4AIMA

Crystal structure of c. crescentus pnpase bound to rnase e recognition peptide
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
698
structure length
698
Chain Sequence
SPMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKIETINIPTDKIREVIGSGGKVIREIVATTGAKVDINDDGVVKVSASDGAKIKAAIDWIKSITDEAEIGKIYDGKVVKVVDFGAFVNFFGAKDGLVHVSQISNERVAKPSDVLKEGQMVKVKLLGFDDRGKTKLSMKVVDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase/peptide
molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
total genus 168
structure length 698
sequence length 698
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aimA04
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aimA01
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aimA02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4aimA03
1GVPA 1O7IA 3B6YA 1Q8KA 3JAMi 3TRZA 3S1RH 4A3IH 1PH7A 2ES2A 1A63A 1CSQA 1EWIA 1RL2A 2F4VQ 1YJNA 3I56A 4ME3A 4A3MH 2ZM6L 2E8GA 4LNQA 3GTMH 1VQJA 3W1GA 3I4MG 2CFMA 4DPGA 1PYSB 4DR7L 2WP8A 5K36B 4HJ9A 1VQOA 2I5MX 5JJLA 1SRUA 2CWAA 4JI4L 1N34L 2Z6KC 4PMWA 1XMQQ 3PO2H 4WANA 2WAQG 2Y0SE 3VDYA 2NN6A 1Q81C 4OWWB 5EAYA 4GLVB 3PIOA 4JV5Q 2A8VA 1VQNA 2VZAA 4JOIA 4BA2A 1YJWA 4DV0Q 4BBSH 2C37B 4AQYL 2IX1A 4UP7A 2KHIA 1CUKA 1YBYA 3H15A 4JVHA 3HKMA 3FKIG 2ZTCA 3JAMc 1I5FA 2MO1A 3SGIA 2NN6G 4IFDG 4B8TA 1HZBA 4R4IA 3GLLA 2JZXA 1XTDA 4JI5Q 4EX5A 2PQUA 4LUVA 3M7NG 2JA7H 1R6LA 2ASBA 4L5SA 2K14A 2XGTA 4A3EG 2JK8A 1HNXQ 4DR5Q 1Q7YC 4A3JH 3I4NH 1VQEA 1TWFH 3KFUA 1PH8A 2PNZB 2PNHA 2L15A 1KQSA 5LMNW 5K36F 4B3TQ 2JEBB 2DUDA 4OONA 2MJHA 2HH3A 3OTOQ 1VQDA 2ATWA 4JC0A 1L2FA 1NMGA 1AE3A 2HIXA 5C0XG 1S40A 2BA1A 2MFIA 3ZJYC 5JEAB 2R7ZG 1ZTGA 3CXCA 3DD6A 4DAMA 1E3PA 2B63H 2JEAI 3HOUG 4IFDA 1SR3A 2LSSA 2JE6I 3CQZH 4X66Q 2NN6I 4GKJQ 3G71A 2ANRA 4BXXG 2ZTDA 2I5HA 4C3HH 5C44H 1T9HA 4IPGA 3CCVA 1EIYB 4BA2I 3I4OA 3UDXA 3CCLA 1R9TH 3M3YH 2A1AA 1J5EQ 1E22A 5LMUQ 1Q1BA 3Q8DA 1TWAH 1VQLA 1TWCH 4DAYB 2LXJA 1I94L 4GN5A 3RLFA 2HQLA 2Q2HA 2VUMG 1CKNB 4X6AH 2BA0D 3V69A 2KCTA 1XPOA 2PY9A 1Y1WH 2R92H 2DGRA 3HOVG 4J15A 4R4QA 1M1KC 2JA7G 3PO3G 4DV0L 4NXNL 3OW2A 1Q86C 2JE6B 3M7ND 1MKHA 1DGSA 2YTVA 5HY6A 1VQ4A 1Y1WG 2R92G 3L0OA 3S2HH 1YVCA 4OO1A 4X65L 2UU9L 4B3SQ 1LUZA 2KCMA 2UXBQ 2K5NA 3D31A 1VCIA 3HFZB 4PZ8A 3ULLA 2AWNA 2VL6A 4AIMA 2N3SA 4HIKA 5AJ3L 3J7ZC 1P16A 2IX0A 1PH4A 1HNXL 5FLXc 4DR7Q 2NN6E 1X56A 5C0XJ 4KHPL 2ANNA 1VQ6A 4YWKA 3H3VH 5C4JH 3UE1A 1D8LA 4IPDA 4DR3L 5IP7G 1G6PA 2ID0A 5C0XD 2B3GA 3GO5A 3HOUH 1NY4A 4UPAA 1EQQA 1E1TA 1J4WA 3H3VI 1XPRA 2E5LQ 2JEAB 3A5ZB 3ULJA 5M3FH 2NN6C 2CTLA 1NTGA 1V9PA 5IT9c 2E2HH 2NN6B 3G48A 4DR6Q 3I2ZA 5GQOA 1X3GA 2UXBL 1VQGA 4X66L 3RZDH 3EIVA 1Z9FA 5J3BA 3TQYA 1K9MC 4LF6L 3KF6B 1HNWL 4ALPA 2CKZB 3IRBA 4TQUS 3TS0A 4A3LH 3L7ZA 1WCMG 5IYBG 4R4OA 5IYCG 4GLAC 1WVNA 4L5RC 2JA9A 3NBHB 4BBRH 5M5WH 4IPCA 1SFOH 2NN6D 4Y7NH 1K73C 2JA8G 4A76A 3KYHC 1WE8A 1VQ8A 4IOCA 4HJ7A 4BY1G 2R93H 5C4XG 3D0FA 3M85G 2D62A 4A3DH 5C0XF 1OYPA 2CTMA 2KBNA 1JE5A 1KRSA 4JI8L 5M3MH 1VQ7A 5JEAF 4DR5L 2JA6G 1EOVA 1GD7A 2IHEA 4LF9L 3I7FA 3LGJA 1HR0Q 5FLMG 3F2CA 1FJGQ 4LFBL 4A3KH 1KD1C 1VQKA 3RN2A 3M4OH 1N32L 1C7YA 4GS3A 2NVQH 2MNAA 1N8RC 4JI7Q 4JYAL 1L1OC 4K0KQ 4JBJA 5K36G 2VQEL 4R4CA 3S16H 1NJIC 3H0GG 1OXVA 2Y0SG 2UUBL 3S1QH 2OTJA 4A3GH 3PF4A 4YCUA 2C38A 4H02A 3KDFB 3AQQA 1YHAA 5IP9G 4DR4L 4FDBA 4BY7H 3HOVH 2ZTEA 3CCEA 1G51A 1N33Q 4IJLA 1VQMA 1XMQL 2WFWA 2VUMH 1BBWA 5C0XC 4HIOA 1K1GA 1OYRA 2I0QA 1Y1VH 2KENA 5JEAD 3EBEA 5FJ8G 4LUOA 1SROA 4DR4Q 5K36A 1VQ5A 1VQHA 3UDGA 2NZHA 3U1KA 2QNDA 2VQFQ 4QQBX 3PIPA 1YEZA 1FGUA 4YCWA 1FVIA 2OTLA 2JA5G 2C38B 2CCZA 1VQIA 2N78A 1KRTA 1GM5A 4GKKQ 5DLQE 3S1MH 1PH3A 1HNWQ 1XNQL 3I4MH 4JVYA 5C0XE 4APVA 1VQFA 3TEHB 2BH8A 2D0PA 4TVAB 1I50H 2NVXH 1IBKQ 3S14H 3MEFA 1I6HH 3HKSA 4X64Q 4BA1I 2UUAQ 3DM3A 2IY5B 5GAEC 4MZ9A 4A3IG 1N34Q 3M7NA 2OWOA 1UDNA 2EXDA 3CPWA 4GNXA 4AIDA 2VW9A 5GAHC 4LF5L 3HOYH 4DR2Q 2N8NA 4X62Q 4DV5Q 4IFDJ 2WP8J 4LUZA 1LTLA 1HNZQ 2NN6F 2GVAA 1FL0A 4A75A 3T1YL 4GN3B 1IBML 2C39A 1TWHH 3CC4A 4OO1G 1PFSA 4L5QA 3CC2A 1W3SA 1K83H 3UDIA 1TWGH 2UUAL 4XTCS 1CKNA 1EUJA 4B3TL 3PO3H 1JT8A 1XMOQ 4DR6L 4LFBQ 4OX9L 4P72A 4MNOA 3PUWA 1ZZKA 1QVCA 5HGQA 2C35B 4IFDC 3VKEA 2CQOA 4LW1A 2CWPA 1Q82C 2H5XA 4JBKA 3J80c 1A8VA 4RMFA 1PH5A 1TUAA 1D7QA 1ASZA 1E1OA 1PVOA 1QVGA 1JMCA 2VQFL 4MTNA 1B70B 4A3MG 4KHPQ 3M85D 3CDIA 4DV3Q 1DT4A 1QZGA 1UE1A 3NENA 2OCEA 3E9HA 2WAQE 4IFDE 4GKJL 2P2RA 4P74A 3HOZH 2Z6KA 1IZ6A 1K3RA 4YWLA 4DUZQ 1KL9A 2OQ0A 4AM3A 4KLKA 1Q1EA 3PF5A 2PO1A 1VIHA 1CKOA 3PUYA 3CCMA 4NXNQ 4WJ3M 2MO0A 4P71A 2AKWB 4LWCA 1UE7A 3GTOH 2BR2A 3W5OA 2KHJA 2OPVA 2AXYA 3ERSX 3L7ZB 2ZM6Q 5IWAQ 4UP9A 3U58A 1MJEA 1JJ2A 4DV4Q 4B3ML 3KJOA 3PUZA 3K7AH 3AYHB 2C39B 2NVTH 1X3EA 2BH2A 1EIFA 1HR0L 1FJGL 3KJPA 3M4PA 1NE3A 4BA1B 2E2IH 1GO3E 3GTPH 4C2MH 5C0XI 2FMRA 1YITA 2QGQA 2AHOB 1EC6A 2YTXA 3STBC 1UDQA 3S17H 4AYBE 5C3EG 3GTKH 2PI2E 4HIDA 1UEBA 3CCUA 1KHIA 3ULPA 1XMOL 3CDJA 1A62A 1L0WA 4NXMQ 1ZZIA 2CTJA 2N49A 2OQKA 4R1JA 3OTOL 1BBUA 5C3EH 3F2BA 4GOPC 1S3OA 4IJHA 3S15H 3J7A5 3STBD 1YZ6A 1PH6A 2RHSB 1HNZL 4OO1C 4OWXB 5M3MG 1QVFA 1SN8A 1HR0W 4DR2L 4JI4Q 1VQBA 3CW2C 3PGZA 5C4XH 3BJUA 3GCMA 1WOCA 4A93G 4IFDI 1PHJA 5IYDG 2PO1B 2PNZA 3T1HL 2JE6A 5GROA 1N33L 2PO2B 4X64L 5LMUL 1UWVA 3K0XA 1KHMA 1Q46A 1WI5A 3NELA 3KLWA 3PSIA 3CMAA 2WNRB 1OXSC 4NPSA 5IYCH 1Y14B 1QUQA 2WNRA 2JEAA 4DR3Q 2UXCL 4UP8A 2VQEQ 5FJ8H 4K0KL 1G291 1UE5A 1BKBA 3J81j 3HOYG 3ICEA 4DV1Q 3GTQH 3RLOA 1X65A 3F2DA 2BL5A 4P75A 4XIGS 5C0XA 1W2BA 1X4NA 2VS1A 1ZZJA 1IYJB 4HJ8A 4LF7L 4BY7G 1KXLA 3FHWA 4OO1F 2A19A 3K8AA 1V43A 4DV6Q 1XNRL 3PV0A 4IPHA 3CCQA 1M90C 4JI0L 1SLJA 1ASYA 4IOAA 1Q12A 3RR5A 1Z47A 4DV7L 3G6EA 4WJ4A 4QL5A 2JEBI 3L2PA 1B7YB 1IXRA 5H1SE 2E2JH 4YY3L 3DLLA 4JOIC 3J81c 4A3FH 4A3KG 4OO1I 4JI6L 2JJQA 5IYDH 3U4ZA 1OXTA 4AYBG 4X62L 4DV5L 1K8GA 1I94Q 2RCNA 4UY8C 2VY3A 2LXKA 1OYSA 1IL2A 4DNIA 4X65Q 1Y1VG 3BZCA 4B3RL 4A3DG 1K8AC 1E3HA 3GTJH 4BY1H 2R93G 1IBLL 4B3SL 4GNXC 2UXCQ 4DUYQ 4HJ5A 1PH9A 1C9OA 2JA8H 4JI1L 4DR1Q 3RLNA 3M4QA 2YU9H 4B3RQ 4NBQA 1N32Q 3M85A 1RIPA 4YCVA 3HOXG 3J81i 2YV5A 4DUYL 4EQ5A 3T1HQ 2Q2UA 2PI2A 1SMXA 4A3LG 5IE8A 4OO1B 3CD6A 1TXYA 3GDEA 4JI8Q 2YQRA 2RHQB 3CP0A 4LFAQ 1L1OA 2UXDQ 3KRNA 5GAGC 4YY3Q 3A0JA 3CPFA 3HKZG 4AH6A 2BA1D 4GOPB 3E9IA 4DV4L 2BA0G 3GMEA 4JCVE 5IWAL 4B3MQ 2GN5A 5M3FG 2F4VL 1X55A 1PA6A 2EIFA 4IFDD 4O0AA 1XJVA 3S2DH 4LIJA 4JI3Q 3K81C 2R7DA 2AWOA 1SE8A 4QIWE 4DV7Q 4BXXH 4HIMA 5M5XH 4A3BG 1EQRA 1N36Q 4LF6Q 4YHHL 3S24A 1PV4A 1H95A 4LF7Q 2RF4A 1X3FA 3J80i 4LFCL 1VQPA 1XNRQ 5JJIA 1UDOA 5C0XB 4O2DA 2JA5H 1X6OA 3CAMA 3BU2A 2UUBQ 2R6GA 2BA0A 1WJJA 2DGYA 2NVYH 4LF8Q 1AE2A 5K36D 1DTJA 4LF4L 1HZCA 2AMCB 4GKKL 4AQYQ 2ZJPA 4JYAQ 2R7FA 4YWMA 1V1QA 4A3BH 3L7ZC 1PYBA 4KI0A 3K80C 2BA1G 3I4NG 4PZ6A 4JI6Q 2PO2A 2B29A 4Y52H 1MJCA 3G4SA 1J5KA 2JQOA 3CMEA 4QGUA 2Q2TA 4LF4Q 2BR2B 4IFDF 1N9WA 1EYGA 3AEVA 1JB7A 3CCRA 2PMZE 3UE0A 4A3GG 2CTEA 3KF8B 4GN4B 2V1CC 5BR8L 1PH1A 2CTFA 2WB1G 4QJFA 4POGA 4WALA 2HH2A 1BVSA 1NMFA 4QMFB 1X9NA 5M5YH 2PO0A 3AFPA 3HOXH 2UU9Q 4L5TA 4DK6C 3PUVA 1C0AA 2Q2IA 1PH2A 1OXUA 2MQHA 3KF6A 3NEMA 3FP9A 3CCJA 5JEAE 2CTKA 1GKHA 4POFA 1QZHA 1VQ9A 2E3UA 2OPUA 4OXPA 5LMNQ 2K75A 2JEBA 2JA6H 3PO2G 2K5VA 4NXML 2ZJQA 3KOJA 2CPQA 2UUCQ 4HJAA 3S1NH 1YNXA 2F52A 2K50A 1JJCB 1E7ZA 2FXQA 2R7ZH 1KAWA 3CCSA 4A3FG 1E24A 4C3IH 1HZ9A 2PQAB 3H1CA 3RNUA 5JEAC 1WFQA 4P73A 4GLXA 4BA2B 2GVBA 1J5EL 1VQAA 2HT1A 2NZOA 2HIVA 1UDSA 1VQCA 4BA1A 4JI1Q 4DR1L 4JI2Q 2K52A 1U0LA 1B8AA 3E0EA 3PCOB 2K5HA 4RG1A 3WWVA 3A5UA 1XNQQ 1R6MA 1NBWA 2D0OA 2JVZA 2HHHL 1A0IA 2XTIA 3ER0A 1OXXK 2PO0B 3JC66 1WYDA 2IT1A 1IBMQ 1MIUA 2HHHQ 1IBLQ 3RN5A 4YHHQ 4JBMA 4DUZL 1S72A 5JEAJ 4LF5Q 3AEVB 5ELOA 4DV3L 2K4KA 5IP7H 3RZOH 5BR8Q 2EQSA 4JG2A 2E5LL 3UDFA 4JI0Q 5K36E 1J6QA 4DV6L 4GNXB 3B4TA 1YIJA 4JI5L 4A93H 4PZ7A 1EFWA 3U50C 3HOZG 4OO1E 1UE6A 3BZKA 1LM0A 3A74A 3I55A 1P8LA 3HOWH 1YJ9A 4JBWA 1YI2A 4LF8L 5IP9H 4JI7L 4OX9Q 5LMNL 2C37A 2PQAA 3CF5A 4A3JG 1AH9A 4C3JH 3H0GH 5AJ3Q 2IHFA 4A3EH 2YYZA 1KIXA 3TS2A 1JJGA 5K36C 1CKMA 3U4VA 1CSPA 1I3QH 3CC7A 4LF9Q 5JEAA 4JV5L 1N36L 2Z0SA 2ZJRA 4DV2Q 1HH2P 4LFCQ 3HOWG 3MXNB 2QA4A 2F3IA 4IFDB 2WP8B 3FKIH 4KHZA 4OWTB 5GADC 5FLMH 5IY0A 3EN2A 1X4MA 4BBSG 4JI3L 4NB3A 4GOPA 4QY7A 1YHQA 1L1OB 1U5KA 3T1YQ 1XPUA 4A3CH 4LFAL 3HKZE 3AFQA 3PUXA 1HJPA 2ALYB 1K0RA 3GD7A 3OYYA 4A4IA 4JI2L 1KC8C 3KDFA 5C44G 4IO9A 1OTCA 3M9BA 3GTGH 2UXDL 1HZAA 3K7UC 4OO1D 2YTYA 4PG3A 2WB1E 4DV2L 4R4TA 5E7NA 4BBRG 3TREA 2B63G 1QUQB 5JJKA 1LYLA 1X54A 4A3CG 1YHBA 2VNUD 1WCMH 4DKAC 5IYBH 2UUCL 5ELNA 1IBKL 4DK3C 1VIGA 5JEAG 1VS0A 3F1ZA 2QEXA 4DV1L 3GTLH 3F8TA 3W1BA 2I5LX
chains in the Genus database with same CATH superfamily
1GVPA 5L37A 3S2DB 2ES2A 3QT6A 4RFBA 1CSQA 1HFGA 1NHJA 1B62A 1PZJD 2F4VQ 1HQMC 4DF7A 5C4JB 3I56A 4A3MH 4FO2A 2IWHA 2E8GA 3GTMH 1Y5YA 1PYSB 4DR7L 3D8GA 3I3CA 4HJ9A 5KIXA 1SRUA 4JI4L 2NN6H 1N34L 2Z6KC 1SYGA 2WAQG 1MBYA 1F2YA 5LHY1 2NN6A 2L55A 4LF6H 4DR7E 2DNEA 1DCZA 4JOIA 4CHTB 5E3FA 4JI8E 2C37B 5EBCA 3K6OA 1YBYA 4I7ZC 5EBDA 3FKIG 2ZTCA 3SGIA 1PMRA 5DAUA 3P76A 1HZBA 4R4IA 2VB2X 2VQEE 3CRLC 4JI5Q 4OX9E 2PQUA 2UUAH 1NXUA 2JXMB 4DR3I 1R6LA 2ASBA 1UG8A 4JPBW 4PMCA 1I4QA 3X3NA 2JK8A 1HNXQ 3G6JB 1E2ZA 3BDOA 1S5DD 1TWFH 4X62H 4DV5H 2PNZB 4CKCA 3GTMB 5LMNW 4R8IA 4TSSA 3E0JA 5COYA 2ZXPA 2DUDA 2MJHA 1LTBD 3WDNA 4C3HG 3OTOQ 3KBXA 2UU9H 2BA1A 2MFIA 3MWYW 4J3DA 4OX9I 1E3PA 3HOUG 1LABA 4DPWA 1SR3A 2ANRA 2PNRC 5C44H 2KA7A 5JVG3 1B4OA 4IPGA 3A8IE 3HRZC 3UDXA 2Q2EB 1J5EQ 5LMUQ 3FPPA 2J4XA 4M8AA 2IJ0A 1LT3D 4XQQA 1E2VA 1CKNB 4X6AH 2KCTA 2B8FA 3HOVG 4ISAA 5KYLA 3VA7A 1GUGA 4IURA 1IBMI 3M7ND 2CH4W 1MKHA 2IOQA 2YTVA 3A55A 1Y1WG 2RVLA 2R92G 1FI4A 4LFCI 2V2ZA 3L0OA 1KTVA 3OMCA 5DEHA 3J81E 1LUZA 2JEBA 1Z6HA 4NZRM 1QILA 4AIMA 4NXMI 2N3SA 5TSSA 5AJ3L 1PH4A 1EQVA 1HNXL 4LF5H 3U9OA 1SYEA 2R3ZA 4YWKA 3NBIA 1EY4A 1CM9A 4IPDA 4DR3L 1LLRD 4H13C 2B3GA 3V5RA 1NY4A 3CHBD 3SHLA 4DR1E 4A3IB 1J4WA 1V1OA 3LWUA 2J7ZA 3W2DA 2O5IC 3H3VI 1XPRA 1B9NA 2JEAB 5IGEA 5M3FH 2CTLA 5IT9c 1PVGA 5GQOA 1X3GA 3GQBA 3QO2A 1B2TA 1VQGA 2GS8A 3ZZ0A 3EIVA 4LFBI 4OCHA 3JAMC 3KF6B 2CKZB 4A3LH 3L7ZA 5IYBG 2V2QA 2F0IA 5ELCA 4DR4I 3EFXD 1VI7A 3NQTA 4RHRA 1I6VC 3TBIB 4A76A 1DZ1A 3LNNA 4IOCA 3J81W 4BY1G 1KIJA 4U673 2KBNA 1UUPA 1KRSA 1HA5A 5M3MH 5JEAF 4LF9E 1RF2D 4DR5L 3RF2A 1XX8A 1EOVA 1BCPC 2NBFA 1HR0Q 2B2VA 1N33E 4LFBL 2FHTA 2SEBD 1BQQT 1W6KA 4ZCKA 1WTXA 2EFGA 4DR4E 3AB9A 4JYAL 4WORA 3K85A 4K6DA 3P7JA 2UUBL 2CZ9A 4H02A 4DR4L 1PTOH 5IP9G 1N0VC 1G51A 5ELBA 4IFDH 3H94A 1ZXNA 3QG1A 2VUMH 1XRHA 2ENBA 4YHHE 5JEAD 3EBEA 5FJ8G 5IWAI 4LUOA 1S5FD 5GMDA 4GKJI 3EA6A 1O78A 3HG9A 5I6WA 3OSOA 2VQFQ 3WU3A 1G8ZD 4X65H 1SFOB 1F9RA 2SDFA 1C4QA 5I9PA 4ED4A 2N78A 3AMUA 2UXCH 1PH3A 1XNQL 3I4MH 5C0XE 4G08A 2HFSA 2UUBI 1VQFA 3HOYB 3KBGA 4X64Q 1O7YA 4OD6A 2IY5B 4H0LC 2A2DA 2IX3A 5EQ0A 3OIPA 5LL6R 2EYFA 4IFDJ 1T5EA 4HYMA 1HQRD 1JB3A 3KLSX 1EYAA 1IBML 2CWFA 1EFID 1TWHH 3CC4A 3Q0AA 4OO1G 1ESFA 3TP6A 1W3SA 4IUTA 1K83H 4ZAIA 1N34E 3PO3H 3WU5A 3B78A 1EL0A 4N3OA 5I2YA 4C3HB 4LFBQ 5FLXQ 3PUWA 3QWNA 3HOVB 3VKEA 1WTHA 3V05A 4JBKA 4HACB 1HPCA 3J80c 4RMFA 2J0TD 4HSPA 1E1OA 3I4LA 3OIQA 4HEDA 3ZYYX 1WD0A 3VYTA 4DV3Q 1DT4A 4FYDA 3NENA 3BS1A 2QDLA 2WAQE 3MFGA 4IFDE 1DOMA 5I4DA 2EE1A 2F3WA 4RWSC 3BVMA 1SAPA 4AM3A 1VIHA 3BDCA 3KLSA 1UE7A 2BR2A 3W5OA 1HK7A 3GTQB 2AXYA 1JJ2A 1MGSA 5DNLA 3PUZA 4KD3A 2DNCA 2NVTH 2BH2A 4L6TB 1NE3A 1G91A 3J81C 4KK7A 3I4NB 1I4XA 4F87A 5EKIA 2B2WC 4RPFA 2L0CA 2AHOB 2UXBE 1IBLE 2YTXA 3STBC 3I90A 3PS1A 3S17H 4AYBE 2JA7B 5D14A 4HIDA 5A2QL 1L0WA 1NR4A 2CTJA 2HFUA 2OQKA 2ZXOA 1BBUA 1BUVT 5C3EH 4GOPC 2HHHH 1Z0VA 2AQ1B 3J7A5 2KJXA 4YHHH 3NHHA 4FWHA 2EYMA 4HN7A 4XYQA 1HUMA 2VF3A 1HR0W 4N9PA 5EGTA 4JI4Q 2A5HA 3CW2C 1LT5D 5C4XH 2WW4A 1PHJA 3ZKDA 2JE6A 4DV2E 5LMUL 5J39A 3S2HB 3K0XA 1SE3A 1Q46A 4WJWA 2RQXA 4PRVA 1OXSC 3MTSA 1QUQA 2WNRA 1FJGH 1RJTA 4K0KL 3J81j 1BKBA 1EI1A 3RLOA 2BE5C 4X66I 2HCIA 2XSCA 2Z5BA 4A3FB 1X4NA 4F8MA 2VS1A 1ZZJA 5IIFA 4DUZI 5ELFA 4QB4A 1G2TA 1SLJA 2G8YA 4IOAA 4JI2I 3G6EA 2JEBI 4NKLA 2B63B 5H1SE 3CWVA 3FMCA 4YY3L 3DLLA 4JOIC 3J81c 4A3FH 5IYDH 3U4ZA 3SXHA 1K8GA 1FKAE 1MG7A 2F4VI 1OYSA 2LXKA 1RD9D 4LFAE 2A68D 3NWSA 4DNIA 3HJCA 4A3DG 1EY6A 5I6YA 4GKKH 3I73A 2DJGC 4MN3A 4HJ5A 4FP5D 1C9OA 5LMUE 4JI1L 4MYTA 3RLNA 3M4QA 1CTMA 5T1GA 4YCVA 1IBLH 3HOXG 2EYOA 1IBKH 2Q2UA 4DGZA 4JI1E 4OO1B 1TXYA 2EYHA 3HZXA 4LF7E 4OEMB 2NVTB 1EYCA 4GOPB 2XRQD 3GMEA 5IWAL 5M9OA 4S3SA 4MU1A 3T1HI 4JI6I 1SJHD 4HIMA 4A3BG 1EQRA 1N36Q 4LF6Q 1GJXA 1PV4A 1H95A 3MFYA 1XNRQ 1VQPA 5GMEA 3OWFA 1UDOA 4B3SI 2VESA 4DV0H 1X6OA 3CAMA 3BU2A 5ELWA 1JC7A 4B3TI 2DGYA 2NVYH 4LF8Q 3VR2A 5K36D 1DTJA 3R2IA 1FJGE 2OF1A 4JYAQ 4GKKL 4JI5H 3T4AC 4Z9CB 4ME5A 1HR0I 1EWCA 3TMEA 5DRPA 2L5TA 5EPJA 4Y52H 4DR5H 1J5KA 2JQOA 1DOLA 3CMEA 2BR2B 4HCEA 3TN2A 3WU4A 1JB7A 2CTEA 3KF8B 2EJMA 1PH1A 1J5EI 1PZID 1U4MA 2EY2A 5IGDA 4POGA 4BY7B 4H44C 1X9NA 3L3OC 5M5YH 1G2SA 3AFPA 3FRPB 2UU9Q 4L5TA 4DUZH 1RR9A 3GTGB 3PS3A 3S16B 3CCJA 4FWGA 4BBRB 2D5DA 1EU3A 5LMNQ 5C4ZA 3NK9A 4X66H 4GKJH 1EY7A 1SNCA 2K5VA 3PO2G 4NXML 2ZM6H 4PMBA 2A6EC 2HKJA 1JJCB 2FXQA 2R7ZH 5LMUH 2Z9HA 5C0XH 2EJFC 3H1CA 2LF0A 4P73A 4BA2B 1IBKE 4DR5I 2X06A 4JI1Q 1U0LA 2C39A 3E0EA 1XNQQ 2HDMA 2D0OA 1CHQD 5IWAE 2HHHL 1A0IA 4C1NI 3GV3A 2FFKB 5LMNI 1RODA 5C4HA 1WYDA 2HCCA 1SYFA 1FNVA 2E5LE 1QNKA 4JBMA 2K32A 4DR7H 4ODGA 3OW7A 2KCNA 1KABA 1QOHA 5ELOA 4DV3L 1PLFA 2K4KA 5IP7H 2VUMB 1XNQE 4TKOB 3H3VC 3D3RA 4BY1B 4DV6L 2BDNA 3B4TA 3P20A 1ICFB 4IZJA 1H74A 2B2VC 3M7GA 1ZEQX 4JBWA 4LF8L 2CVRA 4CDEC 1X32A 3NWTA 1TWCB 4A3JG 4AYBB 1AH9A 3EJIA 3H0GH 2IHFA 4A3EH 4DR6H 5K36C 1X3PA 3U4VA 3J7AK 4JI0E 1I3QH 5A35A 4JV5L 1HH2P 5ELEA 2O1VA 4IFDB 4DV3I 2LY7A 4HSVA 5CV7A 5FLMH 5IY0A 1X4MA 3R3OA 4R8NA 4UAIA 3QT7A 1WTWA 1Z59A 3PUXA 1HJPA 4DV4I 1K0RA 3GD7A 3P3EA 1KC8C 1LO5D 2I07B 1HZAA 2FINB 2K5DA 4OO1D 2YTYA 4I7AA 3D6WA 4R4TA 5E7NA 3TREA 2B63G 1OJ4A 4DR1I 1QUQB 4JI7I 1YHBA 1S5ED 2VNUD 1V8CA 4DK3C 4P2CB 5FK9C 1VS0A 4V190 1TR5A 2QEXA 4DV1L 3GTLH 2BV3A 3F8TA 3B6YA 1Q8KA 3JAMi 4A3IH 2K33A 1PH7A 3T1HH 2Z4HA 3VR4A 1TS3A 1F2MA 4LNQA 3W1GA 5K36B 5IGFA 2CFMA 2K01A 4DPGA 2WP8A 2L12A 1VQOA 5DRQA 2F0LA 2UXDI 2OEOA 3OPOA 2UUCI 1MSZA 4JV5Q 4EVOA 1VQNA 2VZAA 3P1HA 2WACA 1XNRH 4G57A 4EQOA 2UUBH 1CUKA 3H15A 3JAMc 1PRTF 2MO1A 4B8TA 1BR9A 2VKCA 4AQYH 2WV6D 4EX5A 1Z0WA 2JA7H 5CYUA 4L5SA 2B2TC 2K14A 1DM0B 1WCMB 2KEDA 4JV5E 2Z4IA 2G5DA 1KDCA 1H9RA 3I4NH 4LF4H 1D5MC 3K5NA 3KFUA 1PH8A 2LFNA 1PIEA 1KQSA 5KYIA 4EC5A 2O2LD 1WVLA 1QWYA 1VQDA 4KHVA 2ATWA 1AE3A 2FJ2A 4KJOA 1KNEA 5C0XG 1EZ8A 1S40A 1ZTGA 4DAPA 2R7ZG 3CXCA 4P52A 4DAMA 4DV3E 2EZVA 1SE2A 3DM1A 1PTOC 3CQZH 4GKJQ 3G71A 2D9UA 4ULLA 4KHPI 3CCVA 2UUCH 4BA2I 4CGYB 1R9TH 3M3YH 1E22A 1Q1BA 1TWAH 4C3JB 1N33I 4DAYB 2LXJA 2GQ0A 1SE4A 3RLFA 4DK0A 3Q23A 3PIP3 3V69A 1XPOA 2PY9A 1Y1WH 2R92H 2DGRA 5LMNE 2DEIA 2JA7G 4MIUA 4NXNL 1DGSA 1KLUD 1ZM3A 5DNXA 1MHWC 3D4RA 3P3GA 1YVCA 2UU9L 3IAYA 2XN9C 1TT2A 1PQXA 1H73A 2K5NA 3D31A 4HIKA 4IZKB 1RHYA 1P16A 2Y0SB 5IT9L 1X56A 5C0XJ 2E74C 1VQ6A 4NXME 3H3VH 5C4JH 1D8LA 1G6PA 3HOUH 3QIAA 1E1TA 5BR8I 4CBVA 2E5LQ 4JI8I 1S5CD 1Z2IA 1OO9B 1CQVA 3UI2A 2XVSA 2NN6C 3I91A 5FLXL 2NN6B 4C3IB 1Z0BA 2A1SA 4DR6Q 1TS5A 2UXBL 4OIJA 4DV1I 1SEIA 1ICWA 3ZZUA 4LF6L 1Z9FA 3TQYA 2VQEI 5G3LF 3IRBA 2WKDA 4TQUS 3TS0A 4LFCH 4R4OA 4GLAC 5CGKA 4L5RC 3NBHB 5M5WH 5EL9A 4IPCA 1SFOH 4Y7NH 1VQ8A 4FW9A 4HJ7A 1ONLA 4HXZA 3D0FA 3M85G 2D62A 3IFDA 4A3DH 1ZKOA 1OYPA 3T56B 2PZUA 2JA6G 3HOZB 1GD7A 4LF9L 4LFBE 4IZJB 3LGJA 1ZXTA 5KNBA 5FLMG 3F2CA 3S1NB 4A3DB 4NW2A 3J7AG 4K5XA 3RN2A 3M4OH 2NVQH 3NSWA 1USUA 1S20A 4KMUC 5K36G 2VQEL 4LCGA 2VQFE 3H0GG 4PU9A 5DM73 4DV6H 3PF4A 3KDFB 3AQQA 2J65A 3J81L 4LK1C 4MYUA 4DPYA 1N33Q 1TU2B 3P06A 2Z1CA 1OYRA 2I0QA 3O13A 4MU4A 1Y1VH 2KENA 4X3TA 1V9NA 1VQ5A 2JP1A 3UDGA 1HA6A 1K0SA 1AZPA 1I94H 1S4ZA 4K6LA 3PIPA 4QQBX 5KGUA 4K0KI 1FGUA 4YY3E 1FVIA 3HOUB 2JA5G 2F1DA 1VQIA 1HNWQ 4N8X1 4DU8A 5DLQE 3S1MH 4APVA 1Y60A 4NDXA 1ZYRD 5D3DA 3MEFA 2Y3MA 1JWSD 1TS2A 3DEOA 3M4YA 2UUAQ 1EY8A 2SNSA 4AIDA 3CPWA 4GNXA 1W6JA 2VW9A 1ET6A 1BBXC 2N8NA 4B3MH 3KDGA 1LTLA 4A75A 4L8JA 2F0UA 1Y1WB 2R92B 1PFSA 4IUPA 2EDGA 2BDOA 5DROA 1EUJA 4KHPE 1VMPA 4N9TA 4XQJA 1HNXE 5A2QQ 2JA8B 1XMOQ 1U2RA 4OX9L 2MJ8A 2HDLA 3OMGA 2RCFA 4HMIA 1LT6D 3CQZB 5A2QC 1ZZKA 1QVCA 4LJZC 2CQOA 2FMCA 2H5XA 4WUCA 2QILA 1A8VA 4GZYC 1PH5A 4JI6H 1QVGA 1JMCA 3DXJC 4MTNA 2E2JB 1STGA 1VF5C 3M85D 5CORA 3CDIA 1STYA 1KDAA 1QZGA 3VYRA 1UE1A 1N34I 2B2WA 1F9SA 1B53A 4P74A 3HOZH 1F0XA 1HNWI 2OQ0A 4RA8A 3GV6A 4WJ3M 4OIKA 4JI2E 2F0FA 4EGVA 3L7ZB 2ZM6Q 4DV4Q 5M5WB 1D5XC 4GKKE 3K7AH 2Z5CA 4E9JA 2C39B 1X3EA 1EIFA 2L9HA 5DM63 4LFAI 1Z0EA 1GUNA 1DOKA 4X62I 4DV5I 2E2IH 1Z5AA 1D1IA 4LF5I 2FMRA 1N32E 4JI1H 2QGQA 1P42A 3PYDA 5M5XB 4NXNI 1PFMA 5K36H 1UEBA 3ULPA 5HURA 3CDJA 5DNFA 1A62A 2X7IA 1JE4A 2Q8TA 2N49A 4R1JA 3OTOL 4QCLA 5LL6X 4IJHA 3STBD 4JI3E 4B3MI 1VQBA 1BOSA 3BJUA 3OHXC 4IFDI 4LOMA 3V2TA 5IYDG 2F3VA 1KHMA 2WNRB 1VF7A 3MZ5A 4HACA 1Y14B 2K7VA 1N0UA 1S5BD 4DR3Q 2VQEQ 4NZTM 2RDHA 5FJ8H 4FF2A 3HOYG 3ICEA 4DV1Q 2HUGA 3F2DA 3GTOB 4P75A 4K0KH 1HTPA 2CHBD 3H09A 4LF7L 5NUCA 5J22A 3FHWA 4OO1F 3PS2A 4JI1I 2C5CA 3SEBA 1BDOA 1V43A 4IPHA 4IS9A 2SNMA 2EXZA 4DUZE 4DR2I 2E5LI 2KQ3A 4B9WA 3H0GB 3NQIA 1TWGB 4QL5A 3T1YH 4B3RE 2F0JA 1T5XD 1RDPD 4OO1I 4DR4H 3LWEA 3TDQA 5E4WC 4DV6I 2EY1A 3S15B 2JEAA 4X62L 4DV5L 1I94Q 3BZCA 1K8AC 5JVH3 3GTJH 4BY1H 1SNQA 3SE0A 2ICEC 4GNXC 1IBLL 4XYOA 2AUJD 2R42A 3HULA 1PH9A 5G3LD 2YU9H 1N32Q 1RIPA 3NTKA 1PZKD 2BOSA 1IKLA 1GXDC 1V1PB 2YV5A 4C2MB 4DUYL 5EJWA 3QT5A 4XQNA 1JORA 1SMXA 1N36E 1IHZA 4BS9A 4A3LG 1S16A 4JV5I 3CD6A 4R1FA 4X64H 2KHSA 3CP0A 4LFAQ 3HOWB 2UXDQ 2VQFI 1LTGD 3CPFA 3HKZG 4AH6A 3E9IA 4DV4L 2GO3A 4JCVE 4B3MQ 1HNZH 1Y8OB 5M3FG 1PA6A 2EIFA 2PT7G 4LIJA 4JI3Q 4QIWE 4FW3A 1XMQH 1H9SA 2EYJA 3SK6A 4UTGA 3E5SA 1AW7A 2RF4A 4LFCL 5C0XB 4JW0A 1JCKB 1I50B 3SR1A 3WOEA 2JA5H 2R6GA 1ENAA 2BA0A 2RSOA 5KNDA 1JICA 1MU5A 4LF4L 2AMCB 4UHVA 1XXEA 2ZJPA 4A3BH 1V1PA 2CGEA 3L7ZC 2E1RA 3K80C 1FJGI 5E4XA 3I4NG 4LF6E 4PZ6A 4JI6Q 4JI0I 4PNYA 3GTLB 5M5YB 3KLRA 3BZDB 1AZQA 1EYGA 3CCRA 2PMZE 2A74C 5A2QE 1YNNC 4QMFB 1NMFA 3OTOH 1H7SA 3HOXH 1PH2A 1OXUA 5C5MA 5JEAE 2HHHI 2CTKA 4ZYSA 1WUUA 1QZHA 3RUZA 1EEID 4OXPA 2K5QA 2KOLA 2JA6H 3MC0B 1TQOA 2UUCQ 4A3KB 1YNXA 3KUPA 1F9QA 4RGMA 3R93A 3VR3A 5JPMC 2NTSA 2Z8LA 1QZRA 4A3FG 4X3SA 2PQEA 2E2HB 2PQAB 1I3QB 3RNUA 4OKGA 5JEAC 1O7LA 4JI7E 3T13A 1J5EL 1VQAA 2HIVA 4A3EB 1VQCA 4JI2Q 2K52A 2E76C 4HCSA 3A5UA 1F9PA 2K5HA 5D3IB 1GUSA 1H9SB 2NTTA 2JVZA 3M6AA 2XTIA 4DN4M 3ER0A 1OXXK 2UXBI 5ISRA 5A2QW 1MIUA 1PXUA 3B8HA 3J7AV 1RHPA 2X6GA 2K03A 3FAUA 5FWKA 5BR8Q 1GUOA 2EQSA 4JG2A 3UDFA 4JI0Q 2IESA 4LCHA 2B2YC 1J6QA 4GNXB 4KV6A 2R3VA 4AQYE 4I3HA 4PZ7A 2JA6B 3U50C 3HOZG 1UE6A 3BZKA 1SMYD 3I55A 1P8LA 3SDZA 1WTOA 5IP9H 3LPSA 1LTID 5LMNL 5IT9C 4LF5E 2CWHA 1L0XB 4CDCC 1EIGA 4DV1H 5AJ3Q 1JJGA 1C8CA 3J80W 1CKMA 5EPKA 1CSPA 3GONA 3CC7A 5FO7B 3TP8A 1QE6A 4DV2Q 4LFCQ 2Q8RE 3MXNB 1K8MA 5EKLA 2QA4A 1HNZE 3KDKA 4KTAA 1DONA 1LTAD 4G4KA 4XDXA 3EN2A 4B3TE 4USKA 4BBSG 5JEAH 1YHQA 2IW3A 3J7AF 4HY1A 1U5KA 3T1YQ 2A69C 3SK5A 1XPUA 1PDQA 3AFQA 3HKZE 4A4IA 5CBAE 1FNMA 3GTGH 4WJ4A 3KDFA 3M9BA 1K47A 2UUCE 4H8AA 2B8GA 2WB1E 2PNMA 3A7LA 2O1WA 1QB5D 4DA2A 1B50A 1LYLA 4A3CG 2V8PA 1TY0A 5IYBH 3K17A 2IPKD 2UUCL 1J5EE 4DUYH 4JI7H 5C4XB 4CJ2C 1A6FA 2C37A 1N32H 4X65L 4B3RQ 4B3SQ 1YNJC 1O7IA 2LTLA 4HAEA 4OELB 1HNZI 2O3ZA 1A3VA 1RL2A 3BYYB 1N33H 5CV8A 4LCFA 2O1UA 3FDTA 2ZM6L 1CZGA 1GOZA 1EZ6A 1HRJA 1Q90A 2A73B 1ZM4A 1H9MA 1EOTA 2I5MX 4IUUA 5JJLA 2CWAA 1NHHA 4JI3H 2UUAE 4PMWA 3PO2H 4DV7H 4WANA 2Y0SE 1NCVA 3VDYA 1LV9A 1Q81C 4OWWB 4PRXA 5LL6b 4GLVB 4FXGC 2F0KA 4EQPA 4X3UA 4LF7H 4DV0Q 4BBSH 3FEWX 4AQYL 2X36A 4JVHA 3HKMA 4LF8H 1PFBA 4DR3E 4JYAH 3GLLA 5DRRA 1XTDA 2A68C 1SYCA 4LUVA 2ZITA 4OO1H 3GTKB 4DV1E 4LF4I 1EEFD 2XGTA 1BXTA 1CK1A 3X3MA 5D65A 4DR2H 1VQEA 4DV0E 2PNHA 2L15A 3OSSD 1ML0D 4B3TQ 3UHMA 3I8ZA 2UUAI 2HH3A 3L9AX 1L2FA 4JC0A 4RKBA 3T1YE 2HIXA 3HP3A 5JEAB 1BCPF 1SBBB 1FNWA 2B63H 2JEAI 1PRTD 2LSSA 1XMOH 2JE6I 4LFBH 4X66Q 1H9KA 4C3HH 5JOBA 1DJRD 1SYBA 2F0PA 3V96A 4DAYA 5IT9W 1VQLA 4F88A 1I94L 4ABNA 5J1ZA 3ND9A 2HQLA 2VUMG 2ZM6I 1O7ZA 1TWHB 1Y4UA 1AN8A 1XYIA 1XTCD 4R4QA 1M1KC 4FW5A 4M1UB 3OW2A 4KY5A 1Q86C 3GR5A 1KNAA 3VA5A 5KRUA 4B08A 5HY6A 1YNJD 3S2HH 5ELDA 2MP1A 4PV1C 4NXNH 1E2WA 1VISA 2KECA 2RA4A 3ULLA 1XMQE 3HFZB 2AWNA 3NBHA 4Q0FA 2IX0A 5FLXc 4DV4H 3KF8A 3FVQA 2L4NA 5BR8H 2CPMA 2MPMA 1LT4D 3K7AB 3N6RA 5IP7G 2ID0A 1Z0CA 5C3EB 5C0XD 4UPAA 2J7KA 4X64I 4JYAE 1GHJA 3BVZA 4L63B 3PYGA 5I9OA 3DEPA 1WHRA 5BN4A 2F0SA 3A5ZB 2CVEA 1NTGA 2PZTA 2E2HH 4DV0I 3KK7A 3G48A 1JWUD 1I4RA 3I2ZA 1I6HB 4M1KA 3RZDH 2SOBA 1YH8A 3PYFA 2AQ2B 1I4GA 4ALPA 1RKNA 1ELOA 1M8AA 3OTOE 2JA9A 2NN6D 5T1IA 2HK3A 1K73C 3AU7A 3KYHC 1STAA 3LX0A 2R93H 5C4XG 2QDBA 4JI4I 2G9HD 1ESRA 4IQZA 2PO4A 4DR7I 1M4VA 1DYQA 4JI8L 1VQ7A 2NPFA 2PCFB 2IHEA 4FJUA 3I7FA 4DR3H 4DPTA 4RKLA 4A3KH 1N32L 2OXPA 1C7YA 4KJNA 1U9RA 2MNAA 4JI7Q 2X69A 4JBJA 4K0KQ 1J8IA 4R4CA 1IYVA 3D4DA 4U3DA 4IZJD 5C6AA 1OXVA 3S1QH 3QT8A 2G9DA 2C38A 4YIJA 4YCUA 1D5ZC 1K3BC 1YHAA 1ZXMA 1HNWE 3HOVH 2ZTEA 3CCEA 1EA6A 5C3XA 4IJLA 4UDUC 3HKZB 1XMQL 4YY3I 2WFWA 3TP7A 5C0XC 2O4XA 4HIOA 1CHPD 5BN3A 4FW6A 1STHA 3NTIA 2HQEA 1RTOA 2QNDA 1MSGA 1K83B 4DV2I 4DXLA 1YEZA 4YCWA 2DJFC 3NP8A 2OTLA 2C38B 3D4JA 1GM5A 4X62E 4DV5E 4JVYA 3JAML 2DY7A 4IZ8A 4ID6A 4TVAB 1I50H 2NVXH 1IBKQ 3S14H 3K1JA 1XNRI 3HKSA 4K14A 4LMQD 3EROA 4BA1I 4Z7YA 3DM3A 4CKEA 2NZ1D 5GAEC 4MZ9A 4A3IG 1N34Q 3M7NA 1L0YB 3GABA 2EXDA 4JI8H 4LFAH 2UXDH 4J8QA 3HOYH 1EY9A 3ZZTA 1I4PA 4LUZA 5CV4A 1FL0A 2ZT9C 4GN3B 1FWKA 1S4EA 2XEXA 2C9OA 2EYLA 3F0NA 4B3RI 4X3KA 4B3TH 4L5QA 3T51B 3UDIA 2NUCA 2NVQB 1TWGH 1A3TA 4RGOS 2UUAL 1A2TA 3M4OB 1KLGD 1YHCA 3OOCA 1JT8A 4DR6L 5LL6S 4QNJA 3OWEB 1PYWD 2C35B 3GTJB 4IFDC 2CWPA 1SXTA 5JPNC 1LTRD 5CV6A 1D7QA 4KKUA 1ASZA 2I46A 3J80Q 4K0KE 1Y6ZA 1B70B 1E0BA 4A3MG 4KHPQ 1D6TA 3TZUA 3U1YA 1EWHA 2OCEA 4O42A 2BCOA 5FLXE 1ZM2A 3BDLA 2P2RA 4QUCA 3B82A 4DUZQ 3Q24A 2QKIC 4KKSA 1Q1EA 4KLKA 1CKOA 4NXNQ 3K0YA 2AKWB 4LWCA 3GTOH 2UXBH 1DD2A 4J6HA 2EY5A 2OPVA 5E1FA 5IWAQ 3KJOA 1F77A 3AYHB 3CU7A 1HNXI 1EY0A 1B44D 1FJGL 2V2VA 3M4PA 2B39A 3C46A 4I65A 1GO3E 4RCOA 5FKAC 3GTPH 1EC6A 1Y69U 4B3SE 3LTOA 2E5LH 4IN3A 4LF9I 4QNKA 1Z5BA 5C3EG 2PI2E 1XMOL 3CCUA 2ZM6E 5F2DA 4NXMQ 4USMA 3F2BA 5JJZA 1X0AA 1S3OA 3TP5A 3MXGA 1IKMA 1JWMD 5JAVA 1YZ6A 5IOCA 1PH6A 2PNLA 1HNZL 4OO1C 5M3MG 1SN8A 4DR2L 2B2UA 3GCMA 1WOCA 2M6QA 4KY6A 3T1HL 2PNZA 4DR6E 4DU7A 1WI5A 3KLWA 3CMAA 2F0TA 4NPSA 4YHHI 2F0NA 4CDDC 2UXCL 1B9MA 1FGBD 3J80L 3SB1A 1UE5A 1X65A 5IT9Q 1H9JA 2AE8A 3K58A 2JT2A 5C0XA 1PRTC 2BL5A 4FF1A 4LF9H 1IYJB 4HJ8A 2X6LA 4BY7G 1FKAH 4DV2H 3A8KE 3K8AA 5HGTA 4X65E 4DV6Q 1XNRL 1CT1D 1QCBD 3CCQA 1M90C 3Q1QA 5C44B 2F0DA 1ASYA 1Q12A 2K1BA 1Z47A 4FXDA 4DV7L 1UEAB 4NXNE 1NSNS 3L2PA 3J81Q 1B7YB 1IXRA 2PMZB 2E2JH 2BM0A 4JI6L 2JJQA 3EQLC 3K57A 3GKUA 1OXTA 2VQFH 4UY8C 2VY3A 1IL2A 1Y1VG 4DV6E 1PKPA 4Q5VA 2QF7A 1R4QB 2JA8H 4DR1Q 2Z5CB 3ITPA 4B3SH 3J81i 4DR6I 3T53B 2E2DC 4EQ5A 3GTPB 3DHQA 2YQRA 1N34H 1L1OA 4YY3Q 3A0JA 1JQYD 3SVMA 2GN5A 2F4VL 4IFDD 1X55A 5CV9A 2K6AA 3K81C 1PTOD 4DV7Q 3C3LA 3RZOB 3T1HE 4YHHL 2O1TA 3K5MA 3J80i 1X3FA 3WOFA 4V0BA 1IBLI 4O2DA 4DFAA 4XTJA 2UUBQ 2EOTA 1AE2A 4B3ME 3S1MB 2MGSA 1J9OA 1HZCA 2L1BA 4IALA 1LTTD 1PYBA 4ZUJA 3NCVA 3ZM7A 2VB3X 2EY6A 1KAAA 2PO2A 3OETA 3G4SA 4MQYA 2Q2TA 4ZRZA 4QGUA 5L3JA 4IFDF 4X66E 4DXGA 4KHPH 3AEVA 4DV3H 3UE0A 2V1CC 4OZEA 2CTFA 2WB1G 1RCVD 5CR3A 1BVSA 4DK6C 3R8BA 2PW7A 2Q2IA 2MQHA 3NEMA 2XNAC 3FP9A 4MU3A 4JI6E 1NNXA 3VR5A 4C1NK 1SNDA 1VQ9A 2E3UA 1NUCA 1VDZA 2OPUA 1JR0D 3VR6A 5FLXC 3BG3A 3KOJA 1HCZA 5IWAH 3NUCA 4KKTA 4HJAA 3S1NH 2K50A 2XWBB 3FKIB 4RGTA 4G7OC 2HK2A 4FVMA 4DUYE 1E7ZA 1J5EH 3CCSA 2Q8IB 4C3IH 3PYEA 3I72A 1WFQA 3A8JE 2HT1A 2IOPA 4BA1A 2NVXB 3S14B 2CW0C 4DR1L 1Z0TA 1B8AA 3PCOB 1CQFA 4RG1A 4Y7NB 3WWVA 1WTQA 4QMGA 1MI2A 3QJYA 3ND8A 2F4VE 2PO0B 2K28A 3JC66 2IT1A 1A15A 1N36I 4FWDA 4IZKA 4DV7E 1X9ZA 4DUZL 5CC4A 1SDFA 5FOBB 1S72A 4LF5Q 1EU4A 4JI4H 4ZUIA 3RZOH 2E5LL 5K36E 2K05A 1AN7A 3J7YW 4LF8E 4A93H 3RD4A 3S1QB 4ZQ3A 2FPHX 1EFWA 2H1EA 4OO1E 1LM0A 2FMMA 3A74A 1ZM9A 4JI7L 4FW4A 3CF5A 1RREA 4C3JH 3TZDA 1IBKI 1KIXA 1KKHA 1STBA 3TS2A 1IYUA 1AP0A 1B63A 2B2UC 1N36L 2ZJRA 1FD7D 3HOWG 3QR8A 1DARA 2F3IA 4F7XA 4OWTB 4ZLTF 2CW0D 1CA6A 4WRDA 4QY7A 2ZBKB 1PTOF 4HMJA 1Z5CA 2LMCB 3PO3G 1WTRA 2QCPX 5C44G 1MD2D 1TWAB 2NVYB 4PG3A 4LFCE 3M3YB 1R9TB 4DV2L 1B3AA 4BBRG 2Z6BA 4FNFA 4H7BA 4CJ1B 5AFWA 4DPUA 1WCMH 4DKAC 1IBKL 2M8WA 3P75A 3F1ZA 3NE5B 2NWGA 3W1BA 2I5LX 4GLXA 3TRZA 4FJSA 3S1RH 4XXEA 1A63A 1EWIA 2LKVA 1B1ZA 3TSSA 1D6EC 1I94I 1SMYC 2M00A 1YJNA 4ME3A 2PYKA 1Y8PB 4RH6A 2EYPA 2F0OA 4C3JG 1VQJA 3I4MG 1F2ZA 3RZDB 1FYCA 4OL7A 2D9IA 3G7LA 1F2LA 3P3CA 1XMQQ 4JI4E 1TS4A 4NP5A 1N36H 5EAYA 3WU6A 3PIOA 4DR5E 1Z7TA 2DY8A 2A8VA 2JSOA 2TSSA 4EQNA 4BA2A 1YJWA 3QOLA 2IX1A 4UP7A 2KHIA 3QD7X 4MHEA 1I5FA 4IFDG 2NN6G 2JZXA 2ZXRA 2WB1B 3M7NG 2QEJC 4KN7C 3URYA 1GHKA 4A3EG 4DR5Q 1Q7YC 4A3JH 1U4RA 2O4CA 4GKJE 2PZWA 2DEJA 5K36F 4K8JA 2JEBB 4OONA 2LS01 3IFTA 2RDFA 2TMPA 1USVA 4AQYI 1NMGA 3C2PA 3ZJYC 4MU0A 3DD6A 3UOEA 2A2CA 1YNND 4O1NA 5EKKA 4IFDA 4LF4E 3SK4A 2NN6I 5FO8B 4BXXG 2ZTDA 1EY5A 2I5HA 3PQIA 1T9HA 1EIYB 2P5ZX 3I4OA 2A69D 2VXWA 3CCLA 2A1AA 3ZKBA 3Q8DA 1PRTB 1TWCH 4JK1C 4GN5A 2EJGC 2Q2HA 2BA0D 4JI5I 2A6HC 4E6IA 1K8OA 3T16A 4J15A 1XNQH 4DV0L 2JE6B 2OI2A 1VQ4A 2F0GA 1DXMA 2F0MA 4QIWB 2KCMA 2UXBQ 1HUNA 4PZ8A 1VCIA 1U4LA 2VL6A 4OO1A 3J7ZC 4DR7Q 2ANNA 4RCNA 2NN6E 4KHPL 3K5OA 4K5WA 3Q6NA 2KCCA 3UE1A 4JI0H 1EYDA 3U9SA 3GP7A 3QOJA 3GO5A 1NAPA 4KN4C 1EQQA 4P7AA 4BBSB 4RAUC 2M9VA 3ULJA 3MVVA 1BO0A 1V9PA 4ZK9B 2EVBA 4NXMH 3MA2B 2R7ZB 4X66L 1K9MC 1SEBD 4RHSA 3E6ZX 5J3BA 3C1EA 1HNWL 3PMFA 2B2TA 1WCMG 5IYCG 1WVNA 2XWJB 4BBRH 3DUZA 1HTLD 2Z5EA 2IERA 2JA8G 1WE8A 3A54A 1UEKA 5CMDA 5C0XF 2CTMA 1JE5A 2KEEA 1BCPB 1XHKA 3N52A 1VBIA 2ICIA 1FJGQ 1D2BA 4G7ZC 1KD1C 1VQKA 3PO3B 2F0WA 1EQTA 3H4LA 4GS3A 2CG9A 1N8RC 5KEEA 1H7UA 1NZ0A 4CDFC 1L1OC 2WINB 1NJIC 3S16H 4B3RH 2Y0SG 5CV5A 2OTJA 2CPQA 4A3GH 2MHVA 4OGQC 3MAQA 3BYTB 4FDBA 4BY7H 5EKWA 1Q8IA 1II3A 1VQMA 4FF3A 1BBWA 2R61A 1K1GA 1UNSA 3MXNA 4WUDA 1LACA 4PQXA 4DR4Q 1SROA 2R93B 2RDGA 4Z7CA 5K36A 1VQHA 2JN4A 2NZHA 1U4PA 3U1KA 5LMUI 2WKCA 4G7HC 4CJ0B 4R9WA 3I4MB 4XT1B 3IKJA 2CCZA 1O80A 1V8QA 1NR2A 1KRTA 4GKKQ 4OHJA 1CI3M 2O5JC 1ET9A 2F0QA 3TEHB 1JOQA 2BH8A 2D0PA 2V34A 1I6HH 1D1KA 1XNRE 1UDNA 2OWOA 1SSOA 1G6ZA 4DV7I 4YY3H 2UUBE 5GAHC 4LF5L 1HNXH 3ONAB 4DR2Q 4X62Q 4DV5Q 2NN6F 2WP8J 1HNZQ 2GVAA 3R2TA 4C3IG 2F0EA 1I4HA 1IBME 3T1YL 4KY7A 2V4DA 1IL8A 2WAQB 3CKIB 3CC2A 2A6ED 1B3QA 3HOXB 4XTCS 1CKNA 4B3TL 5IODA 4JVZA 4FXKC 2KUMA 1QJOA 4DR2E 5IGGA 4DUYI 3QB3A 4P72A 3JAMQ 4MNOA 1PFNA 2WIIB 4URLA 1KTKA 3F2UA 5HGQA 1CZWA 4LW1A 1Q82C 2Z5BB 4A3GB 1TUAA 4QUFA 1AEXA 1FWLA 1PVOA 2CQAA 2VQFL 1SJED 3MEHA 4A3BB 5DT9A 1BKNA 1NHIA 3D6CA 4B9XA 1Y4SA 4FN5A 3E9HA 2D2CC 5C5LA 4ZKBB 3EZJA 4GKJL 4C56C 2Z6KA 1IZ6A 1K3RA 4YWLA 1KL9A 1EIHA 2BE5D 1XMOI 2DN8A 2K5WA 3PF5A 3PUYA 1STEA 3CCMA 2MO0A 1FR3A 1QG7A 4P71A 5LMNH 4GKKI 2KHJA 1R4PB 2UU9I 3ERSX 3U58A 4B3ML 4UP9A 1MJEA 1SNOA 3Q6MA 4TRDA 2F0HA 1HXYD 1TIID 1HR0L 3KJPA 1TVXA 2UXCE 4BA1B 2JA5B 3S17B 4K5VA 4IUVA 4C2MH 3DWPA 5C0XI 3A7AB 1YITA 4JI2H 3E3XA 1UDQA 3GTKH 2LRRA 1JOKA 1KHIA 1KVKA 2F0VA 4JYAI 4DU9A 2UXCI 1ZZIA 3HS0C 4PDBA 1IBMH 2PPBC 4MTKA 4X65I 1BCPD 4DNTB 4LAAA 3S15H 3S1RB 2K1HA 2RHSB 2H4OA 4OWXB 3H6MA 1QVFA 1A3UA 4UT4A 3J80C 5IGCA 1VMCA 3PGZA 5IT9E 3PO2B 2IL8A 4JI3I 4A93G 1CA5A 2PO1B 5BN5A 2GO4A 5GROA 1N33L 2PO2B 1IW7D 4X64L 2YU9B 1UWVA 3HEJA 3NELA 3PSIA 4ILWA 1WTVA 2M2LA 5IYCH 1ILQA 4N8FA 1HR0H 4UP8A 4OX9H 1G291 1XXGA 3J80E 3GTQH 1C48A 1N32I 4XIGS 1W2BA 1Z0GA 1KXLA 4GQUA 1Q3LA 4U3BA 1I94E 2N88A 2A19A 3PIO3 4XT3B 4MDTA 3PV0A 2LTMA 2RBMA 4JI0L 2RKSA 1A6XA 1HHVA 3RR5A 2UU9E 1K28A 1QNUA 4A3KG 4K2LA 2L11A 4AYBG 2RCNA 4LF8I 3DWQA 4X65Q 4B3RL 1MSHA 1E3HA 4K2KA 2B2YA 2NYZD 3K59A 2R93G 1HNWH 4B3SL 2UXCQ 1JOOA 4DUYQ 3NZKA 4EMDA 1STNA 3NXWA 4NBQA 4NMZA 4LF6I 3LNUA 4LPFA 3M85A 4A3JB 4KD4A 2MUYA 2HD3A 3Q22A 3C1FA 3T1HQ 1TY2A 2PI2A 1BF4A 5IE8A 3CRKC 3GDEA 1ENFA 1GUTA 4JI8Q 2RHQB 2HKEA 4A3MB 4U68A 3KRNA 1XMQI 5GAGC 2F4VH 4HTHA 2BA1D 2BA0G 3BVGA 1ODHA 5I2XA 4O0AA 1XJVA 3S2DH 4DXFA 3Q6SA 2LJPA 2R7DA 2AWOA 1SE8A 4BXXH 3PRYA 2HHHE 4CKBA 2QW7A 5M5XH 3S24A 4X64E 4JV5H 4LF7Q 2K04A 5JJIA 2UXDE 2E2IB 3S9WA 1Y8NB 1PTOB 2CH4A 1WJJA 3VYSA 1HR0E 1RTNA 4AQYQ 2R7FA 4YWMA 1V1QA 4KI0A 2BA1G 1WTJA 1IW7C 1ENCA 2B29A 1MJCA 4FF4A 4J1MA 4LF4Q 3EVQA 1N9WA 1SNPA 3T1YI 4A3GG 5IGBA 5BR8L 4GN4B 1AFPA 1SNMA 1XMOE 5M3MB 4QJFA 2XIWA 2KVMA 4WALA 4DAVA 1WD1A 3J7AM 2HH2A 1LTSD 4DNRB 2PO0A 2FFMA 1C0AA 3PUVA 3KF6A 2JYOA 1XNQI 1GKHA 1A2UA 4POFA 4ZKCB 3NPPA 2AUKA 2K75A 3VYUA 3JAMW 3MHBA 2ZJQA 4HR7B 4K8IA 4ZVIA 1MX0A 2F52A 3RMHA 2F1MA 1KAWA 1E24A 1HZ9A 4BWGB 2GVBA 2NB0A 3D4WA 2NZOA 5EPLA 1UDSA 1S03G 2E75C 2BM1A 1X3QA 1UAPA 1R6MA 1NBWA 2N55A 4DV4E 5KNCA 4LF7I 5FO9B 4A93B 3W3AA 4FW7A 1IBMQ 2HHHQ 1GUWA 3RN5A 4YHHQ 5JEAJ 1BNZA 3I70A 1Y1VB 3AEVB 2A6HD 5M3FB 2OT2A 3V2UC 4B8CD 3DWAA 5CBEE 3H91A 3SK8A 1YIJA 1WTPA 4JI5L 3IL8A 4DPXA 2ZQEA 3JAME 5FLXW 1SYDA 3K5LA 2F03A 3HOWH 1YJ9A 1TKWB 1FNUA 1YI2A 3A56A 4DK1A 1ILPA 4OX9Q 4JI5E 2VQEH 2PQAA 4IUQA 4KQVA 2YYZA 2RSNA 3MXPA 5BR8E 3MXUA 3OTOI 4LF9Q 5JEAA 2Z0SA 2F4IA 2WP8B 3FKIH 4KHZA 5GADC 2AQ3B 4JI3L 4NB3A 5K5PA 4WFN3 4GOPA 1H72C 4IUNA 4JG4A 5C3WA 1L1OB 4A3CH 3DMUA 4JI2L 4LFAL 2ALYB 3NTHA 2AJ4A 3OYYA 4WUBA 2PW5A 3ERQA 4IO9A 2XRSD 1OTCA 2UXDL 3HGBA 1ZYRC 3K7UC 4RGNA 1HFNA 4QF4A 1TWFB 3I0PA 1CFMA 1X54A 5JJKA 1I6UA 1VIGA 5ELNA 3FPUB 1KDBA 2GA4B 5JEAG 4DR1H 1XWEA 2PO1A 2EPBA 1IBLQ
chains in the Genus database with same CATH topology
1GVPA 1O7IA 3B6YA 1Q8KA 3JAMi 3TRZA 3S1RH 4A3IH 1PH7A 2ES2A 1A63A 1CSQA 1EWIA 1RL2A 2F4VQ 1YJNA 3I56A 4ME3A 4A3MH 2ZM6L 2E8GA 4LNQA 3GTMH 1VQJA 3W1GA 3I4MG 2CFMA 4DPGA 1PYSB 4DR7L 2WP8A 5K36B 4HJ9A 1VQOA 2I5MX 5JJLA 1SRUA 2CWAA 4JI4L 1N34L 2Z6KC 4PMWA 1XMQQ 3PO2H 4WANA 2WAQG 2Y0SE 3VDYA 2NN6A 1Q81C 4OWWB 5EAYA 4GLVB 3PIOA 4JV5Q 2A8VA 1VQNA 2VZAA 4JOIA 4BA2A 1YJWA 4DV0Q 4BBSH 2C37B 4AQYL 2IX1A 4UP7A 2KHIA 1CUKA 1YBYA 3H15A 4JVHA 3HKMA 3FKIG 2ZTCA 3JAMc 1I5FA 2MO1A 3SGIA 2NN6G 4IFDG 4B8TA 1HZBA 4R4IA 3GLLA 2JZXA 1XTDA 4JI5Q 4EX5A 2PQUA 4LUVA 3M7NG 2JA7H 1R6LA 2ASBA 4L5SA 2K14A 2XGTA 4A3EG 2JK8A 1HNXQ 4DR5Q 1Q7YC 4A3JH 3I4NH 1VQEA 1TWFH 3KFUA 1PH8A 2PNZB 2PNHA 2L15A 1KQSA 5LMNW 5K36F 4B3TQ 2JEBB 2DUDA 4OONA 2MJHA 2HH3A 3OTOQ 1VQDA 2ATWA 4JC0A 1L2FA 1NMGA 1AE3A 2HIXA 5C0XG 1S40A 2BA1A 2MFIA 3ZJYC 5JEAB 2R7ZG 1ZTGA 3CXCA 3DD6A 4DAMA 1E3PA 2B63H 2JEAI 3HOUG 4IFDA 1SR3A 2LSSA 2JE6I 3CQZH 4X66Q 2NN6I 4GKJQ 3G71A 2ANRA 4BXXG 2ZTDA 2I5HA 4C3HH 5C44H 1T9HA 4IPGA 3CCVA 1EIYB 4BA2I 3I4OA 3UDXA 3CCLA 1R9TH 3M3YH 2A1AA 1J5EQ 1E22A 5LMUQ 1Q1BA 3Q8DA 1TWAH 1VQLA 1TWCH 4DAYB 2LXJA 1I94L 4GN5A 3RLFA 2HQLA 2Q2HA 2VUMG 1CKNB 4X6AH 2BA0D 3V69A 2KCTA 1XPOA 2PY9A 1Y1WH 2R92H 2DGRA 3HOVG 4J15A 4R4QA 1M1KC 2JA7G 3PO3G 4DV0L 4NXNL 3OW2A 1Q86C 2JE6B 3M7ND 1MKHA 1DGSA 2YTVA 5HY6A 1VQ4A 1Y1WG 2R92G 3L0OA 3S2HH 1YVCA 4OO1A 4X65L 2UU9L 4B3SQ 1LUZA 2KCMA 2UXBQ 2K5NA 3D31A 1VCIA 3HFZB 4PZ8A 3ULLA 2AWNA 2VL6A 4AIMA 2N3SA 4HIKA 5AJ3L 3J7ZC 1P16A 2IX0A 1PH4A 1HNXL 5FLXc 4DR7Q 2NN6E 1X56A 5C0XJ 4KHPL 2ANNA 1VQ6A 4YWKA 3H3VH 5C4JH 3UE1A 1D8LA 4IPDA 4DR3L 5IP7G 1G6PA 2ID0A 5C0XD 2B3GA 3GO5A 3HOUH 1NY4A 4UPAA 1EQQA 1E1TA 1J4WA 3H3VI 1XPRA 2E5LQ 2JEAB 3A5ZB 3ULJA 5M3FH 2NN6C 2CTLA 1NTGA 1V9PA 5IT9c 2E2HH 2NN6B 3G48A 4DR6Q 3I2ZA 5GQOA 1X3GA 2UXBL 1VQGA 4X66L 3RZDH 3EIVA 1Z9FA 5J3BA 3TQYA 1K9MC 4LF6L 3KF6B 1HNWL 4ALPA 2CKZB 3IRBA 4TQUS 3TS0A 4A3LH 3L7ZA 1WCMG 5IYBG 4R4OA 5IYCG 4GLAC 1WVNA 4L5RC 2JA9A 3NBHB 4BBRH 5M5WH 4IPCA 1SFOH 2NN6D 4Y7NH 1K73C 2JA8G 4A76A 3KYHC 1WE8A 1VQ8A 4IOCA 4HJ7A 4BY1G 2R93H 5C4XG 3D0FA 3M85G 2D62A 4A3DH 5C0XF 1OYPA 2CTMA 2KBNA 1JE5A 1KRSA 4JI8L 5M3MH 1VQ7A 5JEAF 4DR5L 2JA6G 1EOVA 1GD7A 2IHEA 4LF9L 3I7FA 3LGJA 1HR0Q 5FLMG 3F2CA 1FJGQ 4LFBL 4A3KH 1KD1C 1VQKA 3RN2A 3M4OH 1N32L 1C7YA 4GS3A 2NVQH 2MNAA 1N8RC 4JI7Q 4JYAL 1L1OC 4K0KQ 4JBJA 5K36G 2VQEL 4R4CA 3S16H 1NJIC 3H0GG 1OXVA 2Y0SG 2UUBL 3S1QH 2OTJA 4A3GH 3PF4A 4YCUA 2C38A 4H02A 3KDFB 3AQQA 1YHAA 5IP9G 4DR4L 4FDBA 4BY7H 3HOVH 2ZTEA 3CCEA 1G51A 1N33Q 4IJLA 1VQMA 1XMQL 2WFWA 2VUMH 1BBWA 5C0XC 4HIOA 1K1GA 1OYRA 2I0QA 1Y1VH 2KENA 5JEAD 3EBEA 5FJ8G 4LUOA 1SROA 4DR4Q 5K36A 1VQ5A 1VQHA 3UDGA 2NZHA 3U1KA 2QNDA 2VQFQ 4QQBX 3PIPA 1YEZA 1FGUA 4YCWA 1FVIA 2OTLA 2JA5G 2C38B 2CCZA 1VQIA 2N78A 1KRTA 1GM5A 4GKKQ 5DLQE 3S1MH 1PH3A 1HNWQ 1XNQL 3I4MH 4JVYA 5C0XE 4APVA 1VQFA 3TEHB 2BH8A 2D0PA 4TVAB 1I50H 2NVXH 1IBKQ 3S14H 3MEFA 1I6HH 3HKSA 4X64Q 4BA1I 2UUAQ 3DM3A 2IY5B 5GAEC 4MZ9A 4A3IG 1N34Q 3M7NA 2OWOA 1UDNA 2EXDA 3CPWA 4GNXA 4AIDA 2VW9A 5GAHC 4LF5L 3HOYH 4DR2Q 2N8NA 4X62Q 4DV5Q 4IFDJ 2WP8J 4LUZA 1LTLA 1HNZQ 2NN6F 2GVAA 1FL0A 4A75A 3T1YL 4GN3B 1IBML 2C39A 1TWHH 3CC4A 4OO1G 1PFSA 4L5QA 3CC2A 1W3SA 1K83H 3UDIA 1TWGH 2UUAL 4XTCS 1CKNA 1EUJA 4B3TL 3PO3H 1JT8A 1XMOQ 4DR6L 4LFBQ 4OX9L 4P72A 4MNOA 3PUWA 1ZZKA 1QVCA 5HGQA 2C35B 4IFDC 3VKEA 2CQOA 4LW1A 2CWPA 1Q82C 2H5XA 4JBKA 3J80c 1A8VA 4RMFA 1PH5A 1TUAA 1D7QA 1ASZA 1E1OA 1PVOA 1QVGA 1JMCA 2VQFL 4MTNA 1B70B 4A3MG 4KHPQ 3M85D 3CDIA 4DV3Q 1DT4A 1QZGA 1UE1A 3NENA 2OCEA 3E9HA 2WAQE 4IFDE 4GKJL 2P2RA 4P74A 3HOZH 2Z6KA 1IZ6A 1K3RA 4YWLA 4DUZQ 1KL9A 2OQ0A 4AM3A 4KLKA 1Q1EA 3PF5A 2PO1A 1VIHA 1CKOA 3PUYA 3CCMA 4NXNQ 4WJ3M 2MO0A 4P71A 2AKWB 4LWCA 1UE7A 3GTOH 2BR2A 3W5OA 2KHJA 2OPVA 2AXYA 3ERSX 3L7ZB 2ZM6Q 5IWAQ 4UP9A 3U58A 1MJEA 1JJ2A 4DV4Q 4B3ML 3KJOA 3PUZA 3K7AH 3AYHB 2C39B 2NVTH 1X3EA 2BH2A 1EIFA 1HR0L 1FJGL 3KJPA 3M4PA 1NE3A 4BA1B 2E2IH 1GO3E 3GTPH 4C2MH 5C0XI 2FMRA 1YITA 2QGQA 2AHOB 1EC6A 2YTXA 3STBC 1UDQA 3S17H 4AYBE 5C3EG 3GTKH 2PI2E 4HIDA 1UEBA 3CCUA 1KHIA 3ULPA 1XMOL 3CDJA 1A62A 1L0WA 4NXMQ 1ZZIA 2CTJA 2N49A 2OQKA 4R1JA 3OTOL 1BBUA 5C3EH 3F2BA 4GOPC 1S3OA 4IJHA 3S15H 3J7A5 3STBD 1YZ6A 1PH6A 2RHSB 1HNZL 4OO1C 4OWXB 5M3MG 1QVFA 1SN8A 1HR0W 4DR2L 4JI4Q 1VQBA 3CW2C 3PGZA 5C4XH 3BJUA 3GCMA 1WOCA 4A93G 4IFDI 1PHJA 5IYDG 2PO1B 2PNZA 3T1HL 2JE6A 5GROA 1N33L 2PO2B 4X64L 5LMUL 1UWVA 3K0XA 1KHMA 1Q46A 1WI5A 3NELA 3KLWA 3PSIA 3CMAA 2WNRB 1OXSC 4NPSA 5IYCH 1Y14B 1QUQA 2WNRA 2JEAA 4DR3Q 2UXCL 4UP8A 2VQEQ 5FJ8H 4K0KL 1G291 1UE5A 1BKBA 3J81j 3HOYG 3ICEA 4DV1Q 3GTQH 3RLOA 1X65A 3F2DA 2BL5A 4P75A 4XIGS 5C0XA 1W2BA 1X4NA 2VS1A 1ZZJA 1IYJB 4HJ8A 4LF7L 4BY7G 1KXLA 3FHWA 4OO1F 2A19A 3K8AA 1V43A 4DV6Q 1XNRL 3PV0A 4IPHA 3CCQA 1M90C 4JI0L 1SLJA 1ASYA 4IOAA 1Q12A 3RR5A 1Z47A 4DV7L 3G6EA 4WJ4A 4QL5A 2JEBI 3L2PA 1B7YB 1IXRA 5H1SE 2E2JH 4YY3L 3DLLA 4JOIC 3J81c 4A3FH 4A3KG 4OO1I 4JI6L 2JJQA 5IYDH 3U4ZA 1OXTA 4AYBG 4X62L 4DV5L 1K8GA 1I94Q 2RCNA 4UY8C 2VY3A 2LXKA 1OYSA 1IL2A 4DNIA 4X65Q 1Y1VG 3BZCA 4B3RL 4A3DG 1K8AC 1E3HA 3GTJH 4BY1H 2R93G 1IBLL 4B3SL 4GNXC 2UXCQ 4DUYQ 4HJ5A 1PH9A 1C9OA 2JA8H 4JI1L 4DR1Q 3RLNA 3M4QA 2YU9H 4B3RQ 4NBQA 1N32Q 3M85A 1RIPA 4YCVA 3HOXG 3J81i 2YV5A 4DUYL 4EQ5A 3T1HQ 2Q2UA 2PI2A 1SMXA 4A3LG 5IE8A 4OO1B 3CD6A 1TXYA 3GDEA 4JI8Q 2YQRA 2RHQB 3CP0A 4LFAQ 1L1OA 2UXDQ 3KRNA 5GAGC 4YY3Q 3A0JA 3CPFA 3HKZG 4AH6A 2BA1D 4GOPB 3E9IA 4DV4L 2BA0G 3GMEA 4JCVE 5IWAL 4B3MQ 2GN5A 5M3FG 2F4VL 1X55A 1PA6A 2EIFA 4IFDD 4O0AA 1XJVA 3S2DH 4LIJA 4JI3Q 3K81C 2R7DA 2AWOA 1SE8A 4QIWE 4DV7Q 4BXXH 4HIMA 5M5XH 4A3BG 1EQRA 1N36Q 4LF6Q 4YHHL 3S24A 1PV4A 1H95A 4LF7Q 2RF4A 1X3FA 3J80i 4LFCL 1VQPA 1XNRQ 5JJIA 1UDOA 5C0XB 4O2DA 2JA5H 1X6OA 3CAMA 3BU2A 2UUBQ 2R6GA 2BA0A 1WJJA 2DGYA 2NVYH 4LF8Q 1AE2A 5K36D 1DTJA 4LF4L 1HZCA 2AMCB 4GKKL 4AQYQ 2ZJPA 4JYAQ 2R7FA 4YWMA 1V1QA 4A3BH 3L7ZC 1PYBA 4KI0A 3K80C 2BA1G 3I4NG 4PZ6A 4JI6Q 2PO2A 2B29A 4Y52H 1MJCA 3G4SA 1J5KA 2JQOA 3CMEA 4QGUA 2Q2TA 4LF4Q 2BR2B 4IFDF 1N9WA 1EYGA 3AEVA 1JB7A 3CCRA 2PMZE 3UE0A 4A3GG 2CTEA 3KF8B 4GN4B 2V1CC 5BR8L 1PH1A 2CTFA 2WB1G 4QJFA 4POGA 4WALA 2HH2A 1BVSA 1NMFA 4QMFB 1X9NA 5M5YH 2PO0A 3AFPA 3HOXH 2UU9Q 4L5TA 4DK6C 3PUVA 1C0AA 2Q2IA 1PH2A 1OXUA 2MQHA 3KF6A 3NEMA 3FP9A 3CCJA 5JEAE 2CTKA 1GKHA 4POFA 1QZHA 1VQ9A 2E3UA 2OPUA 4OXPA 5LMNQ 2K75A 2JEBA 2JA6H 3PO2G 2K5VA 4NXML 2ZJQA 3KOJA 2CPQA 2UUCQ 4HJAA 3S1NH 1YNXA 2F52A 2K50A 1JJCB 1E7ZA 2FXQA 2R7ZH 1KAWA 3CCSA 4A3FG 1E24A 4C3IH 1HZ9A 2PQAB 3H1CA 3RNUA 5JEAC 1WFQA 4P73A 4GLXA 4BA2B 2GVBA 1J5EL 1VQAA 2HT1A 2NZOA 2HIVA 1UDSA 1VQCA 4BA1A 4JI1Q 4DR1L 4JI2Q 2K52A 1U0LA 1B8AA 3E0EA 3PCOB 2K5HA 4RG1A 3WWVA 3A5UA 1XNQQ 1R6MA 1NBWA 2D0OA 2JVZA 2HHHL 1A0IA 2XTIA 3ER0A 1OXXK 2PO0B 3JC66 1WYDA 2IT1A 1IBMQ 1MIUA 2HHHQ 1IBLQ 3RN5A 4YHHQ 4JBMA 4DUZL 1S72A 5JEAJ 4LF5Q 3AEVB 5ELOA 4DV3L 2K4KA 5IP7H 3RZOH 5BR8Q 2EQSA 4JG2A 2E5LL 3UDFA 4JI0Q 5K36E 1J6QA 4DV6L 4GNXB 3B4TA 1YIJA 4JI5L 4A93H 4PZ7A 1EFWA 3U50C 3HOZG 4OO1E 1UE6A 3BZKA 1LM0A 3A74A 3I55A 1P8LA 3HOWH 1YJ9A 4JBWA 1YI2A 4LF8L 5IP9H 4JI7L 4OX9Q 5LMNL 2C37A 2PQAA 3CF5A 4A3JG 1AH9A 4C3JH 3H0GH 5AJ3Q 2IHFA 4A3EH 2YYZA 1KIXA 3TS2A 1JJGA 5K36C 1CKMA 3U4VA 1CSPA 1I3QH 3CC7A 4LF9Q 5JEAA 4JV5L 1N36L 2Z0SA 2ZJRA 4DV2Q 1HH2P 4LFCQ 3HOWG 3MXNB 2QA4A 2F3IA 4IFDB 2WP8B 3FKIH 4KHZA 4OWTB 5GADC 5FLMH 5IY0A 3EN2A 1X4MA 4BBSG 4JI3L 4NB3A 4GOPA 4QY7A 1YHQA 1L1OB 1U5KA 3T1YQ 1XPUA 4A3CH 4LFAL 3HKZE 3AFQA 3PUXA 1HJPA 2ALYB 1K0RA 3GD7A 3OYYA 4A4IA 4JI2L 1KC8C 3KDFA 5C44G 4IO9A 1OTCA 3M9BA 3GTGH 2UXDL 1HZAA 3K7UC 4OO1D 2YTYA 4PG3A 2WB1E 4DV2L 4R4TA 5E7NA 4BBRG 3TREA 2B63G 1QUQB 5JJKA 1LYLA 1X54A 4A3CG 1YHBA 2VNUD 1WCMH 4DKAC 5IYBH 2UUCL 5ELNA 1IBKL 4DK3C 1VIGA 5JEAG 1VS0A 3F1ZA 2QEXA 4DV1L 3GTLH 3F8TA 3W1BA 2I5LX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GVP A;  1O7I A;  3B6Y A;  1Q8K A;  3JAM i;  3TRZ A;  3S1R H;  4A3I H;  1PH7 A;  2ES2 A;  1A63 A;  1CSQ A;  1EWI A;  1RL2 A;  2F4V Q;  1YJN A;  3I56 A;  4ME3 A;  4A3M H;  2ZM6 L;  2E8G A;  4LNQ A;  3GTM H;  1VQJ A;  3W1G A;  3I4M G;  2CFM A;  4DPG A;  1PYS B;  4DR7 L;  2WP8 A;  5K36 B;  4HJ9 A;  1VQO A;  2I5M X;  5JJL A;  1SRU A;  2CWA A;  4JI4 L;  1N34 L;  2Z6K C;  4PMW A;  1XMQ Q;  3PO2 H;  4WAN A;  2WAQ G;  2Y0S E;  3VDY A;  2NN6 A;  1Q81 C;  4OWW B;  5EAY A;  4GLV B;  3PIO A;  4JV5 Q;  2A8V A;  1VQN A;  2VZA A;  4JOI A;  4BA2 A;  1YJW A;  4DV0 Q;  4BBS H;  2C37 B;  4AQY L;  2IX1 A;  4UP7 A;  2KHI A;  1CUK A;  1YBY A;  3H15 A;  4JVH A;  3HKM A;  3FKI G;  2ZTC A;  3JAM c;  1I5F A;  2MO1 A;  3SGI A;  2NN6 G;  4IFD G;  4B8T A;  1HZB A;  4R4I A;  3GLL A;  2JZX A;  1XTD A;  4JI5 Q;  4EX5 A;  2PQU A;  4LUV A;  3M7N G;  2JA7 H;  1R6L A;  2ASB A;  4L5S A;  2K14 A;  2XGT A;  4A3E G;  2JK8 A;  1HNX Q;  4DR5 Q;  1Q7Y C;  4A3J H;  3I4N H;  1VQE A;  1TWF H;  3KFU A;  1PH8 A;  2PNZ B;  2PNH A;  2L15 A;  1KQS A;  5LMN W;  5K36 F;  4B3T Q;  2JEB B;  2DUD A;  4OON A;  2MJH A;  2HH3 A;  3OTO Q;  1VQD A;  2ATW A;  4JC0 A;  1L2F A;  1NMG A;  1AE3 A;  2HIX A;  5C0X G;  1S40 A;  2BA1 A;  2MFI A;  3ZJY C;  5JEA B;  2R7Z G;  1ZTG A;  3CXC A;  3DD6 A;  4DAM A;  1E3P A;  2B63 H;  2JEA I;  3HOU G;  4IFD A;  1SR3 A;  2LSS A;  2JE6 I;  3CQZ H;  4X66 Q;  2NN6 I;  4GKJ Q;  3G71 A;  2ANR A;  4BXX G;  2ZTD A;  2I5H A;  4C3H H;  5C44 H;  1T9H A;  4IPG A;  3CCV A;  1EIY B;  4BA2 I;  3I4O A;  3UDX A;  3CCL A;  1R9T H;  3M3Y H;  2A1A A;  1J5E Q;  1E22 A;  5LMU Q;  1Q1B A;  3Q8D A;  1TWA H;  1VQL A;  1TWC H;  4DAY B;  2LXJ A;  1I94 L;  4GN5 A;  3RLF A;  2HQL A;  2Q2H A;  2VUM G;  1CKN B;  4X6A H;  2BA0 D;  3V69 A;  2KCT A;  1XPO A;  2PY9 A;  1Y1W H;  2R92 H;  2DGR A;  3HOV G;  4J15 A;  4R4Q A;  1M1K C;  2JA7 G;  3PO3 G;  4DV0 L;  4NXN L;  3OW2 A;  1Q86 C;  2JE6 B;  3M7N D;  1MKH A;  1DGS A;  2YTV A;  5HY6 A;  1VQ4 A;  1Y1W G;  2R92 G;  3L0O A;  3S2H H;  1YVC A;  4OO1 A;  4X65 L;  2UU9 L;  4B3S Q;  1LUZ A;  2KCM A;  2UXB Q;  2K5N A;  3D31 A;  1VCI A;  3HFZ B;  4PZ8 A;  3ULL A;  2AWN A;  2VL6 A;  4AIM A;  2N3S A;  4HIK A;  5AJ3 L;  3J7Z C;  1P16 A;  2IX0 A;  1PH4 A;  1HNX L;  5FLX c;  4DR7 Q;  2NN6 E;  1X56 A;  5C0X J;  4KHP L;  2ANN A;  1VQ6 A;  4YWK A;  3H3V H;  5C4J H;  3UE1 A;  1D8L A;  4IPD A;  4DR3 L;  5IP7 G;  1G6P A;  2ID0 A;  5C0X D;  2B3G A;  3GO5 A;  3HOU H;  1NY4 A;  4UPA A;  1EQQ A;  1E1T A;  1J4W A;  3H3V I;  1XPR A;  2E5L Q;  2JEA B;  3A5Z B;  3ULJ A;  5M3F H;  2NN6 C;  2CTL A;  1NTG A;  1V9P A;  5IT9 c;  2E2H H;  2NN6 B;  3G48 A;  4DR6 Q;  3I2Z A;  5GQO A;  1X3G A;  2UXB L;  1VQG A;  4X66 L;  3RZD H;  3EIV A;  1Z9F A;  5J3B A;  3TQY A;  1K9M C;  4LF6 L;  3KF6 B;  1HNW L;  4ALP A;  2CKZ B;  3IRB A;  4TQU S;  3TS0 A;  4A3L H;  3L7Z A;  1WCM G;  5IYB G;  4R4O A;  5IYC G;  4GLA C;  1WVN A;  4L5R C;  2JA9 A;  3NBH B;  4BBR H;  5M5W H;  4IPC A;  1SFO H;  2NN6 D;  4Y7N H;  1K73 C;  2JA8 G;  4A76 A;  3KYH C;  1WE8 A;  1VQ8 A;  4IOC A;  4HJ7 A;  4BY1 G;  2R93 H;  5C4X G;  3D0F A;  3M85 G;  2D62 A;  4A3D H;  5C0X F;  1OYP A;  2CTM A;  2KBN A;  1JE5 A;  1KRS A;  4JI8 L;  5M3M H;  1VQ7 A;  5JEA F;  4DR5 L;  2JA6 G;  1EOV A;  1GD7 A;  2IHE A;  4LF9 L;  3I7F A;  3LGJ A;  1HR0 Q;  5FLM G;  3F2C A;  1FJG Q;  4LFB L;  4A3K H;  1KD1 C;  1VQK A;  3RN2 A;  3M4O H;  1N32 L;  1C7Y A;  4GS3 A;  2NVQ H;  2MNA A;  1N8R C;  4JI7 Q;  4JYA L;  1L1O C;  4K0K Q;  4JBJ A;  5K36 G;  2VQE L;  4R4C A;  3S16 H;  1NJI C;  3H0G G;  1OXV A;  2Y0S G;  2UUB L;  3S1Q H;  2OTJ A;  4A3G H;  3PF4 A;  4YCU A;  2C38 A;  4H02 A;  3KDF B;  3AQQ A;  1YHA A;  5IP9 G;  4DR4 L;  4FDB A;  4BY7 H;  3HOV H;  2ZTE A;  3CCE A;  1G51 A;  1N33 Q;  4IJL A;  1VQM A;  1XMQ L;  2WFW A;  2VUM H;  1BBW A;  5C0X C;  4HIO A;  1K1G A;  1OYR A;  2I0Q A;  1Y1V H;  2KEN A;  5JEA D;  3EBE A;  5FJ8 G;  4LUO A;  1SRO A;  4DR4 Q;  5K36 A;  1VQ5 A;  1VQH A;  3UDG A;  2NZH A;  3U1K A;  2QND A;  2VQF Q;  4QQB X;  3PIP A;  1YEZ A;  1FGU A;  4YCW A;  1FVI A;  2OTL A;  2JA5 G;  2C38 B;  2CCZ A;  1VQI A;  2N78 A;  1KRT A;  1GM5 A;  4GKK Q;  5DLQ E;  3S1M H;  1PH3 A;  1HNW Q;  1XNQ L;  3I4M H;  4JVY A;  5C0X E;  4APV A;  1VQF A;  3TEH B;  2BH8 A;  2D0P A;  4TVA B;  1I50 H;  2NVX H;  1IBK Q;  3S14 H;  3MEF A;  1I6H H;  3HKS A;  4X64 Q;  4BA1 I;  2UUA Q;  3DM3 A;  2IY5 B;  5GAE C;  4MZ9 A;  4A3I G;  1N34 Q;  3M7N A;  2OWO A;  1UDN A;  2EXD A;  3CPW A;  4GNX A;  4AID A;  2VW9 A;  5GAH C;  4LF5 L;  3HOY H;  4DR2 Q;  2N8N A;  4X62 Q;  4DV5 Q;  4IFD J;  2WP8 J;  4LUZ A;  1LTL A;  1HNZ Q;  2NN6 F;  2GVA A;  1FL0 A;  4A75 A;  3T1Y L;  4GN3 B;  1IBM L;  2C39 A;  1TWH H;  3CC4 A;  4OO1 G;  1PFS A;  4L5Q A;  3CC2 A;  1W3S A;  1K83 H;  3UDI A;  1TWG H;  2UUA L;  4XTC S;  1CKN A;  1EUJ A;  4B3T L;  3PO3 H;  1JT8 A;  1XMO Q;  4DR6 L;  4LFB Q;  4OX9 L;  4P72 A;  4MNO A;  3PUW A;  1ZZK A;  1QVC A;  5HGQ A;  2C35 B;  4IFD C;  3VKE A;  2CQO A;  4LW1 A;  2CWP A;  1Q82 C;  2H5X A;  4JBK A;  3J80 c;  1A8V A;  4RMF A;  1PH5 A;  1TUA A;  1D7Q A;  1ASZ A;  1E1O A;  1PVO A;  1QVG A;  1JMC A;  2VQF L;  4MTN A;  1B70 B;  4A3M G;  4KHP Q;  3M85 D;  3CDI A;  4DV3 Q;  1DT4 A;  1QZG A;  1UE1 A;  3NEN A;  2OCE A;  3E9H A;  2WAQ E;  4IFD E;  4GKJ L;  2P2R A;  4P74 A;  3HOZ H;  2Z6K A;  1IZ6 A;  1K3R A;  4YWL A;  4DUZ Q;  1KL9 A;  2OQ0 A;  4AM3 A;  4KLK A;  1Q1E A;  3PF5 A;  2PO1 A;  1VIH A;  1CKO A;  3PUY A;  3CCM A;  4NXN Q;  4WJ3 M;  2MO0 A;  4P71 A;  2AKW B;  4LWC A;  1UE7 A;  3GTO H;  2BR2 A;  3W5O A;  2KHJ A;  2OPV A;  2AXY A;  3ERS X;  3L7Z B;  2ZM6 Q;  5IWA Q;  4UP9 A;  3U58 A;  1MJE A;  1JJ2 A;  4DV4 Q;  4B3M L;  3KJO A;  3PUZ A;  3K7A H;  3AYH B;  2C39 B;  2NVT H;  1X3E A;  2BH2 A;  1EIF A;  1HR0 L;  1FJG L;  3KJP A;  3M4P A;  1NE3 A;  4BA1 B;  2E2I H;  1GO3 E;  3GTP H;  4C2M H;  5C0X I;  2FMR A;  1YIT A;  2QGQ A;  2AHO B;  1EC6 A;  2YTX A;  3STB C;  1UDQ A;  3S17 H;  4AYB E;  5C3E G;  3GTK H;  2PI2 E;  4HID A;  1UEB A;  3CCU A;  1KHI A;  3ULP A;  1XMO L;  3CDJ A;  1A62 A;  1L0W A;  4NXM Q;  1ZZI A;  2CTJ A;  2N49 A;  2OQK A;  4R1J A;  3OTO L;  1BBU A;  5C3E H;  3F2B A;  4GOP C;  1S3O A;  4IJH A;  3S15 H;  3J7A 5;  3STB D;  1YZ6 A;  1PH6 A;  2RHS B;  1HNZ L;  4OO1 C;  4OWX B;  5M3M G;  1QVF A;  1SN8 A;  1HR0 W;  4DR2 L;  4JI4 Q;  1VQB A;  3CW2 C;  3PGZ A;  5C4X H;  3BJU A;  3GCM A;  1WOC A;  4A93 G;  4IFD I;  1PHJ A;  5IYD G;  2PO1 B;  2PNZ A;  3T1H L;  2JE6 A;  5GRO A;  1N33 L;  2PO2 B;  4X64 L;  5LMU L;  1UWV A;  3K0X A;  1KHM A;  1Q46 A;  1WI5 A;  3NEL A;  3KLW A;  3PSI A;  3CMA A;  2WNR B;  1OXS C;  4NPS A;  5IYC H;  1Y14 B;  1QUQ A;  2WNR A;  2JEA A;  4DR3 Q;  2UXC L;  4UP8 A;  2VQE Q;  5FJ8 H;  4K0K L;  1G29 1;  1UE5 A;  1BKB A;  3J81 j;  3HOY G;  3ICE A;  4DV1 Q;  3GTQ H;  3RLO A;  1X65 A;  3F2D A;  2BL5 A;  4P75 A;  4XIG S;  5C0X A;  1W2B A;  1X4N A;  2VS1 A;  1ZZJ A;  1IYJ B;  4HJ8 A;  4LF7 L;  4BY7 G;  1KXL A;  3FHW A;  4OO1 F;  2A19 A;  3K8A A;  1V43 A;  4DV6 Q;  1XNR L;  3PV0 A;  4IPH A;  3CCQ A;  1M90 C;  4JI0 L;  1SLJ A;  1ASY A;  4IOA A;  1Q12 A;  3RR5 A;  1Z47 A;  4DV7 L;  3G6E A;  4WJ4 A;  4QL5 A;  2JEB I;  3L2P A;  1B7Y B;  1IXR A;  5H1S E;  2E2J H;  4YY3 L;  3DLL A;  4JOI C;  3J81 c;  4A3F H;  4A3K G;  4OO1 I;  4JI6 L;  2JJQ A;  5IYD H;  3U4Z A;  1OXT A;  4AYB G;  4X62 L;  4DV5 L;  1K8G A;  1I94 Q;  2RCN A;  4UY8 C;  2VY3 A;  2LXK A;  1OYS A;  1IL2 A;  4DNI A;  4X65 Q;  1Y1V G;  3BZC A;  4B3R L;  4A3D G;  1K8A C;  1E3H A;  3GTJ H;  4BY1 H;  2R93 G;  1IBL L;  4B3S L;  4GNX C;  2UXC Q;  4DUY Q;  4HJ5 A;  1PH9 A;  1C9O A;  2JA8 H;  4JI1 L;  4DR1 Q;  3RLN A;  3M4Q A;  2YU9 H;  4B3R Q;  4NBQ A;  1N32 Q;  3M85 A;  1RIP A;  4YCV A;  3HOX G;  3J81 i;  2YV5 A;  4DUY L;  4EQ5 A;  3T1H Q;  2Q2U A;  2PI2 A;  1SMX A;  4A3L G;  5IE8 A;  4OO1 B;  3CD6 A;  1TXY A;  3GDE A;  4JI8 Q;  2YQR A;  2RHQ B;  3CP0 A;  4LFA Q;  1L1O A;  2UXD Q;  3KRN A;  5GAG C;  4YY3 Q;  3A0J A;  3CPF A;  3HKZ G;  4AH6 A;  2BA1 D;  4GOP B;  3E9I A;  4DV4 L;  2BA0 G;  3GME A;  4JCV E;  5IWA L;  4B3M Q;  2GN5 A;  5M3F G;  2F4V L;  1X55 A;  1PA6 A;  2EIF A;  4IFD D;  4O0A A;  1XJV A;  3S2D H;  4LIJ A;  4JI3 Q;  3K81 C;  2R7D A;  2AWO A;  1SE8 A;  4QIW E;  4DV7 Q;  4BXX H;  4HIM A;  5M5X H;  4A3B G;  1EQR A;  1N36 Q;  4LF6 Q;  4YHH L;  3S24 A;  1PV4 A;  1H95 A;  4LF7 Q;  2RF4 A;  1X3F A;  3J80 i;  4LFC L;  1VQP A;  1XNR Q;  5JJI A;  1UDO A;  5C0X B;  4O2D A;  2JA5 H;  1X6O A;  3CAM A;  3BU2 A;  2UUB Q;  2R6G A;  2BA0 A;  1WJJ A;  2DGY A;  2NVY H;  4LF8 Q;  1AE2 A;  5K36 D;  1DTJ A;  4LF4 L;  1HZC A;  2AMC B;  4GKK L;  4AQY Q;  2ZJP A;  4JYA Q;  2R7F A;  4YWM A;  1V1Q A;  4A3B H;  3L7Z C;  1PYB A;  4KI0 A;  3K80 C;  2BA1 G;  3I4N G;  4PZ6 A;  4JI6 Q;  2PO2 A;  2B29 A;  4Y52 H;  1MJC A;  3G4S A;  1J5K A;  2JQO A;  3CME A;  4QGU A;  2Q2T A;  4LF4 Q;  2BR2 B;  4IFD F;  1N9W A;  1EYG A;  3AEV A;  1JB7 A;  3CCR A;  2PMZ E;  3UE0 A;  4A3G G;  2CTE A;  3KF8 B;  4GN4 B;  2V1C C;  5BR8 L;  1PH1 A;  2CTF A;  2WB1 G;  4QJF A;  4POG A;  4WAL A;  2HH2 A;  1BVS A;  1NMF A;  4QMF B;  1X9N A;  5M5Y H;  2PO0 A;  3AFP A;  3HOX H;  2UU9 Q;  4L5T A;  4DK6 C;  3PUV A;  1C0A A;  2Q2I A;  1PH2 A;  1OXU A;  2MQH A;  3KF6 A;  3NEM A;  3FP9 A;  3CCJ A;  5JEA E;  2CTK A;  1GKH A;  4POF A;  1QZH A;  1VQ9 A;  2E3U A;  2OPU A;  4OXP A;  5LMN Q;  2K75 A;  2JEB A;  2JA6 H;  3PO2 G;  2K5V A;  4NXM L;  2ZJQ A;  3KOJ A;  2CPQ A;  2UUC Q;  4HJA A;  3S1N H;  1YNX A;  2F52 A;  2K50 A;  1JJC B;  1E7Z A;  2FXQ A;  2R7Z H;  1KAW A;  3CCS A;  4A3F G;  1E24 A;  4C3I H;  1HZ9 A;  2PQA B;  3H1C A;  3RNU A;  5JEA C;  1WFQ A;  4P73 A;  4GLX A;  4BA2 B;  2GVB A;  1J5E L;  1VQA A;  2HT1 A;  2NZO A;  2HIV A;  1UDS A;  1VQC A;  4BA1 A;  4JI1 Q;  4DR1 L;  4JI2 Q;  2K52 A;  1U0L A;  1B8A A;  3E0E A;  3PCO B;  2K5H A;  4RG1 A;  3WWV A;  3A5U A;  1XNQ Q;  1R6M A;  1NBW A;  2D0O A;  2JVZ A;  2HHH L;  1A0I A;  2XTI A;  3ER0 A;  1OXX K;  2PO0 B;  3JC6 6;  1WYD A;  2IT1 A;  1IBM Q;  1MIU A;  2HHH Q;  1IBL Q;  3RN5 A;  4YHH Q;  4JBM A;  4DUZ L;  1S72 A;  5JEA J;  4LF5 Q;  3AEV B;  5ELO A;  4DV3 L;  2K4K A;  5IP7 H;  3RZO H;  5BR8 Q;  2EQS A;  4JG2 A;  2E5L L;  3UDF A;  4JI0 Q;  5K36 E;  1J6Q A;  4DV6 L;  4GNX B;  3B4T A;  1YIJ A;  4JI5 L;  4A93 H;  4PZ7 A;  1EFW A;  3U50 C;  3HOZ G;  4OO1 E;  1UE6 A;  3BZK A;  1LM0 A;  3A74 A;  3I55 A;  1P8L A;  3HOW H;  1YJ9 A;  4JBW A;  1YI2 A;  4LF8 L;  5IP9 H;  4JI7 L;  4OX9 Q;  5LMN L;  2C37 A;  2PQA A;  3CF5 A;  4A3J G;  1AH9 A;  4C3J H;  3H0G H;  5AJ3 Q;  2IHF A;  4A3E H;  2YYZ A;  1KIX A;  3TS2 A;  1JJG A;  5K36 C;  1CKM A;  3U4V A;  1CSP A;  1I3Q H;  3CC7 A;  4LF9 Q;  5JEA A;  4JV5 L;  1N36 L;  2Z0S A;  2ZJR A;  4DV2 Q;  1HH2 P;  4LFC Q;  3HOW G;  3MXN B;  2QA4 A;  2F3I A;  4IFD B;  2WP8 B;  3FKI H;  4KHZ A;  4OWT B;  5GAD C;  5FLM H;  5IY0 A;  3EN2 A;  1X4M A;  4BBS G;  4JI3 L;  4NB3 A;  4GOP A;  4QY7 A;  1YHQ A;  1L1O B;  1U5K A;  3T1Y Q;  1XPU A;  4A3C H;  4LFA L;  3HKZ E;  3AFQ A;  3PUX A;  1HJP A;  2ALY B;  1K0R A;  3GD7 A;  3OYY A;  4A4I A;  4JI2 L;  1KC8 C;  3KDF A;  5C44 G;  4IO9 A;  1OTC A;  3M9B A;  3GTG H;  2UXD L;  1HZA A;  3K7U C;  4OO1 D;  2YTY A;  4PG3 A;  2WB1 E;  4DV2 L;  4R4T A;  5E7N A;  4BBR G;  3TRE A;  2B63 G;  1QUQ B;  5JJK A;  1LYL A;  1X54 A;  4A3C G;  1YHB A;  2VNU D;  1WCM H;  4DKA C;  5IYB H;  2UUC L;  5ELN A;  1IBK L;  4DK3 C;  1VIG A;  5JEA G;  1VS0 A;  3F1Z A;  2QEX A;  4DV1 L;  3GTL H;  3F8T A;  3W1B A;  2I5L X; 
#chains in the Genus database with same CATH topology
 1GVP A;  5L37 A;  3S2D B;  2ES2 A;  3QT6 A;  4RFB A;  1CSQ A;  1HFG A;  1NHJ A;  1B62 A;  1PZJ D;  2F4V Q;  1HQM C;  4DF7 A;  5C4J B;  3I56 A;  4A3M H;  4FO2 A;  2IWH A;  2E8G A;  3GTM H;  1Y5Y A;  1PYS B;  4DR7 L;  3D8G A;  3I3C A;  4HJ9 A;  5KIX A;  1SRU A;  4JI4 L;  2NN6 H;  1N34 L;  2Z6K C;  1SYG A;  2WAQ G;  1MBY A;  1F2Y A;  5LHY 1;  2NN6 A;  2L55 A;  4LF6 H;  4DR7 E;  2DNE A;  1DCZ A;  4JOI A;  4CHT B;  5E3F A;  4JI8 E;  2C37 B;  5EBC A;  3K6O A;  1YBY A;  4I7Z C;  5EBD A;  3FKI G;  2ZTC A;  3SGI A;  1PMR A;  5DAU A;  3P76 A;  1HZB A;  4R4I A;  2VB2 X;  2VQE E;  3CRL C;  4JI5 Q;  4OX9 E;  2PQU A;  2UUA H;  1NXU A;  2JXM B;  4DR3 I;  1R6L A;  2ASB A;  1UG8 A;  4JPB W;  4PMC A;  1I4Q A;  3X3N A;  2JK8 A;  1HNX Q;  3G6J B;  1E2Z A;  3BDO A;  1S5D D;  1TWF H;  4X62 H;  4DV5 H;  2PNZ B;  4CKC A;  3GTM B;  5LMN W;  4R8I A;  4TSS A;  3E0J A;  5COY A;  2ZXP A;  2DUD A;  2MJH A;  1LTB D;  3WDN A;  4C3H G;  3OTO Q;  3KBX A;  2UU9 H;  2BA1 A;  2MFI A;  3MWY W;  4J3D A;  4OX9 I;  1E3P A;  3HOU G;  1LAB A;  4DPW A;  1SR3 A;  2ANR A;  2PNR C;  5C44 H;  2KA7 A;  5JVG 3;  1B4O A;  4IPG A;  3A8I E;  3HRZ C;  3UDX A;  2Q2E B;  1J5E Q;  5LMU Q;  3FPP A;  2J4X A;  4M8A A;  2IJ0 A;  1LT3 D;  4XQQ A;  1E2V A;  1CKN B;  4X6A H;  2KCT A;  2B8F A;  3HOV G;  4ISA A;  5KYL A;  3VA7 A;  1GUG A;  4IUR A;  1IBM I;  3M7N D;  2CH4 W;  1MKH A;  2IOQ A;  2YTV A;  3A55 A;  1Y1W G;  2RVL A;  2R92 G;  1FI4 A;  4LFC I;  2V2Z A;  3L0O A;  1KTV A;  3OMC A;  5DEH A;  3J81 E;  1LUZ A;  2JEB A;  1Z6H A;  4NZR M;  1QIL A;  4AIM A;  4NXM I;  2N3S A;  5TSS A;  5AJ3 L;  1PH4 A;  1EQV A;  1HNX L;  4LF5 H;  3U9O A;  1SYE A;  2R3Z A;  4YWK A;  3NBI A;  1EY4 A;  1CM9 A;  4IPD A;  4DR3 L;  1LLR D;  4H13 C;  2B3G A;  3V5R A;  1NY4 A;  3CHB D;  3SHL A;  4DR1 E;  4A3I B;  1J4W A;  1V1O A;  3LWU A;  2J7Z A;  3W2D A;  2O5I C;  3H3V I;  1XPR A;  1B9N A;  2JEA B;  5IGE A;  5M3F H;  2CTL A;  5IT9 c;  1PVG A;  5GQO A;  1X3G A;  3GQB A;  3QO2 A;  1B2T A;  1VQG A;  2GS8 A;  3ZZ0 A;  3EIV A;  4LFB I;  4OCH A;  3JAM C;  3KF6 B;  2CKZ B;  4A3L H;  3L7Z A;  5IYB G;  2V2Q A;  2F0I A;  5ELC A;  4DR4 I;  3EFX D;  1VI7 A;  3NQT A;  4RHR A;  1I6V C;  3TBI B;  4A76 A;  1DZ1 A;  3LNN A;  4IOC A;  3J81 W;  4BY1 G;  1KIJ A;  4U67 3;  2KBN A;  1UUP A;  1KRS A;  1HA5 A;  5M3M H;  5JEA F;  4LF9 E;  1RF2 D;  4DR5 L;  3RF2 A;  1XX8 A;  1EOV A;  1BCP C;  2NBF A;  1HR0 Q;  2B2V A;  1N33 E;  4LFB L;  2FHT A;  2SEB D;  1BQQ T;  1W6K A;  4ZCK A;  1WTX A;  2EFG A;  4DR4 E;  3AB9 A;  4JYA L;  4WOR A;  3K85 A;  4K6D A;  3P7J A;  2UUB L;  2CZ9 A;  4H02 A;  4DR4 L;  1PTO H;  5IP9 G;  1N0V C;  1G51 A;  5ELB A;  4IFD H;  3H94 A;  1ZXN A;  3QG1 A;  2VUM H;  1XRH A;  2ENB A;  4YHH E;  5JEA D;  3EBE A;  5FJ8 G;  5IWA I;  4LUO A;  1S5F D;  5GMD A;  4GKJ I;  3EA6 A;  1O78 A;  3HG9 A;  5I6W A;  3OSO A;  2VQF Q;  3WU3 A;  1G8Z D;  4X65 H;  1SFO B;  1F9R A;  2SDF A;  1C4Q A;  5I9P A;  4ED4 A;  2N78 A;  3AMU A;  2UXC H;  1PH3 A;  1XNQ L;  3I4M H;  5C0X E;  4G08 A;  2HFS A;  2UUB I;  1VQF A;  3HOY B;  3KBG A;  4X64 Q;  1O7Y A;  4OD6 A;  2IY5 B;  4H0L C;  2A2D A;  2IX3 A;  5EQ0 A;  3OIP A;  5LL6 R;  2EYF A;  4IFD J;  1T5E A;  4HYM A;  1HQR D;  1JB3 A;  3KLS X;  1EYA A;  1IBM L;  2CWF A;  1EFI D;  1TWH H;  3CC4 A;  3Q0A A;  4OO1 G;  1ESF A;  3TP6 A;  1W3S A;  4IUT A;  1K83 H;  4ZAI A;  1N34 E;  3PO3 H;  3WU5 A;  3B78 A;  1EL0 A;  4N3O A;  5I2Y A;  4C3H B;  4LFB Q;  5FLX Q;  3PUW A;  3QWN A;  3HOV B;  3VKE A;  1WTH A;  3V05 A;  4JBK A;  4HAC B;  1HPC A;  3J80 c;  4RMF A;  2J0T D;  4HSP A;  1E1O A;  3I4L A;  3OIQ A;  4HED A;  3ZYY X;  1WD0 A;  3VYT A;  4DV3 Q;  1DT4 A;  4FYD A;  3NEN A;  3BS1 A;  2QDL A;  2WAQ E;  3MFG A;  4IFD E;  1DOM A;  5I4D A;  2EE1 A;  2F3W A;  4RWS C;  3BVM A;  1SAP A;  4AM3 A;  1VIH A;  3BDC A;  3KLS A;  1UE7 A;  2BR2 A;  3W5O A;  1HK7 A;  3GTQ B;  2AXY A;  1JJ2 A;  1MGS A;  5DNL A;  3PUZ A;  4KD3 A;  2DNC A;  2NVT H;  2BH2 A;  4L6T B;  1NE3 A;  1G91 A;  3J81 C;  4KK7 A;  3I4N B;  1I4X A;  4F87 A;  5EKI A;  2B2W C;  4RPF A;  2L0C A;  2AHO B;  2UXB E;  1IBL E;  2YTX A;  3STB C;  3I90 A;  3PS1 A;  3S17 H;  4AYB E;  2JA7 B;  5D14 A;  4HID A;  5A2Q L;  1L0W A;  1NR4 A;  2CTJ A;  2HFU A;  2OQK A;  2ZXO A;  1BBU A;  1BUV T;  5C3E H;  4GOP C;  2HHH H;  1Z0V A;  2AQ1 B;  3J7A 5;  2KJX A;  4YHH H;  3NHH A;  4FWH A;  2EYM A;  4HN7 A;  4XYQ A;  1HUM A;  2VF3 A;  1HR0 W;  4N9P A;  5EGT A;  4JI4 Q;  2A5H A;  3CW2 C;  1LT5 D;  5C4X H;  2WW4 A;  1PHJ A;  3ZKD A;  2JE6 A;  4DV2 E;  5LMU L;  5J39 A;  3S2H B;  3K0X A;  1SE3 A;  1Q46 A;  4WJW A;  2RQX A;  4PRV A;  1OXS C;  3MTS A;  1QUQ A;  2WNR A;  1FJG H;  1RJT A;  4K0K L;  3J81 j;  1BKB A;  1EI1 A;  3RLO A;  2BE5 C;  4X66 I;  2HCI A;  2XSC A;  2Z5B A;  4A3F B;  1X4N A;  4F8M A;  2VS1 A;  1ZZJ A;  5IIF A;  4DUZ I;  5ELF A;  4QB4 A;  1G2T A;  1SLJ A;  2G8Y A;  4IOA A;  4JI2 I;  3G6E A;  2JEB I;  4NKL A;  2B63 B;  5H1S E;  3CWV A;  3FMC A;  4YY3 L;  3DLL A;  4JOI C;  3J81 c;  4A3F H;  5IYD H;  3U4Z A;  3SXH A;  1K8G A;  1FKA E;  1MG7 A;  2F4V I;  1OYS A;  2LXK A;  1RD9 D;  4LFA E;  2A68 D;  3NWS A;  4DNI A;  3HJC A;  4A3D G;  1EY6 A;  5I6Y A;  4GKK H;  3I73 A;  2DJG C;  4MN3 A;  4HJ5 A;  4FP5 D;  1C9O A;  5LMU E;  4JI1 L;  4MYT A;  3RLN A;  3M4Q A;  1CTM A;  5T1G A;  4YCV A;  1IBL H;  3HOX G;  2EYO A;  1IBK H;  2Q2U A;  4DGZ A;  4JI1 E;  4OO1 B;  1TXY A;  2EYH A;  3HZX A;  4LF7 E;  4OEM B;  2NVT B;  1EYC A;  4GOP B;  2XRQ D;  3GME A;  5IWA L;  5M9O A;  4S3S A;  4MU1 A;  3T1H I;  4JI6 I;  1SJH D;  4HIM A;  4A3B G;  1EQR A;  1N36 Q;  4LF6 Q;  1GJX A;  1PV4 A;  1H95 A;  3MFY A;  1XNR Q;  1VQP A;  5GME A;  3OWF A;  1UDO A;  4B3S I;  2VES A;  4DV0 H;  1X6O A;  3CAM A;  3BU2 A;  5ELW A;  1JC7 A;  4B3T I;  2DGY A;  2NVY H;  4LF8 Q;  3VR2 A;  5K36 D;  1DTJ A;  3R2I A;  1FJG E;  2OF1 A;  4JYA Q;  4GKK L;  4JI5 H;  3T4A C;  4Z9C B;  4ME5 A;  1HR0 I;  1EWC A;  3TME A;  5DRP A;  2L5T A;  5EPJ A;  4Y52 H;  4DR5 H;  1J5K A;  2JQO A;  1DOL A;  3CME A;  2BR2 B;  4HCE A;  3TN2 A;  3WU4 A;  1JB7 A;  2CTE A;  3KF8 B;  2EJM A;  1PH1 A;  1J5E I;  1PZI D;  1U4M A;  2EY2 A;  5IGD A;  4POG A;  4BY7 B;  4H44 C;  1X9N A;  3L3O C;  5M5Y H;  1G2S A;  3AFP A;  3FRP B;  2UU9 Q;  4L5T A;  4DUZ H;  1RR9 A;  3GTG B;  3PS3 A;  3S16 B;  3CCJ A;  4FWG A;  4BBR B;  2D5D A;  1EU3 A;  5LMN Q;  5C4Z A;  3NK9 A;  4X66 H;  4GKJ H;  1EY7 A;  1SNC A;  2K5V A;  3PO2 G;  4NXM L;  2ZM6 H;  4PMB A;  2A6E C;  2HKJ A;  1JJC B;  2FXQ A;  2R7Z H;  5LMU H;  2Z9H A;  5C0X H;  2EJF C;  3H1C A;  2LF0 A;  4P73 A;  4BA2 B;  1IBK E;  4DR5 I;  2X06 A;  4JI1 Q;  1U0L A;  2C39 A;  3E0E A;  1XNQ Q;  2HDM A;  2D0O A;  1CHQ D;  5IWA E;  2HHH L;  1A0I A;  4C1N I;  3GV3 A;  2FFK B;  5LMN I;  1ROD A;  5C4H A;  1WYD A;  2HCC A;  1SYF A;  1FNV A;  2E5L E;  1QNK A;  4JBM A;  2K32 A;  4DR7 H;  4ODG A;  3OW7 A;  2KCN A;  1KAB A;  1QOH A;  5ELO A;  4DV3 L;  1PLF A;  2K4K A;  5IP7 H;  2VUM B;  1XNQ E;  4TKO B;  3H3V C;  3D3R A;  4BY1 B;  4DV6 L;  2BDN A;  3B4T A;  3P20 A;  1ICF B;  4IZJ A;  1H74 A;  2B2V C;  3M7G A;  1ZEQ X;  4JBW A;  4LF8 L;  2CVR A;  4CDE C;  1X32 A;  3NWT A;  1TWC B;  4A3J G;  4AYB B;  1AH9 A;  3EJI A;  3H0G H;  2IHF A;  4A3E H;  4DR6 H;  5K36 C;  1X3P A;  3U4V A;  3J7A K;  4JI0 E;  1I3Q H;  5A35 A;  4JV5 L;  1HH2 P;  5ELE A;  2O1V A;  4IFD B;  4DV3 I;  2LY7 A;  4HSV A;  5CV7 A;  5FLM H;  5IY0 A;  1X4M A;  3R3O A;  4R8N A;  4UAI A;  3QT7 A;  1WTW A;  1Z59 A;  3PUX A;  1HJP A;  4DV4 I;  1K0R A;  3GD7 A;  3P3E A;  1KC8 C;  1LO5 D;  2I07 B;  1HZA A;  2FIN B;  2K5D A;  4OO1 D;  2YTY A;  4I7A A;  3D6W A;  4R4T A;  5E7N A;  3TRE A;  2B63 G;  1OJ4 A;  4DR1 I;  1QUQ B;  4JI7 I;  1YHB A;  1S5E D;  2VNU D;  1V8C A;  4DK3 C;  4P2C B;  5FK9 C;  1VS0 A;  4V19 0;  1TR5 A;  2QEX A;  4DV1 L;  3GTL H;  2BV3 A;  3F8T A;  3B6Y A;  1Q8K A;  3JAM i;  4A3I H;  2K33 A;  1PH7 A;  3T1H H;  2Z4H A;  3VR4 A;  1TS3 A;  1F2M A;  4LNQ A;  3W1G A;  5K36 B;  5IGF A;  2CFM A;  2K01 A;  4DPG A;  2WP8 A;  2L12 A;  1VQO A;  5DRQ A;  2F0L A;  2UXD I;  2OEO A;  3OPO A;  2UUC I;  1MSZ A;  4JV5 Q;  4EVO A;  1VQN A;  2VZA A;  3P1H A;  2WAC A;  1XNR H;  4G57 A;  4EQO A;  2UUB H;  1CUK A;  3H15 A;  3JAM c;  1PRT F;  2MO1 A;  4B8T A;  1BR9 A;  2VKC A;  4AQY H;  2WV6 D;  4EX5 A;  1Z0W A;  2JA7 H;  5CYU A;  4L5S A;  2B2T C;  2K14 A;  1DM0 B;  1WCM B;  2KED A;  4JV5 E;  2Z4I A;  2G5D A;  1KDC A;  1H9R A;  3I4N H;  4LF4 H;  1D5M C;  3K5N A;  3KFU A;  1PH8 A;  2LFN A;  1PIE A;  1KQS A;  5KYI A;  4EC5 A;  2O2L D;  1WVL A;  1QWY A;  1VQD A;  4KHV A;  2ATW A;  1AE3 A;  2FJ2 A;  4KJO A;  1KNE A;  5C0X G;  1EZ8 A;  1S40 A;  1ZTG A;  4DAP A;  2R7Z G;  3CXC A;  4P52 A;  4DAM A;  4DV3 E;  2EZV A;  1SE2 A;  3DM1 A;  1PTO C;  3CQZ H;  4GKJ Q;  3G71 A;  2D9U A;  4ULL A;  4KHP I;  3CCV A;  2UUC H;  4BA2 I;  4CGY B;  1R9T H;  3M3Y H;  1E22 A;  1Q1B A;  1TWA H;  4C3J B;  1N33 I;  4DAY B;  2LXJ A;  2GQ0 A;  1SE4 A;  3RLF A;  4DK0 A;  3Q23 A;  3PIP 3;  3V69 A;  1XPO A;  2PY9 A;  1Y1W H;  2R92 H;  2DGR A;  5LMN E;  2DEI A;  2JA7 G;  4MIU A;  4NXN L;  1DGS A;  1KLU D;  1ZM3 A;  5DNX A;  1MHW C;  3D4R A;  3P3G A;  1YVC A;  2UU9 L;  3IAY A;  2XN9 C;  1TT2 A;  1PQX A;  1H73 A;  2K5N A;  3D31 A;  4HIK A;  4IZK B;  1RHY A;  1P16 A;  2Y0S B;  5IT9 L;  1X56 A;  5C0X J;  2E74 C;  1VQ6 A;  4NXM E;  3H3V H;  5C4J H;  1D8L A;  1G6P A;  3HOU H;  3QIA A;  1E1T A;  5BR8 I;  4CBV A;  2E5L Q;  4JI8 I;  1S5C D;  1Z2I A;  1OO9 B;  1CQV A;  3UI2 A;  2XVS A;  2NN6 C;  3I91 A;  5FLX L;  2NN6 B;  4C3I B;  1Z0B A;  2A1S A;  4DR6 Q;  1TS5 A;  2UXB L;  4OIJ A;  4DV1 I;  1SEI A;  1ICW A;  3ZZU A;  4LF6 L;  1Z9F A;  3TQY A;  2VQE I;  5G3L F;  3IRB A;  2WKD A;  4TQU S;  3TS0 A;  4LFC H;  4R4O A;  4GLA C;  5CGK A;  4L5R C;  3NBH B;  5M5W H;  5EL9 A;  4IPC A;  1SFO H;  4Y7N H;  1VQ8 A;  4FW9 A;  4HJ7 A;  1ONL A;  4HXZ A;  3D0F A;  3M85 G;  2D62 A;  3IFD A;  4A3D H;  1ZKO A;  1OYP A;  3T56 B;  2PZU A;  2JA6 G;  3HOZ B;  1GD7 A;  4LF9 L;  4LFB E;  4IZJ B;  3LGJ A;  1ZXT A;  5KNB A;  5FLM G;  3F2C A;  3S1N B;  4A3D B;  4NW2 A;  3J7A G;  4K5X A;  3RN2 A;  3M4O H;  2NVQ H;  3NSW A;  1USU A;  1S20 A;  4KMU C;  5K36 G;  2VQE L;  4LCG A;  2VQF E;  3H0G G;  4PU9 A;  5DM7 3;  4DV6 H;  3PF4 A;  3KDF B;  3AQQ A;  2J65 A;  3J81 L;  4LK1 C;  4MYU A;  4DPY A;  1N33 Q;  1TU2 B;  3P06 A;  2Z1C A;  1OYR A;  2I0Q A;  3O13 A;  4MU4 A;  1Y1V H;  2KEN A;  4X3T A;  1V9N A;  1VQ5 A;  2JP1 A;  3UDG A;  1HA6 A;  1K0S A;  1AZP A;  1I94 H;  1S4Z A;  4K6L A;  3PIP A;  4QQB X;  5KGU A;  4K0K I;  1FGU A;  4YY3 E;  1FVI A;  3HOU B;  2JA5 G;  2F1D A;  1VQI A;  1HNW Q;  4N8X 1;  4DU8 A;  5DLQ E;  3S1M H;  4APV A;  1Y60 A;  4NDX A;  1ZYR D;  5D3D A;  3MEF A;  2Y3M A;  1JWS D;  1TS2 A;  3DEO A;  3M4Y A;  2UUA Q;  1EY8 A;  2SNS A;  4AID A;  3CPW A;  4GNX A;  1W6J A;  2VW9 A;  1ET6 A;  1BBX C;  2N8N A;  4B3M H;  3KDG A;  1LTL A;  4A75 A;  4L8J A;  2F0U A;  1Y1W B;  2R92 B;  1PFS A;  4IUP A;  2EDG A;  2BDO A;  5DRO A;  1EUJ A;  4KHP E;  1VMP A;  4N9T A;  4XQJ A;  1HNX E;  5A2Q Q;  2JA8 B;  1XMO Q;  1U2R A;  4OX9 L;  2MJ8 A;  2HDL A;  3OMG A;  2RCF A;  4HMI A;  1LT6 D;  3CQZ B;  5A2Q C;  1ZZK A;  1QVC A;  4LJZ C;  2CQO A;  2FMC A;  2H5X A;  4WUC A;  2QIL A;  1A8V A;  4GZY C;  1PH5 A;  4JI6 H;  1QVG A;  1JMC A;  3DXJ C;  4MTN A;  2E2J B;  1STG A;  1VF5 C;  3M85 D;  5COR A;  3CDI A;  1STY A;  1KDA A;  1QZG A;  3VYR A;  1UE1 A;  1N34 I;  2B2W A;  1F9S A;  1B53 A;  4P74 A;  3HOZ H;  1F0X A;  1HNW I;  2OQ0 A;  4RA8 A;  3GV6 A;  4WJ3 M;  4OIK A;  4JI2 E;  2F0F A;  4EGV A;  3L7Z B;  2ZM6 Q;  4DV4 Q;  5M5W B;  1D5X C;  4GKK E;  3K7A H;  2Z5C A;  4E9J A;  2C39 B;  1X3E A;  1EIF A;  2L9H A;  5DM6 3;  4LFA I;  1Z0E A;  1GUN A;  1DOK A;  4X62 I;  4DV5 I;  2E2I H;  1Z5A A;  1D1I A;  4LF5 I;  2FMR A;  1N32 E;  4JI1 H;  2QGQ A;  1P42 A;  3PYD A;  5M5X B;  4NXN I;  1PFM A;  5K36 H;  1UEB A;  3ULP A;  5HUR A;  3CDJ A;  5DNF A;  1A62 A;  2X7I A;  1JE4 A;  2Q8T A;  2N49 A;  4R1J A;  3OTO L;  4QCL A;  5LL6 X;  4IJH A;  3STB D;  4JI3 E;  4B3M I;  1VQB A;  1BOS A;  3BJU A;  3OHX C;  4IFD I;  4LOM A;  3V2T A;  5IYD G;  2F3V A;  1KHM A;  2WNR B;  1VF7 A;  3MZ5 A;  4HAC A;  1Y14 B;  2K7V A;  1N0U A;  1S5B D;  4DR3 Q;  2VQE Q;  4NZT M;  2RDH A;  5FJ8 H;  4FF2 A;  3HOY G;  3ICE A;  4DV1 Q;  2HUG A;  3F2D A;  3GTO B;  4P75 A;  4K0K H;  1HTP A;  2CHB D;  3H09 A;  4LF7 L;  5NUC A;  5J22 A;  3FHW A;  4OO1 F;  3PS2 A;  4JI1 I;  2C5C A;  3SEB A;  1BDO A;  1V43 A;  4IPH A;  4IS9 A;  2SNM A;  2EXZ A;  4DUZ E;  4DR2 I;  2E5L I;  2KQ3 A;  4B9W A;  3H0G B;  3NQI A;  1TWG B;  4QL5 A;  3T1Y H;  4B3R E;  2F0J A;  1T5X D;  1RDP D;  4OO1 I;  4DR4 H;  3LWE A;  3TDQ A;  5E4W C;  4DV6 I;  2EY1 A;  3S15 B;  2JEA A;  4X62 L;  4DV5 L;  1I94 Q;  3BZC A;  1K8A C;  5JVH 3;  3GTJ H;  4BY1 H;  1SNQ A;  3SE0 A;  2ICE C;  4GNX C;  1IBL L;  4XYO A;  2AUJ D;  2R42 A;  3HUL A;  1PH9 A;  5G3L D;  2YU9 H;  1N32 Q;  1RIP A;  3NTK A;  1PZK D;  2BOS A;  1IKL A;  1GXD C;  1V1P B;  2YV5 A;  4C2M B;  4DUY L;  5EJW A;  3QT5 A;  4XQN A;  1JOR A;  1SMX A;  1N36 E;  1IHZ A;  4BS9 A;  4A3L G;  1S16 A;  4JV5 I;  3CD6 A;  4R1F A;  4X64 H;  2KHS A;  3CP0 A;  4LFA Q;  3HOW B;  2UXD Q;  2VQF I;  1LTG D;  3CPF A;  3HKZ G;  4AH6 A;  3E9I A;  4DV4 L;  2GO3 A;  4JCV E;  4B3M Q;  1HNZ H;  1Y8O B;  5M3F G;  1PA6 A;  2EIF A;  2PT7 G;  4LIJ A;  4JI3 Q;  4QIW E;  4FW3 A;  1XMQ H;  1H9S A;  2EYJ A;  3SK6 A;  4UTG A;  3E5S A;  1AW7 A;  2RF4 A;  4LFC L;  5C0X B;  4JW0 A;  1JCK B;  1I50 B;  3SR1 A;  3WOE A;  2JA5 H;  2R6G A;  1ENA A;  2BA0 A;  2RSO A;  5KND A;  1JIC A;  1MU5 A;  4LF4 L;  2AMC B;  4UHV A;  1XXE A;  2ZJP A;  4A3B H;  1V1P A;  2CGE A;  3L7Z C;  2E1R A;  3K80 C;  1FJG I;  5E4X A;  3I4N G;  4LF6 E;  4PZ6 A;  4JI6 Q;  4JI0 I;  4PNY A;  3GTL B;  5M5Y B;  3KLR A;  3BZD B;  1AZQ A;  1EYG A;  3CCR A;  2PMZ E;  2A74 C;  5A2Q E;  1YNN C;  4QMF B;  1NMF A;  3OTO H;  1H7S A;  3HOX H;  1PH2 A;  1OXU A;  5C5M A;  5JEA E;  2HHH I;  2CTK A;  4ZYS A;  1WUU A;  1QZH A;  3RUZ A;  1EEI D;  4OXP A;  2K5Q A;  2KOL A;  2JA6 H;  3MC0 B;  1TQO A;  2UUC Q;  4A3K B;  1YNX A;  3KUP A;  1F9Q A;  4RGM A;  3R93 A;  3VR3 A;  5JPM C;  2NTS A;  2Z8L A;  1QZR A;  4A3F G;  4X3S A;  2PQE A;  2E2H B;  2PQA B;  1I3Q B;  3RNU A;  4OKG A;  5JEA C;  1O7L A;  4JI7 E;  3T13 A;  1J5E L;  1VQA A;  2HIV A;  4A3E B;  1VQC A;  4JI2 Q;  2K52 A;  2E76 C;  4HCS A;  3A5U A;  1F9P A;  2K5H A;  5D3I B;  1GUS A;  1H9S B;  2NTT A;  2JVZ A;  3M6A A;  2XTI A;  4DN4 M;  3ER0 A;  1OXX K;  2UXB I;  5ISR A;  5A2Q W;  1MIU A;  1PXU A;  3B8H A;  3J7A V;  1RHP A;  2X6G A;  2K03 A;  3FAU A;  5FWK A;  5BR8 Q;  1GUO A;  2EQS A;  4JG2 A;  3UDF A;  4JI0 Q;  2IES A;  4LCH A;  2B2Y C;  1J6Q A;  4GNX B;  4KV6 A;  2R3V A;  4AQY E;  4I3H A;  4PZ7 A;  2JA6 B;  3U50 C;  3HOZ G;  1UE6 A;  3BZK A;  1SMY D;  3I55 A;  1P8L A;  3SDZ A;  1WTO A;  5IP9 H;  3LPS A;  1LTI D;  5LMN L;  5IT9 C;  4LF5 E;  2CWH A;  1L0X B;  4CDC C;  1EIG A;  4DV1 H;  5AJ3 Q;  1JJG A;  1C8C A;  3J80 W;  1CKM A;  5EPK A;  1CSP A;  3GON A;  3CC7 A;  5FO7 B;  3TP8 A;  1QE6 A;  4DV2 Q;  4LFC Q;  2Q8R E;  3MXN B;  1K8M A;  5EKL A;  2QA4 A;  1HNZ E;  3KDK A;  4KTA A;  1DON A;  1LTA D;  4G4K A;  4XDX A;  3EN2 A;  4B3T E;  4USK A;  4BBS G;  5JEA H;  1YHQ A;  2IW3 A;  3J7A F;  4HY1 A;  1U5K A;  3T1Y Q;  2A69 C;  3SK5 A;  1XPU A;  1PDQ A;  3AFQ A;  3HKZ E;  4A4I A;  5CBA E;  1FNM A;  3GTG H;  4WJ4 A;  3KDF A;  3M9B A;  1K47 A;  2UUC E;  4H8A A;  2B8G A;  2WB1 E;  2PNM A;  3A7L A;  2O1W A;  1QB5 D;  4DA2 A;  1B50 A;  1LYL A;  4A3C G;  2V8P A;  1TY0 A;  5IYB H;  3K17 A;  2IPK D;  2UUC L;  1J5E E;  4DUY H;  4JI7 H;  5C4X B;  4CJ2 C;  1A6F A;  2C37 A;  1N32 H;  4X65 L;  4B3R Q;  4B3S Q;  1YNJ C;  1O7I A;  2LTL A;  4HAE A;  4OEL B;  1HNZ I;  2O3Z A;  1A3V A;  1RL2 A;  3BYY B;  1N33 H;  5CV8 A;  4LCF A;  2O1U A;  3FDT A;  2ZM6 L;  1CZG A;  1GOZ A;  1EZ6 A;  1HRJ A;  1Q90 A;  2A73 B;  1ZM4 A;  1H9M A;  1EOT A;  2I5M X;  4IUU A;  5JJL A;  2CWA A;  1NHH A;  4JI3 H;  2UUA E;  4PMW A;  3PO2 H;  4DV7 H;  4WAN A;  2Y0S E;  1NCV A;  3VDY A;  1LV9 A;  1Q81 C;  4OWW B;  4PRX A;  5LL6 b;  4GLV B;  4FXG C;  2F0K A;  4EQP A;  4X3U A;  4LF7 H;  4DV0 Q;  4BBS H;  3FEW X;  4AQY L;  2X36 A;  4JVH A;  3HKM A;  4LF8 H;  1PFB A;  4DR3 E;  4JYA H;  3GLL A;  5DRR A;  1XTD A;  2A68 C;  1SYC A;  4LUV A;  2ZIT A;  4OO1 H;  3GTK B;  4DV1 E;  4LF4 I;  1EEF D;  2XGT A;  1BXT A;  1CK1 A;  3X3M A;  5D65 A;  4DR2 H;  1VQE A;  4DV0 E;  2PNH A;  2L15 A;  3OSS D;  1ML0 D;  4B3T Q;  3UHM A;  3I8Z A;  2UUA I;  2HH3 A;  3L9A X;  1L2F A;  4JC0 A;  4RKB A;  3T1Y E;  2HIX A;  3HP3 A;  5JEA B;  1BCP F;  1SBB B;  1FNW A;  2B63 H;  2JEA I;  1PRT D;  2LSS A;  1XMO H;  2JE6 I;  4LFB H;  4X66 Q;  1H9K A;  4C3H H;  5JOB A;  1DJR D;  1SYB A;  2F0P A;  3V96 A;  4DAY A;  5IT9 W;  1VQL A;  4F88 A;  1I94 L;  4ABN A;  5J1Z A;  3ND9 A;  2HQL A;  2VUM G;  2ZM6 I;  1O7Z A;  1TWH B;  1Y4U A;  1AN8 A;  1XYI A;  1XTC D;  4R4Q A;  1M1K C;  4FW5 A;  4M1U B;  3OW2 A;  4KY5 A;  1Q86 C;  3GR5 A;  1KNA A;  3VA5 A;  5KRU A;  4B08 A;  5HY6 A;  1YNJ D;  3S2H H;  5ELD A;  2MP1 A;  4PV1 C;  4NXN H;  1E2W A;  1VIS A;  2KEC A;  2RA4 A;  3ULL A;  1XMQ E;  3HFZ B;  2AWN A;  3NBH A;  4Q0F A;  2IX0 A;  5FLX c;  4DV4 H;  3KF8 A;  3FVQ A;  2L4N A;  5BR8 H;  2CPM A;  2MPM A;  1LT4 D;  3K7A B;  3N6R A;  5IP7 G;  2ID0 A;  1Z0C A;  5C3E B;  5C0X D;  4UPA A;  2J7K A;  4X64 I;  4JYA E;  1GHJ A;  3BVZ A;  4L63 B;  3PYG A;  5I9O A;  3DEP A;  1WHR A;  5BN4 A;  2F0S A;  3A5Z B;  2CVE A;  1NTG A;  2PZT A;  2E2H H;  4DV0 I;  3KK7 A;  3G48 A;  1JWU D;  1I4R A;  3I2Z A;  1I6H B;  4M1K A;  3RZD H;  2SOB A;  1YH8 A;  3PYF A;  2AQ2 B;  1I4G A;  4ALP A;  1RKN A;  1ELO A;  1M8A A;  3OTO E;  2JA9 A;  2NN6 D;  5T1I A;  2HK3 A;  1K73 C;  3AU7 A;  3KYH C;  1STA A;  3LX0 A;  2R93 H;  5C4X G;  2QDB A;  4JI4 I;  2G9H D;  1ESR A;  4IQZ A;  2PO4 A;  4DR7 I;  1M4V A;  1DYQ A;  4JI8 L;  1VQ7 A;  2NPF A;  2PCF B;  2IHE A;  4FJU A;  3I7F A;  4DR3 H;  4DPT A;  4RKL A;  4A3K H;  1N32 L;  2OXP A;  1C7Y A;  4KJN A;  1U9R A;  2MNA A;  4JI7 Q;  2X69 A;  4JBJ A;  4K0K Q;  1J8I A;  4R4C A;  1IYV A;  3D4D A;  4U3D A;  4IZJ D;  5C6A A;  1OXV A;  3S1Q H;  3QT8 A;  2G9D A;  2C38 A;  4YIJ A;  4YCU A;  1D5Z C;  1K3B C;  1YHA A;  1ZXM A;  1HNW E;  3HOV H;  2ZTE A;  3CCE A;  1EA6 A;  5C3X A;  4IJL A;  4UDU C;  3HKZ B;  1XMQ L;  4YY3 I;  2WFW A;  3TP7 A;  5C0X C;  2O4X A;  4HIO A;  1CHP D;  5BN3 A;  4FW6 A;  1STH A;  3NTI A;  2HQE A;  1RTO A;  2QND A;  1MSG A;  1K83 B;  4DV2 I;  4DXL A;  1YEZ A;  4YCW A;  2DJF C;  3NP8 A;  2OTL A;  2C38 B;  3D4J A;  1GM5 A;  4X62 E;  4DV5 E;  4JVY A;  3JAM L;  2DY7 A;  4IZ8 A;  4ID6 A;  4TVA B;  1I50 H;  2NVX H;  1IBK Q;  3S14 H;  3K1J A;  1XNR I;  3HKS A;  4K14 A;  4LMQ D;  3ERO A;  4BA1 I;  4Z7Y A;  3DM3 A;  4CKE A;  2NZ1 D;  5GAE C;  4MZ9 A;  4A3I G;  1N34 Q;  3M7N A;  1L0Y B;  3GAB A;  2EXD A;  4JI8 H;  4LFA H;  2UXD H;  4J8Q A;  3HOY H;  1EY9 A;  3ZZT A;  1I4P A;  4LUZ A;  5CV4 A;  1FL0 A;  2ZT9 C;  4GN3 B;  1FWK A;  1S4E A;  2XEX A;  2C9O A;  2EYL A;  3F0N A;  4B3R I;  4X3K A;  4B3T H;  4L5Q A;  3T51 B;  3UDI A;  2NUC A;  2NVQ B;  1TWG H;  1A3T A;  4RGO S;  2UUA L;  1A2T A;  3M4O B;  1KLG D;  1YHC A;  3OOC A;  1JT8 A;  4DR6 L;  5LL6 S;  4QNJ A;  3OWE B;  1PYW D;  2C35 B;  3GTJ B;  4IFD C;  2CWP A;  1SXT A;  5JPN C;  1LTR D;  5CV6 A;  1D7Q A;  4KKU A;  1ASZ A;  2I46 A;  3J80 Q;  4K0K E;  1Y6Z A;  1B70 B;  1E0B A;  4A3M G;  4KHP Q;  1D6T A;  3TZU A;  3U1Y A;  1EWH A;  2OCE A;  4O42 A;  2BCO A;  5FLX E;  1ZM2 A;  3BDL A;  2P2R A;  4QUC A;  3B82 A;  4DUZ Q;  3Q24 A;  2QKI C;  4KKS A;  1Q1E A;  4KLK A;  1CKO A;  4NXN Q;  3K0Y A;  2AKW B;  4LWC A;  3GTO H;  2UXB H;  1DD2 A;  4J6H A;  2EY5 A;  2OPV A;  5E1F A;  5IWA Q;  3KJO A;  1F77 A;  3AYH B;  3CU7 A;  1HNX I;  1EY0 A;  1B44 D;  1FJG L;  2V2V A;  3M4P A;  2B39 A;  3C46 A;  4I65 A;  1GO3 E;  4RCO A;  5FKA C;  3GTP H;  1EC6 A;  1Y69 U;  4B3S E;  3LTO A;  2E5L H;  4IN3 A;  4LF9 I;  4QNK A;  1Z5B A;  5C3E G;  2PI2 E;  1XMO L;  3CCU A;  2ZM6 E;  5F2D A;  4NXM Q;  4USM A;  3F2B A;  5JJZ A;  1X0A A;  1S3O A;  3TP5 A;  3MXG A;  1IKM A;  1JWM D;  5JAV A;  1YZ6 A;  5IOC A;  1PH6 A;  2PNL A;  1HNZ L;  4OO1 C;  5M3M G;  1SN8 A;  4DR2 L;  2B2U A;  3GCM A;  1WOC A;  2M6Q A;  4KY6 A;  3T1H L;  2PNZ A;  4DR6 E;  4DU7 A;  1WI5 A;  3KLW A;  3CMA A;  2F0T A;  4NPS A;  4YHH I;  2F0N A;  4CDD C;  2UXC L;  1B9M A;  1FGB D;  3J80 L;  3SB1 A;  1UE5 A;  1X65 A;  5IT9 Q;  1H9J A;  2AE8 A;  3K58 A;  2JT2 A;  5C0X A;  1PRT C;  2BL5 A;  4FF1 A;  4LF9 H;  1IYJ B;  4HJ8 A;  2X6L A;  4BY7 G;  1FKA H;  4DV2 H;  3A8K E;  3K8A A;  5HGT A;  4X65 E;  4DV6 Q;  1XNR L;  1CT1 D;  1QCB D;  3CCQ A;  1M90 C;  3Q1Q A;  5C44 B;  2F0D A;  1ASY A;  1Q12 A;  2K1B A;  1Z47 A;  4FXD A;  4DV7 L;  1UEA B;  4NXN E;  1NSN S;  3L2P A;  3J81 Q;  1B7Y B;  1IXR A;  2PMZ B;  2E2J H;  2BM0 A;  4JI6 L;  2JJQ A;  3EQL C;  3K57 A;  3GKU A;  1OXT A;  2VQF H;  4UY8 C;  2VY3 A;  1IL2 A;  1Y1V G;  4DV6 E;  1PKP A;  4Q5V A;  2QF7 A;  1R4Q B;  2JA8 H;  4DR1 Q;  2Z5C B;  3ITP A;  4B3S H;  3J81 i;  4DR6 I;  3T53 B;  2E2D C;  4EQ5 A;  3GTP B;  3DHQ A;  2YQR A;  1N34 H;  1L1O A;  4YY3 Q;  3A0J A;  1JQY D;  3SVM A;  2GN5 A;  2F4V L;  4IFD D;  1X55 A;  5CV9 A;  2K6A A;  3K81 C;  1PTO D;  4DV7 Q;  3C3L A;  3RZO B;  3T1H E;  4YHH L;  2O1T A;  3K5M A;  3J80 i;  1X3F A;  3WOF A;  4V0B A;  1IBL I;  4O2D A;  4DFA A;  4XTJ A;  2UUB Q;  2EOT A;  1AE2 A;  4B3M E;  3S1M B;  2MGS A;  1J9O A;  1HZC A;  2L1B A;  4IAL A;  1LTT D;  1PYB A;  4ZUJ A;  3NCV A;  3ZM7 A;  2VB3 X;  2EY6 A;  1KAA A;  2PO2 A;  3OET A;  3G4S A;  4MQY A;  2Q2T A;  4ZRZ A;  4QGU A;  5L3J A;  4IFD F;  4X66 E;  4DXG A;  4KHP H;  3AEV A;  4DV3 H;  3UE0 A;  2V1C C;  4OZE A;  2CTF A;  2WB1 G;  1RCV D;  5CR3 A;  1BVS A;  4DK6 C;  3R8B A;  2PW7 A;  2Q2I A;  2MQH A;  3NEM A;  2XNA C;  3FP9 A;  4MU3 A;  4JI6 E;  1NNX A;  3VR5 A;  4C1N K;  1SND A;  1VQ9 A;  2E3U A;  1NUC A;  1VDZ A;  2OPU A;  1JR0 D;  3VR6 A;  5FLX C;  3BG3 A;  3KOJ A;  1HCZ A;  5IWA H;  3NUC A;  4KKT A;  4HJA A;  3S1N H;  2K50 A;  2XWB B;  3FKI B;  4RGT A;  4G7O C;  2HK2 A;  4FVM A;  4DUY E;  1E7Z A;  1J5E H;  3CCS A;  2Q8I B;  4C3I H;  3PYE A;  3I72 A;  1WFQ A;  3A8J E;  2HT1 A;  2IOP A;  4BA1 A;  2NVX B;  3S14 B;  2CW0 C;  4DR1 L;  1Z0T A;  1B8A A;  3PCO B;  1CQF A;  4RG1 A;  4Y7N B;  3WWV A;  1WTQ A;  4QMG A;  1MI2 A;  3QJY A;  3ND8 A;  2F4V E;  2PO0 B;  2K28 A;  3JC6 6;  2IT1 A;  1A15 A;  1N36 I;  4FWD A;  4IZK A;  4DV7 E;  1X9Z A;  4DUZ L;  5CC4 A;  1SDF A;  5FOB B;  1S72 A;  4LF5 Q;  1EU4 A;  4JI4 H;  4ZUI A;  3RZO H;  2E5L L;  5K36 E;  2K05 A;  1AN7 A;  3J7Y W;  4LF8 E;  4A93 H;  3RD4 A;  3S1Q B;  4ZQ3 A;  2FPH X;  1EFW A;  2H1E A;  4OO1 E;  1LM0 A;  2FMM A;  3A74 A;  1ZM9 A;  4JI7 L;  4FW4 A;  3CF5 A;  1RRE A;  4C3J H;  3TZD A;  1IBK I;  1KIX A;  1KKH A;  1STB A;  3TS2 A;  1IYU A;  1AP0 A;  1B63 A;  2B2U C;  1N36 L;  2ZJR A;  1FD7 D;  3HOW G;  3QR8 A;  1DAR A;  2F3I A;  4F7X A;  4OWT B;  4ZLT F;  2CW0 D;  1CA6 A;  4WRD A;  4QY7 A;  2ZBK B;  1PTO F;  4HMJ A;  1Z5C A;  2LMC B;  3PO3 G;  1WTR A;  2QCP X;  5C44 G;  1MD2 D;  1TWA B;  2NVY B;  4PG3 A;  4LFC E;  3M3Y B;  1R9T B;  4DV2 L;  1B3A A;  4BBR G;  2Z6B A;  4FNF A;  4H7B A;  4CJ1 B;  5AFW A;  4DPU A;  1WCM H;  4DKA C;  1IBK L;  2M8W A;  3P75 A;  3F1Z A;  3NE5 B;  2NWG A;  3W1B A;  2I5L X;  4GLX A;  3TRZ A;  4FJS A;  3S1R H;  4XXE A;  1A63 A;  1EWI A;  2LKV A;  1B1Z A;  3TSS A;  1D6E C;  1I94 I;  1SMY C;  2M00 A;  1YJN A;  4ME3 A;  2PYK A;  1Y8P B;  4RH6 A;  2EYP A;  2F0O A;  4C3J G;  1VQJ A;  3I4M G;  1F2Z A;  3RZD B;  1FYC A;  4OL7 A;  2D9I A;  3G7L A;  1F2L A;  3P3C A;  1XMQ Q;  4JI4 E;  1TS4 A;  4NP5 A;  1N36 H;  5EAY A;  3WU6 A;  3PIO A;  4DR5 E;  1Z7T A;  2DY8 A;  2A8V A;  2JSO A;  2TSS A;  4EQN A;  4BA2 A;  1YJW A;  3QOL A;  2IX1 A;  4UP7 A;  2KHI A;  3QD7 X;  4MHE A;  1I5F A;  4IFD G;  2NN6 G;  2JZX A;  2ZXR A;  2WB1 B;  3M7N G;  2QEJ C;  4KN7 C;  3URY A;  1GHK A;  4A3E G;  4DR5 Q;  1Q7Y C;  4A3J H;  1U4R A;  2O4C A;  4GKJ E;  2PZW A;  2DEJ A;  5K36 F;  4K8J A;  2JEB B;  4OON A;  2LS0 1;  3IFT A;  2RDF A;  2TMP A;  1USV A;  4AQY I;  1NMG A;  3C2P A;  3ZJY C;  4MU0 A;  3DD6 A;  3UOE A;  2A2C A;  1YNN D;  4O1N A;  5EKK A;  4IFD A;  4LF4 E;  3SK4 A;  2NN6 I;  5FO8 B;  4BXX G;  2ZTD A;  1EY5 A;  2I5H A;  3PQI A;  1T9H A;  1EIY B;  2P5Z X;  3I4O A;  2A69 D;  2VXW A;  3CCL A;  2A1A A;  3ZKB A;  3Q8D A;  1PRT B;  1TWC H;  4JK1 C;  4GN5 A;  2EJG C;  2Q2H A;  2BA0 D;  4JI5 I;  2A6H C;  4E6I A;  1K8O A;  3T16 A;  4J15 A;  1XNQ H;  4DV0 L;  2JE6 B;  2OI2 A;  1VQ4 A;  2F0G A;  1DXM A;  2F0M A;  4QIW B;  2KCM A;  2UXB Q;  1HUN A;  4PZ8 A;  1VCI A;  1U4L A;  2VL6 A;  4OO1 A;  3J7Z C;  4DR7 Q;  2ANN A;  4RCN A;  2NN6 E;  4KHP L;  3K5O A;  4K5W A;  3Q6N A;  2KCC A;  3UE1 A;  4JI0 H;  1EYD A;  3U9S A;  3GP7 A;  3QOJ A;  3GO5 A;  1NAP A;  4KN4 C;  1EQQ A;  4P7A A;  4BBS B;  4RAU C;  2M9V A;  3ULJ A;  3MVV A;  1BO0 A;  1V9P A;  4ZK9 B;  2EVB A;  4NXM H;  3MA2 B;  2R7Z B;  4X66 L;  1K9M C;  1SEB D;  4RHS A;  3E6Z X;  5J3B A;  3C1E A;  1HNW L;  3PMF A;  2B2T A;  1WCM G;  5IYC G;  1WVN A;  2XWJ B;  4BBR H;  3DUZ A;  1HTL D;  2Z5E A;  2IER A;  2JA8 G;  1WE8 A;  3A54 A;  1UEK A;  5CMD A;  5C0X F;  2CTM A;  1JE5 A;  2KEE A;  1BCP B;  1XHK A;  3N52 A;  1VBI A;  2ICI A;  1FJG Q;  1D2B A;  4G7Z C;  1KD1 C;  1VQK A;  3PO3 B;  2F0W A;  1EQT A;  3H4L A;  4GS3 A;  2CG9 A;  1N8R C;  5KEE A;  1H7U A;  1NZ0 A;  4CDF C;  1L1O C;  2WIN B;  1NJI C;  3S16 H;  4B3R H;  2Y0S G;  5CV5 A;  2OTJ A;  2CPQ A;  4A3G H;  2MHV A;  4OGQ C;  3MAQ A;  3BYT B;  4FDB A;  4BY7 H;  5EKW A;  1Q8I A;  1II3 A;  1VQM A;  4FF3 A;  1BBW A;  2R61 A;  1K1G A;  1UNS A;  3MXN A;  4WUD A;  1LAC A;  4PQX A;  4DR4 Q;  1SRO A;  2R93 B;  2RDG A;  4Z7C A;  5K36 A;  1VQH A;  2JN4 A;  2NZH A;  1U4P A;  3U1K A;  5LMU I;  2WKC A;  4G7H C;  4CJ0 B;  4R9W A;  3I4M B;  4XT1 B;  3IKJ A;  2CCZ A;  1O80 A;  1V8Q A;  1NR2 A;  1KRT A;  4GKK Q;  4OHJ A;  1CI3 M;  2O5J C;  1ET9 A;  2F0Q A;  3TEH B;  1JOQ A;  2BH8 A;  2D0P A;  2V34 A;  1I6H H;  1D1K A;  1XNR E;  1UDN A;  2OWO A;  1SSO A;  1G6Z A;  4DV7 I;  4YY3 H;  2UUB E;  5GAH C;  4LF5 L;  1HNX H;  3ONA B;  4DR2 Q;  4X62 Q;  4DV5 Q;  2NN6 F;  2WP8 J;  1HNZ Q;  2GVA A;  3R2T A;  4C3I G;  2F0E A;  1I4H A;  1IBM E;  3T1Y L;  4KY7 A;  2V4D A;  1IL8 A;  2WAQ B;  3CKI B;  3CC2 A;  2A6E D;  1B3Q A;  3HOX B;  4XTC S;  1CKN A;  4B3T L;  5IOD A;  4JVZ A;  4FXK C;  2KUM A;  1QJO A;  4DR2 E;  5IGG A;  4DUY I;  3QB3 A;  4P72 A;  3JAM Q;  4MNO A;  1PFN A;  2WII B;  4URL A;  1KTK A;  3F2U A;  5HGQ A;  1CZW A;  4LW1 A;  1Q82 C;  2Z5B B;  4A3G B;  1TUA A;  4QUF A;  1AEX A;  1FWL A;  1PVO A;  2CQA A;  2VQF L;  1SJE D;  3MEH A;  4A3B B;  5DT9 A;  1BKN A;  1NHI A;  3D6C A;  4B9X A;  1Y4S A;  4FN5 A;  3E9H A;  2D2C C;  5C5L A;  4ZKB B;  3EZJ A;  4GKJ L;  4C56 C;  2Z6K A;  1IZ6 A;  1K3R A;  4YWL A;  1KL9 A;  1EIH A;  2BE5 D;  1XMO I;  2DN8 A;  2K5W A;  3PF5 A;  3PUY A;  1STE A;  3CCM A;  2MO0 A;  1FR3 A;  1QG7 A;  4P71 A;  5LMN H;  4GKK I;  2KHJ A;  1R4P B;  2UU9 I;  3ERS X;  3U58 A;  4B3M L;  4UP9 A;  1MJE A;  1SNO A;  3Q6M A;  4TRD A;  2F0H A;  1HXY D;  1TII D;  1HR0 L;  3KJP A;  1TVX A;  2UXC E;  4BA1 B;  2JA5 B;  3S17 B;  4K5V A;  4IUV A;  4C2M H;  3DWP A;  5C0X I;  3A7A B;  1YIT A;  4JI2 H;  3E3X A;  1UDQ A;  3GTK H;  2LRR A;  1JOK A;  1KHI A;  1KVK A;  2F0V A;  4JYA I;  4DU9 A;  2UXC I;  1ZZI A;  3HS0 C;  4PDB A;  1IBM H;  2PPB C;  4MTK A;  4X65 I;  1BCP D;  4DNT B;  4LAA A;  3S15 H;  3S1R B;  2K1H A;  2RHS B;  2H4O A;  4OWX B;  3H6M A;  1QVF A;  1A3U A;  4UT4 A;  3J80 C;  5IGC A;  1VMC A;  3PGZ A;  5IT9 E;  3PO2 B;  2IL8 A;  4JI3 I;  4A93 G;  1CA5 A;  2PO1 B;  5BN5 A;  2GO4 A;  5GRO A;  1N33 L;  2PO2 B;  1IW7 D;  4X64 L;  2YU9 B;  1UWV A;  3HEJ A;  3NEL A;  3PSI A;  4ILW A;  1WTV A;  2M2L A;  5IYC H;  1ILQ A;  4N8F A;  1HR0 H;  4UP8 A;  4OX9 H;  1G29 1;  1XXG A;  3J80 E;  3GTQ H;  1C48 A;  1N32 I;  4XIG S;  1W2B A;  1Z0G A;  1KXL A;  4GQU A;  1Q3L A;  4U3B A;  1I94 E;  2N88 A;  2A19 A;  3PIO 3;  4XT3 B;  4MDT A;  3PV0 A;  2LTM A;  2RBM A;  4JI0 L;  2RKS A;  1A6X A;  1HHV A;  3RR5 A;  2UU9 E;  1K28 A;  1QNU A;  4A3K G;  4K2L A;  2L11 A;  4AYB G;  2RCN A;  4LF8 I;  3DWQ A;  4X65 Q;  4B3R L;  1MSH A;  1E3H A;  4K2K A;  2B2Y A;  2NYZ D;  3K59 A;  2R93 G;  1HNW H;  4B3S L;  2UXC Q;  1JOO A;  4DUY Q;  3NZK A;  4EMD A;  1STN A;  3NXW A;  4NBQ A;  4NMZ A;  4LF6 I;  3LNU A;  4LPF A;  3M85 A;  4A3J B;  4KD4 A;  2MUY A;  2HD3 A;  3Q22 A;  3C1F A;  3T1H Q;  1TY2 A;  2PI2 A;  1BF4 A;  5IE8 A;  3CRK C;  3GDE A;  1ENF A;  1GUT A;  4JI8 Q;  2RHQ B;  2HKE A;  4A3M B;  4U68 A;  3KRN A;  1XMQ I;  5GAG C;  2F4V H;  4HTH A;  2BA1 D;  2BA0 G;  3BVG A;  1ODH A;  5I2X A;  4O0A A;  1XJV A;  3S2D H;  4DXF A;  3Q6S A;  2LJP A;  2R7D A;  2AWO A;  1SE8 A;  4BXX H;  3PRY A;  2HHH E;  4CKB A;  2QW7 A;  5M5X H;  3S24 A;  4X64 E;  4JV5 H;  4LF7 Q;  2K04 A;  5JJI A;  2UXD E;  2E2I B;  3S9W A;  1Y8N B;  1PTO B;  2CH4 A;  1WJJ A;  3VYS A;  1HR0 E;  1RTN A;  4AQY Q;  2R7F A;  4YWM A;  1V1Q A;  4KI0 A;  2BA1 G;  1WTJ A;  1IW7 C;  1ENC A;  2B29 A;  1MJC A;  4FF4 A;  4J1M A;  4LF4 Q;  3EVQ A;  1N9W A;  1SNP A;  3T1Y I;  4A3G G;  5IGB A;  5BR8 L;  4GN4 B;  1AFP A;  1SNM A;  1XMO E;  5M3M B;  4QJF A;  2XIW A;  2KVM A;  4WAL A;  4DAV A;  1WD1 A;  3J7A M;  2HH2 A;  1LTS D;  4DNR B;  2PO0 A;  2FFM A;  1C0A A;  3PUV A;  3KF6 A;  2JYO A;  1XNQ I;  1GKH A;  1A2U A;  4POF A;  4ZKC B;  3NPP A;  2AUK A;  2K75 A;  3VYU A;  3JAM W;  3MHB A;  2ZJQ A;  4HR7 B;  4K8I A;  4ZVI A;  1MX0 A;  2F52 A;  3RMH A;  2F1M A;  1KAW A;  1E24 A;  1HZ9 A;  4BWG B;  2GVB A;  2NB0 A;  3D4W A;  2NZO A;  5EPL A;  1UDS A;  1S03 G;  2E75 C;  2BM1 A;  1X3Q A;  1UAP A;  1R6M A;  1NBW A;  2N55 A;  4DV4 E;  5KNC A;  4LF7 I;  5FO9 B;  4A93 B;  3W3A A;  4FW7 A;  1IBM Q;  2HHH Q;  1GUW A;  3RN5 A;  4YHH Q;  5JEA J;  1BNZ A;  3I70 A;  1Y1V B;  3AEV B;  2A6H D;  5M3F B;  2OT2 A;  3V2U C;  4B8C D;  3DWA A;  5CBE E;  3H91 A;  3SK8 A;  1YIJ A;  1WTP A;  4JI5 L;  3IL8 A;  4DPX A;  2ZQE A;  3JAM E;  5FLX W;  1SYD A;  3K5L A;  2F03 A;  3HOW H;  1YJ9 A;  1TKW B;  1FNU A;  1YI2 A;  3A56 A;  4DK1 A;  1ILP A;  4OX9 Q;  4JI5 E;  2VQE H;  2PQA A;  4IUQ A;  4KQV A;  2YYZ A;  2RSN A;  3MXP A;  5BR8 E;  3MXU A;  3OTO I;  4LF9 Q;  5JEA A;  2Z0S A;  2F4I A;  2WP8 B;  3FKI H;  4KHZ A;  5GAD C;  2AQ3 B;  4JI3 L;  4NB3 A;  5K5P A;  4WFN 3;  4GOP A;  1H72 C;  4IUN A;  4JG4 A;  5C3W A;  1L1O B;  4A3C H;  3DMU A;  4JI2 L;  4LFA L;  2ALY B;  3NTH A;  2AJ4 A;  3OYY A;  4WUB A;  2PW5 A;  3ERQ A;  4IO9 A;  2XRS D;  1OTC A;  2UXD L;  3HGB A;  1ZYR C;  3K7U C;  4RGN A;  1HFN A;  4QF4 A;  1TWF B;  3I0P A;  1CFM A;  1X54 A;  5JJK A;  1I6U A;  1VIG A;  5ELN A;  3FPU B;  1KDB A;  2GA4 B;  5JEA G;  4DR1 H;  1XWE A;  2PO1 A;  2EPB A;  1IBL Q; 
#chains in the Genus database with same CATH homology
 1GVP A;  1O7I A;  3B6Y A;  1Q8K A;  3JAM i;  3TRZ A;  3S1R H;  4A3I H;  1PH7 A;  2ES2 A;  1A63 A;  1CSQ A;  1EWI A;  1RL2 A;  2F4V Q;  1YJN A;  3I56 A;  4ME3 A;  4A3M H;  2ZM6 L;  2E8G A;  4LNQ A;  3GTM H;  1VQJ A;  3W1G A;  3I4M G;  2CFM A;  4DPG A;  1PYS B;  4DR7 L;  2WP8 A;  5K36 B;  4HJ9 A;  1VQO A;  2I5M X;  5JJL A;  1SRU A;  2CWA A;  4JI4 L;  1N34 L;  2Z6K C;  4PMW A;  1XMQ Q;  3PO2 H;  4WAN A;  2WAQ G;  2Y0S E;  3VDY A;  2NN6 A;  1Q81 C;  4OWW B;  5EAY A;  4GLV B;  3PIO A;  4JV5 Q;  2A8V A;  1VQN A;  2VZA A;  4JOI A;  4BA2 A;  1YJW A;  4DV0 Q;  4BBS H;  2C37 B;  4AQY L;  2IX1 A;  4UP7 A;  2KHI A;  1CUK A;  1YBY A;  3H15 A;  4JVH A;  3HKM A;  3FKI G;  2ZTC A;  3JAM c;  1I5F A;  2MO1 A;  3SGI A;  2NN6 G;  4IFD G;  4B8T A;  1HZB A;  4R4I A;  3GLL A;  2JZX A;  1XTD A;  4JI5 Q;  4EX5 A;  2PQU A;  4LUV A;  3M7N G;  2JA7 H;  1R6L A;  2ASB A;  4L5S A;  2K14 A;  2XGT A;  4A3E G;  2JK8 A;  1HNX Q;  4DR5 Q;  1Q7Y C;  4A3J H;  3I4N H;  1VQE A;  1TWF H;  3KFU A;  1PH8 A;  2PNZ B;  2PNH A;  2L15 A;  1KQS A;  5LMN W;  5K36 F;  4B3T Q;  2JEB B;  2DUD A;  4OON A;  2MJH A;  2HH3 A;  3OTO Q;  1VQD A;  2ATW A;  4JC0 A;  1L2F A;  1NMG A;  1AE3 A;  2HIX A;  5C0X G;  1S40 A;  2BA1 A;  2MFI A;  3ZJY C;  5JEA B;  2R7Z G;  1ZTG A;  3CXC A;  3DD6 A;  4DAM A;  1E3P A;  2B63 H;  2JEA I;  3HOU G;  4IFD A;  1SR3 A;  2LSS A;  2JE6 I;  3CQZ H;  4X66 Q;  2NN6 I;  4GKJ Q;  3G71 A;  2ANR A;  4BXX G;  2ZTD A;  2I5H A;  4C3H H;  5C44 H;  1T9H A;  4IPG A;  3CCV A;  1EIY B;  4BA2 I;  3I4O A;  3UDX A;  3CCL A;  1R9T H;  3M3Y H;  2A1A A;  1J5E Q;  1E22 A;  5LMU Q;  1Q1B A;  3Q8D A;  1TWA H;  1VQL A;  1TWC H;  4DAY B;  2LXJ A;  1I94 L;  4GN5 A;  3RLF A;  2HQL A;  2Q2H A;  2VUM G;  1CKN B;  4X6A H;  2BA0 D;  3V69 A;  2KCT A;  1XPO A;  2PY9 A;  1Y1W H;  2R92 H;  2DGR A;  3HOV G;  4J15 A;  4R4Q A;  1M1K C;  2JA7 G;  3PO3 G;  4DV0 L;  4NXN L;  3OW2 A;  1Q86 C;  2JE6 B;  3M7N D;  1MKH A;  1DGS A;  2YTV A;  5HY6 A;  1VQ4 A;  1Y1W G;  2R92 G;  3L0O A;  3S2H H;  1YVC A;  4OO1 A;  4X65 L;  2UU9 L;  4B3S Q;  1LUZ A;  2KCM A;  2UXB Q;  2K5N A;  3D31 A;  1VCI A;  3HFZ B;  4PZ8 A;  3ULL A;  2AWN A;  2VL6 A;  4AIM A;  2N3S A;  4HIK A;  5AJ3 L;  3J7Z C;  1P16 A;  2IX0 A;  1PH4 A;  1HNX L;  5FLX c;  4DR7 Q;  2NN6 E;  1X56 A;  5C0X J;  4KHP L;  2ANN A;  1VQ6 A;  4YWK A;  3H3V H;  5C4J H;  3UE1 A;  1D8L A;  4IPD A;  4DR3 L;  5IP7 G;  1G6P A;  2ID0 A;  5C0X D;  2B3G A;  3GO5 A;  3HOU H;  1NY4 A;  4UPA A;  1EQQ A;  1E1T A;  1J4W A;  3H3V I;  1XPR A;  2E5L Q;  2JEA B;  3A5Z B;  3ULJ A;  5M3F H;  2NN6 C;  2CTL A;  1NTG A;  1V9P A;  5IT9 c;  2E2H H;  2NN6 B;  3G48 A;  4DR6 Q;  3I2Z A;  5GQO A;  1X3G A;  2UXB L;  1VQG A;  4X66 L;  3RZD H;  3EIV A;  1Z9F A;  5J3B A;  3TQY A;  1K9M C;  4LF6 L;  3KF6 B;  1HNW L;  4ALP A;  2CKZ B;  3IRB A;  4TQU S;  3TS0 A;  4A3L H;  3L7Z A;  1WCM G;  5IYB G;  4R4O A;  5IYC G;  4GLA C;  1WVN A;  4L5R C;  2JA9 A;  3NBH B;  4BBR H;  5M5W H;  4IPC A;  1SFO H;  2NN6 D;  4Y7N H;  1K73 C;  2JA8 G;  4A76 A;  3KYH C;  1WE8 A;  1VQ8 A;  4IOC A;  4HJ7 A;  4BY1 G;  2R93 H;  5C4X G;  3D0F A;  3M85 G;  2D62 A;  4A3D H;  5C0X F;  1OYP A;  2CTM A;  2KBN A;  1JE5 A;  1KRS A;  4JI8 L;  5M3M H;  1VQ7 A;  5JEA F;  4DR5 L;  2JA6 G;  1EOV A;  1GD7 A;  2IHE A;  4LF9 L;  3I7F A;  3LGJ A;  1HR0 Q;  5FLM G;  3F2C A;  1FJG Q;  4LFB L;  4A3K H;  1KD1 C;  1VQK A;  3RN2 A;  3M4O H;  1N32 L;  1C7Y A;  4GS3 A;  2NVQ H;  2MNA A;  1N8R C;  4JI7 Q;  4JYA L;  1L1O C;  4K0K Q;  4JBJ A;  5K36 G;  2VQE L;  4R4C A;  3S16 H;  1NJI C;  3H0G G;  1OXV A;  2Y0S G;  2UUB L;  3S1Q H;  2OTJ A;  4A3G H;  3PF4 A;  4YCU A;  2C38 A;  4H02 A;  3KDF B;  3AQQ A;  1YHA A;  5IP9 G;  4DR4 L;  4FDB A;  4BY7 H;  3HOV H;  2ZTE A;  3CCE A;  1G51 A;  1N33 Q;  4IJL A;  1VQM A;  1XMQ L;  2WFW A;  2VUM H;  1BBW A;  5C0X C;  4HIO A;  1K1G A;  1OYR A;  2I0Q A;  1Y1V H;  2KEN A;  5JEA D;  3EBE A;  5FJ8 G;  4LUO A;  1SRO A;  4DR4 Q;  5K36 A;  1VQ5 A;  1VQH A;  3UDG A;  2NZH A;  3U1K A;  2QND A;  2VQF Q;  4QQB X;  3PIP A;  1YEZ A;  1FGU A;  4YCW A;  1FVI A;  2OTL A;  2JA5 G;  2C38 B;  2CCZ A;  1VQI A;  2N78 A;  1KRT A;  1GM5 A;  4GKK Q;  5DLQ E;  3S1M H;  1PH3 A;  1HNW Q;  1XNQ L;  3I4M H;  4JVY A;  5C0X E;  4APV A;  1VQF A;  3TEH B;  2BH8 A;  2D0P A;  4TVA B;  1I50 H;  2NVX H;  1IBK Q;  3S14 H;  3MEF A;  1I6H H;  3HKS A;  4X64 Q;  4BA1 I;  2UUA Q;  3DM3 A;  2IY5 B;  5GAE C;  4MZ9 A;  4A3I G;  1N34 Q;  3M7N A;  2OWO A;  1UDN A;  2EXD A;  3CPW A;  4GNX A;  4AID A;  2VW9 A;  5GAH C;  4LF5 L;  3HOY H;  4DR2 Q;  2N8N A;  4X62 Q;  4DV5 Q;  4IFD J;  2WP8 J;  4LUZ A;  1LTL A;  1HNZ Q;  2NN6 F;  2GVA A;  1FL0 A;  4A75 A;  3T1Y L;  4GN3 B;  1IBM L;  2C39 A;  1TWH H;  3CC4 A;  4OO1 G;  1PFS A;  4L5Q A;  3CC2 A;  1W3S A;  1K83 H;  3UDI A;  1TWG H;  2UUA L;  4XTC S;  1CKN A;  1EUJ A;  4B3T L;  3PO3 H;  1JT8 A;  1XMO Q;  4DR6 L;  4LFB Q;  4OX9 L;  4P72 A;  4MNO A;  3PUW A;  1ZZK A;  1QVC A;  5HGQ A;  2C35 B;  4IFD C;  3VKE A;  2CQO A;  4LW1 A;  2CWP A;  1Q82 C;  2H5X A;  4JBK A;  3J80 c;  1A8V A;  4RMF A;  1PH5 A;  1TUA A;  1D7Q A;  1ASZ A;  1E1O A;  1PVO A;  1QVG A;  1JMC A;  2VQF L;  4MTN A;  1B70 B;  4A3M G;  4KHP Q;  3M85 D;  3CDI A;  4DV3 Q;  1DT4 A;  1QZG A;  1UE1 A;  3NEN A;  2OCE A;  3E9H A;  2WAQ E;  4IFD E;  4GKJ L;  2P2R A;  4P74 A;  3HOZ H;  2Z6K A;  1IZ6 A;  1K3R A;  4YWL A;  4DUZ Q;  1KL9 A;  2OQ0 A;  4AM3 A;  4KLK A;  1Q1E A;  3PF5 A;  2PO1 A;  1VIH A;  1CKO A;  3PUY A;  3CCM A;  4NXN Q;  4WJ3 M;  2MO0 A;  4P71 A;  2AKW B;  4LWC A;  1UE7 A;  3GTO H;  2BR2 A;  3W5O A;  2KHJ A;  2OPV A;  2AXY A;  3ERS X;  3L7Z B;  2ZM6 Q;  5IWA Q;  4UP9 A;  3U58 A;  1MJE A;  1JJ2 A;  4DV4 Q;  4B3M L;  3KJO A;  3PUZ A;  3K7A H;  3AYH B;  2C39 B;  2NVT H;  1X3E A;  2BH2 A;  1EIF A;  1HR0 L;  1FJG L;  3KJP A;  3M4P A;  1NE3 A;  4BA1 B;  2E2I H;  1GO3 E;  3GTP H;  4C2M H;  5C0X I;  2FMR A;  1YIT A;  2QGQ A;  2AHO B;  1EC6 A;  2YTX A;  3STB C;  1UDQ A;  3S17 H;  4AYB E;  5C3E G;  3GTK H;  2PI2 E;  4HID A;  1UEB A;  3CCU A;  1KHI A;  3ULP A;  1XMO L;  3CDJ A;  1A62 A;  1L0W A;  4NXM Q;  1ZZI A;  2CTJ A;  2N49 A;  2OQK A;  4R1J A;  3OTO L;  1BBU A;  5C3E H;  3F2B A;  4GOP C;  1S3O A;  4IJH A;  3S15 H;  3J7A 5;  3STB D;  1YZ6 A;  1PH6 A;  2RHS B;  1HNZ L;  4OO1 C;  4OWX B;  5M3M G;  1QVF A;  1SN8 A;  1HR0 W;  4DR2 L;  4JI4 Q;  1VQB A;  3CW2 C;  3PGZ A;  5C4X H;  3BJU A;  3GCM A;  1WOC A;  4A93 G;  4IFD I;  1PHJ A;  5IYD G;  2PO1 B;  2PNZ A;  3T1H L;  2JE6 A;  5GRO A;  1N33 L;  2PO2 B;  4X64 L;  5LMU L;  1UWV A;  3K0X A;  1KHM A;  1Q46 A;  1WI5 A;  3NEL A;  3KLW A;  3PSI A;  3CMA A;  2WNR B;  1OXS C;  4NPS A;  5IYC H;  1Y14 B;  1QUQ A;  2WNR A;  2JEA A;  4DR3 Q;  2UXC L;  4UP8 A;  2VQE Q;  5FJ8 H;  4K0K L;  1G29 1;  1UE5 A;  1BKB A;  3J81 j;  3HOY G;  3ICE A;  4DV1 Q;  3GTQ H;  3RLO A;  1X65 A;  3F2D A;  2BL5 A;  4P75 A;  4XIG S;  5C0X A;  1W2B A;  1X4N A;  2VS1 A;  1ZZJ A;  1IYJ B;  4HJ8 A;  4LF7 L;  4BY7 G;  1KXL A;  3FHW A;  4OO1 F;  2A19 A;  3K8A A;  1V43 A;  4DV6 Q;  1XNR L;  3PV0 A;  4IPH A;  3CCQ A;  1M90 C;  4JI0 L;  1SLJ A;  1ASY A;  4IOA A;  1Q12 A;  3RR5 A;  1Z47 A;  4DV7 L;  3G6E A;  4WJ4 A;  4QL5 A;  2JEB I;  3L2P A;  1B7Y B;  1IXR A;  5H1S E;  2E2J H;  4YY3 L;  3DLL A;  4JOI C;  3J81 c;  4A3F H;  4A3K G;  4OO1 I;  4JI6 L;  2JJQ A;  5IYD H;  3U4Z A;  1OXT A;  4AYB G;  4X62 L;  4DV5 L;  1K8G A;  1I94 Q;  2RCN A;  4UY8 C;  2VY3 A;  2LXK A;  1OYS A;  1IL2 A;  4DNI A;  4X65 Q;  1Y1V G;  3BZC A;  4B3R L;  4A3D G;  1K8A C;  1E3H A;  3GTJ H;  4BY1 H;  2R93 G;  1IBL L;  4B3S L;  4GNX C;  2UXC Q;  4DUY Q;  4HJ5 A;  1PH9 A;  1C9O A;  2JA8 H;  4JI1 L;  4DR1 Q;  3RLN A;  3M4Q A;  2YU9 H;  4B3R Q;  4NBQ A;  1N32 Q;  3M85 A;  1RIP A;  4YCV A;  3HOX G;  3J81 i;  2YV5 A;  4DUY L;  4EQ5 A;  3T1H Q;  2Q2U A;  2PI2 A;  1SMX A;  4A3L G;  5IE8 A;  4OO1 B;  3CD6 A;  1TXY A;  3GDE A;  4JI8 Q;  2YQR A;  2RHQ B;  3CP0 A;  4LFA Q;  1L1O A;  2UXD Q;  3KRN A;  5GAG C;  4YY3 Q;  3A0J A;  3CPF A;  3HKZ G;  4AH6 A;  2BA1 D;  4GOP B;  3E9I A;  4DV4 L;  2BA0 G;  3GME A;  4JCV E;  5IWA L;  4B3M Q;  2GN5 A;  5M3F G;  2F4V L;  1X55 A;  1PA6 A;  2EIF A;  4IFD D;  4O0A A;  1XJV A;  3S2D H;  4LIJ A;  4JI3 Q;  3K81 C;  2R7D A;  2AWO A;  1SE8 A;  4QIW E;  4DV7 Q;  4BXX H;  4HIM A;  5M5X H;  4A3B G;  1EQR A;  1N36 Q;  4LF6 Q;  4YHH L;  3S24 A;  1PV4 A;  1H95 A;  4LF7 Q;  2RF4 A;  1X3F A;  3J80 i;  4LFC L;  1VQP A;  1XNR Q;  5JJI A;  1UDO A;  5C0X B;  4O2D A;  2JA5 H;  1X6O A;  3CAM A;  3BU2 A;  2UUB Q;  2R6G A;  2BA0 A;  1WJJ A;  2DGY A;  2NVY H;  4LF8 Q;  1AE2 A;  5K36 D;  1DTJ A;  4LF4 L;  1HZC A;  2AMC B;  4GKK L;  4AQY Q;  2ZJP A;  4JYA Q;  2R7F A;  4YWM A;  1V1Q A;  4A3B H;  3L7Z C;  1PYB A;  4KI0 A;  3K80 C;  2BA1 G;  3I4N G;  4PZ6 A;  4JI6 Q;  2PO2 A;  2B29 A;  4Y52 H;  1MJC A;  3G4S A;  1J5K A;  2JQO A;  3CME A;  4QGU A;  2Q2T A;  4LF4 Q;  2BR2 B;  4IFD F;  1N9W A;  1EYG A;  3AEV A;  1JB7 A;  3CCR A;  2PMZ E;  3UE0 A;  4A3G G;  2CTE A;  3KF8 B;  4GN4 B;  2V1C C;  5BR8 L;  1PH1 A;  2CTF A;  2WB1 G;  4QJF A;  4POG A;  4WAL A;  2HH2 A;  1BVS A;  1NMF A;  4QMF B;  1X9N A;  5M5Y H;  2PO0 A;  3AFP A;  3HOX H;  2UU9 Q;  4L5T A;  4DK6 C;  3PUV A;  1C0A A;  2Q2I A;  1PH2 A;  1OXU A;  2MQH A;  3KF6 A;  3NEM A;  3FP9 A;  3CCJ A;  5JEA E;  2CTK A;  1GKH A;  4POF A;  1QZH A;  1VQ9 A;  2E3U A;  2OPU A;  4OXP A;  5LMN Q;  2K75 A;  2JEB A;  2JA6 H;  3PO2 G;  2K5V A;  4NXM L;  2ZJQ A;  3KOJ A;  2CPQ A;  2UUC Q;  4HJA A;  3S1N H;  1YNX A;  2F52 A;  2K50 A;  1JJC B;  1E7Z A;  2FXQ A;  2R7Z H;  1KAW A;  3CCS A;  4A3F G;  1E24 A;  4C3I H;  1HZ9 A;  2PQA B;  3H1C A;  3RNU A;  5JEA C;  1WFQ A;  4P73 A;  4GLX A;  4BA2 B;  2GVB A;  1J5E L;  1VQA A;  2HT1 A;  2NZO A;  2HIV A;  1UDS A;  1VQC A;  4BA1 A;  4JI1 Q;  4DR1 L;  4JI2 Q;  2K52 A;  1U0L A;  1B8A A;  3E0E A;  3PCO B;  2K5H A;  4RG1 A;  3WWV A;  3A5U A;  1XNQ Q;  1R6M A;  1NBW A;  2D0O A;  2JVZ A;  2HHH L;  1A0I A;  2XTI A;  3ER0 A;  1OXX K;  2PO0 B;  3JC6 6;  1WYD A;  2IT1 A;  1IBM Q;  1MIU A;  2HHH Q;  1IBL Q;  3RN5 A;  4YHH Q;  4JBM A;  4DUZ L;  1S72 A;  5JEA J;  4LF5 Q;  3AEV B;  5ELO A;  4DV3 L;  2K4K A;  5IP7 H;  3RZO H;  5BR8 Q;  2EQS A;  4JG2 A;  2E5L L;  3UDF A;  4JI0 Q;  5K36 E;  1J6Q A;  4DV6 L;  4GNX B;  3B4T A;  1YIJ A;  4JI5 L;  4A93 H;  4PZ7 A;  1EFW A;  3U50 C;  3HOZ G;  4OO1 E;  1UE6 A;  3BZK A;  1LM0 A;  3A74 A;  3I55 A;  1P8L A;  3HOW H;  1YJ9 A;  4JBW A;  1YI2 A;  4LF8 L;  5IP9 H;  4JI7 L;  4OX9 Q;  5LMN L;  2C37 A;  2PQA A;  3CF5 A;  4A3J G;  1AH9 A;  4C3J H;  3H0G H;  5AJ3 Q;  2IHF A;  4A3E H;  2YYZ A;  1KIX A;  3TS2 A;  1JJG A;  5K36 C;  1CKM A;  3U4V A;  1CSP A;  1I3Q H;  3CC7 A;  4LF9 Q;  5JEA A;  4JV5 L;  1N36 L;  2Z0S A;  2ZJR A;  4DV2 Q;  1HH2 P;  4LFC Q;  3HOW G;  3MXN B;  2QA4 A;  2F3I A;  4IFD B;  2WP8 B;  3FKI H;  4KHZ A;  4OWT B;  5GAD C;  5FLM H;  5IY0 A;  3EN2 A;  1X4M A;  4BBS G;  4JI3 L;  4NB3 A;  4GOP A;  4QY7 A;  1YHQ A;  1L1O B;  1U5K A;  3T1Y Q;  1XPU A;  4A3C H;  4LFA L;  3HKZ E;  3AFQ A;  3PUX A;  1HJP A;  2ALY B;  1K0R A;  3GD7 A;  3OYY A;  4A4I A;  4JI2 L;  1KC8 C;  3KDF A;  5C44 G;  4IO9 A;  1OTC A;  3M9B A;  3GTG H;  2UXD L;  1HZA A;  3K7U C;  4OO1 D;  2YTY A;  4PG3 A;  2WB1 E;  4DV2 L;  4R4T A;  5E7N A;  4BBR G;  3TRE A;  2B63 G;  1QUQ B;  5JJK A;  1LYL A;  1X54 A;  4A3C G;  1YHB A;  2VNU D;  1WCM H;  4DKA C;  5IYB H;  2UUC L;  5ELN A;  1IBK L;  4DK3 C;  1VIG A;  5JEA G;  1VS0 A;  3F1Z A;  2QEX A;  4DV1 L;  3GTL H;  3F8T A;  3W1B A;  2I5L X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...