K4KA 1R6LA 2X6LA 2B8FA 2ATWA 1CKNB 3G6JB 3D4DA 1ZZIA 1XXGA 1KC8C 5M9OA 2ZTCA 2QCPX 1WCMG 3URYA 5EBDA 5DRRA 3ND8A 4KKTA 1YJWA 3Q24A 3KOJA 2K33A 5FLXC 4LFCE 1O7IA 1Z0VA 4C3IG 2PMZB 2B2WC 3AFQA 4DAMA 1Q82C 5AFWA 2KHIA 2F1DA 4MQYA 4X62I 2BM0A 2YQRA 4X62E 3DEOA 1HHVA 1PH4A 4JI1H 1A3TA 1SYFA 5CBEE 5E4XA 3I7FA 4X65L 2B29A 4BBSG 4AQYQ 1GUWA 4LF4H 1S5DD 5JEAG 2L11A 1SE8A 2NWGA 2RF4A 4DAYB 4QMFB 4PMBA 4RGMA 2F4VI 4PV1C 2F4VE 1DARA 4ZCKA 3K6OA 3CW2C 4X3UA 3V2UC 1JQYD 3OIQA 4JI2Q 1STBA 2RSNA 3WDNA 2FFMA 4IUNA 3V69A 3T56B 2Z5BA 1FJGI 1PLFA 2EE1A 1FJGE 3LNNA 3S2DH 1EU3A 1SE4A 1D5ZC 5IE8A 4UPAA 1QCBD 4IZ8A 4P2CB 4LFBL 2GS8A 3GTPB 1PYWD 2CWAA 4X3KA 3Q22A 4DPXA 4DR5H 1EIHA 3A5UA 4C2MH 3S1MH 3HOXB 1I94L 1TS4A 3NWTA 4X66H 3RZDB 1IBLL 4DV4I 5JAVA 4DV4E 2MFIA 3QOJA 1G2SA 2LTLA 5D14A 4FWDA 2E2IB 4B3TH 1HNZL 4DV0I 2YTXA 3CF5A 3PO2H 4DV0E 4UY8C 4RFBA 2IW3A 1V1OA 2KEDA 3HJCA 2B2TC 1QWYA 5AJ3L 1YJNA 1Y5YA 5C0XF 4WJWA 3F2UA 4MU3A 4LAAA 5FLXW 3P3GA 1X9NA 3E0JA 4LUVA 4ZUIA 2PY9A 3AEVB 1XMOL 4DV5H 3CCUA 5IT9L 1ZZKA 3ZZ0A 2ZXPA 1RREA 4K6LA 3J81i 5LMNI 3KBGA 1Y1VH 5LMNE 4JYAI 1VQIA 5D3DA 3CMAA 4JYAE 5DAUA 1QE6A 4P73A 1VF5C 3TDQA 1SBBB 4TVAB 3CCVA 2EY1A 3DM1A 2VW9A 2RDHA 1JWSD 3P76A 4J3DA 4BWGB 1CFMA 1B3QA 1EOVA 3MFYA 5DM63 1MU5A 3Q8DA 4GNXA 3QG1A 2PI2A 4K8IA 3H0GB 2PO0B 2LS01 4POGA 4YHHI 2OCEA 2WAQB 1I94Q 5IY0A 4YHHE 2CTEA 5C4JH 5L3JA 1IBLQ 2A6HC 2WB1G 4ULLA 5EKWA 4JK1C 1FL0A 1K47A 2KOLA 3M7ND 4L5SA 2O3ZA 4B3RI 4USKA 2EVBA 4B3RE 1EFID 3A8KE 2K28A 3FKIG 5IT9c 1HNZQ 1WCMB 3T1HI 2CQAA 2UU9Q 2KJXA 3T1HE 4JC0A 4DUYH 2OF1A 3A55A 1HR0I 5EPKA 4C3IB 1B63A 3HS0C 1VQFA 1HR0E 3TZDA 3FP9A 4MTKA 5L37A 5KNCA 1QUQB 1MD2D 1STNA 4PRVA 5IYBH 1VISA 1OXTA 1XMOQ 3VR3A 2CTJA 3GD7A 1RIPA 1K83H 2A68C 2JA9A 3R93A 1KLGD 2E2DC 2F4VL 4HR7B 4BBSB 1J5EH 1LLRD 3PUVA 3ULPA 5JEAB 1V43A 4DXFA 4JI3I 5FO7B 2IOQA 3CXCA 3AQQA 4K5XA 1T5EA 1NHJA 4JI3E 4WRDA 4WUCA 5I9OA 4DNTB 1CKNA 1FJGL 3K57A 4OO1I 3G71A 4OO1E 4LF9H 1BNZA 4DV7H 4GKKH 2AJ4A 4OX9I 1E1OA 4LK1C 4OX9E 4JPBW 4A3MG 1W6JA 1PVOA 5K36D 4IFDI 1M90C 4IFDE 1UDOA 2LRRA 1EYCA 2OT2A 1QNUA 4LF8H 1VQMA 3JAMC 1CKMA 3K59A 4FXGC 3J80i 1G51A 2UUCI 2UUCE 4DV4L 1L1OB 1C48A 3BZDB 4WALA 5K36E 3ONAB 1YVCA 2NN6H 1HUMA 1SNPA 5JPNC 3KJOA 1IL2A 1MKHA 3H1CA 3HKSA 2MO0A 3T4AC 4X62Q 4DAYA 4MDTA 2JQOA 1NHIA 2DY7A 4AIDA 1A3VA 3T16A 4IZJB 4PZ7A 3M6AA 2N78A 2YYZA 1JCKB 3VYTA 4BA1I 1ILQA 3TEHB 2PPBC 5DNLA 2F4VQ 1ZXNA 2UXDQ 3E9HA 2KVMA 4P7AA 1E0BA 4LF5H 1EC6A 2BH2A 3S2DB 1F0XA 1Y14B 1RHPA 2M00A 4B3SQ 4LFAL 4BXXG 4DR4I 3KBXA 4DR4E 5CV9A 4FVMA 1XJVA 2BA1G 5LMNL 2WP8J 4A3EH 1FJGQ 4JYAL 4RKLA 3D6CA 1LYLA 2RQXA 1YZ6A 4C2MB 1UNSA 1K8AC 2AQ3B 3HOZH 5IGBA 1H9KA 1X6OA 3PUWA 3LX0A 4XT3B 2ZQEA 2GN5A 3K5MA 1M4VA 3K0YA 4YHHL 4DUZH 4J15A 2K5QA 4DV4Q 4L5RC 4CDDC 2TSSA 4DV1I 2KCTA 3B78A 1OXVA 4DV1E 2NZ1D 1X9ZA 2WB1B 3PUZA 4FP5D 4IQZA 4DR1I 2LFNA 4DR1E 3V5RA 1PH1A 4DV0Q 3K17A 3T1HL 4LFBH 5M5WB 1EQRA 3ZYYX 3AEVA 1CI3M 3FKIB 1ET9A 3J81c 4OD6A 4EC5A 4A3EG 1HR0L 3GTGH 3GR5A 4ZUJA 4F8MA 1LTLA 1S4ZA 2JA5G 2R3ZA 3S1RH 3MFGA 3HOZG 2EXZA 2VY3A 1IBMQ 3T1YL 3F0NA 4KTAA 1JR0D 3BJUA 3TP7A 1TS5A 4GLVB 2VQEI 1EWIA 4DR7H 3CCQA 2VQEE 4X64E 3VR5A 5LMNQ 5HY6A 5LHY1 2HK3A 5C4XH 2D2CC 4JYAQ 1ET6A 4BA2B 1SYEA 4UDUC 1VBIA 1GOZA 1NMGA 3HKZG 4JI3L 2PO0A 2MHVA 1WTPA 3A54A 4HSVA 1E2ZA 1TR5A 1JICA 1T5XD 4OIKA 2RSOA 2C9OA 2HKJA 4YHHQ 4OX9L 4DXGA 2D9UA 2E2HH 1B2TA 2QF7A 4J6HA 1WTWA 1XMQI 4OO1F 4IPCA 1XMQE 4FXKC 2D5DA 1N9WA 3SDZA 1QILA 2AXYA 4A3MB 4B3RQ 1V1QA 4KK7A 3I4NB 1NR4A 4UT4A 5EPLA 4KHVA 1R9TH 4R1JA 2EQSA 2UUCL 2M9VA 1QUQA 1O78A 3T1HQ 3B4TA 4IFDF 1DOLA 3CCMA 2E76C 2RHQB 3TP8A 5C0XG 4FW6A 1IBKH 5COYA 5C4XG 1ZM9A 4DV6I 2I46A 1WTVA 2O4XA 4DV6E 1CSQA 1ESRA 5JEAA 1KIJA 1D2BA 5K36F 2KCNA 4LW1A 3J7AG 1XPOA 2DN8A 2JE6I 4H8AA 4QY7A 4DV2L 1F77A 3FPUB 5E1FA 2DY8A 3TSSA 1EYDA 5GAEC 1Z5CA 3LTOA 3U58A 2BE5D 4KN4C 4DR4L 2VNUD 2L12A 1I50H 2A2CA 1RKNA 3OIPA 4KN7C 4U68A 3TMEA 4GKJI 2ZM6H 4GKJE 2Y0SE 3PYEA 1SNCA 4DPUA 2EXDA 2K14A 4NXME 4OX9Q 4Z7YA 4RKBA 4MTNA 1NHHA 3MXPA 4U3BA 3GTLH 1L1OA 2IX3A 1QZGA 1BBUA 4FW4A 4RA8A 3OTOI 4YCUA 4GOPC 3OTOE 3CCRA 1WTQA 3W2DA 4C56C 4N9TA 4QJFA 2C37B 2MQHA 1MSZA 2HIXA 1UUPA 4DV1L 1SEBD 1WTXA 4IURA 1D6EC 1YNJD 4HJ9A 4DR1L 1I4PA 2XRSD 2UUBH 1FNVA 1VQHA 2PNLA 3QOLA 1J6QA 2C35B 1W3SA 4BS9A 1V9NA 1L0YB 1LM0A 2DEIA 4BY7H 3SHLA 1NUCA 5CV8A 4RPFA 3TP5A 1N36I 2F0SA 1BF4A 1N36E 1QNKA 3DWQA 4A3EB 4GN5A 4B3TI 1LT4D 2YU9H 1PRTB 4KKSA 4DAVA 1IL8A 2F0JA 5T1GA 2FFKB 2JA5B 1X4NA 2N8NA 4X3SA 3QT5A 4WJ4A 2HFSA 4JI7H 2K1BA 2VQEL 4X64L 2FMRA 4K14A 5J3BA 3T51B 5EL9A 2WIIB 2OI2A 3L7ZB 5A2QC 1HNXI 1XNRH 1HNXE 1KAAA 3MTSA 4ZAIA 2XN9C 3V2TA 2ZBKB 1R6MA 5LMNW 3KLRA 3HKZB 2R93H 1UG8A 5I2XA 5EKLA 4AYBE 3BZCA 4R4QA 2CFMA 1XHKA 1ZYRD 3S1NB 3BVMA 3FHWA 1FGUA 4LPFA 1RTOA 1S3OA 1XMQL 5K36C 2F0IA 3DM3A 3SE0A 3S14B 4DV1Q 2DUDA 2Z8LA 2R92H 4DR1Q 4I7ZC 4HTHA 3Q0AA 1TWFH 3ZKDA 4HEDA 3S1RB 2VB2X 4PMWA 3J81j 1PV4A 4JBMA 5FJ8G 2F4IA 2HDMA 2NVXH 4AH6A 4K0KI 3NPPA 5C0XB 4K0KE 4DV6L 1IHZA 4QMGA 1Q86C 2VS1A 5C4XB 1WYDA 2K05A 4BA2A 4LUZA 1GHJA 4CHTB 1HR0W 4B9XA 1VQCA 1STAA 3I70A 2VQEQ 4DUYI 1U5KA 1A6XA 5M5XB 4DUYE 1PFNA 1IYJB 2Q8RE 1N34L 1X3QA 5CGKA 4JI0H 4EQ5A 4DFAA 2CWHA 4IALA 2JSOA 1UE6A 1D8LA 3QT6A 2E2HB 4DR3Q 4AQYI 4AQYE 2A2DA 4E9JA 1BCPD 2F0KA 1PTOF 2OTJA 3T1YH 4NXML 2P2RA 2L0CA 4Z7CA 5EAYA 3MVVA 1A3UA 1E1TA 1PMRA 2KECA 2RVLA 5CC4A 3CCJA 3OTOL 5BN5A 1SYDA 4DV3H 3TRZA 2LY7A 4FF2A 2VKCA 3I73A 1H9RA 2HH3A 3CAMA 3CWVA 4GKKI 3KFUA 4JV5H 4GKKE 5LL6b 1YEZA 1B53A 2XRQD 2K32A 4CJ1B 2E8GA 1DXMA 3L3OC 3EQLC 3B6YA 4DV6Q 2NN6D 3BVGA 5EPJA 4JI4I 1Z9FA 1LUZA 1Q3LA 4JI4E 2K01A 3GTPH 1I50B 1LT3D 4K8JA 3RD4A 4DPWA 2JN4A 4DR2L 1N36L 1UDQA 4LCGA 4H13C 5ELBA 2GVBA 3MA2B 3M4QA 3S16H 5FLXL 3RZDH 2BA1A 1C7YA 5E7NA 5LMUL 2VESA 1F2ZA 2Z9HA 3CPFA 3M3YH 4JI1Q 3I56A 3VR4A 4GKJQ 2E2IH 1KABA 5KNDA 3GTLB 1HNXL 2UXCH 3QR8A 1I4RA 3HOYG 3GONA 3D4WA 5ELFA 2DGYA 2EYHA 4ZVIA 1YHQA 1GUSA 4OO1G 1OO9B 2C37A 2K5VA 4X3TA 1VIGA 1USVA 2O2LD 2V4DA 1GUTA 2BL5A 2NYZD 3OTOQ 4EGVA 2XIWA 4IUTA 2N49A 5BN4A 5HGTA 4OKGA 4IFDG 1UE5A 3CRLC 3EROA 4KI0A 3F8TA 3F2BA 2KCCA 1KQSA 2DEJA 2LXKA 2R7FA 3CHBD 3BG3A 3D31A 3LWEA 1V8QA 3F2CA 5GQOA 4CBVA 4IUPA 2ES2A 5FLXc 3PS1A 3UDXA 1AN7A 4A3KG 1VQEA 4LF6H 3AU7A 1EY4A 1PH3A 4QIWB 1D6TA 4K0KL 2UXBI 3I3CA 3MXUA 1N36Q 4LNQA 4FJUA 2UXBE 5F2DA 1EQTA 1S5ED 3H0GH 4KY7A 2VF3A 4FWGA 4F7XA 3L7ZA 4B3TQ 2UUAI 1SYGA 4PZ8A 3JAME 2UUAE 2UU9I 3QT7A 1N0UA 1R4PB 1A6FA 2VQFH 2UU9E 2J7ZA 2O4CA 4MYTA 1KHIA 4OCHA 1L0XB 2RKSA 5C3WA 2NTTA 1HNXQ 2BE5C 1S5BD 5JEAJ 1WCMH 4A3FG 4JI5I 1MJCA 1X32A 4JI5E 2I0QA 1RL2A 5EKKA 4JOIA 3P1HA 3IAYA 2DGRA 1GXDC 4NZTM 2I5MX 4AQYL 4C3IH 1T9HA 3K58A 1ENFA 2J0TD 1K9MC 1Y4SA 1TWFB 2B2YC 4HIKA 1XX8A 4FW5A 3I90A 1PH5A 4GS3A 3CD6A 2SEBD 1JJCB 4JI2L 2E5LI 3ULJA 2B2UA 2E5LE 3KF6B 3B82A 1VQDA 3NQTA 2QDBA 5JEAH 1Q8KA 2PCFB 1AEXA 1KDBA 4CDFC 5C0XA 1AZQA 2ZT9C 5FO8B 3M7GA 3WU3A 5DNXA 1H74A 1YNJC 1BCPF 1LTAD 3K80C 1KD1C 2A74C 4K0KQ 1FR3A 3I4OA 1TIID 2FHTA 1EQVA 2QILA 3CQZB 4KJNA 3K81C 2K5DA 3HEJA 1ONLA 3OSSD 1II3A 4JI4L 4I3HA 1EWHA 4MU4A 3CDIA 2LXJA 2H1EA 1M1KC 3ZZUA 2A1SA 4ID6A 4DUYQ 3PF4A 1VQ6A 4O1NA 3H09A 4DPTA 2CCZA 4RMFA 1EL0A 2ENBA 2ZXOA 3GO5A 1JOQA 1TWCH 3CKIB 4TKOB 3R2TA 3CCEA 4DR6E 4DR6I 1KL9A 1VDZA 1H73A 4LIJA 5FO9B 1I4GA 3KK7A 2UXDI 2K5WA 3WOEA 3HOUH 1Z5AA 2UXDE 2HH2A 4OWXB 4B3SI 2F0WA 3A8IE 3TS0A 4B3SE 3HOYB 2AQ1B 2NVYH 1EEID 1JE4A 2Z5CB 3NE5B 4OO1B 4L8JA 2LTMA 3T13A 1NE3A 2L1BA 1RCVD 1ZYRC 4QUFA 3FRPB 1XXEA 3EN2A 1VQGA 3PQIA 4DV7Q 4GKKQ 5H1SE 5IWAI 5IWAE 4IFDB 5E3FA 1SROA 2CGEA 3MWYW 1Z0TA 1Z5BA 1KRTA 4TSSA 4KHPI 5IGEA 1S5FD 2F52A 4KHPE 1HZ9A 3PSIA 2IX0A 4ALPA 5KNBA 5KIXA 3Q6NA 4JI4Q 1U4RA 3S16B 4LFCI 5CV7A 4FF3A 4H0LC 4CKBA 4DK1A 4A76A 1B62A 2PQEA 3M3YB 1TWGH 1TWHB 3BS1A 3GTKB 3Q23A 4LJZC 4A3KB 2UXBL 3HOUG 2IY5B 3JAML 4Y52H 1BBWA 2Z4IA 4XXEA 1I6VC 2UU9L 3TQYA 3FAUA 1Q12A 1STYA 4RWSC 1XTDA 4NW2A 3HP3A 3KUPA 4ED4A 1RHYA 4JI5L 1ZM3A 3IL8A 5M5WH 2F0FA 2JEAA 1IBMI 2BR2B 1J4WA 1ESFA 2Y0SG 1MIUA 3FKIH 1IBME 1EIGA 2F0DA 4QF4A 3PIO3 4B9WA 4A3FB 5JJIA 1AFPA 2K50A 4XQNA 4JI7I 3E5SA 1Z0WA 4JI7E 4CGYB 1BCPC 3N52A 4KHZA 1W2BA 3KF8B 4ODGA 2AHOB 3L9AX 2L4NA 1N33H 3NUCA 4Y7NB 2O1WA 4KD4A 1U0LA 1RF2D 2IL8A 2JA8H 3PS3A 2A69C 2H4OA 4CKCA 4DU9A 4ZK9B 4DPYA 4FO2A 4K2LA 5FOBB 4FN5A 4JI8H 2CH4W 2Z6KA 4F88A 5EBCA 3JAMc 3H15A 4AM3A 4JG2A 4P71A 1DOKA 1BKNA 1GVPA 2OWOA 2K04A 2Y3MA 2CTKA 2X36A 4IOAA 4DUZQ 2JXMB 2Q8IB 5ELOA 2UXBQ 1OXUA 2NN6C 3B8HA 3KDGA 3JAMQ 3NK9A 2R7ZH 2UUAQ 3VR2A 2IWHA 1KTVA 1N32I 1D5MC 1AE2A 4HAEA 1H7SA 1N32E 2WV6D 4HXZA 3MC0B 1K3BC 1D7QA 4A3MH 1SNOA 3FPPA 4OXPA 3I4NH 4X62L 1S03G 4JI5Q 2E75C 1I4XA 2JA8G 4DR6L 3E3XA 4HN7A 3ICEA 4MYUA 2KHSA 5BR8I 3PUXA 5DLQE 4G7OC 5BR8E 1H9MA 5IIFA 2UXDL 1A63A 1STHA 4AYBG 4KLKA 5I2YA 4B3SL 1YNND 4JI0I 4JI0E 3HZXA 1I6UA 4P52A 2HT1A 3GV6A 3RR5A 1Q46A 2E5LQ 1CM9A 1X4MA 3OOCA 4YY3H 1EYGA 2PZTA 2R7ZG 1EI1A 1TT2A 5CV6A 5J39A 5A2QE 1L2FA 1UDSA 1F2YA 4APVA 5IWAL 2EYLA 2QW7A 1ZEQX 4J1MA 2I5LX 3TN2A 4BXXH 4HACB 3K1JA 4LF7E 4FYDA 4IPGA 3W1GA 5KGUA 3I4NG 4R4OA 3K5OA 3CMEA 4KHPL 5ELDA 4R9WA 4NP5A 1WTRA 2L9HA 4OZEA 5KEEA 3SXHA 4JI2H 1F9QA 1B8AA 1KKHA 2B2VC 1TWCB 1VMCA 3NZKA 4JI6E 4DV0L 2PW7A 2PZUA 3CC7A 5JJZA 1BKBA 1P8LA 3HOUB 2A73B 3SB1A 3M85G 1YHCA 2JE6B 2B2UC 4JI6I 4DR6Q 4GN3B 4CDCC 1PH7A 5JJKA 1PIEA 2NVYB 2PQUA
chains in the Genus database with same CATH topology
2OQKA 4OO1A 4A3IG 2Q2IA 1SRUA 1IBML 1X3EA 4X6AH 3STBD 3TS2A 2A8VA 4IFDA 1UWVA 3RLFA 2JA5H 5IWAQ 3U1KA 4OWTB 2R7DA 3UE1A 1I5FA 4KHPQ 1Q1EA 4P72A 5IYDG 1E24A 4NB3A 2HQLA 5IP9G 3U4ZA 3F2DA 4LFCQ 1YNXA 4B3RL 3S1NH 2UUBQ 4XTCS 3S14H 1N32L 2ZJPA 2CTMA 3MEFA 2MNAA 3PUYA 1V9PA 2WFWA 3OW2A 1YI2A 2Q2HA 1WI5A 5BR8L 4JI7Q 1B70B 2ANNA 2PQAB 1PH2A 1XNRQ 5M5XH 1GKHA 5JEAD 2Q2TA 3S1QH 3K8AA 4AIMA 3UE0A 5JEAE 1S40A 1GM5A 1N32Q 3CPWA 1QVCA 2AKWB 1NMFA 2N3SA 5M3FH 3CC4A 4DKAC 4ME3A 2BA0G 2AMCB 1Q7YC 4GNXC 5BR8Q 3GCMA 4JI0Q 1XNQL 1UEBA 1SN8A 1ASYA 1UE1A 2CWPA 1X3FA 2XTIA 1VQAA 2PNZB 4LF7Q 2B3GA 1NY4A 1X55A 4DK3C 1OYPA 5M3FG 3BZKA 1EUJA 2KENA 4A3LG 1HNWL 5IYCH 2JE6A 4A93G 4A75A 4IJHA 1ASZA 3ER0A 1Q1BA 3A74A 1GD7A 3K7UC 4JI6Q 1SMXA 4R4IA 1EIYB 1WVNA 4GLAC 1XNQQ 3RLOA 5IP7H 2QA4A 5FJ8H 3U4VA 1PYSB 1GO3E 2UXCQ 2HHHQ 4B3ML 5IYCG 4DR3L 1HNWQ 4EX5A 1HJPA 1JMCA 2C39B 4BA2I 2IT1A 2D0OA 5IP7G 3L0OA 3A0JA 5JEAF 2WP8B 4NXNQ 2QEXA 2QGQA 1ZTGA 2VZAA 2PQAA 4QL5A 3K0XA 2ZJQA 3GTJH 4IO9A 3CQZH 2IHFA 4MZ9A 4YCVA 1X56A 2PO1B 3STBC 3TREA 4B3MQ 2JA6G 3GLLA 4JBJA 4JI1L 4GKJL 2IHEA 4IJLA 5GROA 1K8GA 1VQBA 4PG3A 1VS0A 4P75A 2OPUA 2BA1D 2BH8A 3HOYH 1EIFA 3UDFA 1KXLA 1XPUA 4DNIA 3M85A 4DR5L 3NEMA 3G4SA 3M7NG 4X66L 4JBWA 3S24A 4FDBA 1HZBA 2NN6I 2NN6E 4B3TL 2ZTDA 2K5NA 4QQBX 2PNZA 3GTKH 1TWHH 4A3KH 4LF4Q 4A3BG 2ZTEA 4DV5L 1ZZJA 3MXNB 2CQOA 5JEAC 1OXSC 1VCIA 4A3FH 1I3QH 2YTYA 5K36G 4Y7NH 4DR5Q 3PIPA 4X66Q 4B8TA 3ZJYC 3JAMi 2MJHA 2ZJRA 3PO3H 1L1OC 1PH6A 4HJ8A 1YHAA 4DUYL 1H95A 5C0XD 1A8VA 1PH9A 4DV5Q 1JB7A 2BA0D 4A3JH 2JEBI 2L15A 3H3VH 1J5EL 3BU2A 3S2HH 4JVYA 3PV0A 2WP8A 3PO3G 4LF9L 1CSPA 4IPHA 4DV7L 4GKKL 3RNUA 1E3HA 1VQNA 1VQ9A 4GOPB 2BA0A 1YITA 4LF8L 1QVFA 3HFZB 1CKOA 2PO1A 3PCOB 3PIOA 4A3JG 3I55A 4A3GG 1NTGA 4JBKA 1IZ6A 1SR3A 2NN6F 3CP0A 1AE3A 2OQ0A 1J5EQ 1J5KA 4LF5L 3KJPA 1K0RA 4NPSA 2VUMG 1G291 1YJ9A 3RN5A 3DLLA 3KRNA 4YY3Q 4L5QA 4LF9Q 3EIVA 2E3UA 4C3JH 4LF8Q 3F1ZA 2AWNA 5K36B 1VIHA 4DUZL 1EQQA 3HOVH 1I6HH 3OYYA 2JEAI 4L5TA 2UUAL 3CCSA 4BA1B 2H5XA 4UP9A 5GADC 1CUKA 3PGZA 1A0IA 4LF5Q 3AFPA 4DR7L 4QIWE 4A3DH 2PI2E 1OYRA 4BBRH 4X65Q 3HOVG 3VDYA 2E5LL 2C38B 1B7YB 1JJ2A 3IRBA 1TUAA 4OONA 3L2PA 1X65A 4QGUA 1E22A 2CKZB 1YBYA 4A3CH 1WOCA 2JZXA 4LFBQ 1IBKL 4A3DG 1JE5A 3PO2G 2NVTH 4BBRG 4JCVE 3HOWH 5HGQA 2F3IA 4P74A 2K52A 4WANA 3NBHB 4DR7Q 2PNHA 3KF6A 1C0AA 2QNDA 2ANRA 4TQUS 1Y1VG 5AJ3Q 2PMZE 3L7ZC 4A3CG 1HZAA 2ZM6L 2IX1A 4GOPA 1HH2P 1VQ5A 4A3IH 3EBEA 1PH8A 3S17H 3M7NA 4OO1D 3HOWG 4JOIC 2PO2B 4LFCL 4IFDD 2JJQA 5M5YH 5GAGC 1IBKQ 3VKEA 4GLXA 2UUBL 5IYDH 4UP7A 4A4IA 5IP9H 5IYBG 5C0XC 2RCNA 2EIFA 5GAHC 4GN4B 4HIOA 4JI7L 2ZM6Q 1Q81C 1XNRL 3NELA 3J7ZC 5K36A 2KHJA 2JK8A 1PHJA 3GDEA 1X54A 1KIXA 1DT4A 4BA1A 4HIMA 3W5OA 1QZHA 5C0XJ 2ASBA 2HIVA 1UDNA 2NN6G 1OYSA 2BR2A 4MNOA 2CTLA 2WAQE 2Z0SA 1P16A 1BVSA 4HJAA 2C38A 1DGSA 3M9BA 4JI0L 4RG1A 2R6GA 2NZOA 3RLNA 4C3HH 3J7A5 3CDJA 4DK6C 4LFAQ 1QVGA 5ELNA 3H3VI 1EFWA 4LF7L 4IPDA 1KHMA 3I2ZA 4OWWB 4WJ3M 4DV3L 1VQ8A 4JV5L 3SGIA 3WWVA 2WNRB 1G6PA 4JI6L 4A3LH 2Z6KC 1JT8A 3RZOH 4A93H 3KLWA 1HR0Q 3KDFB 4YCWA 1WJJA 1K1GA 2Q2UA 2UXCL 5C3EH 3T1YQ 2HHHL 2PO2A 3KYHC 3HKMA 4YWLA 1YIJA 4JI3Q 4DV3Q 2GVAA 1WE8A 3E0EA 4JV5Q 2D0PA 1KAWA 3J80c 3NENA 3D0FA 3ERSX 2NVQH 4HJ7A 3UDIA 4LF6L 2NN6B 4NXNL 4O2DA 3GMEA 2V1CC 5C3EG 3M4OH 2UUCQ 2CTFA 4JVHA 1TXYA 2VQFL 1K3RA 1L0WA 2YTVA 2WB1E 4H02A 1PYBA 4DV2Q 2E2JH 1YHBA 4BY1H 1VQLA 4DR4Q 5JJLA 2RHSB 4OO1C 2JA6H 3LGJA 3GTMH 1E3PA 4IFDC 4PZ6A 1A62A 2K75A 4NBQA 4LF6Q 1TWAH 4BY7G 2XGTA 2MO1A 4XIGS 1JJGA 3AYHB 1WFQA 2NZHA 1SFOH 2LSSA 2VQFQ 3G48A 4BY1G 3A5ZB 2D62A 2FXQA 3CCLA 1FVIA 1NJIC 1VQKA 1VQOA 2ALYB 4LF4L 2JEBB 3M85D 2B63H 2VL6A 2AWOA 2R93G 3S15H 4IFDJ 4X64Q 1UE7A 3RN2A 1Y1WH 1XPRA 4A3BH 4UP8A 4LWCA 2R92G 1C9OA 2A19A 4R4CA 2WNRA 3M4PA 2OPVA 1OTCA 5M3MH 1PA6A 1XMQQ 4HIDA 2A1AA 2B63G 3KDFA 1N8RC 3E9IA 2KBNA 2JVZA 3GTOH 1E7ZA 1PFSA 4YWMA 1VQ4A 1Y1WG 1S72A 3I4MH 4DPGA 2YV5A 5M3MG 1N34Q 3HOXH 4LUOA 1OXXK 1N33L 2ID0A 1HZCA 2NN6A 4JI8L 2JA7H 4HJ5A 4NXMQ 1NBWA 5C44H 1MJEA 3U50C 3I4MG 3HKZE 2JEAB 3G6EA 3PF5A 3DD6A 5FLMH 2KCMA 3K7AH 1Z47A 3HOXG 1AH9A 1VQ7A 1SLJA 4YWKA 1K73C 3W1BA 4GNXB 4DR2Q 3JC66 3ULLA 3GTQH 2JA7G 5C0XI 4A3GH 5C44G 5C0XE 2C39A 3CC2A 1DTJA 5LMUQ 4IOCA 1VQJA 1N33Q 3UDGA 4POFA 4JI8Q 4YY3L 5FLMG 1KRSA 4R4TA 2OTLA 2CPQA 2VUMH 1IXRA 4BBSH 3H0GG 1VQPA 2WAQG 2I5HA 1X3GA 2JEBA 4O0AA 2K5HA 2K4KA 1R6LA 2ATWA 1CKNB 1ZZIA 1KC8C 2ZTCA 1WCMG 1YJWA 3KOJA 1O7IA 3AFQA 1Q82C 4DAMA 2KHIA 2YQRA 1PH4A 3I7FA 4X65L 2B29A 4BBSG 4AQYQ 5JEAG 1SE8A 2RF4A 4DAYB 4QMFB 3CW2C 4JI2Q 3V69A 3S2DH 5IE8A 4UPAA 4LFBL 2CWAA 3A5UA 4C2MH 3S1MH 1I94L 1IBLL 2MFIA 1HNZL 2YTXA 3CF5A 3PO2H 4UY8C 5AJ3L 1YJNA 5C0XF 1X9NA 4LUVA 2PY9A 3AEVB 1XMOL 3CCUA 1ZZKA 3J81i 1Y1VH 1VQIA 3CMAA 4P73A 4TVAB 3CCVA 2VW9A 1EOVA 3Q8DA 4GNXA 2PI2A 2PO0B 4POGA 2OCEA 1I94Q 2CTEA 5IY0A 5C4JH 1IBLQ 2WB1G 1FL0A 3M7ND 4L5SA 3FKIG 5IT9c 1HNZQ 2UU9Q 4JC0A 1VQFA 3FP9A 1QUQB 5IYBH 1OXTA 1XMOQ 2CTJA 3GD7A 1RIPA 1K83H 2JA9A 2F4VL 3PUVA 3ULPA 5JEAB 1V43A 3CXCA 3AQQA 1CKNA 1FJGL 4OO1I 3G71A 4OO1E 1E1OA 4A3MG 1PVOA 5K36D 4IFDI 1M90C 4IFDE 1UDOA 1VQMA 1CKMA 3J80i 1G51A 4DV4L 1L1OB 4WALA 5K36E 3H1CA 1YVCA 1IL2A 3KJOA 1MKHA 3HKSA 2MO0A 4X62Q 2JQOA 4AIDA 4PZ7A 2N78A 2YYZA 4BA1I 3TEHB 2F4VQ 2UXDQ 3E9HA 1EC6A 2BH2A 1Y14B 4B3SQ 4BXXG 4LFAL 1XJVA 2BA1G 5LMNL 2WP8J 4A3EH 1FJGQ 4JYAL 1LYLA 1YZ6A 1K8AC 3HOZH 1X6OA 3PUWA 2GN5A 4YHHL 4J15A 4DV4Q 4L5RC 2KCTA 1OXVA 3PUZA 1PH1A 4DV0Q 3T1HL 1EQRA 3AEVA 3J81c 4A3EG 1HR0L 3GTGH 1LTLA 2JA5G 3S1RH 3HOZG 2VY3A 1IBMQ 3T1YL 3BJUA 4GLVB 1EWIA 3CCQA 5LMNQ 5HY6A 5C4XH 4JYAQ 4BA2B 1NMGA 3HKZG 4JI3L 2PO0A 4YHHQ 4OX9L 2E2HH 4OO1F 4IPCA 1N9WA 2AXYA 4B3RQ 1V1QA 1R9TH 4R1JA 2EQSA 2UUCL 1QUQA 3T1HQ 3B4TA 4IFDF 3CCMA 2RHQB 5C0XG 5C4XG 1CSQA 5JEAA 5K36F 4LW1A 1XPOA 2JE6I 4QY7A 4DV2L 5GAEC 3U58A 4DR4L 2VNUD 1I50H 2Y0SE 2EXDA 2K14A 4OX9Q 4MTNA 3GTLH 1L1OA 1QZGA 1BBUA 4YCUA 4GOPC 3CCRA 4QJFA 2C37B 2MQHA 2HIXA 4DV1L 4HJ9A 4DR1L 1VQHA 1J6QA 2C35B 1W3SA 1LM0A 4BY7H 4GN5A 2YU9H 1X4NA 2N8NA 4WJ4A 2VQEL 4X64L 2FMRA 5J3BA 3L7ZB 1R6MA 5LMNW 2R93H 4AYBE 3BZCA 4R4QA 2CFMA 3FHWA 1FGUA 1S3OA 1XMQL 5K36C 3DM3A 4DV1Q 2DUDA 2R92H 4DR1Q 1TWFH 4PMWA 3J81j 1PV4A 4JBMA 5FJ8G 2NVXH 4AH6A 5C0XB 4DV6L 1Q86C 2VS1A 1WYDA 4BA2A 4LUZA 1HR0W 1VQCA 2VQEQ 1U5KA 1IYJB 1N34L 4EQ5A 1UE6A 1D8LA 4DR3Q 2OTJA 4NXML 2P2RA 5EAYA 1E1TA 3CCJA 3OTOL 3TRZA 2HH3A 3CAMA 3KFUA 1YEZA 2E8GA 2NN6D 3B6YA 4DV6Q 1Z9FA 1LUZA 3GTPH 4DR2L 1N36L 1UDQA 2GVBA 3M4QA 3S16H 3RZDH 2BA1A 1C7YA 5E7NA 5LMUL 3CPFA 3M3YH 4JI1Q 3I56A 4GKJQ 2E2IH 1HNXL 3HOYG 2DGYA 1YHQA 4OO1G 2C37A 2K5VA 1VIGA 2BL5A 3OTOQ 2N49A 4IFDG 1UE5A 4KI0A 3F2BA 1KQSA 3F8TA 2LXKA 2R7FA 3D31A 3F2CA 5GQOA 2ES2A 5FLXc 3UDXA 4A3KG 1VQEA 1PH3A 4K0KL 4LNQA 1N36Q 3H0GH 3L7ZA 4B3TQ 4PZ8A 1KHIA 1HNXQ 5JEAJ 1WCMH 4A3FG 1MJCA 2I0QA 1RL2A 4JOIA 2DGRA 2I5MX 4AQYL 4C3IH 1T9HA 1K9MC 4HIKA 1PH5A 4GS3A 3CD6A 1JJCB 4JI2L 3ULJA 3KF6B 1VQDA 1Q8KA 5C0XA 3K80C 1KD1C 4K0KQ 3I4OA 3K81C 4JI4L 3CDIA 2LXJA 1M1KC 4DUYQ 3PF4A 1VQ6A 2CCZA 4RMFA 3GO5A 1TWCH 3CCEA 1KL9A 4LIJA 2HH2A 3HOUH 4OWXB 3TS0A 2NVYH 4OO1B 1NE3A 3EN2A 1VQGA 4DV7Q 4GKKQ 5H1SE 4IFDB 1SROA 1KRTA 2F52A 1HZ9A 3PSIA 2IX0A 4ALPA 4JI4Q 4A76A 1TWGH 2UXBL 3HOUG 2IY5B 4Y52H 1BBWA 2UU9L 3TQYA 1Q12A 1XTDA 4JI5L 5M5WH 2JEAA 2BR2B 1J4WA 2Y0SG 3FKIH 1MIUA 5JJIA 2K50A 4KHZA 1W2BA 3KF8B 2AHOB 1U0LA 2JA8H 2Z6KA 3H15A 3JAMc 4AM3A 4JG2A 4P71A 1GVPA 2OWOA 2CTKA 4IOAA 4DUZQ 5ELOA 2UXBQ 1OXUA 2NN6C 2R7ZH 2UUAQ 1AE2A 1D7QA 4A3MH 4OXPA 3I4NH 4X62L 4JI5Q 2JA8G 4DR6L 3ICEA 3PUXA 5DLQE 2UXDL 1A63A 4AYBG 4KLKA 4B3SL 2HT1A 3RR5A 1Q46A 2E5LQ 1X4MA 1EYGA 2R7ZG 1UDSA 1L2FA 4APVA 5IWAL 4BXXH 2I5LX 4IPGA 3W1GA 3I4NG 4R4OA 3CMEA 4KHPL 1B8AA 4DV0L 3CC7A 1BKBA 1P8LA 3M85G 2JE6B 4DR6Q 4GN3B 1PH7A 5JJKA 2PQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQK A;  4OO1 A;  4A3I G;  2Q2I A;  1SRU A;  1IBM L;  1X3E A;  4X6A H;  3STB D;  3TS2 A;  2A8V A;  4IFD A;  1UWV A;  3RLF A;  2JA5 H;  5IWA Q;  3U1K A;  4OWT B;  2R7D A;  3UE1 A;  1I5F A;  4KHP Q;  1Q1E A;  4P72 A;  5IYD G;  1E24 A;  4NB3 A;  2HQL A;  5IP9 G;  3U4Z A;  3F2D A;  4LFC Q;  1YNX A;  4B3R L;  3S1N H;  2UUB Q;  4XTC S;  3S14 H;  1N32 L;  2ZJP A;  2CTM A;  3MEF A;  2MNA A;  3PUY A;  1V9P A;  2WFW A;  3OW2 A;  1YI2 A;  2Q2H A;  1WI5 A;  5BR8 L;  4JI7 Q;  1B70 B;  2ANN A;  2PQA B;  1PH2 A;  1XNR Q;  5M5X H;  1GKH A;  5JEA D;  2Q2T A;  3S1Q H;  3K8A A;  4AIM A;  3UE0 A;  5JEA E;  1S40 A;  1GM5 A;  1N32 Q;  3CPW A;  1QVC A;  2AKW B;  1NMF A;  2N3S A;  5M3F H;  3CC4 A;  4DKA C;  4ME3 A;  2BA0 G;  2AMC B;  1Q7Y C;  4GNX C;  5BR8 Q;  3GCM A;  4JI0 Q;  1XNQ L;  1UEB A;  1SN8 A;  1ASY A;  1UE1 A;  2CWP A;  1X3F A;  2XTI A;  1VQA A;  2PNZ B;  4LF7 Q;  2B3G A;  1NY4 A;  1X55 A;  4DK3 C;  1OYP A;  5M3F G;  3BZK A;  1EUJ A;  2KEN A;  4A3L G;  1HNW L;  5IYC H;  2JE6 A;  4A93 G;  4A75 A;  4IJH A;  1ASZ A;  3ER0 A;  1Q1B A;  3A74 A;  1GD7 A;  3K7U C;  4JI6 Q;  1SMX A;  4R4I A;  1EIY B;  1WVN A;  4GLA C;  1XNQ Q;  3RLO A;  5IP7 H;  2QA4 A;  5FJ8 H;  3U4V A;  1PYS B;  1GO3 E;  2UXC Q;  2HHH Q;  4B3M L;  5IYC G;  4DR3 L;  1HNW Q;  4EX5 A;  1HJP A;  1JMC A;  2C39 B;  4BA2 I;  2IT1 A;  2D0O A;  5IP7 G;  3L0O A;  3A0J A;  5JEA F;  2WP8 B;  4NXN Q;  2QEX A;  2QGQ A;  1ZTG A;  2VZA A;  2PQA A;  4QL5 A;  3K0X A;  2ZJQ A;  3GTJ H;  4IO9 A;  3CQZ H;  2IHF A;  4MZ9 A;  4YCV A;  1X56 A;  2PO1 B;  3STB C;  3TRE A;  4B3M Q;  2JA6 G;  3GLL A;  4JBJ A;  4JI1 L;  4GKJ L;  2IHE A;  4IJL A;  5GRO A;  1K8G A;  1VQB A;  4PG3 A;  1VS0 A;  4P75 A;  2OPU A;  2BA1 D;  2BH8 A;  3HOY H;  1EIF A;  3UDF A;  1KXL A;  1XPU A;  4DNI A;  3M85 A;  4DR5 L;  3NEM A;  3G4S A;  3M7N G;  4X66 L;  4JBW A;  3S24 A;  4FDB A;  1HZB A;  2NN6 I;  2NN6 E;  4B3T L;  2ZTD A;  2K5N A;  4QQB X;  2PNZ A;  3GTK H;  1TWH H;  4A3K H;  4LF4 Q;  4A3B G;  2ZTE A;  4DV5 L;  1ZZJ A;  3MXN B;  2CQO A;  5JEA C;  1OXS C;  1VCI A;  4A3F H;  1I3Q H;  2YTY A;  5K36 G;  4Y7N H;  4DR5 Q;  3PIP A;  4X66 Q;  4B8T A;  3ZJY C;  3JAM i;  2MJH A;  2ZJR A;  3PO3 H;  1L1O C;  1PH6 A;  4HJ8 A;  1YHA A;  4DUY L;  1H95 A;  5C0X D;  1A8V A;  1PH9 A;  4DV5 Q;  1JB7 A;  2BA0 D;  4A3J H;  2JEB I;  2L15 A;  3H3V H;  1J5E L;  3BU2 A;  3S2H H;  4JVY A;  3PV0 A;  2WP8 A;  3PO3 G;  4LF9 L;  1CSP A;  4IPH A;  4DV7 L;  4GKK L;  3RNU A;  1E3H A;  1VQN A;  1VQ9 A;  4GOP B;  2BA0 A;  1YIT A;  4LF8 L;  1QVF A;  3HFZ B;  1CKO A;  2PO1 A;  3PCO B;  3PIO A;  4A3J G;  3I55 A;  4A3G G;  1NTG A;  4JBK A;  1IZ6 A;  1SR3 A;  2NN6 F;  3CP0 A;  1AE3 A;  2OQ0 A;  1J5E Q;  1J5K A;  4LF5 L;  3KJP A;  1K0R A;  4NPS A;  2VUM G;  1G29 1;  1YJ9 A;  3RN5 A;  3DLL A;  3KRN A;  4YY3 Q;  4L5Q A;  4LF9 Q;  3EIV A;  2E3U A;  4C3J H;  4LF8 Q;  3F1Z A;  2AWN A;  5K36 B;  1VIH A;  4DUZ L;  1EQQ A;  3HOV H;  1I6H H;  3OYY A;  2JEA I;  4L5T A;  2UUA L;  3CCS A;  4BA1 B;  2H5X A;  4UP9 A;  5GAD C;  1CUK A;  3PGZ A;  1A0I A;  4LF5 Q;  3AFP A;  4DR7 L;  4QIW E;  4A3D H;  2PI2 E;  1OYR A;  4BBR H;  4X65 Q;  3HOV G;  3VDY A;  2E5L L;  2C38 B;  1B7Y B;  1JJ2 A;  3IRB A;  1TUA A;  4OON A;  3L2P A;  1X65 A;  4QGU A;  1E22 A;  2CKZ B;  1YBY A;  4A3C H;  1WOC A;  2JZX A;  4LFB Q;  1IBK L;  4A3D G;  1JE5 A;  3PO2 G;  2NVT H;  4BBR G;  4JCV E;  3HOW H;  5HGQ A;  2F3I A;  4P74 A;  2K52 A;  4WAN A;  3NBH B;  4DR7 Q;  2PNH A;  3KF6 A;  1C0A A;  2QND A;  2ANR A;  4TQU S;  1Y1V G;  5AJ3 Q;  2PMZ E;  3L7Z C;  4A3C G;  1HZA A;  2ZM6 L;  2IX1 A;  4GOP A;  1HH2 P;  1VQ5 A;  4A3I H;  3EBE A;  1PH8 A;  3S17 H;  3M7N A;  4OO1 D;  3HOW G;  4JOI C;  2PO2 B;  4LFC L;  4IFD D;  2JJQ A;  5M5Y H;  5GAG C;  1IBK Q;  3VKE A;  4GLX A;  2UUB L;  5IYD H;  4UP7 A;  4A4I A;  5IP9 H;  5IYB G;  5C0X C;  2RCN A;  2EIF A;  5GAH C;  4GN4 B;  4HIO A;  4JI7 L;  2ZM6 Q;  1Q81 C;  1XNR L;  3NEL A;  3J7Z C;  5K36 A;  2KHJ A;  2JK8 A;  1PHJ A;  3GDE A;  1X54 A;  1KIX A;  1DT4 A;  4BA1 A;  4HIM A;  3W5O A;  1QZH A;  5C0X J;  2ASB A;  2HIV A;  1UDN A;  2NN6 G;  1OYS A;  2BR2 A;  4MNO A;  2CTL A;  2WAQ E;  2Z0S A;  1P16 A;  1BVS A;  4HJA A;  2C38 A;  1DGS A;  3M9B A;  4JI0 L;  4RG1 A;  2R6G A;  2NZO A;  3RLN A;  4C3H H;  3J7A 5;  3CDJ A;  4DK6 C;  4LFA Q;  1QVG A;  5ELN A;  3H3V I;  1EFW A;  4LF7 L;  4IPD A;  1KHM A;  3I2Z A;  4OWW B;  4WJ3 M;  4DV3 L;  1VQ8 A;  4JV5 L;  3SGI A;  3WWV A;  2WNR B;  1G6P A;  4JI6 L;  4A3L H;  2Z6K C;  1JT8 A;  3RZO H;  4A93 H;  3KLW A;  1HR0 Q;  3KDF B;  4YCW A;  1WJJ A;  1K1G A;  2Q2U A;  2UXC L;  5C3E H;  3T1Y Q;  2HHH L;  2PO2 A;  3KYH C;  3HKM A;  4YWL A;  1YIJ A;  4JI3 Q;  4DV3 Q;  2GVA A;  1WE8 A;  3E0E A;  4JV5 Q;  2D0P A;  1KAW A;  3J80 c;  3NEN A;  3D0F A;  3ERS X;  2NVQ H;  4HJ7 A;  3UDI A;  4LF6 L;  2NN6 B;  4NXN L;  4O2D A;  3GME A;  2V1C C;  5C3E G;  3M4O H;  2UUC Q;  2CTF A;  4JVH A;  1TXY A;  2VQF L;  1K3R A;  1L0W A;  2YTV A;  2WB1 E;  4H02 A;  1PYB A;  4DV2 Q;  2E2J H;  1YHB A;  4BY1 H;  1VQL A;  4DR4 Q;  5JJL A;  2RHS B;  4OO1 C;  2JA6 H;  3LGJ A;  3GTM H;  1E3P A;  4IFD C;  4PZ6 A;  1A62 A;  2K75 A;  4NBQ A;  4LF6 Q;  1TWA H;  4BY7 G;  2XGT A;  2MO1 A;  4XIG S;  1JJG A;  3AYH B;  1WFQ A;  2NZH A;  1SFO H;  2LSS A;  2VQF Q;  3G48 A;  4BY1 G;  3A5Z B;  2D62 A;  2FXQ A;  3CCL A;  1FVI A;  1NJI C;  1VQK A;  1VQO A;  2ALY B;  4LF4 L;  2JEB B;  3M85 D;  2B63 H;  2VL6 A;  2AWO A;  2R93 G;  3S15 H;  4IFD J;  4X64 Q;  1UE7 A;  3RN2 A;  1Y1W H;  1XPR A;  4A3B H;  4UP8 A;  4LWC A;  2R92 G;  1C9O A;  2A19 A;  4R4C A;  2WNR A;  3M4P A;  2OPV A;  1OTC A;  5M3M H;  1PA6 A;  1XMQ Q;  4HID A;  2A1A A;  2B63 G;  3KDF A;  1N8R C;  3E9I A;  2KBN A;  2JVZ A;  3GTO H;  1E7Z A;  1PFS A;  4YWM A;  1VQ4 A;  1Y1W G;  1S72 A;  3I4M H;  4DPG A;  2YV5 A;  5M3M G;  1N34 Q;  3HOX H;  4LUO A;  1OXX K;  1N33 L;  2ID0 A;  1HZC A;  2NN6 A;  4JI8 L;  2JA7 H;  4HJ5 A;  4NXM Q;  1NBW A;  5C44 H;  1MJE A;  3U50 C;  3I4M G;  3HKZ E;  2JEA B;  3G6E A;  3PF5 A;  3DD6 A;  5FLM H;  2KCM A;  3K7A H;  1Z47 A;  3HOX G;  1AH9 A;  1VQ7 A;  1SLJ A;  4YWK A;  1K73 C;  3W1B A;  4GNX B;  4DR2 Q;  3JC6 6;  3ULL A;  3GTQ H;  2JA7 G;  5C0X I;  4A3G H;  5C44 G;  5C0X E;  2C39 A;  3CC2 A;  1DTJ A;  5LMU Q;  4IOC A;  1VQJ A;  1N33 Q;  3UDG A;  4POF A;  4JI8 Q;  4YY3 L;  5FLM G;  1KRS A;  4R4T A;  2OTL A;  2CPQ A;  2VUM H;  1IXR A;  4BBS H;  3H0G G;  1VQP A;  2WAQ G;  2I5H A;  1X3G A;  2JEB A;  4O0A A;  2K5H A;  2K4K A;  1R6L A;  2ATW A;  1CKN B;  1ZZI A;  1KC8 C;  2ZTC A;  1WCM G;  1YJW A;  3KOJ A;  1O7I A;  3AFQ A;  1Q82 C;  4DAM A;  2KHI A;  2YQR A;  1PH4 A;  3I7F A;  4X65 L;  2B29 A;  4BBS G;  4AQY Q;  5JEA G;  1SE8 A;  2RF4 A;  4DAY B;  4QMF B;  3CW2 C;  4JI2 Q;  3V69 A;  3S2D H;  5IE8 A;  4UPA A;  4LFB L;  2CWA A;  3A5U A;  4C2M H;  3S1M H;  1I94 L;  1IBL L;  2MFI A;  1HNZ L;  2YTX A;  3CF5 A;  3PO2 H;  4UY8 C;  5AJ3 L;  1YJN A;  5C0X F;  1X9N A;  4LUV A;  2PY9 A;  3AEV B;  1XMO L;  3CCU A;  1ZZK A;  3J81 i;  1Y1V H;  1VQI A;  3CMA A;  4P73 A;  4TVA B;  3CCV A;  2VW9 A;  1EOV A;  3Q8D A;  4GNX A;  2PI2 A;  2PO0 B;  4POG A;  2OCE A;  1I94 Q;  2CTE A;  5IY0 A;  5C4J H;  1IBL Q;  2WB1 G;  1FL0 A;  3M7N D;  4L5S A;  3FKI G;  5IT9 c;  1HNZ Q;  2UU9 Q;  4JC0 A;  1VQF A;  3FP9 A;  1QUQ B;  5IYB H;  1OXT A;  1XMO Q;  2CTJ A;  3GD7 A;  1RIP A;  1K83 H;  2JA9 A;  2F4V L;  3PUV A;  3ULP A;  5JEA B;  1V43 A;  3CXC A;  3AQQ A;  1CKN A;  1FJG L;  4OO1 I;  3G71 A;  4OO1 E;  1E1O A;  4A3M G;  1PVO A;  5K36 D;  4IFD I;  1M90 C;  4IFD E;  1UDO A;  1VQM A;  1CKM A;  3J80 i;  1G51 A;  4DV4 L;  1L1O B;  4WAL A;  5K36 E;  3H1C A;  1YVC A;  1IL2 A;  3KJO A;  1MKH A;  3HKS A;  2MO0 A;  4X62 Q;  2JQO A;  4AID A;  4PZ7 A;  2N78 A;  2YYZ A;  4BA1 I;  3TEH B;  2F4V Q;  2UXD Q;  3E9H A;  1EC6 A;  2BH2 A;  1Y14 B;  4B3S Q;  4BXX G;  4LFA L;  1XJV A;  2BA1 G;  5LMN L;  2WP8 J;  4A3E H;  1FJG Q;  4JYA L;  1LYL A;  1YZ6 A;  1K8A C;  3HOZ H;  1X6O A;  3PUW A;  2GN5 A;  4YHH L;  4J15 A;  4DV4 Q;  4L5R C;  2KCT A;  1OXV A;  3PUZ A;  1PH1 A;  4DV0 Q;  3T1H L;  1EQR A;  3AEV A;  3J81 c;  4A3E G;  1HR0 L;  3GTG H;  1LTL A;  2JA5 G;  3S1R H;  3HOZ G;  2VY3 A;  1IBM Q;  3T1Y L;  3BJU A;  4GLV B;  1EWI A;  3CCQ A;  5LMN Q;  5HY6 A;  5C4X H;  4JYA Q;  4BA2 B;  1NMG A;  3HKZ G;  4JI3 L;  2PO0 A;  4YHH Q;  4OX9 L;  2E2H H;  4OO1 F;  4IPC A;  1N9W A;  2AXY A;  4B3R Q;  1V1Q A;  1R9T H;  4R1J A;  2EQS A;  2UUC L;  1QUQ A;  3T1H Q;  3B4T A;  4IFD F;  3CCM A;  2RHQ B;  5C0X G;  5C4X G;  1CSQ A;  5JEA A;  5K36 F;  4LW1 A;  1XPO A;  2JE6 I;  4QY7 A;  4DV2 L;  5GAE C;  3U58 A;  4DR4 L;  2VNU D;  1I50 H;  2Y0S E;  2EXD A;  2K14 A;  4OX9 Q;  4MTN A;  3GTL H;  1L1O A;  1QZG A;  1BBU A;  4YCU A;  4GOP C;  3CCR A;  4QJF A;  2C37 B;  2MQH A;  2HIX A;  4DV1 L;  4HJ9 A;  4DR1 L;  1VQH A;  1J6Q A;  2C35 B;  1W3S A;  1LM0 A;  4BY7 H;  4GN5 A;  2YU9 H;  1X4N A;  2N8N A;  4WJ4 A;  2VQE L;  4X64 L;  2FMR A;  5J3B A;  3L7Z B;  1R6M A;  5LMN W;  2R93 H;  4AYB E;  3BZC A;  4R4Q A;  2CFM A;  3FHW A;  1FGU A;  1S3O A;  1XMQ L;  5K36 C;  3DM3 A;  4DV1 Q;  2DUD A;  2R92 H;  4DR1 Q;  1TWF H;  4PMW A;  3J81 j;  1PV4 A;  4JBM A;  5FJ8 G;  2NVX H;  4AH6 A;  5C0X B;  4DV6 L;  1Q86 C;  2VS1 A;  1WYD A;  4BA2 A;  4LUZ A;  1HR0 W;  1VQC A;  2VQE Q;  1U5K A;  1IYJ B;  1N34 L;  4EQ5 A;  1UE6 A;  1D8L A;  4DR3 Q;  2OTJ A;  4NXM L;  2P2R A;  5EAY A;  1E1T A;  3CCJ A;  3OTO L;  3TRZ A;  2HH3 A;  3CAM A;  3KFU A;  1YEZ A;  2E8G A;  2NN6 D;  3B6Y A;  4DV6 Q;  1Z9F A;  1LUZ A;  3GTP H;  4DR2 L;  1N36 L;  1UDQ A;  2GVB A;  3M4Q A;  3S16 H;  3RZD H;  2BA1 A;  1C7Y A;  5E7N A;  5LMU L;  3CPF A;  3M3Y H;  4JI1 Q;  3I56 A;  4GKJ Q;  2E2I H;  1HNX L;  3HOY G;  2DGY A;  1YHQ A;  4OO1 G;  2C37 A;  2K5V A;  1VIG A;  2BL5 A;  3OTO Q;  2N49 A;  4IFD G;  1UE5 A;  4KI0 A;  3F2B A;  1KQS A;  3F8T A;  2LXK A;  2R7F A;  3D31 A;  3F2C A;  5GQO A;  2ES2 A;  5FLX c;  3UDX A;  4A3K G;  1VQE A;  1PH3 A;  4K0K L;  4LNQ A;  1N36 Q;  3H0G H;  3L7Z A;  4B3T Q;  4PZ8 A;  1KHI A;  1HNX Q;  5JEA J;  1WCM H;  4A3F G;  1MJC A;  2I0Q A;  1RL2 A;  4JOI A;  2DGR A;  2I5M X;  4AQY L;  4C3I H;  1T9H A;  1K9M C;  4HIK A;  1PH5 A;  4GS3 A;  3CD6 A;  1JJC B;  4JI2 L;  3ULJ A;  3KF6 B;  1VQD A;  1Q8K A;  5C0X A;  3K80 C;  1KD1 C;  4K0K Q;  3I4O A;  3K81 C;  4JI4 L;  3CDI A;  2LXJ A;  1M1K C;  4DUY Q;  3PF4 A;  1VQ6 A;  2CCZ A;  4RMF A;  3GO5 A;  1TWC H;  3CCE A;  1KL9 A;  4LIJ A;  2HH2 A;  3HOU H;  4OWX B;  3TS0 A;  2NVY H;  4OO1 B;  1NE3 A;  3EN2 A;  1VQG A;  4DV7 Q;  4GKK Q;  5H1S E;  4IFD B;  1SRO A;  1KRT A;  2F52 A;  1HZ9 A;  3PSI A;  2IX0 A;  4ALP A;  4JI4 Q;  4A76 A;  1TWG H;  2UXB L;  3HOU G;  2IY5 B;  4Y52 H;  1BBW A;  2UU9 L;  3TQY A;  1Q12 A;  1XTD A;  4JI5 L;  5M5W H;  2JEA A;  2BR2 B;  1J4W A;  2Y0S G;  3FKI H;  1MIU A;  5JJI A;  2K50 A;  4KHZ A;  1W2B A;  3KF8 B;  2AHO B;  1U0L A;  2JA8 H;  2Z6K A;  3H15 A;  3JAM c;  4AM3 A;  4JG2 A;  4P71 A;  1GVP A;  2OWO A;  2CTK A;  4IOA A;  4DUZ Q;  5ELO A;  2UXB Q;  1OXU A;  2NN6 C;  2R7Z H;  2UUA Q;  1AE2 A;  1D7Q A;  4A3M H;  4OXP A;  3I4N H;  4X62 L;  4JI5 Q;  2JA8 G;  4DR6 L;  3ICE A;  3PUX A;  5DLQ E;  2UXD L;  1A63 A;  4AYB G;  4KLK A;  4B3S L;  2HT1 A;  3RR5 A;  1Q46 A;  2E5L Q;  1X4M A;  1EYG A;  2R7Z G;  1UDS A;  1L2F A;  4APV A;  5IWA L;  4BXX H;  2I5L X;  4IPG A;  3W1G A;  3I4N G;  4R4O A;  3CME A;  4KHP L;  1B8A A;  4DV0 L;  3CC7 A;  1BKB A;  1P8L A;  3M85 G;  2JE6 B;  4DR6 Q;  4GN3 B;  1PH7 A;  5JJK A;  2PQU A; 
#chains in the Genus database with same CATH topology
 1ZM4 A;  2OQK A;  4OO1 A;  4A3I G;  2X06 A;  1B4O A;  2O1V A;  1Z0G A;  2Q2I A;  1PTO B;  1SRU A;  1IBM L;  1XNQ I;  1X3E A;  1BUV T;  4X6A H;  3OMG A;  1XNQ E;  3STB D;  1IYV A;  4MU1 A;  3OPO A;  2Y0S B;  2I07 B;  3IKJ A;  2A8V A;  3TS2 A;  5GMD A;  3P7J A;  4IFD A;  1SMY D;  2EOT A;  1UWV A;  4G4K A;  3RLF A;  2EYP A;  1DM0 B;  4ZRZ A;  2JA5 H;  4X65 H;  3BDO A;  5LL6 X;  4KJO A;  2HHH I;  5IWA Q;  2HHH E;  5C3X A;  3U1K A;  1BQQ T;  4OWT B;  3R8B A;  2R7D A;  3UE1 A;  1I5F A;  1TWG B;  4KHP Q;  1Q1E A;  1PQX A;  4P72 A;  5IYD G;  3GAB A;  3TBI B;  3O13 A;  1E24 A;  1HNW I;  4NB3 A;  2HQL A;  4MN3 A;  1HNW E;  5IP9 G;  1K0S A;  3U4Z A;  3F2D A;  4LFC Q;  4HY1 A;  1YNX A;  5EKI A;  1HTL D;  1HTP A;  2GO4 A;  4B3R L;  2XVS A;  3S1N H;  4CKE A;  2UUB Q;  4XTC S;  3S14 H;  3GV3 A;  1N32 L;  4IZK B;  4KV6 A;  4I7A A;  2ZJP A;  5E4W C;  4NXN I;  2CTM A;  2Z1C A;  4V19 0;  1Y60 A;  1S20 A;  3JAM W;  3DWP A;  4UHV A;  4NXN E;  1I94 H;  3MEF A;  2EZV A;  2MNA A;  4A3D B;  3PUY A;  1IBL H;  1V9P A;  3KF8 A;  2WFW A;  1C8C A;  4OL7 A;  3OW2 A;  2RDG A;  3VA7 A;  1YI2 A;  2Q2H A;  1WI5 A;  2JA8 B;  5JPM C;  2HFU A;  1TQO A;  5BR8 L;  5C0X H;  3K5N A;  4JI7 Q;  1SNM A;  3QD7 X;  1HNZ H;  1B70 B;  1PFM A;  3KDK A;  2CW0 D;  3SVM A;  2PQA B;  2ANN A;  2O1T A;  1PH2 A;  1XNR Q;  3EA6 A;  1TS3 A;  4B3M I;  4AYB B;  3S9W A;  4DR3 I;  4B3M E;  1B1Z A;  4XTJ A;  5M5X H;  4DR3 E;  1UAP A;  4XYO A;  1XMO H;  1GKH A;  1FKA H;  5A2Q L;  2PZW A;  5JEA D;  2Q2T A;  3U9O A;  2R7Z B;  3S1Q H;  1Y69 U;  3K8A A;  4S3S A;  4AIM A;  5G3L D;  1LV9 A;  3UE0 A;  5JEA E;  1IKM A;  2IPK D;  2TMP A;  1S40 A;  1GM5 A;  3H94 A;  1N32 Q;  3CPW A;  1EWC A;  1QVC A;  4M1K A;  2AKW B;  1MX0 A;  1NMF A;  1BR9 A;  2N3S A;  3TP6 A;  5M3F H;  1Z0E A;  3CC4 A;  1Z0B A;  4DKA C;  2Q8T A;  1H72 C;  4ME3 A;  2BA0 G;  2AMC B;  4U67 3;  1Q7Y C;  4GNX C;  1FNW A;  1PVG A;  5BR8 Q;  4FW7 A;  5T1I A;  3KLS A;  4QNK A;  3GCM A;  1QG7 A;  2DNC A;  4JI0 Q;  4A3I B;  4RH6 A;  1XNQ L;  3N6R A;  1UEB A;  3S17 B;  1SN8 A;  1U4P A;  1ASY A;  4IZJ D;  4JI1 I;  5C5L A;  1UE1 A;  2CWP A;  4HAC A;  4JI1 E;  4LF4 I;  2F0H A;  1HRJ A;  4LF4 E;  1X3F A;  2XTI A;  5A2Q Q;  2Z4H A;  1VQA A;  3P75 A;  2PNZ B;  4LF7 Q;  2B3G A;  1NY4 A;  1X55 A;  4DK3 C;  2F4V H;  1OYP A;  4UTG A;  1X0A A;  1NAP A;  5M3F G;  3R2I A;  1TS2 A;  3BZK A;  3NXW A;  1EUJ A;  5I4D A;  2KEN A;  4A3L G;  1HNW L;  1A2T A;  1FJG H;  3PMF A;  4K5V A;  5IYC H;  4IZJ A;  5ISR A;  2JE6 A;  1DJR D;  2AUK A;  2PT7 G;  4A93 G;  4A75 A;  4IJH A;  1F9S A;  1SNQ A;  1Z59 A;  3NCV A;  2VB3 X;  5LL6 R;  4DR5 I;  2CHB D;  4USM A;  1ASZ A;  3ER0 A;  1MSH A;  4KQV A;  1Q1B A;  4DR5 E;  3A74 A;  2CVR A;  1LAB A;  3UI2 A;  1GD7 A;  3K7U C;  4X66 I;  3PYF A;  4JI6 Q;  1SE3 A;  4WFN 3;  4X66 E;  4DNR B;  2K1H A;  1SMX A;  4ABN A;  1WTH A;  4R4I A;  5IGF A;  4FWH A;  4DF7 A;  1EIY B;  1LO5 D;  1DD2 A;  3WU6 A;  1WVN A;  4DV4 H;  4UAI A;  5EGT A;  4B3T E;  1LTR D;  4GLA C;  1LT5 D;  1HQR D;  1M8A A;  2XWJ B;  4Q0F A;  1XNQ Q;  1F9R A;  3RLO A;  5IP7 H;  4B08 A;  2QA4 A;  2IER A;  5C6A A;  5FJ8 H;  4DA2 A;  3U4V A;  1PYS B;  2FIN B;  4QUC A;  1GO3 E;  5IOD A;  3IFT A;  1YNN C;  3MEH A;  2UXC Q;  2EYJ A;  2HHH Q;  5LL6 S;  2F3W A;  5IYC G;  4B3M L;  4DV5 I;  4DR3 L;  4DV5 E;  1NXU A;  2LKV A;  4PDB A;  5C5M A;  1CZW A;  1SJE D;  2B8G A;  1YH8 A;  5J22 A;  4LFA H;  5D3I B;  2AQ2 B;  4ISA A;  1D5X C;  2O1U A;  2CVE A;  1HNW Q;  4EX5 A;  5CYU A;  2FJ2 A;  1S16 A;  5LMN H;  1ROD A;  1HJP A;  1JMC A;  4JYA H;  5D65 A;  4KMU C;  4IZK A;  2MGS A;  4FW3 A;  2C39 B;  1X3P A;  4BA2 I;  2IT1 A;  2D0O A;  3NWS A;  5IP7 G;  2N88 A;  3L0O A;  3A0J A;  2B2W A;  1LTI D;  2WP8 B;  5JEA F;  4NXN Q;  4MIU A;  2DJF C;  3J80 C;  2QEX A;  4E6I A;  4YHH H;  1JB3 A;  1Z7T A;  2QGQ A;  1ZTG A;  2VZA A;  2PQA A;  5HUR A;  3A7A B;  3GQB A;  1E2W A;  4QL5 A;  3K0X A;  5TSS A;  4B3R H;  3NTH A;  1SYB A;  2ZJQ A;  3GTJ H;  3OET A;  1BXT A;  3T1H H;  4IO9 A;  3CQZ H;  2IHF A;  2K7V A;  4MZ9 A;  4YCV A;  2CH4 A;  2G5D A;  1FWL A;  1X56 A;  2PO1 B;  1ODH A;  1CK1 A;  3STB C;  2MP1 A;  1HR0 H;  3TRE A;  4B3M Q;  2JA6 G;  3GLL A;  4JBJ A;  3S1Q B;  4JI1 L;  4M1U B;  1SMY C;  4GKJ L;  2IHE A;  4IJL A;  5GRO A;  5K5P A;  1K8G A;  1J5E I;  3BVZ A;  1J5E E;  1VQB A;  5ELE A;  4PG3 A;  2V2Q A;  1FD7 D;  1VS0 A;  5A2Q W;  5I6Y A;  1I4H A;  4JI3 H;  5KYL A;  4HCE A;  4P75 A;  1KVK A;  2OPU A;  3W3A A;  3SK8 A;  2BA1 D;  1H7U A;  2BH8 A;  5M3F B;  3HOY H;  4LF9 I;  4DV7 I;  4LF9 E;  1EIF A;  4DV7 E;  3UDF A;  4OO1 H;  1CZG A;  1IKL A;  4XQJ A;  3RZO B;  1KXL A;  1XPU A;  3C2P A;  4DNI A;  1PZK D;  3M85 A;  4OX9 H;  2OEO A;  2M2L A;  4LF8 I;  1MGS A;  3NEM A;  4DR5 L;  4URL A;  3G4S A;  4OGQ C;  4GQU A;  4LF8 E;  3M7N G;  4A93 B;  4LCF A;  4IFD H;  4IN3 A;  2E1R A;  5CV5 A;  4X66 L;  4JBW A;  3S24 A;  4FDB A;  1HZB A;  2NN6 I;  2UUC H;  3D3R A;  2NN6 E;  4B3T L;  2ZTD A;  2K5N A;  4QQB X;  3MZ5 A;  5K36 H;  1PFB A;  2PW5 A;  1TVX A;  2Z5B B;  4LOM A;  2PNZ A;  3GTK H;  1TWH H;  4A3K H;  3OWF A;  2CG9 A;  4O42 A;  2J4X A;  5IGC A;  4LF4 Q;  2CW0 C;  4K5W A;  4A3B G;  3VYU A;  1SAP A;  2ZTE A;  3G7L A;  4LF5 I;  1PRT D;  4DV5 L;  4LF5 E;  5CV4 A;  4DV2 H;  1ZZJ A;  1KDC A;  4KY6 A;  2BDO A;  1SND A;  3MXN B;  4FNF A;  2IOP A;  2CQO A;  5JEA C;  4DR4 H;  1OXS C;  1VCI A;  2BOS A;  2NVQ B;  4N9P A;  4A3F H;  1K8O A;  4X65 I;  2O5J C;  1SDF A;  1HFG A;  5DM7 3;  4X65 E;  1R4Q B;  1I3Q H;  2YTY A;  4J8Q A;  3BDL A;  3K85 A;  1Z6H A;  3BYY B;  3LWU A;  4H44 C;  5K36 G;  4Y7N H;  4DR5 Q;  4ZQ3 A;  4FW9 A;  3PIP A;  4DUZ I;  4X66 Q;  1SXT A;  3Q6S A;  1QB5 D;  1U4L A;  1GJX A;  4DUZ E;  3DUZ A;  1PXU A;  1SSO A;  4B8T A;  1CA6 A;  3ZJY C;  1BDO A;  3JAM i;  2MJH A;  3QO2 A;  2ZJR A;  3PO3 H;  1GUO A;  4DV1 H;  4KKU A;  1GUG A;  1L1O C;  4LFB I;  3OSO A;  1PH6 A;  4HSP A;  4HJ8 A;  1J8I A;  4LFB E;  4DR1 H;  1YHA A;  4DUY L;  3A8J E;  1H95 A;  5C0X D;  1HA6 A;  1A8V A;  3UHM A;  2EPB A;  1Q8I A;  1HA5 A;  3KLS X;  4DV5 Q;  1PH9 A;  1ILP A;  1TY2 A;  1JB7 A;  2JA6 B;  4DR7 I;  2BA0 D;  4A3J H;  4DR7 E;  1QZR A;  2JEB I;  5DT9 A;  2L15 A;  3H3V H;  1J5E L;  3GTM B;  3BU2 A;  2VQE H;  4X64 H;  3K5L A;  2NUC A;  3S2H H;  3P20 A;  1CQV A;  4N3O A;  5FKA C;  4JVY A;  3PV0 A;  1DOM A;  2VXW A;  2WP8 A;  1TWA B;  2XSC A;  3PO3 G;  4LF9 L;  1CSP A;  1I4Q A;  4IPH A;  3Q6M A;  4DV7 L;  5IT9 E;  3RNU A;  4GKK L;  1E3H A;  2K6A A;  1VQN A;  1VQ9 A;  4GOP B;  3GTJ B;  2A5H A;  2BA0 A;  1Q90 A;  1YIT A;  4LF8 L;  3CU7 A;  4CDE C;  1QVF A;  3PRY A;  3HFZ B;  2EDG A;  1XMQ H;  1CKO A;  1PKP A;  1BO0 A;  4C1N I;  2JP1 A;  3ITP A;  2PO1 A;  2ICI A;  3Q1Q A;  5FWK A;  3PCO B;  3PIO A;  2CZ9 A;  5JOB A;  1FNM A;  1USU A;  4A3J G;  1IBK I;  2K03 A;  3I55 A;  4A3G G;  2OXP A;  3NHH A;  1IBK E;  4NZR M;  4WOR A;  1IW7 D;  1LTB D;  1WHR A;  3PIP 3;  1NZ0 A;  1NTG A;  1STE A;  3S15 B;  4JBK A;  1IZ6 A;  1SR3 A;  2Z5E A;  4OHJ A;  2NN6 F;  4DV6 H;  4IUV A;  1XTC D;  4PNY A;  3SEB A;  1Y1W B;  1HQM C;  1EZ8 A;  1JWU D;  3H91 A;  1Y8N B;  3CP0 A;  4GZY C;  1AE3 A;  2OQ0 A;  1J5E Q;  1J5K A;  3R3O A;  4A3B B;  4LF5 L;  3KJP A;  1K0R A;  2EYO A;  4NPS A;  2VUM G;  1FWK A;  1N34 H;  1G29 1;  1HFN A;  4HYM A;  3OMC A;  3X3N A;  1YJ9 A;  3RN5 A;  3DLL A;  3KRN A;  4L6T B;  2ZM6 I;  5ELC A;  1PTO H;  5M3M B;  4YY3 Q;  2ZM6 E;  3NTK A;  3RF2 A;  1HPC A;  4FF1 A;  4L5Q A;  4LF9 Q;  3EIV A;  3PYG A;  2A6E D;  2E3U A;  4GKJ H;  2HDL A;  1G6Z A;  4NDX A;  1U2R A;  4NXM H;  4C3J H;  4K6D A;  1PRT F;  3SK6 A;  2F1M A;  2R61 A;  4LF8 Q;  3PS2 A;  3J7A M;  3F1Z A;  3GTO B;  2AWN A;  5K36 B;  1VIH A;  4DUZ L;  5FK9 C;  1EQQ A;  3OTO H;  1H9S B;  4RHR A;  1O80 A;  2EJM A;  1U9R A;  3HOV H;  3A56 A;  3I4M B;  1I6H H;  3OYY A;  1EA6 A;  2JEA I;  2UUB I;  4L5T A;  2UUA L;  1FI4 A;  3CCS A;  3D4J A;  1TKW B;  4BA1 B;  2UUB E;  1ENA A;  2H5X A;  4UP9 A;  4JVZ A;  5GAD C;  1CUK A;  3C1F A;  1V8C A;  3EVQ A;  2RBM A;  3PGZ A;  4MHE A;  3M4Y A;  3MXN A;  4R1F A;  3GP7 A;  1A0I A;  2EY5 A;  4LF5 Q;  1N36 H;  2AE8 A;  2V2Z A;  3AFP A;  2EYF A;  4C3J G;  1I3Q B;  4DR7 L;  4QIW E;  4A3D H;  3D4R A;  4XQQ A;  2PI2 E;  3V05 A;  3NSW A;  1BOS A;  4H7B A;  5LMU H;  2JA7 B;  1OYR A;  1XNR I;  5J1Z A;  4BBR H;  4FXD A;  5C44 B;  2QKI C;  1XNR E;  1ICW A;  2MPM A;  4X65 Q;  1PDQ A;  1U4M A;  4PQX A;  1HNX H;  1XWE A;  3HOV G;  3LNU A;  3VDY A;  2E5L L;  2C38 B;  3HUL A;  1B7Y B;  1FNU A;  3QIA A;  1JJ2 A;  3EZJ A;  3HG9 A;  3FMC A;  3IRB A;  1TUA A;  1ZM2 A;  4PRX A;  1W6K A;  4LFA I;  2G9H D;  2SOB A;  4OON A;  3L2P A;  2EYM A;  4LFA E;  1X65 A;  3PO3 B;  2M6Q A;  4QGU A;  3J7A F;  3J81 E;  3K7A B;  1E22 A;  2F03 A;  2CKZ B;  3ZM7 A;  1YBY A;  4A3C H;  4DGZ A;  1WOC A;  4RHS A;  3LPS A;  2JZX A;  1HK7 A;  4LFB Q;  1RR9 A;  1IBK L;  4A3D G;  1JE5 A;  3NBI A;  3PO2 G;  3GTQ B;  2NVT H;  4A3J B;  4WUB A;  4BBR G;  1ELO A;  4A3G B;  4JCV E;  3HOW H;  2XWB B;  2EJG C;  4K0K H;  4YIJ A;  5HGQ A;  3S2H B;  1AW7 A;  1OJ4 A;  2F3I A;  4QNJ A;  3D8G A;  4P74 A;  2K52 A;  4WAN A;  3NBH B;  4DR7 Q;  2PNH A;  1E2V A;  3WU4 A;  3I4L A;  5EJW A;  3KF6 A;  1NSN S;  2WW4 A;  2KA7 A;  1C0A A;  1PRT C;  2FMC A;  2QND A;  1EY5 A;  2RDF A;  2ANR A;  1EU4 A;  4TQU S;  5DNF A;  1Y1V G;  4LCH A;  5AJ3 Q;  2PMZ E;  3RUZ A;  1C4Q A;  2WIN B;  3L7Z C;  1DYQ A;  4G7H C;  1HZA A;  1CA5 A;  4A3C G;  2ZM6 L;  2VUM B;  2KEE A;  2IX1 A;  3FVQ A;  4GOP A;  1HH2 P;  1VQ5 A;  4A3I H;  3FDT A;  3T1Y I;  1WTO A;  5IT9 Q;  3EBE A;  1PH8 A;  4AQY H;  3T1Y E;  3S17 H;  4HMJ A;  4EVO A;  2V2V A;  2G8Y A;  3V96 A;  3NP8 A;  4IS9 A;  3M7N A;  4EQN A;  4OO1 D;  3SR1 A;  2BCO A;  2AUJ D;  3HOW G;  4JOI C;  4PMC A;  4K2K A;  2PO2 B;  4DV3 I;  2HUG A;  4DV3 E;  5I9P A;  4LFC L;  3DHQ A;  4JV5 I;  4LMQ D;  1FYC A;  4IFD D;  4FJS A;  1HCZ A;  2JJQ A;  5M5Y H;  2F0E A;  4JV5 E;  5GAG C;  1IBK Q;  3VKE A;  4GLX A;  2UUB L;  4RGO S;  3SK4 A;  5IYD H;  1B44 D;  1MI2 A;  4UP7 A;  2SNM A;  1WD1 A;  4A4I A;  3H6M A;  2KQ3 A;  5JVG 3;  1EYA A;  3AB9 A;  5IP9 H;  3VYR A;  5IYB G;  5C0X C;  3BYT B;  2D9I A;  2Z5C A;  2F0Q A;  4JI4 H;  4JW0 A;  3J80 E;  4OEM B;  1A15 A;  5JVH 3;  2RCN A;  3ZKB A;  2EIF A;  5GAH C;  1WTJ A;  4GN4 B;  4HIO A;  4JI7 L;  1WD0 A;  2CWF A;  2O5I C;  5DRQ A;  3I8Z A;  2ZM6 Q;  4C3J B;  5IT9 C;  2UXC I;  1Q81 C;  1XNR L;  4IUQ A;  2UXC E;  3NEL A;  2B39 A;  3J7Z C;  4DV2 I;  1Y8O B;  5K36 A;  1UEK A;  4JG4 A;  4DV2 E;  1H9S A;  3HOV B;  2KHJ A;  2JK8 A;  2IES A;  2RA4 A;  1I6H B;  1PHJ A;  4XDX A;  3U1Y A;  1JOK A;  3GDE A;  4CJ0 B;  1X54 A;  1KIX A;  3C3L A;  1DT4 A;  4BA1 A;  3J81 L;  3DXJ C;  4HIM A;  2FPH X;  1N0V C;  3W5O A;  1KLU D;  1QZH A;  5C0X J;  1AZP A;  2XEX A;  4F87 A;  2ASB A;  1CQF A;  2HIV A;  3S1M B;  4G08 A;  4ZLT F;  1UDN A;  2PNM A;  2NN6 G;  1OYS A;  2BR2 A;  2EJF C;  2HCC A;  3DWA A;  1Y4U A;  4LF6 I;  5DEH A;  4CJ2 C;  4LF6 E;  4G57 A;  4MNO A;  2F0P A;  1IW7 C;  3PO2 B;  1PZI D;  1B50 A;  1SE2 A;  2CTL A;  4BBR B;  2UXB H;  2WAQ E;  5IGG A;  2VQF I;  1V1P B;  2NTS A;  2Z0S A;  5GME A;  2VQF E;  1P16 A;  1BVS A;  4HJA A;  2UUA H;  2C38 A;  1IYU A;  5A35 A;  2UU9 H;  1DGS A;  2JT2 A;  3M9B A;  4JI0 L;  1EOT A;  1CHQ D;  4RG1 A;  1K8M A;  2R6G A;  2NZO A;  1EY6 A;  3RLN A;  4JI5 H;  2PO4 A;  3A7L A;  4C3H H;  1Y1V B;  4NMZ A;  3J7A 5;  3QT8 A;  3CDJ A;  4DK6 C;  1MHW C;  2A6E C;  2F3V A;  4IUU A;  5ELN A;  4HMI A;  4LFA Q;  1QVG A;  1EFW A;  3H3V I;  4ZKB B;  5C4H A;  4LF7 L;  4IPD A;  4X64 I;  2L5T A;  3J81 Q;  4OIJ A;  1KHM A;  3FEW X;  4L63 B;  3J7A K;  3I2Z A;  3IFD A;  5IT9 W;  2N55 A;  4OWW B;  2EFG A;  1LT6 D;  2NVT B;  1MBY A;  3DEP A;  4WJ3 M;  1QJO A;  1EY8 A;  2MUY A;  4DV3 L;  2E5L H;  3HOW B;  1LTG D;  5C4J B;  1VQ8 A;  2LF0 A;  1WVL A;  4JV5 L;  4G7Z C;  5I6W A;  4OEL B;  2J65 A;  4DAP A;  4MU0 A;  3NBH A;  3SGI A;  3MHB A;  2BV3 A;  3WWV A;  2WNR B;  4C1N K;  1G6P A;  1WUU A;  4JI6 L;  4A3L H;  4M8A A;  2Z6K C;  1JT8 A;  3RZO H;  4C3H G;  3D6W A;  2PYK A;  3J80 L;  4A93 H;  1Z0C A;  3MXG A;  4KY5 A;  2FMM A;  3KLW A;  2QDL A;  1ICF B;  1BBX C;  1HR0 Q;  4X62 H;  1K83 B;  2F0T A;  3KDF B;  3UOE A;  1JC7 A;  4YCW A;  1WJJ A;  1K1G A;  5CR3 A;  2Q2U A;  2UXC L;  5C3E H;  4DR6 H;  1F2L A;  4FF4 A;  3T1Y Q;  1PTO D;  2HHH L;  2PO2 A;  3KYH C;  3HKM A;  3J81 C;  1ZXT A;  4R8I A;  4RCO A;  5KYI A;  2UXD H;  1VI7 A;  4YWL A;  1BCP B;  1YIJ A;  1XYI A;  4RGT A;  1O7Z A;  1PZJ D;  2F0N A;  5M5Y B;  1Y6Z A;  2HK2 A;  1N34 I;  1N34 E;  4B3S H;  1TY0 A;  4JI3 Q;  4DV3 Q;  2GVA A;  4N8X 1;  1WE8 A;  1HXY D;  3E0E A;  4JV5 Q;  2D0P A;  1KAW A;  2HD3 A;  3J80 c;  3BDC A;  3NEN A;  1CT1 D;  3D0F A;  2MJ8 A;  3ERS X;  2NVQ H;  4HJ7 A;  4NXM I;  5IWA H;  1G2T A;  3OWE B;  3P06 A;  2JYO A;  3P3C A;  3PYD A;  3UDI A;  2F0L A;  4KHP H;  4QB4 A;  4ZYS A;  1EY7 A;  1FGB D;  4NXN L;  4LF6 L;  4O2D A;  2NN6 B;  3GME A;  2V1C C;  5C3E G;  3M4O H;  3J80 Q;  2LMC B;  3MAQ A;  2UUC Q;  2CTF A;  3T53 B;  4LFC H;  1KNA A;  4N8F A;  1RD9 D;  2WAC A;  1XRH A;  3C1E A;  1TXY A;  1D1I A;  2BDN A;  4RAU C;  4JVH A;  4I65 A;  2VQF L;  1K3R A;  1L0W A;  4DV0 H;  2YTV A;  2WB1 E;  1AP0 A;  4H02 A;  1B9N A;  2X69 A;  4DN4 M;  3U9S A;  2B2Y A;  3ERQ A;  1TU2 B;  4ME5 A;  1PYB A;  4DR2 I;  4EQO A;  2P5Z X;  2PNR C;  3P3E A;  4DV2 Q;  4DR2 E;  2E2J H;  4R8N A;  2NB0 A;  4ILW A;  1YHB A;  2F0O A;  3NQI A;  1IBM H;  2F0V A;  2G9D A;  4BY1 H;  4ZKC B;  1VQL A;  2V8P A;  5LMU I;  5FLX E;  4DR4 Q;  2HCI A;  4DU7 A;  5LMU E;  2HQE A;  3HOZ B;  1N33 I;  5JJL A;  1N33 E;  2RHS B;  4OO1 C;  2JA6 H;  3QB3 A;  3LGJ A;  4PU9 A;  1RJT A;  4JI8 I;  1JOR A;  3GTM H;  4B8C D;  1RTN A;  4JI8 E;  1E3P A;  1EEF D;  3J81 W;  4IFD C;  4PZ6 A;  1KNE A;  1CHP D;  1A62 A;  2K75 A;  4NBQ A;  4LF6 Q;  1V1P A;  1TWA H;  4RCN A;  2GA4 B;  4BY7 G;  2XGT A;  1DZ1 A;  2MO1 A;  4V0B A;  4XIG S;  1JJG A;  1KDA A;  3ZZT A;  3AYH B;  1WFQ A;  1LAC A;  2NZH A;  5G3L F;  3J7A V;  1SFO H;  2LSS A;  2VQF Q;  2Z6B A;  5IOC A;  2E74 C;  3GTG B;  1O7L A;  3G48 A;  4BY1 G;  3A5Z B;  4C3H B;  1B3A A;  3HGB A;  1N32 H;  2D62 A;  2FXQ A;  5NUC A;  3CCL A;  1FVI A;  1S4E A;  1NJI C;  1VQK A;  1SJH D;  3OW7 A;  2ALY B;  3SK5 A;  5IGD A;  1VQO A;  4LF4 L;  2JEB B;  2LJP A;  3M85 D;  1AN8 A;  2VL6 A;  2B63 H;  5CMD A;  1JOO A;  2AWO A;  1LTS D;  3DMU A;  5DRO A;  2R93 G;  1ZKO A;  3S15 H;  5BR8 H;  4IFD J;  4X64 Q;  1EZ6 A;  2WKD A;  2BM1 A;  2ZIT A;  1UE7 A;  3RN2 A;  4RGN A;  1Y1W H;  1UEA B;  4XYQ A;  1VF7 A;  4YY3 I;  5BN3 A;  1XPR A;  4A3B H;  4YY3 E;  4UP8 A;  3WU5 A;  5KRU A;  4LWC A;  2R92 G;  1C9O A;  2A19 A;  4R4C A;  2WNR A;  3M4P A;  2OPV A;  1OTC A;  1MSG A;  3QJY A;  5M3M H;  1PA6 A;  2J7K A;  3RMH A;  2C5C A;  3C46 A;  4LF7 H;  3TZU A;  1R9T B;  1XMQ Q;  4HID A;  4JI2 I;  4NKL A;  1CTM A;  3NTI A;  4JI2 E;  2A69 D;  2B2T A;  2A1A A;  2B63 G;  3VYS A;  1ZXM A;  1G8Z D;  2XNA C;  4DK0 A;  3KDF A;  2X6G A;  1N8R C;  3E9I A;  4XT1 B;  2F0U A;  2KBN A;  1A2U A;  2SNS A;  2JVZ A;  5EQ0 A;  3J7Y W;  3GTO H;  5C3E B;  1E7Z A;  1PFS A;  4YWM A;  2R3V A;  1VQ4 A;  2A6H D;  1Y1W G;  2EY2 A;  5ELW A;  3J80 W;  1VMP A;  1S72 A;  3I4M H;  1S5C D;  2IJ0 A;  3H3V C;  1ML0 D;  4JI6 H;  4DPG A;  2YV5 A;  1DON A;  2V34 A;  5COR A;  1B9M A;  2M8W A;  5M3M G;  2QEJ C;  2R42 A;  1J9O A;  1GHK A;  2HKE A;  1N34 Q;  3HOX H;  1XNQ H;  3EFX D;  4QCL A;  4LUO A;  2NBF A;  4LF7 I;  1ENC A;  1NNX A;  1OXX K;  1N33 L;  5DRP A;  1H9J A;  2ID0 A;  2GO3 A;  2RCF A;  3HRZ C;  2A68 D;  1HZC A;  3H4L A;  2GQ0 A;  4JI8 L;  2NN6 A;  2HHH H;  2JA7 H;  4HJ5 A;  3GKU A;  4NXM Q;  3M4O B;  1NBW A;  1NCV A;  5C44 H;  3ND9 A;  1MJE A;  3U50 C;  3I72 A;  3I4M G;  1QOH A;  1RDP D;  2SDF A;  2F0G A;  3HKZ E;  1LTT D;  2JEA B;  3I0P A;  3G6E A;  1EY0 A;  1HNW H;  1JWM D;  3PF5 A;  2ZXR A;  3DD6 A;  3OHX C;  5FLM H;  4BY7 B;  3I91 A;  5CBA E;  2Q2E B;  2KCM A;  2F0M A;  3K7A H;  1Z47 A;  3HOX G;  1AH9 A;  2E2J B;  1P42 A;  1VQ7 A;  1SLJ A;  4YWK A;  1K73 C;  2DNE A;  1I94 I;  3W1B A;  4BY1 B;  2DJG C;  1DCZ A;  2YU9 B;  1I94 E;  1IBL I;  1Y8P B;  1IBL E;  4NXN H;  1NR2 A;  4GNX B;  4Q5V A;  4DR2 Q;  1HUN A;  2ICE C;  3EJI A;  4EQP A;  2EY6 A;  3JC6 6;  3ULL A;  3GTQ H;  1SYC A;  2JA7 G;  5C0X I;  4DR2 H;  4KD3 A;  1HNZ I;  4A3G H;  5C44 G;  1MG7 A;  5C0X E;  2C39 A;  1PTO C;  3QWN A;  1HNZ E;  5FLX Q;  3CC2 A;  1DTJ A;  5LMU Q;  3X3M A;  4IOC A;  3E6Z X;  1VQJ A;  1N33 Q;  1K28 A;  2X7I A;  4DU8 A;  3AMU A;  2R93 B;  3UDG A;  4POF A;  2KUM A;  1STG A;  1SEI A;  4JI8 Q;  4YY3 L;  1XMO I;  1F2M A;  4B3M H;  1G91 A;  1XMO E;  5FLM G;  4DR3 H;  4U3D A;  1FKA E;  2WKC A;  1KRS A;  4R4T A;  4Z9C B;  1O7Y A;  2OTL A;  4HCS A;  2B2V A;  1SFO B;  2VUM H;  2R92 B;  2CPQ A;  3CRK C;  4EMD A;  3VR6 A;  2L55 A;  1IXR A;  1KTK A;  4WUD A;  3WOF A;  1D1K A;  4DXL A;  4BBS H;  2NVX B;  3H0G G;  1EY9 A;  1VQP A;  1F9P A;  2WAQ G;  2NPF A;  1Z2I A;  4TRD A;  1GUN A;  2I5H A;  3VA5 A;  1X3G A;  2JEB A;  2B63 B;  4O0A A;  2CPM A;  2K5H A;  5C4Z A;  2K4K A;  1R6L A;  2X6L A;  2B8F A;  2ATW A;  1CKN B;  3G6J B;  3D4D A;  1ZZI A;  1XXG A;  1KC8 C;  5M9O A;  2ZTC A;  2QCP X;  1WCM G;  3URY A;  5EBD A;  5DRR A;  3ND8 A;  4KKT A;  1YJW A;  3Q24 A;  3KOJ A;  2K33 A;  5FLX C;  4LFC E;  1O7I A;  1Z0V A;  4C3I G;  2PMZ B;  2B2W C;  3AFQ A;  4DAM A;  1Q82 C;  5AFW A;  2KHI A;  2F1D A;  4MQY A;  4X62 I;  2BM0 A;  2YQR A;  4X62 E;  3DEO A;  1HHV A;  1PH4 A;  4JI1 H;  1A3T A;  1SYF A;  5CBE E;  5E4X A;  3I7F A;  4X65 L;  2B29 A;  4BBS G;  4AQY Q;  1GUW A;  4LF4 H;  1S5D D;  5JEA G;  2L11 A;  1SE8 A;  2NWG A;  2RF4 A;  4DAY B;  4QMF B;  4PMB A;  4RGM A;  2F4V I;  4PV1 C;  2F4V E;  1DAR A;  4ZCK A;  3K6O A;  3CW2 C;  4X3U A;  3V2U C;  1JQY D;  3OIQ A;  4JI2 Q;  1STB A;  2RSN A;  3WDN A;  2FFM A;  4IUN A;  3V69 A;  3T56 B;  2Z5B A;  1FJG I;  1PLF A;  2EE1 A;  1FJG E;  3LNN A;  3S2D H;  1EU3 A;  1SE4 A;  1D5Z C;  5IE8 A;  4UPA A;  1QCB D;  4IZ8 A;  4P2C B;  4LFB L;  2GS8 A;  3GTP B;  1PYW D;  2CWA A;  4X3K A;  3Q22 A;  4DPX A;  4DR5 H;  1EIH A;  3A5U A;  4C2M H;  3S1M H;  3HOX B;  1I94 L;  1TS4 A;  3NWT A;  4X66 H;  3RZD B;  1IBL L;  4DV4 I;  5JAV A;  4DV4 E;  2MFI A;  3QOJ A;  1G2S A;  2LTL A;  5D14 A;  4FWD A;  2E2I B;  4B3T H;  1HNZ L;  4DV0 I;  2YTX A;  3CF5 A;  3PO2 H;  4DV0 E;  4UY8 C;  4RFB A;  2IW3 A;  1V1O A;  2KED A;  3HJC A;  2B2T C;  1QWY A;  5AJ3 L;  1YJN A;  1Y5Y A;  5C0X F;  4WJW A;  3F2U A;  4MU3 A;  4LAA A;  5FLX W;  3P3G A;  1X9N A;  3E0J A;  4LUV A;  4ZUI A;  2PY9 A;  3AEV B;  1XMO L;  4DV5 H;  3CCU A;  5IT9 L;  1ZZK A;  3ZZ0 A;  2ZXP A;  1RRE A;  4K6L A;  3J81 i;  5LMN I;  3KBG A;  1Y1V H;  5LMN E;  4JYA I;  1VQI A;  5D3D A;  3CMA A;  4JYA E;  5DAU A;  1QE6 A;  4P73 A;  1VF5 C;  3TDQ A;  1SBB B;  4TVA B;  3CCV A;  2EY1 A;  3DM1 A;  2VW9 A;  2RDH A;  1JWS D;  3P76 A;  4J3D A;  4BWG B;  1CFM A;  1B3Q A;  1EOV A;  3MFY A;  5DM6 3;  1MU5 A;  3Q8D A;  4GNX A;  3QG1 A;  2PI2 A;  4K8I A;  3H0G B;  2PO0 B;  2LS0 1;  4POG A;  4YHH I;  2OCE A;  2WAQ B;  1I94 Q;  5IY0 A;  4YHH E;  2CTE A;  5C4J H;  5L3J A;  1IBL Q;  2A6H C;  2WB1 G;  4ULL A;  5EKW A;  4JK1 C;  1FL0 A;  1K47 A;  2KOL A;  3M7N D;  4L5S A;  2O3Z A;  4B3R I;  4USK A;  2EVB A;  4B3R E;  1EFI D;  3A8K E;  2K28 A;  3FKI G;  5IT9 c;  1HNZ Q;  1WCM B;  3T1H I;  2CQA A;  2UU9 Q;  2KJX A;  3T1H E;  4JC0 A;  4DUY H;  2OF1 A;  3A55 A;  1HR0 I;  5EPK A;  4C3I B;  1B63 A;  3HS0 C;  1VQF A;  1HR0 E;  3TZD A;  3FP9 A;  4MTK A;  5L37 A;  5KNC A;  1QUQ B;  1MD2 D;  1STN A;  4PRV A;  5IYB H;  1VIS A;  1OXT A;  1XMO Q;  3VR3 A;  2CTJ A;  3GD7 A;  1RIP A;  1K83 H;  2A68 C;  2JA9 A;  3R93 A;  1KLG D;  2E2D C;  2F4V L;  4HR7 B;  4BBS B;  1J5E H;  1LLR D;  3PUV A;  3ULP A;  5JEA B;  1V43 A;  4DXF A;  4JI3 I;  5FO7 B;  2IOQ A;  3CXC A;  3AQQ A;  4K5X A;  1T5E A;  1NHJ A;  4JI3 E;  4WRD A;  4WUC A;  5I9O A;  4DNT B;  1CKN A;  1FJG L;  3K57 A;  4OO1 I;  3G71 A;  4OO1 E;  4LF9 H;  1BNZ A;  4DV7 H;  4GKK H;  2AJ4 A;  4OX9 I;  1E1O A;  4LK1 C;  4OX9 E;  4JPB W;  4A3M G;  1W6J A;  1PVO A;  5K36 D;  4IFD I;  1M90 C;  4IFD E;  1UDO A;  2LRR A;  1EYC A;  2OT2 A;  1QNU A;  4LF8 H;  1VQM A;  3JAM C;  1CKM A;  3K59 A;  4FXG C;  3J80 i;  1G51 A;  2UUC I;  2UUC E;  4DV4 L;  1L1O B;  1C48 A;  3BZD B;  4WAL A;  5K36 E;  3ONA B;  1YVC A;  2NN6 H;  1HUM A;  1SNP A;  5JPN C;  3KJO A;  1IL2 A;  1MKH A;  3H1C A;  3HKS A;  2MO0 A;  3T4A C;  4X62 Q;  4DAY A;  4MDT A;  2JQO A;  1NHI A;  2DY7 A;  4AID A;  1A3V A;  3T16 A;  4IZJ B;  4PZ7 A;  3M6A A;  2N78 A;  2YYZ A;  1JCK B;  3VYT A;  4BA1 I;  1ILQ A;  3TEH B;  2PPB C;  5DNL A;  2F4V Q;  1ZXN A;  2UXD Q;  3E9H A;  2KVM A;  4P7A A;  1E0B A;  4LF5 H;  1EC6 A;  2BH2 A;  3S2D B;  1F0X A;  1Y14 B;  1RHP A;  2M00 A;  4B3S Q;  4LFA L;  4BXX G;  4DR4 I;  3KBX A;  4DR4 E;  5CV9 A;  4FVM A;  1XJV A;  2BA1 G;  5LMN L;  2WP8 J;  4A3E H;  1FJG Q;  4JYA L;  4RKL A;  3D6C A;  1LYL A;  2RQX A;  1YZ6 A;  4C2M B;  1UNS A;  1K8A C;  2AQ3 B;  3HOZ H;  5IGB A;  1H9K A;  1X6O A;  3PUW A;  3LX0 A;  4XT3 B;  2ZQE A;  2GN5 A;  3K5M A;  1M4V A;  3K0Y A;  4YHH L;  4DUZ H;  4J15 A;  2K5Q A;  4DV4 Q;  4L5R C;  4CDD C;  2TSS A;  4DV1 I;  2KCT A;  3B78 A;  1OXV A;  4DV1 E;  2NZ1 D;  1X9Z A;  2WB1 B;  3PUZ A;  4FP5 D;  4IQZ A;  4DR1 I;  2LFN A;  4DR1 E;  3V5R A;  1PH1 A;  4DV0 Q;  3K17 A;  3T1H L;  4LFB H;  5M5W B;  1EQR A;  3ZYY X;  3AEV A;  1CI3 M;  3FKI B;  1ET9 A;  3J81 c;  4OD6 A;  4EC5 A;  4A3E G;  1HR0 L;  3GTG H;  3GR5 A;  4ZUJ A;  4F8M A;  1LTL A;  1S4Z A;  2JA5 G;  2R3Z A;  3S1R H;  3MFG A;  3HOZ G;  2EXZ A;  2VY3 A;  1IBM Q;  3T1Y L;  3F0N A;  4KTA A;  1JR0 D;  3BJU A;  3TP7 A;  1TS5 A;  4GLV B;  2VQE I;  1EWI A;  4DR7 H;  3CCQ A;  2VQE E;  4X64 E;  3VR5 A;  5LMN Q;  5HY6 A;  5LHY 1;  2HK3 A;  5C4X H;  2D2C C;  4JYA Q;  1ET6 A;  4BA2 B;  1SYE A;  4UDU C;  1VBI A;  1GOZ A;  1NMG A;  3HKZ G;  4JI3 L;  2PO0 A;  2MHV A;  1WTP A;  3A54 A;  4HSV A;  1E2Z A;  1TR5 A;  1JIC A;  1T5X D;  4OIK A;  2RSO A;  2C9O A;  2HKJ A;  4YHH Q;  4OX9 L;  4DXG A;  2D9U A;  2E2H H;  1B2T A;  2QF7 A;  4J6H A;  1WTW A;  1XMQ I;  4OO1 F;  4IPC A;  1XMQ E;  4FXK C;  2D5D A;  1N9W A;  3SDZ A;  1QIL A;  2AXY A;  4A3M B;  4B3R Q;  1V1Q A;  4KK7 A;  3I4N B;  1NR4 A;  4UT4 A;  5EPL A;  4KHV A;  1R9T H;  4R1J A;  2EQS A;  2UUC L;  2M9V A;  1QUQ A;  1O78 A;  3T1H Q;  3B4T A;  4IFD F;  1DOL A;  3CCM A;  2E76 C;  2RHQ B;  3TP8 A;  5C0X G;  4FW6 A;  1IBK H;  5COY A;  5C4X G;  1ZM9 A;  4DV6 I;  2I46 A;  1WTV A;  2O4X A;  4DV6 E;  1CSQ A;  1ESR A;  5JEA A;  1KIJ A;  1D2B A;  5K36 F;  2KCN A;  4LW1 A;  3J7A G;  1XPO A;  2DN8 A;  2JE6 I;  4H8A A;  4QY7 A;  4DV2 L;  1F77 A;  3FPU B;  5E1F A;  2DY8 A;  3TSS A;  1EYD A;  5GAE C;  1Z5C A;  3LTO A;  3U58 A;  2BE5 D;  4KN4 C;  4DR4 L;  2VNU D;  2L12 A;  1I50 H;  2A2C A;  1RKN A;  3OIP A;  4KN7 C;  4U68 A;  3TME A;  4GKJ I;  2ZM6 H;  4GKJ E;  2Y0S E;  3PYE A;  1SNC A;  4DPU A;  2EXD A;  2K14 A;  4NXM E;  4OX9 Q;  4Z7Y A;  4RKB A;  4MTN A;  1NHH A;  3MXP A;  4U3B A;  3GTL H;  1L1O A;  2IX3 A;  1QZG A;  1BBU A;  4FW4 A;  4RA8 A;  3OTO I;  4YCU A;  4GOP C;  3OTO E;  3CCR A;  1WTQ A;  3W2D A;  4C56 C;  4N9T A;  4QJF A;  2C37 B;  2MQH A;  1MSZ A;  2HIX A;  1UUP A;  4DV1 L;  1SEB D;  1WTX A;  4IUR A;  1D6E C;  1YNJ D;  4HJ9 A;  4DR1 L;  1I4P A;  2XRS D;  2UUB H;  1FNV A;  1VQH A;  2PNL A;  3QOL A;  1J6Q A;  2C35 B;  1W3S A;  4BS9 A;  1V9N A;  1L0Y B;  1LM0 A;  2DEI A;  4BY7 H;  3SHL A;  1NUC A;  5CV8 A;  4RPF A;  3TP5 A;  1N36 I;  2F0S A;  1BF4 A;  1N36 E;  1QNK A;  3DWQ A;  4A3E B;  4GN5 A;  4B3T I;  1LT4 D;  2YU9 H;  1PRT B;  4KKS A;  4DAV A;  1IL8 A;  2F0J A;  5T1G A;  2FFK B;  2JA5 B;  1X4N A;  2N8N A;  4X3S A;  3QT5 A;  4WJ4 A;  2HFS A;  4JI7 H;  2K1B A;  2VQE L;  4X64 L;  2FMR A;  4K14 A;  5J3B A;  3T51 B;  5EL9 A;  2WII B;  2OI2 A;  3L7Z B;  5A2Q C;  1HNX I;  1XNR H;  1HNX E;  1KAA A;  3MTS A;  4ZAI A;  2XN9 C;  3V2T A;  2ZBK B;  1R6M A;  5LMN W;  3KLR A;  3HKZ B;  2R93 H;  1UG8 A;  5I2X A;  5EKL A;  4AYB E;  3BZC A;  4R4Q A;  2CFM A;  1XHK A;  1ZYR D;  3S1N B;  3BVM A;  3FHW A;  1FGU A;  4LPF A;  1RTO A;  1S3O A;  1XMQ L;  5K36 C;  2F0I A;  3DM3 A;  3SE0 A;  3S14 B;  4DV1 Q;  2DUD A;  2Z8L A;  2R92 H;  4DR1 Q;  4I7Z C;  4HTH A;  3Q0A A;  1TWF H;  3ZKD A;  4HED A;  3S1R B;  2VB2 X;  4PMW A;  3J81 j;  1PV4 A;  4JBM A;  5FJ8 G;  2F4I A;  2HDM A;  2NVX H;  4AH6 A;  4K0K I;  3NPP A;  5C0X B;  4K0K E;  4DV6 L;  1IHZ A;  4QMG A;  1Q86 C;  2VS1 A;  5C4X B;  1WYD A;  2K05 A;  4BA2 A;  4LUZ A;  1GHJ A;  4CHT B;  1HR0 W;  4B9X A;  1VQC A;  1STA A;  3I70 A;  2VQE Q;  4DUY I;  1U5K A;  1A6X A;  5M5X B;  4DUY E;  1PFN A;  1IYJ B;  2Q8R E;  1N34 L;  1X3Q A;  5CGK A;  4JI0 H;  4EQ5 A;  4DFA A;  2CWH A;  4IAL A;  2JSO A;  1UE6 A;  1D8L A;  3QT6 A;  2E2H B;  4DR3 Q;  4AQY I;  4AQY E;  2A2D A;  4E9J A;  1BCP D;  2F0K A;  1PTO F;  2OTJ A;  3T1Y H;  4NXM L;  2P2R A;  2L0C A;  4Z7C A;  5EAY A;  3MVV A;  1A3U A;  1E1T A;  1PMR A;  2KEC A;  2RVL A;  5CC4 A;  3CCJ A;  3OTO L;  5BN5 A;  1SYD A;  4DV3 H;  3TRZ A;  2LY7 A;  4FF2 A;  2VKC A;  3I73 A;  1H9R A;  2HH3 A;  3CAM A;  3CWV A;  4GKK I;  3KFU A;  4JV5 H;  4GKK E;  5LL6 b;  1YEZ A;  1B53 A;  2XRQ D;  2K32 A;  4CJ1 B;  2E8G A;  1DXM A;  3L3O C;  3EQL C;  3B6Y A;  4DV6 Q;  2NN6 D;  3BVG A;  5EPJ A;  4JI4 I;  1Z9F A;  1LUZ A;  1Q3L A;  4JI4 E;  2K01 A;  3GTP H;  1I50 B;  1LT3 D;  4K8J A;  3RD4 A;  4DPW A;  2JN4 A;  4DR2 L;  1N36 L;  1UDQ A;  4LCG A;  4H13 C;  5ELB A;  2GVB A;  3MA2 B;  3M4Q A;  3S16 H;  5FLX L;  3RZD H;  2BA1 A;  1C7Y A;  5E7N A;  5LMU L;  2VES A;  1F2Z A;  2Z9H A;  3CPF A;  3M3Y H;  4JI1 Q;  3I56 A;  3VR4 A;  4GKJ Q;  2E2I H;  1KAB A;  5KND A;  3GTL B;  1HNX L;  2UXC H;  3QR8 A;  1I4R A;  3HOY G;  3GON A;  3D4W A;  5ELF A;  2DGY A;  2EYH A;  4ZVI A;  1YHQ A;  1GUS A;  4OO1 G;  1OO9 B;  2C37 A;  2K5V A;  4X3T A;  1VIG A;  1USV A;  2O2L D;  2V4D A;  1GUT A;  2BL5 A;  2NYZ D;  3OTO Q;  4EGV A;  2XIW A;  4IUT A;  2N49 A;  5BN4 A;  5HGT A;  4OKG A;  4IFD G;  1UE5 A;  3CRL C;  3ERO A;  4KI0 A;  3F8T A;  3F2B A;  2KCC A;  1KQS A;  2DEJ A;  2LXK A;  2R7F A;  3CHB D;  3BG3 A;  3D31 A;  3LWE A;  1V8Q A;  3F2C A;  5GQO A;  4CBV A;  4IUP A;  2ES2 A;  5FLX c;  3PS1 A;  3UDX A;  1AN7 A;  4A3K G;  1VQE A;  4LF6 H;  3AU7 A;  1EY4 A;  1PH3 A;  4QIW B;  1D6T A;  4K0K L;  2UXB I;  3I3C A;  3MXU A;  1N36 Q;  4LNQ A;  4FJU A;  2UXB E;  5F2D A;  1EQT A;  1S5E D;  3H0G H;  4KY7 A;  2VF3 A;  4FWG A;  4F7X A;  3L7Z A;  4B3T Q;  2UUA I;  1SYG A;  4PZ8 A;  3JAM E;  2UUA E;  2UU9 I;  3QT7 A;  1N0U A;  1R4P B;  1A6F A;  2VQF H;  2UU9 E;  2J7Z A;  2O4C A;  4MYT A;  1KHI A;  4OCH A;  1L0X B;  2RKS A;  5C3W A;  2NTT A;  1HNX Q;  2BE5 C;  1S5B D;  5JEA J;  1WCM H;  4A3F G;  4JI5 I;  1MJC A;  1X32 A;  4JI5 E;  2I0Q A;  1RL2 A;  5EKK A;  4JOI A;  3P1H A;  3IAY A;  2DGR A;  1GXD C;  4NZT M;  2I5M X;  4AQY L;  4C3I H;  1T9H A;  3K58 A;  1ENF A;  2J0T D;  1K9M C;  1Y4S A;  1TWF B;  2B2Y C;  4HIK A;  1XX8 A;  4FW5 A;  3I90 A;  1PH5 A;  4GS3 A;  3CD6 A;  2SEB D;  1JJC B;  4JI2 L;  2E5L I;  3ULJ A;  2B2U A;  2E5L E;  3KF6 B;  3B82 A;  1VQD A;  3NQT A;  2QDB A;  5JEA H;  1Q8K A;  2PCF B;  1AEX A;  1KDB A;  4CDF C;  5C0X A;  1AZQ A;  2ZT9 C;  5FO8 B;  3M7G A;  3WU3 A;  5DNX A;  1H74 A;  1YNJ C;  1BCP F;  1LTA D;  3K80 C;  1KD1 C;  2A74 C;  4K0K Q;  1FR3 A;  3I4O A;  1TII D;  2FHT A;  1EQV A;  2QIL A;  3CQZ B;  4KJN A;  3K81 C;  2K5D A;  3HEJ A;  1ONL A;  3OSS D;  1II3 A;  4JI4 L;  4I3H A;  1EWH A;  4MU4 A;  3CDI A;  2LXJ A;  2H1E A;  1M1K C;  3ZZU A;  2A1S A;  4ID6 A;  4DUY Q;  3PF4 A;  1VQ6 A;  4O1N A;  3H09 A;  4DPT A;  2CCZ A;  4RMF A;  1EL0 A;  2ENB A;  2ZXO A;  3GO5 A;  1JOQ A;  1TWC H;  3CKI B;  4TKO B;  3R2T A;  3CCE A;  4DR6 E;  4DR6 I;  1KL9 A;  1VDZ A;  1H73 A;  4LIJ A;  5FO9 B;  1I4G A;  3KK7 A;  2UXD I;  2K5W A;  3WOE A;  3HOU H;  1Z5A A;  2UXD E;  2HH2 A;  4OWX B;  4B3S I;  2F0W A;  3A8I E;  3TS0 A;  4B3S E;  3HOY B;  2AQ1 B;  2NVY H;  1EEI D;  1JE4 A;  2Z5C B;  3NE5 B;  4OO1 B;  4L8J A;  2LTM A;  3T13 A;  1NE3 A;  2L1B A;  1RCV D;  1ZYR C;  4QUF A;  3FRP B;  1XXE A;  3EN2 A;  1VQG A;  3PQI A;  4DV7 Q;  4GKK Q;  5H1S E;  5IWA I;  5IWA E;  4IFD B;  5E3F A;  1SRO A;  2CGE A;  3MWY W;  1Z0T A;  1Z5B A;  1KRT A;  4TSS A;  4KHP I;  5IGE A;  1S5F D;  2F52 A;  4KHP E;  1HZ9 A;  3PSI A;  2IX0 A;  4ALP A;  5KNB A;  5KIX A;  3Q6N A;  4JI4 Q;  1U4R A;  3S16 B;  4LFC I;  5CV7 A;  4FF3 A;  4H0L C;  4CKB A;  4DK1 A;  4A76 A;  1B62 A;  2PQE A;  3M3Y B;  1TWG H;  1TWH B;  3BS1 A;  3GTK B;  3Q23 A;  4LJZ C;  4A3K B;  2UXB L;  3HOU G;  2IY5 B;  3JAM L;  4Y52 H;  1BBW A;  2Z4I A;  4XXE A;  1I6V C;  2UU9 L;  3TQY A;  3FAU A;  1Q12 A;  1STY A;  4RWS C;  1XTD A;  4NW2 A;  3HP3 A;  3KUP A;  4ED4 A;  1RHY A;  4JI5 L;  1ZM3 A;  3IL8 A;  5M5W H;  2F0F A;  2JEA A;  1IBM I;  2BR2 B;  1J4W A;  1ESF A;  2Y0S G;  1MIU A;  3FKI H;  1IBM E;  1EIG A;  2F0D A;  4QF4 A;  3PIO 3;  4B9W A;  4A3F B;  5JJI A;  1AFP A;  2K50 A;  4XQN A;  4JI7 I;  3E5S A;  1Z0W A;  4JI7 E;  4CGY B;  1BCP C;  3N52 A;  4KHZ A;  1W2B A;  3KF8 B;  4ODG A;  2AHO B;  3L9A X;  2L4N A;  1N33 H;  3NUC A;  4Y7N B;  2O1W A;  4KD4 A;  1U0L A;  1RF2 D;  2IL8 A;  2JA8 H;  3PS3 A;  2A69 C;  2H4O A;  4CKC A;  4DU9 A;  4ZK9 B;  4DPY A;  4FO2 A;  4K2L A;  5FOB B;  4FN5 A;  4JI8 H;  2CH4 W;  2Z6K A;  4F88 A;  5EBC A;  3JAM c;  3H15 A;  4AM3 A;  4JG2 A;  4P71 A;  1DOK A;  1BKN A;  1GVP A;  2OWO A;  2K04 A;  2Y3M A;  2CTK A;  2X36 A;  4IOA A;  4DUZ Q;  2JXM B;  2Q8I B;  5ELO A;  2UXB Q;  1OXU A;  2NN6 C;  3B8H A;  3KDG A;  3JAM Q;  3NK9 A;  2R7Z H;  2UUA Q;  3VR2 A;  2IWH A;  1KTV A;  1N32 I;  1D5M C;  1AE2 A;  4HAE A;  1H7S A;  1N32 E;  2WV6 D;  4HXZ A;  3MC0 B;  1K3B C;  1D7Q A;  4A3M H;  1SNO A;  3FPP A;  4OXP A;  3I4N H;  4X62 L;  1S03 G;  4JI5 Q;  2E75 C;  1I4X A;  2JA8 G;  4DR6 L;  3E3X A;  4HN7 A;  3ICE A;  4MYU A;  2KHS A;  5BR8 I;  3PUX A;  5DLQ E;  4G7O C;  5BR8 E;  1H9M A;  5IIF A;  2UXD L;  1A63 A;  1STH A;  4AYB G;  4KLK A;  5I2Y A;  4B3S L;  1YNN D;  4JI0 I;  4JI0 E;  3HZX A;  1I6U A;  4P52 A;  2HT1 A;  3GV6 A;  3RR5 A;  1Q46 A;  2E5L Q;  1CM9 A;  1X4M A;  3OOC A;  4YY3 H;  1EYG A;  2PZT A;  2R7Z G;  1EI1 A;  1TT2 A;  5CV6 A;  5J39 A;  5A2Q E;  1L2F A;  1UDS A;  1F2Y A;  4APV A;  5IWA L;  2EYL A;  2QW7 A;  1ZEQ X;  4J1M A;  2I5L X;  3TN2 A;  4BXX H;  4HAC B;  3K1J A;  4LF7 E;  4FYD A;  4IPG A;  3W1G A;  5KGU A;  3I4N G;  4R4O A;  3K5O A;  3CME A;  4KHP L;  5ELD A;  4R9W A;  4NP5 A;  1WTR A;  2L9H A;  4OZE A;  5KEE A;  3SXH A;  4JI2 H;  1F9Q A;  1B8A A;  1KKH A;  2B2V C;  1TWC B;  1VMC A;  3NZK A;  4JI6 E;  4DV0 L;  2PW7 A;  2PZU A;  3CC7 A;  5JJZ A;  1BKB A;  1P8L A;  3HOU B;  2A73 B;  3SB1 A;  3M85 G;  1YHC A;  2JE6 B;  2B2U C;  4JI6 I;  4DR6 Q;  4GN3 B;  4CDC C;  1PH7 A;  5JJK A;  1PIE A;  2NVY B;  2PQU A; 
#chains in the Genus database with same CATH homology
 2OQK A;  4OO1 A;  4A3I G;  2Q2I A;  1SRU A;  1IBM L;  1X3E A;  4X6A H;  3STB D;  3TS2 A;  2A8V A;  4IFD A;  1UWV A;  3RLF A;  2JA5 H;  5IWA Q;  3U1K A;  4OWT B;  2R7D A;  3UE1 A;  1I5F A;  4KHP Q;  1Q1E A;  4P72 A;  5IYD G;  1E24 A;  4NB3 A;  2HQL A;  5IP9 G;  3U4Z A;  3F2D A;  4LFC Q;  1YNX A;  4B3R L;  3S1N H;  2UUB Q;  4XTC S;  3S14 H;  1N32 L;  2ZJP A;  2CTM A;  3MEF A;  2MNA A;  3PUY A;  1V9P A;  2WFW A;  3OW2 A;  1YI2 A;  2Q2H A;  1WI5 A;  5BR8 L;  4JI7 Q;  1B70 B;  2ANN A;  2PQA B;  1PH2 A;  1XNR Q;  5M5X H;  1GKH A;  5JEA D;  2Q2T A;  3S1Q H;  3K8A A;  4AIM A;  3UE0 A;  5JEA E;  1S40 A;  1GM5 A;  1N32 Q;  3CPW A;  1QVC A;  2AKW B;  1NMF A;  2N3S A;  5M3F H;  3CC4 A;  4DKA C;  4ME3 A;  2BA0 G;  2AMC B;  1Q7Y C;  4GNX C;  5BR8 Q;  3GCM A;  4JI0 Q;  1XNQ L;  1UEB A;  1SN8 A;  1ASY A;  1UE1 A;  2CWP A;  1X3F A;  2XTI A;  1VQA A;  2PNZ B;  4LF7 Q;  2B3G A;  1NY4 A;  1X55 A;  4DK3 C;  1OYP A;  5M3F G;  3BZK A;  1EUJ A;  2KEN A;  4A3L G;  1HNW L;  5IYC H;  2JE6 A;  4A93 G;  4A75 A;  4IJH A;  1ASZ A;  3ER0 A;  1Q1B A;  3A74 A;  1GD7 A;  3K7U C;  4JI6 Q;  1SMX A;  4R4I A;  1EIY B;  1WVN A;  4GLA C;  1XNQ Q;  3RLO A;  5IP7 H;  2QA4 A;  5FJ8 H;  3U4V A;  1PYS B;  1GO3 E;  2UXC Q;  2HHH Q;  4B3M L;  5IYC G;  4DR3 L;  1HNW Q;  4EX5 A;  1HJP A;  1JMC A;  2C39 B;  4BA2 I;  2IT1 A;  2D0O A;  5IP7 G;  3L0O A;  3A0J A;  5JEA F;  2WP8 B;  4NXN Q;  2QEX A;  2QGQ A;  1ZTG A;  2VZA A;  2PQA A;  4QL5 A;  3K0X A;  2ZJQ A;  3GTJ H;  4IO9 A;  3CQZ H;  2IHF A;  4MZ9 A;  4YCV A;  1X56 A;  2PO1 B;  3STB C;  3TRE A;  4B3M Q;  2JA6 G;  3GLL A;  4JBJ A;  4JI1 L;  4GKJ L;  2IHE A;  4IJL A;  5GRO A;  1K8G A;  1VQB A;  4PG3 A;  1VS0 A;  4P75 A;  2OPU A;  2BA1 D;  2BH8 A;  3HOY H;  1EIF A;  3UDF A;  1KXL A;  1XPU A;  4DNI A;  3M85 A;  4DR5 L;  3NEM A;  3G4S A;  3M7N G;  4X66 L;  4JBW A;  3S24 A;  4FDB A;  1HZB A;  2NN6 I;  2NN6 E;  4B3T L;  2ZTD A;  2K5N A;  4QQB X;  2PNZ A;  3GTK H;  1TWH H;  4A3K H;  4LF4 Q;  4A3B G;  2ZTE A;  4DV5 L;  1ZZJ A;  3MXN B;  2CQO A;  5JEA C;  1OXS C;  1VCI A;  4A3F H;  1I3Q H;  2YTY A;  5K36 G;  4Y7N H;  4DR5 Q;  3PIP A;  4X66 Q;  4B8T A;  3ZJY C;  3JAM i;  2MJH A;  2ZJR A;  3PO3 H;  1L1O C;  1PH6 A;  4HJ8 A;  1YHA A;  4DUY L;  1H95 A;  5C0X D;  1A8V A;  1PH9 A;  4DV5 Q;  1JB7 A;  2BA0 D;  4A3J H;  2JEB I;  2L15 A;  3H3V H;  1J5E L;  3BU2 A;  3S2H H;  4JVY A;  3PV0 A;  2WP8 A;  3PO3 G;  4LF9 L;  1CSP A;  4IPH A;  4DV7 L;  4GKK L;  3RNU A;  1E3H A;  1VQN A;  1VQ9 A;  4GOP B;  2BA0 A;  1YIT A;  4LF8 L;  1QVF A;  3HFZ B;  1CKO A;  2PO1 A;  3PCO B;  3PIO A;  4A3J G;  3I55 A;  4A3G G;  1NTG A;  4JBK A;  1IZ6 A;  1SR3 A;  2NN6 F;  3CP0 A;  1AE3 A;  2OQ0 A;  1J5E Q;  1J5K A;  4LF5 L;  3KJP A;  1K0R A;  4NPS A;  2VUM G;  1G29 1;  1YJ9 A;  3RN5 A;  3DLL A;  3KRN A;  4YY3 Q;  4L5Q A;  4LF9 Q;  3EIV A;  2E3U A;  4C3J H;  4LF8 Q;  3F1Z A;  2AWN A;  5K36 B;  1VIH A;  4DUZ L;  1EQQ A;  3HOV H;  1I6H H;  3OYY A;  2JEA I;  4L5T A;  2UUA L;  3CCS A;  4BA1 B;  2H5X A;  4UP9 A;  5GAD C;  1CUK A;  3PGZ A;  1A0I A;  4LF5 Q;  3AFP A;  4DR7 L;  4QIW E;  4A3D H;  2PI2 E;  1OYR A;  4BBR H;  4X65 Q;  3HOV G;  3VDY A;  2E5L L;  2C38 B;  1B7Y B;  1JJ2 A;  3IRB A;  1TUA A;  4OON A;  3L2P A;  1X65 A;  4QGU A;  1E22 A;  2CKZ B;  1YBY A;  4A3C H;  1WOC A;  2JZX A;  4LFB Q;  1IBK L;  4A3D G;  1JE5 A;  3PO2 G;  2NVT H;  4BBR G;  4JCV E;  3HOW H;  5HGQ A;  2F3I A;  4P74 A;  2K52 A;  4WAN A;  3NBH B;  4DR7 Q;  2PNH A;  3KF6 A;  1C0A A;  2QND A;  2ANR A;  4TQU S;  1Y1V G;  5AJ3 Q;  2PMZ E;  3L7Z C;  4A3C G;  1HZA A;  2ZM6 L;  2IX1 A;  4GOP A;  1HH2 P;  1VQ5 A;  4A3I H;  3EBE A;  1PH8 A;  3S17 H;  3M7N A;  4OO1 D;  3HOW G;  4JOI C;  2PO2 B;  4LFC L;  4IFD D;  2JJQ A;  5M5Y H;  5GAG C;  1IBK Q;  3VKE A;  4GLX A;  2UUB L;  5IYD H;  4UP7 A;  4A4I A;  5IP9 H;  5IYB G;  5C0X C;  2RCN A;  2EIF A;  5GAH C;  4GN4 B;  4HIO A;  4JI7 L;  2ZM6 Q;  1Q81 C;  1XNR L;  3NEL A;  3J7Z C;  5K36 A;  2KHJ A;  2JK8 A;  1PHJ A;  3GDE A;  1X54 A;  1KIX A;  1DT4 A;  4BA1 A;  4HIM A;  3W5O A;  1QZH A;  5C0X J;  2ASB A;  2HIV A;  1UDN A;  2NN6 G;  1OYS A;  2BR2 A;  4MNO A;  2CTL A;  2WAQ E;  2Z0S A;  1P16 A;  1BVS A;  4HJA A;  2C38 A;  1DGS A;  3M9B A;  4JI0 L;  4RG1 A;  2R6G A;  2NZO A;  3RLN A;  4C3H H;  3J7A 5;  3CDJ A;  4DK6 C;  4LFA Q;  1QVG A;  5ELN A;  3H3V I;  1EFW A;  4LF7 L;  4IPD A;  1KHM A;  3I2Z A;  4OWW B;  4WJ3 M;  4DV3 L;  1VQ8 A;  4JV5 L;  3SGI A;  3WWV A;  2WNR B;  1G6P A;  4JI6 L;  4A3L H;  2Z6K C;  1JT8 A;  3RZO H;  4A93 H;  3KLW A;  1HR0 Q;  3KDF B;  4YCW A;  1WJJ A;  1K1G A;  2Q2U A;  2UXC L;  5C3E H;  3T1Y Q;  2HHH L;  2PO2 A;  3KYH C;  3HKM A;  4YWL A;  1YIJ A;  4JI3 Q;  4DV3 Q;  2GVA A;  1WE8 A;  3E0E A;  4JV5 Q;  2D0P A;  1KAW A;  3J80 c;  3NEN A;  3D0F A;  3ERS X;  2NVQ H;  4HJ7 A;  3UDI A;  4LF6 L;  2NN6 B;  4NXN L;  4O2D A;  3GME A;  2V1C C;  5C3E G;  3M4O H;  2UUC Q;  2CTF A;  4JVH A;  1TXY A;  2VQF L;  1K3R A;  1L0W A;  2YTV A;  2WB1 E;  4H02 A;  1PYB A;  4DV2 Q;  2E2J H;  1YHB A;  4BY1 H;  1VQL A;  4DR4 Q;  5JJL A;  2RHS B;  4OO1 C;  2JA6 H;  3LGJ A;  3GTM H;  1E3P A;  4IFD C;  4PZ6 A;  1A62 A;  2K75 A;  4NBQ A;  4LF6 Q;  1TWA H;  4BY7 G;  2XGT A;  2MO1 A;  4XIG S;  1JJG A;  3AYH B;  1WFQ A;  2NZH A;  1SFO H;  2LSS A;  2VQF Q;  3G48 A;  4BY1 G;  3A5Z B;  2D62 A;  2FXQ A;  3CCL A;  1FVI A;  1NJI C;  1VQK A;  1VQO A;  2ALY B;  4LF4 L;  2JEB B;  3M85 D;  2B63 H;  2VL6 A;  2AWO A;  2R93 G;  3S15 H;  4IFD J;  4X64 Q;  1UE7 A;  3RN2 A;  1Y1W H;  1XPR A;  4A3B H;  4UP8 A;  4LWC A;  2R92 G;  1C9O A;  2A19 A;  4R4C A;  2WNR A;  3M4P A;  2OPV A;  1OTC A;  5M3M H;  1PA6 A;  1XMQ Q;  4HID A;  2A1A A;  2B63 G;  3KDF A;  1N8R C;  3E9I A;  2KBN A;  2JVZ A;  3GTO H;  1E7Z A;  1PFS A;  4YWM A;  1VQ4 A;  1Y1W G;  1S72 A;  3I4M H;  4DPG A;  2YV5 A;  5M3M G;  1N34 Q;  3HOX H;  4LUO A;  1OXX K;  1N33 L;  2ID0 A;  1HZC A;  2NN6 A;  4JI8 L;  2JA7 H;  4HJ5 A;  4NXM Q;  1NBW A;  5C44 H;  1MJE A;  3U50 C;  3I4M G;  3HKZ E;  2JEA B;  3G6E A;  3PF5 A;  3DD6 A;  5FLM H;  2KCM A;  3K7A H;  1Z47 A;  3HOX G;  1AH9 A;  1VQ7 A;  1SLJ A;  4YWK A;  1K73 C;  3W1B A;  4GNX B;  4DR2 Q;  3JC6 6;  3ULL A;  3GTQ H;  2JA7 G;  5C0X I;  4A3G H;  5C44 G;  5C0X E;  2C39 A;  3CC2 A;  1DTJ A;  5LMU Q;  4IOC A;  1VQJ A;  1N33 Q;  3UDG A;  4POF A;  4JI8 Q;  4YY3 L;  5FLM G;  1KRS A;  4R4T A;  2OTL A;  2CPQ A;  2VUM H;  1IXR A;  4BBS H;  3H0G G;  1VQP A;  2WAQ G;  2I5H A;  1X3G A;  2JEB A;  4O0A A;  2K5H A;  2K4K A;  1R6L A;  2ATW A;  1CKN B;  1ZZI A;  1KC8 C;  2ZTC A;  1WCM G;  1YJW A;  3KOJ A;  1O7I A;  3AFQ A;  1Q82 C;  4DAM A;  2KHI A;  2YQR A;  1PH4 A;  3I7F A;  4X65 L;  2B29 A;  4BBS G;  4AQY Q;  5JEA G;  1SE8 A;  2RF4 A;  4DAY B;  4QMF B;  3CW2 C;  4JI2 Q;  3V69 A;  3S2D H;  5IE8 A;  4UPA A;  4LFB L;  2CWA A;  3A5U A;  4C2M H;  3S1M H;  1I94 L;  1IBL L;  2MFI A;  1HNZ L;  2YTX A;  3CF5 A;  3PO2 H;  4UY8 C;  5AJ3 L;  1YJN A;  5C0X F;  1X9N A;  4LUV A;  2PY9 A;  3AEV B;  1XMO L;  3CCU A;  1ZZK A;  3J81 i;  1Y1V H;  1VQI A;  3CMA A;  4P73 A;  4TVA B;  3CCV A;  2VW9 A;  1EOV A;  3Q8D A;  4GNX A;  2PI2 A;  2PO0 B;  4POG A;  2OCE A;  1I94 Q;  2CTE A;  5IY0 A;  5C4J H;  1IBL Q;  2WB1 G;  1FL0 A;  3M7N D;  4L5S A;  3FKI G;  5IT9 c;  1HNZ Q;  2UU9 Q;  4JC0 A;  1VQF A;  3FP9 A;  1QUQ B;  5IYB H;  1OXT A;  1XMO Q;  2CTJ A;  3GD7 A;  1RIP A;  1K83 H;  2JA9 A;  2F4V L;  3PUV A;  3ULP A;  5JEA B;  1V43 A;  3CXC A;  3AQQ A;  1CKN A;  1FJG L;  4OO1 I;  3G71 A;  4OO1 E;  1E1O A;  4A3M G;  1PVO A;  5K36 D;  4IFD I;  1M90 C;  4IFD E;  1UDO A;  1VQM A;  1CKM A;  3J80 i;  1G51 A;  4DV4 L;  1L1O B;  4WAL A;  5K36 E;  3H1C A;  1YVC A;  1IL2 A;  3KJO A;  1MKH A;  3HKS A;  2MO0 A;  4X62 Q;  2JQO A;  4AID A;  4PZ7 A;  2N78 A;  2YYZ A;  4BA1 I;  3TEH B;  2F4V Q;  2UXD Q;  3E9H A;  1EC6 A;  2BH2 A;  1Y14 B;  4B3S Q;  4BXX G;  4LFA L;  1XJV A;  2BA1 G;  5LMN L;  2WP8 J;  4A3E H;  1FJG Q;  4JYA L;  1LYL A;  1YZ6 A;  1K8A C;  3HOZ H;  1X6O A;  3PUW A;  2GN5 A;  4YHH L;  4J15 A;  4DV4 Q;  4L5R C;  2KCT A;  1OXV A;  3PUZ A;  1PH1 A;  4DV0 Q;  3T1H L;  1EQR A;  3AEV A;  3J81 c;  4A3E G;  1HR0 L;  3GTG H;  1LTL A;  2JA5 G;  3S1R H;  3HOZ G;  2VY3 A;  1IBM Q;  3T1Y L;  3BJU A;  4GLV B;  1EWI A;  3CCQ A;  5LMN Q;  5HY6 A;  5C4X H;  4JYA Q;  4BA2 B;  1NMG A;  3HKZ G;  4JI3 L;  2PO0 A;  4YHH Q;  4OX9 L;  2E2H H;  4OO1 F;  4IPC A;  1N9W A;  2AXY A;  4B3R Q;  1V1Q A;  1R9T H;  4R1J A;  2EQS A;  2UUC L;  1QUQ A;  3T1H Q;  3B4T A;  4IFD F;  3CCM A;  2RHQ B;  5C0X G;  5C4X G;  1CSQ A;  5JEA A;  5K36 F;  4LW1 A;  1XPO A;  2JE6 I;  4QY7 A;  4DV2 L;  5GAE C;  3U58 A;  4DR4 L;  2VNU D;  1I50 H;  2Y0S E;  2EXD A;  2K14 A;  4OX9 Q;  4MTN A;  3GTL H;  1L1O A;  1QZG A;  1BBU A;  4YCU A;  4GOP C;  3CCR A;  4QJF A;  2C37 B;  2MQH A;  2HIX A;  4DV1 L;  4HJ9 A;  4DR1 L;  1VQH A;  1J6Q A;  2C35 B;  1W3S A;  1LM0 A;  4BY7 H;  4GN5 A;  2YU9 H;  1X4N A;  2N8N A;  4WJ4 A;  2VQE L;  4X64 L;  2FMR A;  5J3B A;  3L7Z B;  1R6M A;  5LMN W;  2R93 H;  4AYB E;  3BZC A;  4R4Q A;  2CFM A;  3FHW A;  1FGU A;  1S3O A;  1XMQ L;  5K36 C;  3DM3 A;  4DV1 Q;  2DUD A;  2R92 H;  4DR1 Q;  1TWF H;  4PMW A;  3J81 j;  1PV4 A;  4JBM A;  5FJ8 G;  2NVX H;  4AH6 A;  5C0X B;  4DV6 L;  1Q86 C;  2VS1 A;  1WYD A;  4BA2 A;  4LUZ A;  1HR0 W;  1VQC A;  2VQE Q;  1U5K A;  1IYJ B;  1N34 L;  4EQ5 A;  1UE6 A;  1D8L A;  4DR3 Q;  2OTJ A;  4NXM L;  2P2R A;  5EAY A;  1E1T A;  3CCJ A;  3OTO L;  3TRZ A;  2HH3 A;  3CAM A;  3KFU A;  1YEZ A;  2E8G A;  2NN6 D;  3B6Y A;  4DV6 Q;  1Z9F A;  1LUZ A;  3GTP H;  4DR2 L;  1N36 L;  1UDQ A;  2GVB A;  3M4Q A;  3S16 H;  3RZD H;  2BA1 A;  1C7Y A;  5E7N A;  5LMU L;  3CPF A;  3M3Y H;  4JI1 Q;  3I56 A;  4GKJ Q;  2E2I H;  1HNX L;  3HOY G;  2DGY A;  1YHQ A;  4OO1 G;  2C37 A;  2K5V A;  1VIG A;  2BL5 A;  3OTO Q;  2N49 A;  4IFD G;  1UE5 A;  4KI0 A;  3F2B A;  1KQS A;  3F8T A;  2LXK A;  2R7F A;  3D31 A;  3F2C A;  5GQO A;  2ES2 A;  5FLX c;  3UDX A;  4A3K G;  1VQE A;  1PH3 A;  4K0K L;  4LNQ A;  1N36 Q;  3H0G H;  3L7Z A;  4B3T Q;  4PZ8 A;  1KHI A;  1HNX Q;  5JEA J;  1WCM H;  4A3F G;  1MJC A;  2I0Q A;  1RL2 A;  4JOI A;  2DGR A;  2I5M X;  4AQY L;  4C3I H;  1T9H A;  1K9M C;  4HIK A;  1PH5 A;  4GS3 A;  3CD6 A;  1JJC B;  4JI2 L;  3ULJ A;  3KF6 B;  1VQD A;  1Q8K A;  5C0X A;  3K80 C;  1KD1 C;  4K0K Q;  3I4O A;  3K81 C;  4JI4 L;  3CDI A;  2LXJ A;  1M1K C;  4DUY Q;  3PF4 A;  1VQ6 A;  2CCZ A;  4RMF A;  3GO5 A;  1TWC H;  3CCE A;  1KL9 A;  4LIJ A;  2HH2 A;  3HOU H;  4OWX B;  3TS0 A;  2NVY H;  4OO1 B;  1NE3 A;  3EN2 A;  1VQG A;  4DV7 Q;  4GKK Q;  5H1S E;  4IFD B;  1SRO A;  1KRT A;  2F52 A;  1HZ9 A;  3PSI A;  2IX0 A;  4ALP A;  4JI4 Q;  4A76 A;  1TWG H;  2UXB L;  3HOU G;  2IY5 B;  4Y52 H;  1BBW A;  2UU9 L;  3TQY A;  1Q12 A;  1XTD A;  4JI5 L;  5M5W H;  2JEA A;  2BR2 B;  1J4W A;  2Y0S G;  3FKI H;  1MIU A;  5JJI A;  2K50 A;  4KHZ A;  1W2B A;  3KF8 B;  2AHO B;  1U0L A;  2JA8 H;  2Z6K A;  3H15 A;  3JAM c;  4AM3 A;  4JG2 A;  4P71 A;  1GVP A;  2OWO A;  2CTK A;  4IOA A;  4DUZ Q;  5ELO A;  2UXB Q;  1OXU A;  2NN6 C;  2R7Z H;  2UUA Q;  1AE2 A;  1D7Q A;  4A3M H;  4OXP A;  3I4N H;  4X62 L;  4JI5 Q;  2JA8 G;  4DR6 L;  3ICE A;  3PUX A;  5DLQ E;  2UXD L;  1A63 A;  4AYB G;  4KLK A;  4B3S L;  2HT1 A;  3RR5 A;  1Q46 A;  2E5L Q;  1X4M A;  1EYG A;  2R7Z G;  1UDS A;  1L2F A;  4APV A;  5IWA L;  4BXX H;  2I5L X;  4IPG A;  3W1G A;  3I4N G;  4R4O A;  3CME A;  4KHP L;  1B8A A;  4DV0 L;  3CC7 A;  1BKB A;  1P8L A;  3M85 G;  2JE6 B;  4DR6 Q;  4GN3 B;  1PH7 A;  5JJK A;  2PQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...