4AIMA

Crystal structure of c. crescentus pnpase bound to rnase e recognition peptide
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
698
structure length
698
Chain Sequence
SPMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKIETINIPTDKIREVIGSGGKVIREIVATTGAKVDINDDGVVKVSASDGAKIKAAIDWIKSITDEAEIGKIYDGKVVKVVDFGAFVNFFGAKDGLVHVSQISNERVAKPSDVLKEGQMVKVKLLGFDDRGKTKLSMKVVDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase/peptide
total genus 168
structure length 698
sequence length 698
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aimA04
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aimA01
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4aimA02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4aimA03
2YYZA 2UXDQ 1R9TH 2KHIA 3GDEA 3AEVA 1KIXA 1J4WA 5IYDG 3E9HA 1IBKL 3BZKA 4JOIA 3GMEA 1VQ7A 2YTYA 4DR3L 3I4NG 4C2MH 5C0XC 4DV1Q 1N36Q 2KCMA 1IL2A 1CKOA 4IOCA 2E5LL 2L15A 2B63H 4LFCL 4AIMA 2NN6B 4LW1A 4MNOA 3SGIA 3I4MH 4DPGA 2JA5H 4DV6L 2PI2A 2UXCL 4PG3A 4HIKA 1OTCA 2A1AA 2D0PA 4P75A 1CKNB 1XPOA 4JI8Q 2H5XA 5ELOA 3AQQA 1HR0W 4UPAA 3KF6A 4A3EH 3S1MH 4AYBE 1PH5A 4C3IH 1Q81C 2CQOA 4AQYL 3U58A 1YI2A 3PGZA 1EWIA 4DV3Q 3F1ZA 3JAMc 3AEVB 3L2PA 1X4MA 1VQJA 3CC7A 1FGUA 2R92H 4B3ML 3RN5A 1IXRA 1EC6A 1X3GA 2EIFA 3HOWH 2RCNA 3S1NH 1ASZA 2PMZE 1N34L 4IFDG 1KHIA 1U5KA 1K0RA 2MFIA 4LF7L 3D31A 4YCVA 2A8VA 4DR5Q 4IPHA 3F2BA 4JYAL 3CXCA 3HOVG 3B6YA 1VQHA 1GD7A 2K50A 2I0QA 2Q2TA 5JEAJ 4JV5L 1A62A 3KOJA 2RF4A 1VQ9A 3CCJA 4BY7G 1JJGA 1QZHA 2OQ0A 4LFAL 4DR6Q 1NY4A 1Q12A 3HKMA 3KF6B 4A3GG 1XNQL 3S2HH 1VQMA 2ANRA 1OXXK 2PO2A 1YZ6A 4JOIC 4JBKA 1R6LA 4A3DH 5IYBG 4YWKA 5GADC 2BA1D 1VQLA 4DNIA 4L5SA 2BR2A 3M7NA 1BVSA 3PCOB 1Q7YC 1NBWA 4P74A 2ANNA 2JA8H 1HNZL 4A3FG 2JEBB 1YBYA 2ASBA 4JI4Q 2PO1A 3PUZA 2WP8A 4DUZL 5GAGC 3U50C 2JEAI 4OO1F 3S17H 5LMNW 2NZHA 2ZTEA 4QMFB 4LF4Q 4R4QA 3UDIA 1HNXQ 2QA4A 3I56A 2VQFL 4YCWA 2JEAA 3CP0A 4DR4L 4O0AA 2PNZA 1S3OA 1YJWA 1MJEA 1Q82C 1KXLA 2B3GA 4R4CA 1Q8KA 2HHHQ 2BR2B 4HJ7A 4OWXB 2ZM6Q 1Y1VG 1W3SA 2YV5A 2UXBL 5IP7G 5JJIA 2YTXA 2E2IH 2UUAQ 2BA0G 2BA1A 2WB1E 2N8NA 4JI2Q 1SLJA 5J3BA 3EBEA 4GLXA 1HR0L 4KI0A 1WYDA 4X65L 3PF5A 4LF9L 3ULJA 4A3JH 3HOVH 3CCVA 4WALA 3OYYA 2JEAB 3CCRA 2RHQB 2C39A 2R93G 2PNZB 3CDJA 4X66L 1VQ4A 3CC4A 3PUXA 4LF6L 4A3GH 5M3MH 4GNXB 4PMWA 1WJJA 2JQOA 4DV2Q 4OONA 3PIPA 4IO9A 2NVTH 5GAHC 1BBUA 3EIVA 3T1YQ 2CPQA 1UDSA 2B63G 3Q8DA 5LMUQ 5K36G 2R6GA 1XMOQ 4LF5L 3HOZH 1D8LA 3H3VI 2OCEA 1VQ8A 3FKIH 3BZCA 4P71A 1Q86C 4UP7A 5K36E 2HH2A 2JA9A 1LM0A 4X64L 3RN2A 2C39B 3NBHB 4BY1G 3CCEA 2VUMG 1DGSA 4OX9L 5IT9c 2QNDA 2KENA 3KDFA 3CC2A 5JEAG 4A75A 1L1OA 3K7UC 3ERSX 1OXUA 1PFSA 1IBMQ 4BBSH 5FLXc 4XIGS 3HFZB 1YIJA 3HOWG 5LMNL 5JEAE 4IFDD 2VL6A 1E24A 4DK6C 4IPDA 3S15H 1B8AA 5IY0A 4QIWE 1K1GA 4JI5Q 2NN6I 5IP7H 4GOPA 4AM3A 4A3MG 3RZDH 1PH3A 3EN2A 1TUAA 3M4OH 3GLLA 4JI6L 2OWOA 3K81C 3OW2A 2NN6A 4ME3A 5GROA 1JJCB 5ELNA 4MZ9A 4Y52H 4LF4L 2ZJQA 3CPFA 2VZAA 3CPWA 1L1OB 1OYRA 4H02A 4TVAB 2WNRB 4A3BG 2JA6H 3RNUA 2F4VL 4JVYA 2R93H 1O7IA 2K5NA 1C9OA 2LSSA 1VQNA 2UU9Q 5C0XE 1RIPA 3A0JA 4JI0L 2CKZB 2HHHL 4IFDI 2CTMA 3UDGA 2DUDA 2WAQG 4DV7Q 2JA8G 3TS2A 4GOPB 2JK8A 2UUAL 2KHJA 4IFDA 2WP8J 4HIMA 4X62Q 2ALYB 1XNRQ 1CSPA 3DLLA 1WFQA 2Z0SA 2WAQE 4LIJA 4NXNL 3CF5A 3KLWA 1DTJA 3DM3A 1J5EL 3STBD 3J80i 3UE1A 1L1OC 4R4TA 1OYSA 3K0XA 3J7ZC 4AYBG 2IHEA 5M5YH 4PZ8A 4JI1Q 4DV0L 1AH9A 4BY1H 4DAMA 2VUMH 3ULPA 1N32L 1XMQL 4JI7Q 1EQRA 1YITA 4YY3Q 1Y14B 5EAYA 3PV0A 4GOPC 4GKJL 4YWLA 4GS3A 2BA0D 3WWVA 2MJHA 2CFMA 1X3EA 3G48A 2JEBI 4HIOA 4IFDB 4P73A 4DR2Q 1IYJB 3A5ZB 2NN6C 4LFBL 1OXSC 1UEBA 5K36F 4QJFA 2N3SA 3GTGH 2HQLA 4QL5A 4BXXG 1MKHA 1W2BA 2JEBA 1EUJA 4A3JG 1HZBA 4A3MH 4AH6A 4DK3C 1UE7A 5FLMH 4EQ5A 2PQAA 1R6MA 3CCMA 4IJLA 3BJUA 4POFA 1GVPA 3RLNA 5M3MG 5JEAF 1UDNA 3JC66 3M9BA 4A3BH 1IBLL 4K0KQ 3CW2C 2Q2HA 2JA7G 3K80C 2I5LX 3UDXA 2PI2E 1TWCH 4IFDC 1A0IA 4LF8Q 1HJPA 5K36D 3M4QA 2XTIA 1N33L 4LUOA 1GO3E 3HOZG 4DV5Q 1SE8A 3FKIG 3ICEA 2YQRA 2BA0A 1TWAH 4KHPL 1P8LA 1K8AC 1HNWQ 5C0XJ 1AE3A 3H1CA 2FMRA 3KF8B 2MO0A 3PO2H 1UDQA 2PQAB 4NB3A 1PHJA 1FJGQ 4DUYL 4GLAC 1YHAA 2CWPA 5JEAD 2E8GA 1PVOA 5C0XF 2QEXA 3MXNB 2IX0A 2Q2UA 1ZTGA 3CAMA 2D62A 4DV4Q 4BBSG 2GVBA 2KBNA 3F8TA 1XTDA 2PO0A 3S14H 5IWAQ 5AJ3L 2E2JH 4B3TL 3U4VA 2ZTDA 3K8AA 1PA6A 1KAWA 1CKMA 3H0GG 4JBWA 1G291 2UU9L 1A63A 2WB1G 2AWNA 1Q1EA 2IX1A 2UXDL 4GNXA 1PH8A 3TREA 1X54A 3MEFA 4GKKQ 4B3RQ 3CD6A 2D0OA 3PUVA 2GVAA 3S2DH 1E22A 1SROA 1EFWA 4DV1L 3M7NG 4OO1D 2IHFA 1N36L 4IPCA 3U4ZA 1IBKQ 2K4KA 2E2HH 4DR3Q 4J15A 2NZOA 1E1TA 1G6PA 3NELA 3LGJA 3STBC 4BXXH 2E5LQ 4BBRH 4PZ6A 3GTOH 4LFCQ 4ALPA 3PO3G 1VQCA 4JVHA 1PH6A 1WVNA 3V69A 4DAYB 3L7ZA 3OTOQ 4UY8C 2JA6G 2I5HA 3S1RH 1PYSB 2PO0B 4JI8L 4DV6Q 1YEZA 2UXCQ 5C4XG 2MO1A 4HJAA 1K8GA 4GN3B 3PUYA 2K52A 1QUQA 2ES2A 2I5MX 3ULLA 3KJOA 1K83H 4DV3L 3PF4A 2EQSA 1MJCA 3ZJYC 5IP9H 3TQYA 3UDFA 2JA7H 4AQYQ 2F52A 1CSQA 2LXKA 4B8TA 4IFDJ 2ZTCA 5K36B 4R4OA 1KHMA 2JVZA 1XPRA 4OO1I 4B3MQ 2R7DA 1IZ6A 3CQZH 5IYCG 1HZCA 4C3HH 2OTLA 1N34Q 5IE8A 1K3RA 1MIUA 5M5WH 4DR5L 4FDBA 4LF7Q 3CCSA 1TWFH 4OO1A 5GAEC 1I5FA 1XJVA 1X65A 1VIHA 3L7ZB 4QY7A 1UE1A 4JYAQ 3JAMi 4NPSA 3FHWA 3GTJH 1TXYA 2OTJA 4DR6L 4JV5Q 5JEAB 3S16H 4A3IH 1UE6A 4GNXC 1QUQB 2K5VA 2E3UA 2RHSB 5HGQA 2WNRA 5C3EG 4YCUA 3B4TA 1XNQQ 2VNUD 3CMAA 3DD6A 2JJQA 2AKWB 3H0GH 2CTFA 1VQKA 4IOAA 1PH7A 2PNHA 1WCMG 4HJ5A 2JE6B 1VIGA 1Z9FA 1J5KA 1V43A 4O2DA 1SR3A 1TWGH 4P72A 3GTKH 1A8VA 4BA1I 4JI4L 3L7ZC 4OO1B 1X55A 3GD7A 5FLMG 2V1CC 2WFWA 1Q46A 1QVGA 1HNZQ 2N78A 5BR8Q 2DGYA 2ZJRA 1G51A 2OPVA 2ID0A 1FJGL 4DUZQ 1JE5A 5C0XG 4GN5A 4BA1A 1VQGA 4LUZA 1HNXL 4YHHQ 3PO3H 1V1QA 2VY3A 3J81j 3M4PA 5H1SE 4BA2B 4DV4L 2Y0SE 2VQFQ 1CUKA 1X56A 4DR4Q 5C4XH 3J7A5 3CCQA 1C0AA 1L0WA 4MTNA 3HOUG 1GKHA 1AE2A 4A3KH 2ZM6L 2YTVA 4GKKL 4B3RL 5M5XH 4A4IA 4B3SQ 4R4IA 4OO1C 4A76A 1YHBA 3K7AH 2UXBQ 1VQ6A 4JI2L 3L0OA 1VQIA 2VQEQ 3PO2G 2HH3A 1VQOA 2IT1A 4PZ7A 2NVYH 1UE5A 5IYCH 3HOXH 1HR0Q 3CCLA 1N8RC 4BA1B 1SN8A 4C3JH 1V9PA 4GLVB 3CDIA 3GO5A 2R7ZH 3RLFA 3HOYG 2UUBQ 4X65Q 4UP8A 2NN6G 2Q2IA 4LF9Q 3OTOL 3T1HQ 4JI3Q 1HH2P 4KLKA 2K14A 4APVA 1SRUA 2GN5A 2MNAA 2BH2A 4DKAC 2HIVA 2NN6E 1M1KC 2A19A 2MQHA 1KD1C 1H95A 2KCTA 4L5RC 4X66Q 5C3EH 1QZGA 2BH8A 4LF6Q 4DV2L 3W1BA 3M7ND 3M85G 1ASYA 3T1YL 2DGRA 1L2FA 1JB7A 5LMUL 4QQBX 1WCMH 3BU2A 1XMOL 1JJ2A 3HKSA 4BBRG 1YHQA 2F3IA 2HIXA 4LF5Q 1OXVA 4DR1Q 1S40A 1DT4A 1QVCA 4A93G 2C38A 1YJ9A 3I4OA 1KRTA 1PYBA 3HKZG 4X64Q 1T9HA 4IFDE 1QVFA 1EYGA 4RMFA 4OX9Q 3H3VH 4WANA 3CMEA 4OXPA 3FP9A 4AIDA 5IP9G 3J81i 1IBML 4JBJA 2NVQH 3A5UA 3HKZE 1EIFA 3I2ZA 3AYHB 1BKBA 2LXJA 4NXMQ 5GQOA 3HOUH 2VS1A 2P2RA 3D0FA 4JCVE 5LMNQ 3IRBA 4A3LH 2B29A 4JI5L 2FXQA 4WJ4A 4YWMA 3VKEA 1U0LA 1BBWA 3W5OA 3KFUA 2QGQA 5IYDH 1WI5A 4X6AH 4JBMA 2CTJA 1I94Q 2CTKA 3I4NH 3G6EA 5BR8L 2YU9H 2C38B 4JI6Q 1E3HA 2ZJPA 1SFOH 2IY5B 2UUCQ 3NEMA 1VQDA 3F2CA 4A3IG 1Q1BA 3AFQA 1ZZKA 4YHHL 3HOYH 4GN4B 4QGUA 1KC8C 3GTQH 3GTPH 1JT8A 4XTCS 5C44G 1X6OA 5FJ8G 3E9IA 4DR7Q 2BL5A 1D7QA 1E7ZA 1WOCA 2XGTA 4R1JA 3I7FA 2PO2B 2F4VQ 5M3FG 1EQQA 4TQUS 4JC0A 1PH9A 1TWHH 3J80c 2EXDA 2NVXH 3S24A 5C4JH 4A3CG 3RLOA 4DV7L 4JI0Q 1HZAA 3E0EA 4LWCA 4B3SL 1VQEA 2AMCB 1YNXA 1PH4A 1Z47A 5K36A 3RZOH 3KRNA 4X62L 1XNRL 1NJIC 1K9MC 1HZ9A 1E1OA 3I55A 2VQEL 3U1KA 3G71A 5C0XD 2AHOB 2PO1B 2WP8B 2N49A 3UE0A 1XPUA 1I50H 1EIYB 4NXNQ 3W1GA 4NBQA 3ER0A 4KHZA 1EOVA 2UUBL 1J5EQ 1Y1WG 2NN6F 4JI1L 1OXTA 3T1HL 4JI3L 1S72A 1C7YA 4A93H 4HIDA 4EX5A 5JEAA 2JZXA 4JI7L 2ATWA 4DV0Q 1FL0A 4A3KG 4YY3L 1JMCA 4BY7H 1N32Q 1XMQQ 4L5TA 2JE6I 1VQ5A 3A74A 1KQSA 1YJNA 4HJ8A 1LTLA 3H15A 1PH2A 1SMXA 1NMFA 1X4NA 3GCMA 2Z6KA 1VQPA 3TRZA 4GKJQ 2JE6A 4DR2L 3PSIA 1NMGA 1ZZIA 4LUVA 4RG1A 3HOXG 5IYBH 4HJ9A 1KRSA 1VQBA 1GM5A 3G4SA 2BA1G 1FVIA 4LFBQ 5C0XI 5JJLA 2R7ZG 2NN6D 4IFDF 3J81c 3PIOA 1RL2A 1ZZJA 3I4MG 4OWTB 3GTMH 4BA2I 2OQKA 3RR5A 4DR1L 4WJ3M 3KJPA 2AXYA 2JA5G 4A3FH 2CCZA 5C0XA 3AFPA 3KYHC 1VS0A 1K73C 3PUWA 3GTLH 2HT1A 4LFAQ 3CCUA 2K75A 1VQFA 2AWOA 4Y7NH 1NTGA 1YVCA 4BA2A 4A3EG 3M85D 4K0KL 5C44H 2R7FA 2VW9A 2CTLA 1X3FA 5DLQE 1WE8A 5FJ8H 4POGA 1I3QH 2C37A 5K36C 3TEHB 1IBLQ 4LF8L 4NXML 5HY6A 1PV4A 5M3FH 2R92G 5JJKA 1X9NA 2K5HA 1B70B 4DV5L 4A3CH 1N33Q 1J6QA 2CTEA 1HNWL 4JG2A 1Y1VH 1VCIA 4L5QA 4KHPQ 1UDOA 5E7NA 1KL9A 2Y0SG 3S1QH 5JEAC 5C0XB 1I94L 4IJHA 1E3PA 1NE3A 2CWAA 4OO1G 1I6HH 2UUCL 1N9WA 4DUYQ 1LUZA 3VDYA 2PQUA 2C35B 1OYPA 2OPUA 1M90C 2PY9A 1Y1WH 3KDFB 3NENA 4OWWB 5IWAL 4UP9A 4LNQA 1UWVA 4DR7L 2C37B 4OO1E 1LYLA 2Z6KC 1VQAA 3TS0A 1CKNA 5AJ3Q 4A3DG 1PH1A 4B3TQ 1B7YB 3F2DA 4IPGA 4A3LG 3M3YH 3M85A 1P16A
chains in the Genus database with same CATH superfamily
1CK1A 3WU3A 2YYZA 1N33H 1F2YA 2UXDQ 1Q3LA 4FYDA 1TS3A 1R9TH 2KHIA 3GDEA 3QJYA 3LPSA 1Q8IA 3AEVA 5HGTA 1TY2A 1KIXA 2BE5D 4KHPH 1BNZA 1J4WA 5IYDG 5DNFA 1O7LA 3E9HA 3VA7A 3PO2B 1ZXNA 1IBKL 1Y4UA 5IWAI 1EQTA 3BZKA 2K5WA 4JOIA 2O3ZA 1EYAA 5C4ZA 2R3VA 2Z5CA 3J7AM 2O1VA 1VQ7A 3GMEA 4DA2A 4DR7I 2YTYA 4DR3L 2YU9B 4C2MH 3I4NG 4DV1Q 2R61A 4KKTA 1N0VC 5C0XC 2K28A 3ZKDA 4DU9A 3QB3A 1N36Q 3HS0C 2KCMA 5CV5A 1CT1D 1IL2A 1A3TA 1ZYRC 2F4VI 1CKOA 5J22A 4IOCA 3SDZA 2E5LL 2L15A 2B63H 3H3VC 1TQOA 1N0UA 3A8IE 4DUYH 4LFCL 3HOYB 1L0YB 4AIMA 4DR5E 2X6GA 3GQBA 3Q0AA 3GTQB 2NN6B 5IGDA 4LW1A 4EQPA 3GTPB 4MNOA 1Z0GA 2AQ1B 3V2TA 3SGIA 2E2JB 2ZXOA 4KHVA 4P52A 1E2WA 3WOEA 1CA6A 3I4MH 4DPGA 1PTOC 1BCPB 2KUMA 2JA5H 4DV6L 2PI2A 2L5TA 3OMGA 2UXCL 4CDEC 1BUVT 4PG3A 2L1BA 4HIKA 1KLGD 4K2KA 2A1AA 2D0PA 1OTCA 3AMUA 1U2RA 4P75A 3Q6MA 4B3TH 4DR6E 4USMA 1CKNB 1SEBD 4DR3I 4E6IA 4FO2A 1XPOA 1K47A 1TWHB 4JI8Q 5T1GA 2H5XA 3I90A 1QB5D 2NVXB 1D6TA 5ELOA 2UU9H 3AQQA 2G8YA 4N9PA 5C4JB 4IZJB 3P76A 1HR0W 3S2DB 4ZK9B 4HTHA 2EXZA 3C2PA 3J81L 4UPAA 3KF6A 2E5LI 4GZYC 5BN3A 4A3EH 2UXDH 5KRUA 4LFCI 3S1MH 4AYBE 1PH5A 2A6HC 4C3IH 1Q81C 2CQOA 3TP7A 1V8QA 4K0KE 4AQYL 2XWJB 3U58A 3PGZA 1YI2A 1EWIA 3ND8A 1H73A 4DV3Q 1JWSD 3F1ZA 3JAMc 2BV3A 2X36A 4RGTA 3AEVB 4XT3B 3L2PA 1RD9D 1X4MA 1VQJA 3CC7A 1SYFA 2TSSA 1FGUA 3V05A 5CMDA 1B1ZA 1GUWA 2X06A 2R92H 4DV1H 2F0JA 2F0IA 4B3ML 4DV6I 4FXGC 3RN5A 1IXRA 1EC6A 1X3GA 2EIFA 3HOWH 2RCNA 1N36H 3S1NH 4BBRB 4QNKA 1ASZA 2VXWA 2PMZE 4HY1A 3RF2A 4MDTA 4DV5E 3QT6A 1N34L 4FF2A 1SDFA 3CU7A 1KHIA 1U5KA 5C5MA 4K8JA 1K0RA 4IFDG 1U4LA 2MFIA 3R93A 4LF7L 3D31A 4NMZA 2A68D 1N32I 3PYFA 4N3OA 5DAUA 4GQUA 5NUCA 4YCVA 2A8VA 4DR5Q 1WTOA 4IPHA 3F2BA 1K28A 1BCPC 4AQYI 4A93B 4JYAL 3CXCA 1VI7A 3WU4A 1ZKOA 4EQNA 3D4JA 3HOVG 3B6YA 4KY6A 1VQHA 1BDOA 2GO4A 1GD7A 2K50A 4HR7B 2I0QA 2Q2TA 2NPFA 5JEAJ 1FJGE 3GV3A 1R4PB 4JV5L 1A62A 1IHZA 3PMFA 4B3MI 5KNCA 3KOJA 4OO1H 3J80E 4JI8H 3R3OA 2RF4A 2K7VA 1VQ9A 4XQQA 3CCJA 4BY7G 1JJGA 1QZHA 1Z0BA 2QW7A 1HNXE 2OQ0A 1EYCA 3TP6A 2DJFC 4LFAL 4DR6Q 3QIAA 1NY4A 4TSSA 3PYEA 1Q12A 1N34I 1EY7A 3HKMA 2Z5EA 1FKAH 3KF6B 2E74C 4LF7I 4A3GG 4DFAA 4DV4E 1XNQL 3S2HH 4DV3H 4HCEA 1VQMA 2A69D 2ANRA 3H94A 4C56C 2ZT9C 5IWAE 1MD2D 1HUMA 1OXXK 2PO2A 3DWQA 3OETA 1YZ6A 4C1NK 4JOIC 4JBKA 4JYAI 1R6LA 4A3DH 1Z5BA 5J39A 1H9SB 2K1BA 4LPFA 1H9KA 5IYBG 3D4RA 4YWKA 5GADC 4C3HB 2F0UA 2BA1D 4IUQA 1VQLA 2ZM6E 3DHQA 3QOJA 5M5WB 3NSWA 4DNIA 4L5SA 4GKKE 4B3RE 2BR2A 3M7NA 1BVSA 4IUVA 4LFAI 4DPTA 3PCOB 1Q7YC 2ICEC 4LCHA 2A2DA 1NBWA 4P74A 4FW3A 3QG1A 2ANNA 3K5OA 4DR5H 3TP8A 1ZM9A 2JA8H 2B2WA 1HNZL 2F0SA 4A3FG 2JEBB 4KJNA 3H09A 1YBYA 2ASBA 3ONAB 4JI4Q 2NYZD 3DMUA 3PUZA 2PO1A 2WKCA 2WP8A 4DR3E 2G9HD 4A3IB 4H7BA 4DUZL 3GTLB 1I4PA 5GAGC 3OSOA 3U50C 4OGQC 2K5DA 2RQXA 2JEAI 4OO1F 3S17H 4DR6H 5LMNW 4LFCE 2NZHA 2ZTEA 4FWGA 2PQEA 4KY5A 1SE2A 4QMFB 1HQMC 2X6LA 4LF4Q 5GMEA 5C44B 1ZM4A 4Q5VA 2PNLA 4R4QA 3UDIA 1HNXQ 2QA4A 3I56A 1N33I 1I3QB 2RCFA 3KK7A 5C5LA 1RREA 2VQFL 3OTOE 4YCWA 2O5JC 4R9WA 1Z0TA 2JEAA 3CP0A 4DR4L 2VKCA 4O0AA 2UXCE 5M3FB 3G6JB 2Y3MA 2LTLA 1WVLA 2PNZA 1GUGA 3QT7A 1IW7C 5ELCA 3DM1A 3OWEB 1S3OA 1E0BA 3D4DA 4FN5A 4DUZI 1YJWA 1MJEA 1Q82C 2CH4W 3MXPA 1SYEA 1TWGB 1KXLA 4RPFA 2XRSD 2B3GA 3GTKB 2ZBKB 1TS4A 3E0JA 1NCVA 4XTJA 1VF7A 1Q8KA 4R4CA 2HHHQ 4NW2A 2BR2B 4UTGA 1KDAA 4HJ7A 1STAA 4OWXB 2ZM6Q 1Y1VG 2BE5C 4XT1B 1W3SA 2YV5A 2UXBL 1V1PA 2QILA 3GP7A 1PRTF 1LT4D 2VQFI 5IP7G 5JJIA 3N6RA 2YTXA 2E2IH 2EY1A 2QKIC 3T1YE 2EZVA 4JI4H 2F1DA 1EEFD 2UUAQ 1RHPA 5LMUE 2BA0G 5A35A 2BA1A 2WB1E 4QMGA 4B3ME 2N8NA 4JI2Q 3MZ5A 1SLJA 1B3AA 1EI1A 5J3BA 3J81C 1BF4A 1XMOE 1I6HB 3EBEA 4GLXA 1B9NA 1HR0L 1H9RA 3LWEA 4KI0A 1AP0A 4B3TI 5JPNC 3B8HA 1FJGH 5KNBA 1N34E 1WYDA 4U3BA 5BN4A 5A2QC 1Y1WB 4X65L 2I07B 1HNXH 4IURA 2KA7A 3JAML 3WOFA 1U4PA 3PF5A 1CZWA 4LF9L 4KD3A 4I7AA 4CDFC 3ULJA 4A3JH 1LT3D 3D6CA 3DEPA 3HOVH 2UXBI 1QE6A 1O7YA 3CCVA 2F3WA 4WALA 4DV4H 3OYYA 2JEAB 1DD2A 1I4GA 2C9OA 4E9JA 1B4OA 1W6JA 4OZEA 4A3KB 3CCRA 2RHQB 2C39A 2R93G 3NBHA 4JV5E 1AN7A 3M3YB 2PNZB 5M5XB 4DV1I 2RDGA 3CDJA 2NZ1D 2BCOA 1D2BA 1II3A 1K0SA 1HR0I 4ZCKA 3SXHA 3KDGA 4X66L 5ELBA 1VQ4A 3CC4A 4DK1A 1PFMA 3PUXA 4LF6L 4A3GH 2ZM6H 4LK1C 1DOLA 5M3MH 4GKKH 4B3RH 4GNXB 4X65I 3VYUA 1GOZA 4PMWA 1WJJA 1UUPA 1XNQE 2JQOA 2M00A 3MXUA 4LF9I 2HK3A 4DV2Q 1V1PB 4OONA 2B2WC 1JE4A 3PIPA 4C2MB 3B78A 4IO9A 2XWBB 3HOXB 2PT7G 4NZRM 3KBXA 2NVTH 4JI2H 1E2VA 5GAHC 1BBUA 3EIVA 3T1YQ 2CPQA 1UDSA 1RHYA 2B63G 2R7ZB 1G6ZA 4JI5E 3Q8DA 5LMUQ 5K36G 4JI8I 2A68C 2R6GA 3J81W 3P3CA 2FMCA 1QOHA 1WTRA 1ENFA 1STNA 3NQTA 1XMOQ 4LF5L 4FF1A 2HDLA 3P20A 3HOZH 1D8LA 3H3VI 1GUSA 3I4MB 2OCEA 5EPLA 1VQ8A 3FKIH 4KKUA 3BZCA 4PMCA 2JA5B 5A2QW 3SB1A 4WRDA 4P71A 3I0PA 3UI2A 4RCOA 1Q86C 1X3QA 1HNZE 4UP7A 3PYGA 5K36E 2HH2A 1G91A 3OTOH 3A55A 5BR8E 2JA9A 4G4KA 3PS2A 1LM0A 4X64L 2F0HA 4DPUA 1O7ZA 3RN2A 1I4HA 4B8CD 1A3UA 2C39B 3NBHB 1PVGA 4BY1G 3CCEA 3E3XA 2VUMG 2KVMA 1DGSA 1NHJA 5IT9W 4A3EB 4OX9L 5IT9c 4YHHE 1F9PA 2QNDA 2KENA 1SJED 3OIPA 3KDFA 3J7AK 5ELWA 2Z4IA 2CGEA 2F0TA 4C3IB 2HK2A 3P7JA 3TBIB 3Q6SA 4ZUJA 1EWHA 3CC2A 4P2CB 5JEAG 3Q24A 1SAPA 1EY6A 1L1OA 4A75A 4ZKBB 3CKIB 3K7UC 2EVBA 2VQFE 2F0MA 3ERSX 1OXUA 4DV2H 1A15A 5I6WA 1ML0D 1PFSA 1IBMQ 5FLXW 2R92B 1WCMB 4BBSH 1HHVA 3EQLC 5FLXc 4DR4E 1TU2B 4XIGS 1C48A 3HFZB 2OF1A 3HG9A 2K01A 3D3RA 1S5FD 3S1NB 1YIJA 3HOWG 4MIUA 3A56A 3M4YA 2F1MA 3T1YH 4X64I 2ZXRA 1VMPA 5LMNL 5JEAE 1AEXA 4IFDD 2VL6A 5LMUH 4IN3A 1Q90A 1E24A 4DV7E 4DK6C 4DXLA 4IPDA 3S15H 5EPJA 3KLSA 4V0BA 1B8AA 1XMOH 1S5CD 4KN4C 5IY0A 4H44C 4I7ZC 4OX9I 4B3SE 3L9AX 3D4WA 2G5DA 4QIWE 2HQEA 1K1GA 1USVA 1KDBA 4JI5Q 3I72A 2NN6I 1TY0A 1ET9A 5IP7H 4GOPA 2UXBE 4NKLA 4AM3A 2Y0SB 1ZM3A 5EKLA 4X62E 4A3MG 3RZDH 1XNRE 1PH3A 1HK7A 4HACA 3EN2A 2BM1A 1S5DD 3MEHA 5DNXA 2VQEE 1E2ZA 4DXFA 1YNJD 5C3WA 3I70A 1TUAA 3M4OH 3GLLA 3K0YA 2OWOA 1JWMD 4JI6L 1JOQA 3K81C 1Y60A 3OW2A 1PZKD 1G2TA 4XYOA 2NN6A 4ME3A 1U4RA 2F0WA 5LMNI 1X3PA 1JORA 5GROA 2K04A 1JJCB 5ELNA 3SE0A 4MZ9A 4Y52H 1SNCA 2UUBE 4LF4L 3FPUB 4X65E 4F87A 3ZZUA 2QF7A 2ZJQA 4ISAA 3UOEA 3CPFA 4JI1E 4LF9E 2VZAA 2BDOA 3CPWA 1L1OB 1OYRA 4H02A 5I9OA 4MTKA 3T1HE 4JI3E 5JVG3 1IBMH 2MUYA 4TVAB 2WNRB 1DZ1A 4A3BG 2KEEA 1YH8A 2JA6H 3RNUA 4JI7E 2F4VL 1MSHA 4JVYA 4HCSA 2R93H 1O7IA 2K5NA 4JI4I 1C9OA 2LSSA 1EY0A 1VQNA 3NE5B 2UU9Q 5C0XE 4IZ8A 1RIPA 3MAQA 1EU4A 4RGNA 3JAMC 3A0JA 1Y4SA 4X66E 4JI0L 2K32A 4BS9A 2CKZB 1ENCA 5FWKA 2HHHL 4L8JA 4IFDI 2RBMA 4RKBA 4LF6E 3SEBA 2CTMA 5G3LD 4JI5H 1IKMA 3RUZA 3UDGA 4HMJA 2DUDA 1UG8A 2WAQG 4DV7Q 3LNUA 4LF4I 2JA8G 3TS2A 3LNNA 4M8AA 3I4NB 4GOPB 2CH4A 2F0EA 3FEWX 3NZKA 1LABA 4DR2E 1B62A 1F77A 2EYMA 1SFOB 2JK8A 4HACB 2BM0A 2UUAL 1DCZA 3Q6NA 3MTSA 1LTTD 1FNVA 2QEJC 2IWHA 2KHJA 2DY7A 4IFDA 2WP8J 3EROA 3NUCA 4HIMA 3ERQA 4X62Q 2ALYB 1XNRQ 1CSPA 3S17B 1HPCA 3DLLA 2O2LD 4EGVA 1WFQA 5K36H 2Z0SA 5BR8H 3Q22A 1NUCA 2WAQE 1GJXA 2JYOA 4LIJA 4NXNL 5IGCA 1AZQA 3KLSX 3CF5A 4EMDA 1MU5A 3KLWA 1DTJA 4WFN3 2Z8LA 1LT5D 2R42A 4LF5E 2Q8IB 2CW0C 3DM3A 4JI0I 3I4LA 3DXJC 1J5EL 3STBD 2HHHI 3J80i 3UE1A 1L1OC 4YHHH 2CWHA 4R4TA 1OYSA 1PDQA 3K0XA 4DR1E 1XHKA 3J7ZC 5EBCA 4AYBG 2IHEA 2IOQA 2VESA 4ZAIA 5FO8B 4CBVA 1OO9B 2WKDA 5M5YH 3NCVA 3J7YW 3FPPA 1AW7A 2Q8RE 3DWAA 1JOKA 3KUPA 4L6TB 5D3DA 4PZ8A 4JI1Q 4PMBA 4KTAA 1CFMA 2B2TA 2MGSA 4DV0L 1J8IA 2UUAI 1AH9A 4BY1H 2HCIA 1ONLA 4DAMA 3ULPA 2VUMH 1N32L 4JI2I 4F8MA 1XMQL 3IAYA 2KECA 5IGBA 4JI7Q 1STYA 1EQRA 2B2UA 2H4OA 2SOBA 1SE4A 1YITA 3F0NA 4YY3Q 4NXNI 5JEAH 2NWGA 3RZOB 4HMIA 2B2VA 1Y14B 3L3OC 3MC0B 3JAMW 5ELDA 5A2QL 2ZQEA 1NNXA 3K57A 4DV7H 1Y8NB 4X3SA 3TZUA 5EAYA 3PV0A 1H74A 5IIFA 1M4VA 5CBEE 2NBFA 3VR4A 1J5EI 1F9QA 2MJ8A 2IESA 4GOPC 1H9SA 3N52A 3QO2A 4B3SH 4LF8E 4GKJL 2PNRC 2M6QA 1JB3A 4YWLA 2A6ED 5IGFA 5DRQA 4GS3A 2BA0D 4NXME 2D9UA 3OIQA 2FFMA 3WWVA 2MJHA 3KBGA 1EZ8A 2CFMA 1UEAB 1X3EA 3G48A 2JEBI 4X62H 2EY2A 4M1UB 1XNRH 4N8FA 1I50B 4HIOA 5IT9L 1L0XB 4IFDB 1BO0A 4P73A 4DR2Q 4DV0I 4ZLTF 1IYJB 3A5ZB 2VQEH 1UEKA 2NN6C 4LFBL 1SMYD 1OXSC 1BR9A 2LRRA 2DNCA 1UEBA 1B50A 5K36F 1XMQI 4QJFA 2N3SA 4J8QA 5J1ZA 1YHCA 5COYA 2EDGA 1ZXMA 4KV6A 4IS9A 4LCGA 3GTGH 2HQLA 4QL5A 1HNWE 1PKPA 4BXXG 1ELOA 1MKHA 1W2BA 1MI2A 2JEBA 1EUJA 4A3JG 5M9OA 4UT4A 2EYJA 3HOVB 1RKNA 5FLXL 1HZBA 2RKSA 4A3MH 3HKZB 1S16A 4AH6A 4K5WA 2UUBH 3GR5A 1EY8A 1D5MC 5LL6R 4DK3C 4GKJI 4JI1H 1I94E 4DV2I 3J7AF 2V8PA 1UE7A 3KF8A 3T56B 4BY7B 3T1HH 4JI6E 4JI3H 5FLMH 1IYUA 4EQ5A 2PQAA 2WINB 1DM0B 1R6MA 2UUCE 4ZKCB 2MPMA 2FMMA 4JI7H 3CCMA 4IJLA 3BVZA 3BJUA 4POFA 4KQVA 1NSNS 4MU4A 4TRDA 2JSOA 4FXKC 3TZDA 4A3GB 1GVPA 4LFBI 2CWFA 4YY3H 4DN4M 3RLNA 2F0LA 3HRZC 1RTNA 4KD4A 5M3MG 1A3VA 1KAAA 3TDQA 3NP8A 3X3NA 5JEAF 1UDNA 1EWCA 1RR9A 5HURA 1EFID 2IW3A 3JC66 3NXWA 4ULLA 3SK8A 4DR7E 3M9BA 4A3BH 3A7AB 4H0LC 1IBLL 4K0KQ 3CW2C 1BKNA 2Q2HA 2L9HA 1PXUA 4KMUC 4S3SA 4F88A 5IOCA 2JA7G 1PFNA 3K80C 2I5LX 4ZVIA 2F4VE 4Z7YA 2EY5A 3UDXA 1TS2A 2PI2E 1TWCH 4IFDC 5JOBA 1A0IA 2K6AA 4LF8Q 4L63B 1HJPA 1DARA 1STBA 2M9VA 3FMCA 2M8WA 4DR2H 3PIO3 5K36D 1PQXA 1PTOH 1ESRA 2XTIA 1KLUD 3M4QA 3VR6A 1XRHA 1YNND 2DEIA 4U68A 1N33L 2O1TA 1Z0WA 1CQVA 4LUOA 1GO3E 2PYKA 4DF7A 3HOZG 2V2ZA 4DV5Q 1SE8A 4RHRA 2J7ZA 2RSNA 1LTID 3GTMB 5EBDA 3FKIG 3ICEA 2YQRA 1CA5A 2VF3A 4A3FB 2BA0A 1TWAH 4KHPL 3OW7A 1P8LA 1IBKE 1EIHA 1K8AC 4QF4A 1S03G 1HNWQ 1YNJC 5C0XJ 1HFGA 3CWVA 1STGA 4KKSA 1IBLI 1AE3A 3H1CA 1IBMI 2FMRA 4DR1H 4Y7NB 2B2TC 3KF8B 2AUKA 2MO0A 2K1HA 1XWEA 3HJCA 4FW9A 2E5LE 3PO2H 1UDQA 2PQAB 3SK4A 2SEBD 4NB3A 1PHJA 1FJGQ 4DUYL 3LX0A 4GLAC 3J80Q 3NTKA 5JJZA 1C4QA 2XRQD 1YHAA 3SK5A 2B2UC 1K3BC 2CWPA 2NTTA 5JEAD 2E8GA 3DWPA 4JG4A 1LT6D 1Z7TA 3URYA 3A8KE 1PVOA 5C0XF 1G8ZD 2QEXA 2B2VC 1BXTA 3MXNB 1ZM2A 2IX0A 2RSOA 2Q2UA 2O1UA 4DAYA 1ZTGA 4U673 3CAMA 2D62A 4DV4Q 3PS3A 4DV6E 4BBSG 4K0KH 4KHPI 2GVBA 2KBNA 3C1FA 4G7ZC 2EYOA 3F8TA 1XTDA 1RF2D 1RODA 2PO0A 3S14H 5IWAQ 5AJ3L 2E2JH 1HA5A 1STHA 4B3TL 2XVSA 5ELEA 4IZKB 3U4VA 2ZTDA 3K8AA 1SJHD 3J7AV 1LLRD 1S5ED 1PA6A 1ZXTA 3VYSA 4Z7CA 1KAWA 4LF8H 3BDLA 1CKMA 1SYBA 3H0GG 4NXMH 4JBWA 1G291 1IL8A 3K6OA 5EPKA 1MGSA 1DOKA 2UU9L 2AE8A 1A63A 2WB1G 2AWNA 3J81E 1N32E 1Q1EA 1VBIA 1XMQE 2IX1A 3OMCA 1PTOF 1Y1VB 2UXDL 4GNXA 1PH8A 1LV9A 1SNOA 3TREA 4DUYI 1K8MA 1X54A 4DV5H 1Z0EA 2KCCA 4FJSA 4R8NA 2XIWA 3MEFA 4GKKQ 4B3RQ 3CD6A 4DNTB 4AQYE 2D0OA 1HQRD 4G08A 1TT2A 3PUVA 3V96A 2GVAA 5A2QE 4ZYSA 4LJZC 3WU5A 3NWSA 1CI3M 3HGBA 3S2DH 3S1QB 1E22A 4I65A 1S4ZA 1HNWH 1SROA 2HKJA 5DRRA 4PQXA 4DAPA 5CV6A 1EFWA 3MWYW 4DGZA 3M4OB 2FJ2A 4DV1L 1JWUD 3M7NG 1KTKA 4OO1D 1RCVD 1PYWD 3BZDB 2IHFA 1N36L 4IPCA 3U4ZA 4TKOB 1IBKQ 2JT2A 1EY9A 2K4KA 1ILQA 2GQ0A 1PLFA 4XQNA 2E2HH 3R2IA 1RDPD 4DR3Q 1I94H 4J15A 5DROA 2E2DC 2E76C 2NZOA 1E1TA 5IGEA 1G6PA 1WD0A 4R1FA 4ILWA 2UU9I 1DXMA 4LF7E 1X0AA 2A5HA 2RDFA 1V9NA 1HRJA 1KNEA 1M8AA 4Z9CB 3NELA 3LGJA 2UUCH 3STBC 4BXXH 3D8GA 2V2QA 2UXDI 4YIJA 2E5LQ 4BBRH 2AQ2B 2VB2X 2HDMA 4PZ6A 3GTOH 4LFCQ 4ALPA 3PO3G 1VQCA 4JYAE 5FKAC 2KQ3A 4JVHA 4JK1C 4FXDA 1PH6A 1F9RA 1WVNA 3V69A 4KY7A 4DAYB 3L7ZA 3LWUA 3OTOQ 4FVMA 4UY8C 2JA6G 4P7AA 3GABA 2R93B 5IT9C 5IWAH 2I5HA 3S1RH 2HKEA 1DJRD 4RH6A 1LTBD 1PYSB 2DJGC 2RDHA 4K6DA 2PO0B 4DR7H 4FJUA 5IGGA 4JI8L 2JXMB 4DV6Q 1YEZA 2UXCQ 1I4QA 5C4XG 1N36I 1LACA 1QG7A 2MO1A 3SK6A 4HJAA 2EOTA 4LFAE 1I6UA 1K8GA 1ZEQX 1MG7A 1R9TB 4GN3B 5ELFA 3PUYA 1BCPF 2K52A 1QUQA 2ES2A 4LMQD 2I5MX 2KHSA 1PRTD 5FLXC 1EOTA 4CJ2C 3U9OA 4CKCA 2OXPA 4CKEA 3ULLA 1F2LA 3KJOA 4FW6A 1K83H 1A6XA 1CM9A 3PQIA 4DV3L 3PF4A 2QCPX 2EQSA 4RFBA 2CHBD 4CDDC 2A6EC 1MJCA 2O1WA 3ZJYC 5IP9H 2B8GA 3TQYA 3UDFA 2JA7H 1IBLE 4AQYQ 2F52A 1CSQA 2LXKA 1D1KA 4CJ1B 2ZITA 3M6AA 1QILA 2B63B 3QOLA 4FW5A 1IBKH 2F0OA 4B8TA 1XX8A 4IFDJ 2ZTCA 5K36B 4R4OA 4DR3H 1KHMA 2JVZA 1XPRA 5CYUA 4OO1I 2D5DA 4B3MQ 2GS8A 4MQYA 3VYRA 2LKVA 3ND9A 2R7DA 4EQOA 1IZ6A 2D9IA 1SSOA 1N33E 3CQZH 5IYCG 5DM73 4LOMA 3KDKA 3GKUA 2E5LH 2F0DA 4M1KA 1F9SA 1HZCA 3T16A 4C3HH 2OTLA 5LL6X 1N34Q 5IE8A 4LFCH 3K5LA 1K3RA 4C3JG 1MIUA 5M5WH 5CGKA 4DR5L 4FDBA 4LF7Q 4AIDA 3CCSA 1SNPA 4V190 1TWFH 1H7SA 4DV3I 1CQFA 5GAEC 4OO1A 2B8FA 5M5YB 3J7AG 2LTMA 4NP5A 1I5FA 3QR8A 1XJVA 1X65A 3NBIA 1VIHA 3L7ZB 4QY7A 2OI2A 4DUZE 3BYTB 1EY5A 3ZZ0A 2AUJD 1UE1A 4JYAQ 4BY1B 4DV6H 2UXCH 3JAMi 2VUMB 4NPSA 3FHWA 3GTJH 1TXYA 4OEMB 2DNEA 2OTJA 4DR6L 3S1MB 4JV5Q 4WUDA 5E4XA 5JEAB 4H13C 5I2XA 3S16H 4A3IH 1UE6A 4GNXC 2A69C 1GUNA 1QUQB 5CORA 2K5VA 3KLRA 3VR5A 1H9MA 3P3EA 2E3UA 2RHSB 5HGQA 2WNRA 4Q0FA 5C3EG 2ZXPA 4YCUA 4PDBA 2OEOA 4DR5I 3CRKC 2AJ4A 4RWSC 3HOWB 4AQYH 3NHHA 3B4TA 1CZGA 1XNQQ 2VNUD 3CMAA 3DD6A 5IODA 2JJQA 5EQ0A 2AKWB 1SNDA 4B3TE 3H0GH 1A2UA 4JPBW 2CTFA 1YNNC 1SXTA 4FP5D 4B3MH 1VQKA 3NTIA 4IOAA 1PH7A 1WCMG 2PNHA 4LCFA 4HJ5A 1SNMA 2JE6B 1VIGA 3AU7A 1Z9FA 2Z4HA 4OHJA 4DR6I 1FWKA 1J5KA 1OJ4A 4DNRB 1N34H 4K8IA 1V43A 4O2DA 1LO5D 4IQZA 4A3MB 4LF7H 4QUCA 1SR3A 1TWGH 2I46A 4P72A 1FNUA 3GTKH 1DYQA 2XN9C 4PRVA 4ABNA 1A8VA 3C1EA 1PZID 4RAUC 2J7KA 4BA1I 4JI4L 3T13A 1H9JA 2F0QA 3L7ZC 4OO1B 4B9WA 1X55A 1VMCA 3GD7A 4DV1E 3QWNA 4PV1C 1D5ZC 3I3CA 2N88A 4IUTA 5FLMG 4K0KI 4JYAH 2V1CC 2WFWA 1Q46A 1QVGA 1HNZQ 1HR0E 4FNFA 1B44D 2N78A 5BR8Q 2DGYA 2ZJRA 1GHKA 1FR3A 1G51A 3T51B 3Q1QA 4JV5H 2OPVA 2ID0A 1FJGL 4NZTM 4DUZQ 1JQYD 1JE5A 5C0XG 4GN5A 4BA1A 1VQGA 3AB9A 4LUZA 3S2HB 2NUCA 5FK9C 3JAME 4DU7A 1HNXL 1A6FA 4LFAH 4DU8A 5DT9A 4YHHQ 5F2DA 1V1QA 3PO3H 3FRPB 4I3HA 2VY3A 3EVQA 1CHQD 3J81j 2F0PA 2V34A 1EZ6A 4A3BB 1Y6ZA 1MX0A 3M4PA 4ID6A 4A3DB 1MHWC 5H1SE 4BA2B 2QDLA 4DV4L 2HCCA 1QCBD 1B63A 2LY7A 1XNQH 2Y0SE 5DM63 2VQFQ 3BYYB 1CUKA 3SR1A 1TWCB 1Y8OB 2DY8A 3F2UA 1B3QA 1GUTA 1X56A 3BDCA 4DR4Q 5C4XH 3TSSA 4JI8E 3J7A5 3CCQA 1DOMA 1L0WA 1C0AA 4MTNA 2EY6A 3HOUG 1GKHA 2B2YA 1UNSA 1HTLD 1PRTB 1AE2A 1LTGD 4DPYA 4A3KH 1FJGI 2ZM6L 1BOSA 2WAQB 2YTVA 3EFXD 3NQIA 2JA8B 4GKKL 2PO4A 4B3RL 5M5XH 2Z5BB 4IUUA 1JCKB 3RD4A 1HNXI 1FI4A 2L55A 4A4IA 4PNYA 4B3SQ 4N9TA 4DV3E 2WW4A 2BOSA 5I9PA 4R4IA 2A74C 4OO1C 4A76A 2IL8A 1YHBA 4FWHA 3K7AH 3IKJA 4OELB 2UXBQ 1VQ6A 3NWTA 4DV4I 4JI2L 3L0OA 1HNZH 1VQIA 3HEJA 4QCLA 2PW7A 5KIXA 1Z2IA 1JR0D 2VQEQ 1CTMA 3PO2G 2HH3A 1VQOA 2IT1A 4PZ7A 2NVYH 4DUZH 4IUNA 5FO7B 1EU3A 1UE5A 2V2VA 4QNJA 5C3XA 5IYCH 3HOXH 4WORA 4C1NI 1HR0Q 1Z0CA 1U4MA 3CCLA 1N8RC 2CG9A 4BA1B 1SN8A 4C3JH 1QZRA 2PZWA 5CV4A 1V9PA 1WTVA 2ZM6I 1H7UA 4GLVB 3CDIA 4AYBB 2L0CA 4XQJA 3PRYA 3GO5A 2R7ZH 4GKKI 1HXYD 5EKIA 3RLFA 3HOYG 2UUBQ 2DN8A 4B3RI 2JP1A 2K03A 4MYUA 2A1SA 5LL6S 4X65Q 3G7LA 4UP8A 2KOLA 2NN6G 3T53B 3JAMQ 2Q2IA 3W2DA 4ZUIA 2F03A 3S14B 4URLA 2VQFH 1KDCA 4LF9Q 4ED4A 4MU1A 3OTOL 4X64E 2NB0A 3T1HQ 4JI3Q 1HH2P 3S9WA 4DR4H 4KLKA 4G7HC 1Z59A 3U1YA 1S4EA 3EA6A 1G2SA 2K14A 4APVA 4DK0A 5C6AA 1SRUA 2GN5A 1NR4A 1EA6A 2PMZB 4OX9E 3HZXA 2MNAA 2BH2A 4DKAC 2HIVA 1PRTC 4MYTA 1WHRA 2WV6D 2NN6E 4QUFA 1VDZA 4OKGA 1XYIA 1M1KC 1HFNA 2CVEA 2A19A 2MQHA 1KD1C 1H95A 4LAAA 2KCTA 4MHEA 2E2IB 2X7IA 4L5RC 4X66Q 1SYGA 4KK7A 5C3EH 1QZGA 2BH8A 4LF6Q 4DV2L 3W1BA 1ILPA 3OPOA 3R8BA 3M7ND 3M85G 2A2CA 2KEDA 4K5XA 1NHIA 2UXBH 2EYFA 1ASYA 3ZKBA 3A7LA 4O42A 1KNAA 3OTOI 3T1YL 2E2HB 2IERA 2DGRA 5I6YA 5LMNE 1L2FA 3A8JE 4DPWA 4PRXA 1JB7A 4HSVA 5LMUL 2LJPA 4QQBX 1WCMH 3BU2A 1HA6A 2Z5CB 2UXCI 2LMCB 1XMOL 3OSSD 1HR0H 2PCFB 1JJ2A 4DXGA 3HKSA 4A3JB 1BBXC 4BBRG 1YHQA 3GTOB 4K14A 2F3IA 4UHVA 1T5EA 3K17A 4B08A 2HIXA 2F0VA 1STEA 1EL0A 3ZYYX 4LF5Q 2SDFA 4FW4A 4X65H 1ODHA 5ISRA 1Y8PB 3S1RB 1PMRA 1OXVA 4LF9H 4JI4E 2AQ3B 3W3AA 2CVRA 4OIJA 4OD6A 1FGBD 4DR1Q 2CZ9A 1S40A 1DT4A 3EZJA 1IBKI 5CBAE 2RVLA 1KVKA 1QVCA 4RA8A 4A93G 2C38A 1YJ9A 2GO3A 1HCZA 3I4OA 3I73A 1KRTA 3T1YI 5GMDA 1PYBA 5CV9A 1NR2A 3HKZG 4R8IA 4X64Q 1T9HA 1Z5CA 5E3FA 4IFDE 3P75A 1MSZA 5C0XH 2B2YC 3QD7X 5LMUI 1EQVA 5M3MB 4FF3A 3MXNA 1QVFA 4FWDA 5DNLA 1K83B 2JN4A 3IL8A 5T1IA 4LF4E 1XMOI 3PIP3 1NZ0A 1EYGA 2ENBA 4RMFA 4OX9Q 4X66H 1O80A 3H3VH 4B9XA 4WANA 3TN2A 1LTAD 4LF6H 1SYDA 3CMEA 2L4NA 4OXPA 3FP9A 3K58A 3NTHA 2LS01 3VYTA 2JA7B 1USUA 2L12A 5IP9G 3J81i 1IBML 4HYMA 4G57A 3OWFA 2LFNA 2NVTB 4IZKA 4HAEA 4JBJA 2NVQH 3A5UA 3HKZE 1EIFA 3I2ZA 1HTPA 3AYHB 3BS1A 1F2MA 1BKBA 1D6EC 2LXJA 4NXMQ 1B9MA 4MU3A 3C46A 5GQOA 3J80C 2Z1CA 2HFSA 3HOUH 2F3VA 3DUZA 3HOZB 2VS1A 3PS1A 2P2RA 3D0FA 3CQZB 2UUCI 4JI0E 2HHHE 3T4AC 3D6WA 3FKIB 4JCVE 5LMNQ 3IRBA 1AFPA 4ODGA 4C3HG 2EJGC 3SVMA 4A3LH 4JV5I 2B29A 4HEDA 4JI5L 1GUOA 2G9DA 2FXQA 4WJ4A 1XXEA 4YWMA 2PW5A 1VF5C 3H6MA 1TWFB 3VKEA 4LF5H 3OOCA 1PFBA 3TMEA 2EPBA 5KEEA 1I6VC 1U0LA 1BBWA 3W5OA 3KFUA 2N55A 1WTWA 2UUAE 2QGQA 5KYIA 4G7OC 2FHTA 2CPMA 5IYDH 5FOBB 1WI5A 5JPMC 4X6AH 4JI2E 2F0KA 2R3ZA 1XNQI 3GTJB 4QB4A 4JBMA 5EGTA 2J4XA 2CTJA 2X69A 2IOPA 5LL6b 1I94Q 2H1EA 1ICFB 2CTKA 3I4NH 2XEXA 3G6EA 5BR8L 4X64H 2YU9H 2C38B 4JI6Q 4NXNE 5AFWA 1AZPA 1E3HA 2ZJPA 1SFOH 3S16B 2IY5B 2K5QA 2UUCQ 3NEMA 1VQDA 3F2CA 4A3IG 4EC5A 1J5EE 2F0FA 1Q1BA 2P5ZX 3AFQA 2IPKD 4OX9H 1ZZKA 4YHHL 2CQAA 3HOYH 4BBSB 1TS5A 4GN4B 4JI5I 4QGUA 1KC8C 1SE3A 3GTQH 2NN6H 1S5BD 3GTPH 1JOOA 1JT8A 1C8CA 1WTXA 4EVOA 4XTCS 5C44G 1X6OA 5TSSA 5FJ8G 3E9IA 4DR7Q 3H0GB 2NTSA 4DV0E 3X3MA 5K5PA 2BL5A 5EKWA 1D7QA 1E7ZA 2WB1B 1FYCA 5KGUA 1WOCA 4HXZA 3ITPA 1D1IA 1ESFA 3H91A 2TMPA 2XGTA 3MFGA 4R1JA 3S15B 3I7FA 2BDNA 4XXEA 2HD3A 2PO2B 2F4VQ 3QT8A 1HNZI 2C5CA 2VB3X 3H4LA 5M3FG 1EQQA 1R4QB 3BVMA 5BR8I 4TQUS 4JC0A 1PH9A 4WUCA 3J80W 1TWHH 5LMNH 3J80c 1XXGA 2M2LA 3NPPA 2CTLA 2EXDA 4UAIA 4XYQA 2NVXH 1KTVA 2V4DA 3S24A 2O4CA 1SNQA 2QDBA 5E1FA 3P3GA 1WTPA 5C4JH 3RZDB 4A3CG 3RLOA 4DV7L 2K05A 3IFTA 4JI0Q 1HZAA 1SYCA 3E0EA 4IUPA 4LWCA 4YHHI 3WDNA 4B3SL 4GKJE 5CC4A 1VQEA 1PZJD 4DV2E 2AMCB 1YNXA 1PH4A 3SHLA 1Z47A 4UDUC 5K36A 4MU0A 2EE1A 3DEOA 3RZOH 3O13A 4RKLA 3KRNA 2EYPA 4X62L 1XNRL 4USKA 1NJIC 1K9MC 3BVGA 5IT9E 2EJMA 3ZM7A 1HZ9A 1E1OA 1QNKA 3I55A 4LFBE 2EJFC 2VQEL 5BN5A 2E1RA 5I2YA 2J0TD 4JI6H 1KIJA 2PZUA 4DR4I 2XNAC 4ZQ3A 3U1KA 1QWYA 3G71A 2AHOB 5C0XD 3VA5A 3FDTA 2PO1B 1LTRD 1EEID 2WP8B 3PO3B 2DEJA 2N49A 2Q8TA 3UE0A 1XPUA 1I50H 1ZYRD 1EIYB 4IFDH 4NXNQ 2K33A 1Z6HA 1WD1A 5FLXE 3FVQA 4RGOS 3W1GA 5EJWA 4NBQA 3ER0A 2JA6B 4KN7C 1Z5AA 2SNMA 4KHZA 4HSPA 4DV7I 1EOVA 4LF4H 2UUBL 1EY4A 1RTOA 1J5EQ 1Y1WG 5E4WC 4CGYB 2NN6F 4B3SI 4JI1L 1ICWA 2CW0D 1OXTA 5C4XB 1F2ZA 1Y5YA 3T1HL 4JI3L 2WACA 1S72A 1C7YA 1GHJA 4A93H 2F0NA 1PTOD 4HIDA 4EX5A 5JEAA 3PYDA 1HUNA 4X62I 1XNRI 2LF0A 2F4VH 2B39A 4JI7L 3C3LA 1P42A 1TR5A 3ZZTA 2JZXA 2FINB 3UHMA 4RGMA 2ATWA 1SEIA 4DV0Q 2VQEI 2RA4A 2Z9HA 5KNDA 1FL0A 4A3KG 4YY3L 5C4HA 3E6ZX 1JMCA 4BY7H 4J3DA 1IKLA 1N32Q 1V1OA 3J81Q 3HULA 3MHBA 1XMQQ 4L5TA 2JE6I 1VQ5A 3A74A 4K5VA 4OL7A 4DPXA 4JI0H 1KQSA 1X9ZA 2HHHH 1YJNA 1Y69U 4HJ8A 1LTLA 2EYHA 4X3TA 2EYLA 3K7AB 1IBME 1IYVA 5A2QQ 3RMHA 3H15A 4ZRZA 2A6HD 4U3DA 5D14A 1PH2A 2J65A 2UUBI 5L37A 1SMXA 1NMFA 1X4NA 3GCMA 2Z6KA 1SMYC 1VQPA 4JI1I 3TRZA 2IX3A 1EYDA 4GKJQ 1TKWB 2ICIA 3VR3A 2JE6A 4DR2L 3K85A 3T1HI 5D65A 2NVYB 4JI3I 3A54A 4ME5A 2UUAH 1KKHA 3PSIA 3K59A 3QT5A 1NMGA 1ZZIA 4LUVA 4CHTB 4RG1A 3MFYA 3HOXG 3MXGA 5IYBH 4HJ9A 5L3JA 1Z0VA 3R2TA 3V5RA 1KRSA 3MA2B 4JI7I 1VQBA 5LHY1 1NXUA 5IT9Q 1GM5A 1W6KA 4C3JB 3G4SA 4RHSA 2BA1G 3OHXC 4X3KA 1FVIA 4LFBQ 4YY3I 5C0XI 5JJLA 4NXNH 5CV8A 1TIID 2R7ZG 4KHPE 2NN6D 4IFDF 3J81c 3PIOA 1RL2A 3B82A 3K1JA 5JVH3 4X66I 1J5EH 3U9SA 4LF6I 5FO9B 2IJ0A 1ZZJA 3I4MG 5FLXQ 3IFDA 4OWTB 3M7GA 3HP3A 4DAVA 3GTMH 2FPHX 4BA2I 2OQKA 3RR5A 4DR1L 4WJ3M 3KJPA 2AXYA 1BCPD 1WTHA 4X3UA 4A3FH 2CCZA 2JA5G 5C0XA 4JVZA 3K5NA 3AFPA 3MVVA 4DUYE 1KABA 1JICA 3KYHC 4DR2I 4DV0H 1VS0A 1K73C 3PUWA 4O1NA 3CHBD 3GV6A 4NDXA 5EKKA 2O5IC 1TVXA 3I91A 4JW0A 3GTLH 4BWGB 2HT1A 4LFAQ 1RJTA 1N32H 3CCUA 5EL9A 1XMQH 3VR2A 1ET6A 4J6HA 1VQFA 2AWOA 2K75A 2XSCA 4Y7NH 1NTGA 5C3EB 1YVCA 5D3IB 4IZJD 4F7XA 4QIWB 4BA2A 3NK9A 4PU9A 1NAPA 2F0GA 3FAUA 1BQQT 4A3EG 3E5SA 3M85D 1J9OA 4HN7A 3GONA 4K0KL 5C44H 3P1HA 2R7FA 1QJOA 4XDXA 4C3IG 1X3FA 5DLQE 1I4XA 2VW9A 5FJ8H 2GA4B 4POGA 1K8OA 4LF5I 1WE8A 1I3QH 4OIKA 1DONA 2C37A 1EIGA 5K36C 3TEHB 2PNMA 3TP5A 4GKJH 2E75C 4J1MA 4RCNA 1IBLQ 4LF8L 4H8AA 4NXML 2UU9E 5HY6A 4DR1I 1PV4A 5M3FH 2R92G 1JC7A 3EJIA 5JJKA 3GTGB 1WUUA 2UXDE 1X9NA 5CV7A 1MBYA 2K5HA 4KJOA 2Z5BA 1B70B 1XTCD 1V8CA 4DV5L 4FF4A 2HUGA 3P06A 4LFBH 4A3CH 4FW7A 1N33Q 3BG3A 2Z6BA 1J6QA 4WUBA 5DRPA 5CR3A 2O4XA 1ENAA 3Q23A 1F0XA 1GXDC 1FWLA 1HNWL 2CTEA 4JG2A 1Y1VH 1PIEA 3I8ZA 1VCIA 4L5QA 1FNWA 4KHPQ 1D5XC 1UDOA 5E7NA 1N36E 2WIIB 1A2TA 4WJWA 5G3LF 1KL9A 2OT2A 4MN3A 2A73B 3LTOA 1O78A 4N8X1 2Y0SG 3S1QH 4IALA 4LF8I 5JEAC 5C0XB 5I4DA 1I94L 4NXMI 4IJHA 1WTJA 1E3PA 3J80L 1I4RA 2KCNA 1NE3A 2CWAA 4OO1G 4OCHA 1I6HH 3K5MA 2UUCL 1N9WA 2D2CC 4DUYQ 2PZTA 1FNMA 4DV5I 1LUZA 2MHVA 3VDYA 2PQUA 1H72C 1X32A 2C35B 1OYPA 3WU6A 2OPUA 1M90C 4K2LA 2NVQB 1MSGA 1Y1WH 2PY9A 2Q2EB 2EFGA 3V2UC 3KDFB 1S20A 3NENA 1B2TA 1B53A 4OWWB 5IWAL 1FD7D 1HNWI 5KYLA 2FFKB 4UP9A 4LNQA 1CHPD 1UWVA 1SBBB 4CJ0B 4DR7L 2C37B 1LYLA 1PTOB 4OO1E 1IBLH 1QNUA 2Z6KC 1VQAA 2HFUA 3HOUB 1VISA 3BDOA 1T5XD 1CKNA 2F4IA 3TS0A 2PPBC 4CKBA 5AJ3Q 4A3DG 1UAPA 1WTQA 1PH1A 1AN8A 4K6LA 4B3TQ 2KJXA 3CRLC 1B7YB 2L11A 5DEHA 2SNSA 4IZJA 1I94I 1FKAE 1LTSD 1IW7D 3F2DA 4IPGA 4A3LG 2MP1A 4YY3E 1U9RA 3M3YH 4JI6I 1TWAB 4CDCC 5JAVA 1NHHA 3M85A 1P16A
chains in the Genus database with same CATH topology
2YYZA 2UXDQ 1R9TH 2KHIA 3GDEA 3AEVA 1KIXA 1J4WA 5IYDG 3E9HA 1IBKL 3BZKA 4JOIA 3GMEA 1VQ7A 2YTYA 4DR3L 3I4NG 4C2MH 5C0XC 4DV1Q 1N36Q 2KCMA 1IL2A 1CKOA 4IOCA 2E5LL 2L15A 2B63H 4LFCL 4AIMA 2NN6B 4LW1A 4MNOA 3SGIA 3I4MH 4DPGA 2JA5H 4DV6L 2PI2A 2UXCL 4PG3A 4HIKA 1OTCA 2A1AA 2D0PA 4P75A 1CKNB 1XPOA 4JI8Q 2H5XA 5ELOA 3AQQA 1HR0W 4UPAA 3KF6A 4A3EH 3S1MH 4AYBE 1PH5A 4C3IH 1Q81C 2CQOA 4AQYL 3U58A 1YI2A 3PGZA 1EWIA 4DV3Q 3F1ZA 3JAMc 3AEVB 3L2PA 1X4MA 1VQJA 3CC7A 1FGUA 2R92H 4B3ML 3RN5A 1IXRA 1EC6A 1X3GA 2EIFA 3HOWH 2RCNA 3S1NH 1ASZA 2PMZE 1N34L 4IFDG 1KHIA 1U5KA 1K0RA 2MFIA 4LF7L 3D31A 4YCVA 2A8VA 4DR5Q 4IPHA 3F2BA 4JYAL 3CXCA 3HOVG 3B6YA 1VQHA 1GD7A 2K50A 2I0QA 2Q2TA 5JEAJ 4JV5L 1A62A 3KOJA 2RF4A 1VQ9A 3CCJA 4BY7G 1JJGA 1QZHA 2OQ0A 4LFAL 4DR6Q 1NY4A 1Q12A 3HKMA 3KF6B 4A3GG 1XNQL 3S2HH 1VQMA 2ANRA 1OXXK 2PO2A 1YZ6A 4JOIC 4JBKA 1R6LA 4A3DH 5IYBG 4YWKA 5GADC 2BA1D 1VQLA 4DNIA 4L5SA 2BR2A 3M7NA 1BVSA 3PCOB 1Q7YC 1NBWA 4P74A 2ANNA 2JA8H 1HNZL 4A3FG 2JEBB 1YBYA 2ASBA 4JI4Q 2PO1A 3PUZA 2WP8A 4DUZL 5GAGC 3U50C 2JEAI 4OO1F 3S17H 5LMNW 2NZHA 2ZTEA 4QMFB 4LF4Q 4R4QA 3UDIA 1HNXQ 2QA4A 3I56A 2VQFL 4YCWA 2JEAA 3CP0A 4DR4L 4O0AA 2PNZA 1S3OA 1YJWA 1MJEA 1Q82C 1KXLA 2B3GA 4R4CA 1Q8KA 2HHHQ 2BR2B 4HJ7A 4OWXB 2ZM6Q 1Y1VG 1W3SA 2YV5A 2UXBL 5IP7G 5JJIA 2YTXA 2E2IH 2UUAQ 2BA0G 2BA1A 2WB1E 2N8NA 4JI2Q 1SLJA 5J3BA 3EBEA 4GLXA 1HR0L 4KI0A 1WYDA 4X65L 3PF5A 4LF9L 3ULJA 4A3JH 3HOVH 3CCVA 4WALA 3OYYA 2JEAB 3CCRA 2RHQB 2C39A 2R93G 2PNZB 3CDJA 4X66L 1VQ4A 3CC4A 3PUXA 4LF6L 4A3GH 5M3MH 4GNXB 4PMWA 1WJJA 2JQOA 4DV2Q 4OONA 3PIPA 4IO9A 2NVTH 5GAHC 1BBUA 3EIVA 3T1YQ 2CPQA 1UDSA 2B63G 3Q8DA 5LMUQ 5K36G 2R6GA 1XMOQ 4LF5L 3HOZH 1D8LA 3H3VI 2OCEA 1VQ8A 3FKIH 3BZCA 4P71A 1Q86C 4UP7A 5K36E 2HH2A 2JA9A 1LM0A 4X64L 3RN2A 2C39B 3NBHB 4BY1G 3CCEA 2VUMG 1DGSA 4OX9L 5IT9c 2QNDA 2KENA 3KDFA 3CC2A 5JEAG 4A75A 1L1OA 3K7UC 3ERSX 1OXUA 1PFSA 1IBMQ 4BBSH 5FLXc 4XIGS 3HFZB 1YIJA 3HOWG 5LMNL 5JEAE 4IFDD 2VL6A 1E24A 4DK6C 4IPDA 3S15H 1B8AA 5IY0A 4QIWE 1K1GA 4JI5Q 2NN6I 5IP7H 4GOPA 4AM3A 4A3MG 3RZDH 1PH3A 3EN2A 1TUAA 3M4OH 3GLLA 4JI6L 2OWOA 3K81C 3OW2A 2NN6A 4ME3A 5GROA 1JJCB 5ELNA 4MZ9A 4Y52H 4LF4L 2ZJQA 3CPFA 2VZAA 3CPWA 1L1OB 1OYRA 4H02A 4TVAB 2WNRB 4A3BG 2JA6H 3RNUA 2F4VL 4JVYA 2R93H 1O7IA 2K5NA 1C9OA 2LSSA 1VQNA 2UU9Q 5C0XE 1RIPA 3A0JA 4JI0L 2CKZB 2HHHL 4IFDI 2CTMA 3UDGA 2DUDA 2WAQG 4DV7Q 2JA8G 3TS2A 4GOPB 2JK8A 2UUAL 2KHJA 4IFDA 2WP8J 4HIMA 4X62Q 2ALYB 1XNRQ 1CSPA 3DLLA 1WFQA 2Z0SA 2WAQE 4LIJA 4NXNL 3CF5A 3KLWA 1DTJA 3DM3A 1J5EL 3STBD 3J80i 3UE1A 1L1OC 4R4TA 1OYSA 3K0XA 3J7ZC 4AYBG 2IHEA 5M5YH 4PZ8A 4JI1Q 4DV0L 1AH9A 4BY1H 4DAMA 2VUMH 3ULPA 1N32L 1XMQL 4JI7Q 1EQRA 1YITA 4YY3Q 1Y14B 5EAYA 3PV0A 4GOPC 4GKJL 4YWLA 4GS3A 2BA0D 3WWVA 2MJHA 2CFMA 1X3EA 3G48A 2JEBI 4HIOA 4IFDB 4P73A 4DR2Q 1IYJB 3A5ZB 2NN6C 4LFBL 1OXSC 1UEBA 5K36F 4QJFA 2N3SA 3GTGH 2HQLA 4QL5A 4BXXG 1MKHA 1W2BA 2JEBA 1EUJA 4A3JG 1HZBA 4A3MH 4AH6A 4DK3C 1UE7A 5FLMH 4EQ5A 2PQAA 1R6MA 3CCMA 4IJLA 3BJUA 4POFA 1GVPA 3RLNA 5M3MG 5JEAF 1UDNA 3JC66 3M9BA 4A3BH 1IBLL 4K0KQ 3CW2C 2Q2HA 2JA7G 3K80C 2I5LX 3UDXA 2PI2E 1TWCH 4IFDC 1A0IA 4LF8Q 1HJPA 5K36D 3M4QA 2XTIA 1N33L 4LUOA 1GO3E 3HOZG 4DV5Q 1SE8A 3FKIG 3ICEA 2YQRA 2BA0A 1TWAH 4KHPL 1P8LA 1K8AC 1HNWQ 5C0XJ 1AE3A 3H1CA 2FMRA 3KF8B 2MO0A 3PO2H 1UDQA 2PQAB 4NB3A 1PHJA 1FJGQ 4DUYL 4GLAC 1YHAA 2CWPA 5JEAD 2E8GA 1PVOA 5C0XF 2QEXA 3MXNB 2IX0A 2Q2UA 1ZTGA 3CAMA 2D62A 4DV4Q 4BBSG 2GVBA 2KBNA 3F8TA 1XTDA 2PO0A 3S14H 5IWAQ 5AJ3L 2E2JH 4B3TL 3U4VA 2ZTDA 3K8AA 1PA6A 1KAWA 1CKMA 3H0GG 4JBWA 1G291 2UU9L 1A63A 2WB1G 2AWNA 1Q1EA 2IX1A 2UXDL 4GNXA 1PH8A 3TREA 1X54A 3MEFA 4GKKQ 4B3RQ 3CD6A 2D0OA 3PUVA 2GVAA 3S2DH 1E22A 1SROA 1EFWA 4DV1L 3M7NG 4OO1D 2IHFA 1N36L 4IPCA 3U4ZA 1IBKQ 2K4KA 2E2HH 4DR3Q 4J15A 2NZOA 1E1TA 1G6PA 3NELA 3LGJA 3STBC 4BXXH 2E5LQ 4BBRH 4PZ6A 3GTOH 4LFCQ 4ALPA 3PO3G 1VQCA 4JVHA 1PH6A 1WVNA 3V69A 4DAYB 3L7ZA 3OTOQ 4UY8C 2JA6G 2I5HA 3S1RH 1PYSB 2PO0B 4JI8L 4DV6Q 1YEZA 2UXCQ 5C4XG 2MO1A 4HJAA 1K8GA 4GN3B 3PUYA 2K52A 1QUQA 2ES2A 2I5MX 3ULLA 3KJOA 1K83H 4DV3L 3PF4A 2EQSA 1MJCA 3ZJYC 5IP9H 3TQYA 3UDFA 2JA7H 4AQYQ 2F52A 1CSQA 2LXKA 4B8TA 4IFDJ 2ZTCA 5K36B 4R4OA 1KHMA 2JVZA 1XPRA 4OO1I 4B3MQ 2R7DA 1IZ6A 3CQZH 5IYCG 1HZCA 4C3HH 2OTLA 1N34Q 5IE8A 1K3RA 1MIUA 5M5WH 4DR5L 4FDBA 4LF7Q 3CCSA 1TWFH 4OO1A 5GAEC 1I5FA 1XJVA 1X65A 1VIHA 3L7ZB 4QY7A 1UE1A 4JYAQ 3JAMi 4NPSA 3FHWA 3GTJH 1TXYA 2OTJA 4DR6L 4JV5Q 5JEAB 3S16H 4A3IH 1UE6A 4GNXC 1QUQB 2K5VA 2E3UA 2RHSB 5HGQA 2WNRA 5C3EG 4YCUA 3B4TA 1XNQQ 2VNUD 3CMAA 3DD6A 2JJQA 2AKWB 3H0GH 2CTFA 1VQKA 4IOAA 1PH7A 2PNHA 1WCMG 4HJ5A 2JE6B 1VIGA 1Z9FA 1J5KA 1V43A 4O2DA 1SR3A 1TWGH 4P72A 3GTKH 1A8VA 4BA1I 4JI4L 3L7ZC 4OO1B 1X55A 3GD7A 5FLMG 2V1CC 2WFWA 1Q46A 1QVGA 1HNZQ 2N78A 5BR8Q 2DGYA 2ZJRA 1G51A 2OPVA 2ID0A 1FJGL 4DUZQ 1JE5A 5C0XG 4GN5A 4BA1A 1VQGA 4LUZA 1HNXL 4YHHQ 3PO3H 1V1QA 2VY3A 3J81j 3M4PA 5H1SE 4BA2B 4DV4L 2Y0SE 2VQFQ 1CUKA 1X56A 4DR4Q 5C4XH 3J7A5 3CCQA 1C0AA 1L0WA 4MTNA 3HOUG 1GKHA 1AE2A 4A3KH 2ZM6L 2YTVA 4GKKL 4B3RL 5M5XH 4A4IA 4B3SQ 4R4IA 4OO1C 4A76A 1YHBA 3K7AH 2UXBQ 1VQ6A 4JI2L 3L0OA 1VQIA 2VQEQ 3PO2G 2HH3A 1VQOA 2IT1A 4PZ7A 2NVYH 1UE5A 5IYCH 3HOXH 1HR0Q 3CCLA 1N8RC 4BA1B 1SN8A 4C3JH 1V9PA 4GLVB 3CDIA 3GO5A 2R7ZH 3RLFA 3HOYG 2UUBQ 4X65Q 4UP8A 2NN6G 2Q2IA 4LF9Q 3OTOL 3T1HQ 4JI3Q 1HH2P 4KLKA 2K14A 4APVA 1SRUA 2GN5A 2MNAA 2BH2A 4DKAC 2HIVA 2NN6E 1M1KC 2A19A 2MQHA 1KD1C 1H95A 2KCTA 4L5RC 4X66Q 5C3EH 1QZGA 2BH8A 4LF6Q 4DV2L 3W1BA 3M7ND 3M85G 1ASYA 3T1YL 2DGRA 1L2FA 1JB7A 5LMUL 4QQBX 1WCMH 3BU2A 1XMOL 1JJ2A 3HKSA 4BBRG 1YHQA 2F3IA 2HIXA 4LF5Q 1OXVA 4DR1Q 1S40A 1DT4A 1QVCA 4A93G 2C38A 1YJ9A 3I4OA 1KRTA 1PYBA 3HKZG 4X64Q 1T9HA 4IFDE 1QVFA 1EYGA 4RMFA 4OX9Q 3H3VH 4WANA 3CMEA 4OXPA 3FP9A 4AIDA 5IP9G 3J81i 1IBML 4JBJA 2NVQH 3A5UA 3HKZE 1EIFA 3I2ZA 3AYHB 1BKBA 2LXJA 4NXMQ 5GQOA 3HOUH 2VS1A 2P2RA 3D0FA 4JCVE 5LMNQ 3IRBA 4A3LH 2B29A 4JI5L 2FXQA 4WJ4A 4YWMA 3VKEA 1U0LA 1BBWA 3W5OA 3KFUA 2QGQA 5IYDH 1WI5A 4X6AH 4JBMA 2CTJA 1I94Q 2CTKA 3I4NH 3G6EA 5BR8L 2YU9H 2C38B 4JI6Q 1E3HA 2ZJPA 1SFOH 2IY5B 2UUCQ 3NEMA 1VQDA 3F2CA 4A3IG 1Q1BA 3AFQA 1ZZKA 4YHHL 3HOYH 4GN4B 4QGUA 1KC8C 3GTQH 3GTPH 1JT8A 4XTCS 5C44G 1X6OA 5FJ8G 3E9IA 4DR7Q 2BL5A 1D7QA 1E7ZA 1WOCA 2XGTA 4R1JA 3I7FA 2PO2B 2F4VQ 5M3FG 1EQQA 4TQUS 4JC0A 1PH9A 1TWHH 3J80c 2EXDA 2NVXH 3S24A 5C4JH 4A3CG 3RLOA 4DV7L 4JI0Q 1HZAA 3E0EA 4LWCA 4B3SL 1VQEA 2AMCB 1YNXA 1PH4A 1Z47A 5K36A 3RZOH 3KRNA 4X62L 1XNRL 1NJIC 1K9MC 1HZ9A 1E1OA 3I55A 2VQEL 3U1KA 3G71A 5C0XD 2AHOB 2PO1B 2WP8B 2N49A 3UE0A 1XPUA 1I50H 1EIYB 4NXNQ 3W1GA 4NBQA 3ER0A 4KHZA 1EOVA 2UUBL 1J5EQ 1Y1WG 2NN6F 4JI1L 1OXTA 3T1HL 4JI3L 1S72A 1C7YA 4A93H 4HIDA 4EX5A 5JEAA 2JZXA 4JI7L 2ATWA 4DV0Q 1FL0A 4A3KG 4YY3L 1JMCA 4BY7H 1N32Q 1XMQQ 4L5TA 2JE6I 1VQ5A 3A74A 1KQSA 1YJNA 4HJ8A 1LTLA 3H15A 1PH2A 1SMXA 1NMFA 1X4NA 3GCMA 2Z6KA 1VQPA 3TRZA 4GKJQ 2JE6A 4DR2L 3PSIA 1NMGA 1ZZIA 4LUVA 4RG1A 3HOXG 5IYBH 4HJ9A 1KRSA 1VQBA 1GM5A 3G4SA 2BA1G 1FVIA 4LFBQ 5C0XI 5JJLA 2R7ZG 2NN6D 4IFDF 3J81c 3PIOA 1RL2A 1ZZJA 3I4MG 4OWTB 3GTMH 4BA2I 2OQKA 3RR5A 4DR1L 4WJ3M 3KJPA 2AXYA 2JA5G 4A3FH 2CCZA 5C0XA 3AFPA 3KYHC 1VS0A 1K73C 3PUWA 3GTLH 2HT1A 4LFAQ 3CCUA 2K75A 1VQFA 2AWOA 4Y7NH 1NTGA 1YVCA 4BA2A 4A3EG 3M85D 4K0KL 5C44H 2R7FA 2VW9A 2CTLA 1X3FA 5DLQE 1WE8A 5FJ8H 4POGA 1I3QH 2C37A 5K36C 3TEHB 1IBLQ 4LF8L 4NXML 5HY6A 1PV4A 5M3FH 2R92G 5JJKA 1X9NA 2K5HA 1B70B 4DV5L 4A3CH 1N33Q 1J6QA 2CTEA 1HNWL 4JG2A 1Y1VH 1VCIA 4L5QA 4KHPQ 1UDOA 5E7NA 1KL9A 2Y0SG 3S1QH 5JEAC 5C0XB 1I94L 4IJHA 1E3PA 1NE3A 2CWAA 4OO1G 1I6HH 2UUCL 1N9WA 4DUYQ 1LUZA 3VDYA 2PQUA 2C35B 1OYPA 2OPUA 1M90C 2PY9A 1Y1WH 3KDFB 3NENA 4OWWB 5IWAL 4UP9A 4LNQA 1UWVA 4DR7L 2C37B 4OO1E 1LYLA 2Z6KC 1VQAA 3TS0A 1CKNA 5AJ3Q 4A3DG 1PH1A 4B3TQ 1B7YB 3F2DA 4IPGA 4A3LG 3M3YH 3M85A 1P16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YYZ A;  2UXD Q;  1R9T H;  2KHI A;  3GDE A;  3AEV A;  1KIX A;  1J4W A;  5IYD G;  3E9H A;  1IBK L;  3BZK A;  4JOI A;  3GME A;  1VQ7 A;  2YTY A;  4DR3 L;  3I4N G;  4C2M H;  5C0X C;  4DV1 Q;  1N36 Q;  2KCM A;  1IL2 A;  1CKO A;  4IOC A;  2E5L L;  2L15 A;  2B63 H;  4LFC L;  4AIM A;  2NN6 B;  4LW1 A;  4MNO A;  3SGI A;  3I4M H;  4DPG A;  2JA5 H;  4DV6 L;  2PI2 A;  2UXC L;  4PG3 A;  4HIK A;  1OTC A;  2A1A A;  2D0P A;  4P75 A;  1CKN B;  1XPO A;  4JI8 Q;  2H5X A;  5ELO A;  3AQQ A;  1HR0 W;  4UPA A;  3KF6 A;  4A3E H;  3S1M H;  4AYB E;  1PH5 A;  4C3I H;  1Q81 C;  2CQO A;  4AQY L;  3U58 A;  1YI2 A;  3PGZ A;  1EWI A;  4DV3 Q;  3F1Z A;  3JAM c;  3AEV B;  3L2P A;  1X4M A;  1VQJ A;  3CC7 A;  1FGU A;  2R92 H;  4B3M L;  3RN5 A;  1IXR A;  1EC6 A;  1X3G A;  2EIF A;  3HOW H;  2RCN A;  3S1N H;  1ASZ A;  2PMZ E;  1N34 L;  4IFD G;  1KHI A;  1U5K A;  1K0R A;  2MFI A;  4LF7 L;  3D31 A;  4YCV A;  2A8V A;  4DR5 Q;  4IPH A;  3F2B A;  4JYA L;  3CXC A;  3HOV G;  3B6Y A;  1VQH A;  1GD7 A;  2K50 A;  2I0Q A;  2Q2T A;  5JEA J;  4JV5 L;  1A62 A;  3KOJ A;  2RF4 A;  1VQ9 A;  3CCJ A;  4BY7 G;  1JJG A;  1QZH A;  2OQ0 A;  4LFA L;  4DR6 Q;  1NY4 A;  1Q12 A;  3HKM A;  3KF6 B;  4A3G G;  1XNQ L;  3S2H H;  1VQM A;  2ANR A;  1OXX K;  2PO2 A;  1YZ6 A;  4JOI C;  4JBK A;  1R6L A;  4A3D H;  5IYB G;  4YWK A;  5GAD C;  2BA1 D;  1VQL A;  4DNI A;  4L5S A;  2BR2 A;  3M7N A;  1BVS A;  3PCO B;  1Q7Y C;  1NBW A;  4P74 A;  2ANN A;  2JA8 H;  1HNZ L;  4A3F G;  2JEB B;  1YBY A;  2ASB A;  4JI4 Q;  2PO1 A;  3PUZ A;  2WP8 A;  4DUZ L;  5GAG C;  3U50 C;  2JEA I;  4OO1 F;  3S17 H;  5LMN W;  2NZH A;  2ZTE A;  4QMF B;  4LF4 Q;  4R4Q A;  3UDI A;  1HNX Q;  2QA4 A;  3I56 A;  2VQF L;  4YCW A;  2JEA A;  3CP0 A;  4DR4 L;  4O0A A;  2PNZ A;  1S3O A;  1YJW A;  1MJE A;  1Q82 C;  1KXL A;  2B3G A;  4R4C A;  1Q8K A;  2HHH Q;  2BR2 B;  4HJ7 A;  4OWX B;  2ZM6 Q;  1Y1V G;  1W3S A;  2YV5 A;  2UXB L;  5IP7 G;  5JJI A;  2YTX A;  2E2I H;  2UUA Q;  2BA0 G;  2BA1 A;  2WB1 E;  2N8N A;  4JI2 Q;  1SLJ A;  5J3B A;  3EBE A;  4GLX A;  1HR0 L;  4KI0 A;  1WYD A;  4X65 L;  3PF5 A;  4LF9 L;  3ULJ A;  4A3J H;  3HOV H;  3CCV A;  4WAL A;  3OYY A;  2JEA B;  3CCR A;  2RHQ B;  2C39 A;  2R93 G;  2PNZ B;  3CDJ A;  4X66 L;  1VQ4 A;  3CC4 A;  3PUX A;  4LF6 L;  4A3G H;  5M3M H;  4GNX B;  4PMW A;  1WJJ A;  2JQO A;  4DV2 Q;  4OON A;  3PIP A;  4IO9 A;  2NVT H;  5GAH C;  1BBU A;  3EIV A;  3T1Y Q;  2CPQ A;  1UDS A;  2B63 G;  3Q8D A;  5LMU Q;  5K36 G;  2R6G A;  1XMO Q;  4LF5 L;  3HOZ H;  1D8L A;  3H3V I;  2OCE A;  1VQ8 A;  3FKI H;  3BZC A;  4P71 A;  1Q86 C;  4UP7 A;  5K36 E;  2HH2 A;  2JA9 A;  1LM0 A;  4X64 L;  3RN2 A;  2C39 B;  3NBH B;  4BY1 G;  3CCE A;  2VUM G;  1DGS A;  4OX9 L;  5IT9 c;  2QND A;  2KEN A;  3KDF A;  3CC2 A;  5JEA G;  4A75 A;  1L1O A;  3K7U C;  3ERS X;  1OXU A;  1PFS A;  1IBM Q;  4BBS H;  5FLX c;  4XIG S;  3HFZ B;  1YIJ A;  3HOW G;  5LMN L;  5JEA E;  4IFD D;  2VL6 A;  1E24 A;  4DK6 C;  4IPD A;  3S15 H;  1B8A A;  5IY0 A;  4QIW E;  1K1G A;  4JI5 Q;  2NN6 I;  5IP7 H;  4GOP A;  4AM3 A;  4A3M G;  3RZD H;  1PH3 A;  3EN2 A;  1TUA A;  3M4O H;  3GLL A;  4JI6 L;  2OWO A;  3K81 C;  3OW2 A;  2NN6 A;  4ME3 A;  5GRO A;  1JJC B;  5ELN A;  4MZ9 A;  4Y52 H;  4LF4 L;  2ZJQ A;  3CPF A;  2VZA A;  3CPW A;  1L1O B;  1OYR A;  4H02 A;  4TVA B;  2WNR B;  4A3B G;  2JA6 H;  3RNU A;  2F4V L;  4JVY A;  2R93 H;  1O7I A;  2K5N A;  1C9O A;  2LSS A;  1VQN A;  2UU9 Q;  5C0X E;  1RIP A;  3A0J A;  4JI0 L;  2CKZ B;  2HHH L;  4IFD I;  2CTM A;  3UDG A;  2DUD A;  2WAQ G;  4DV7 Q;  2JA8 G;  3TS2 A;  4GOP B;  2JK8 A;  2UUA L;  2KHJ A;  4IFD A;  2WP8 J;  4HIM A;  4X62 Q;  2ALY B;  1XNR Q;  1CSP A;  3DLL A;  1WFQ A;  2Z0S A;  2WAQ E;  4LIJ A;  4NXN L;  3CF5 A;  3KLW A;  1DTJ A;  3DM3 A;  1J5E L;  3STB D;  3J80 i;  3UE1 A;  1L1O C;  4R4T A;  1OYS A;  3K0X A;  3J7Z C;  4AYB G;  2IHE A;  5M5Y H;  4PZ8 A;  4JI1 Q;  4DV0 L;  1AH9 A;  4BY1 H;  4DAM A;  2VUM H;  3ULP A;  1N32 L;  1XMQ L;  4JI7 Q;  1EQR A;  1YIT A;  4YY3 Q;  1Y14 B;  5EAY A;  3PV0 A;  4GOP C;  4GKJ L;  4YWL A;  4GS3 A;  2BA0 D;  3WWV A;  2MJH A;  2CFM A;  1X3E A;  3G48 A;  2JEB I;  4HIO A;  4IFD B;  4P73 A;  4DR2 Q;  1IYJ B;  3A5Z B;  2NN6 C;  4LFB L;  1OXS C;  1UEB A;  5K36 F;  4QJF A;  2N3S A;  3GTG H;  2HQL A;  4QL5 A;  4BXX G;  1MKH A;  1W2B A;  2JEB A;  1EUJ A;  4A3J G;  1HZB A;  4A3M H;  4AH6 A;  4DK3 C;  1UE7 A;  5FLM H;  4EQ5 A;  2PQA A;  1R6M A;  3CCM A;  4IJL A;  3BJU A;  4POF A;  1GVP A;  3RLN A;  5M3M G;  5JEA F;  1UDN A;  3JC6 6;  3M9B A;  4A3B H;  1IBL L;  4K0K Q;  3CW2 C;  2Q2H A;  2JA7 G;  3K80 C;  2I5L X;  3UDX A;  2PI2 E;  1TWC H;  4IFD C;  1A0I A;  4LF8 Q;  1HJP A;  5K36 D;  3M4Q A;  2XTI A;  1N33 L;  4LUO A;  1GO3 E;  3HOZ G;  4DV5 Q;  1SE8 A;  3FKI G;  3ICE A;  2YQR A;  2BA0 A;  1TWA H;  4KHP L;  1P8L A;  1K8A C;  1HNW Q;  5C0X J;  1AE3 A;  3H1C A;  2FMR A;  3KF8 B;  2MO0 A;  3PO2 H;  1UDQ A;  2PQA B;  4NB3 A;  1PHJ A;  1FJG Q;  4DUY L;  4GLA C;  1YHA A;  2CWP A;  5JEA D;  2E8G A;  1PVO A;  5C0X F;  2QEX A;  3MXN B;  2IX0 A;  2Q2U A;  1ZTG A;  3CAM A;  2D62 A;  4DV4 Q;  4BBS G;  2GVB A;  2KBN A;  3F8T A;  1XTD A;  2PO0 A;  3S14 H;  5IWA Q;  5AJ3 L;  2E2J H;  4B3T L;  3U4V A;  2ZTD A;  3K8A A;  1PA6 A;  1KAW A;  1CKM A;  3H0G G;  4JBW A;  1G29 1;  2UU9 L;  1A63 A;  2WB1 G;  2AWN A;  1Q1E A;  2IX1 A;  2UXD L;  4GNX A;  1PH8 A;  3TRE A;  1X54 A;  3MEF A;  4GKK Q;  4B3R Q;  3CD6 A;  2D0O A;  3PUV A;  2GVA A;  3S2D H;  1E22 A;  1SRO A;  1EFW A;  4DV1 L;  3M7N G;  4OO1 D;  2IHF A;  1N36 L;  4IPC A;  3U4Z A;  1IBK Q;  2K4K A;  2E2H H;  4DR3 Q;  4J15 A;  2NZO A;  1E1T A;  1G6P A;  3NEL A;  3LGJ A;  3STB C;  4BXX H;  2E5L Q;  4BBR H;  4PZ6 A;  3GTO H;  4LFC Q;  4ALP A;  3PO3 G;  1VQC A;  4JVH A;  1PH6 A;  1WVN A;  3V69 A;  4DAY B;  3L7Z A;  3OTO Q;  4UY8 C;  2JA6 G;  2I5H A;  3S1R H;  1PYS B;  2PO0 B;  4JI8 L;  4DV6 Q;  1YEZ A;  2UXC Q;  5C4X G;  2MO1 A;  4HJA A;  1K8G A;  4GN3 B;  3PUY A;  2K52 A;  1QUQ A;  2ES2 A;  2I5M X;  3ULL A;  3KJO A;  1K83 H;  4DV3 L;  3PF4 A;  2EQS A;  1MJC A;  3ZJY C;  5IP9 H;  3TQY A;  3UDF A;  2JA7 H;  4AQY Q;  2F52 A;  1CSQ A;  2LXK A;  4B8T A;  4IFD J;  2ZTC A;  5K36 B;  4R4O A;  1KHM A;  2JVZ A;  1XPR A;  4OO1 I;  4B3M Q;  2R7D A;  1IZ6 A;  3CQZ H;  5IYC G;  1HZC A;  4C3H H;  2OTL A;  1N34 Q;  5IE8 A;  1K3R A;  1MIU A;  5M5W H;  4DR5 L;  4FDB A;  4LF7 Q;  3CCS A;  1TWF H;  4OO1 A;  5GAE C;  1I5F A;  1XJV A;  1X65 A;  1VIH A;  3L7Z B;  4QY7 A;  1UE1 A;  4JYA Q;  3JAM i;  4NPS A;  3FHW A;  3GTJ H;  1TXY A;  2OTJ A;  4DR6 L;  4JV5 Q;  5JEA B;  3S16 H;  4A3I H;  1UE6 A;  4GNX C;  1QUQ B;  2K5V A;  2E3U A;  2RHS B;  5HGQ A;  2WNR A;  5C3E G;  4YCU A;  3B4T A;  1XNQ Q;  2VNU D;  3CMA A;  3DD6 A;  2JJQ A;  2AKW B;  3H0G H;  2CTF A;  1VQK A;  4IOA A;  1PH7 A;  2PNH A;  1WCM G;  4HJ5 A;  2JE6 B;  1VIG A;  1Z9F A;  1J5K A;  1V43 A;  4O2D A;  1SR3 A;  1TWG H;  4P72 A;  3GTK H;  1A8V A;  4BA1 I;  4JI4 L;  3L7Z C;  4OO1 B;  1X55 A;  3GD7 A;  5FLM G;  2V1C C;  2WFW A;  1Q46 A;  1QVG A;  1HNZ Q;  2N78 A;  5BR8 Q;  2DGY A;  2ZJR A;  1G51 A;  2OPV A;  2ID0 A;  1FJG L;  4DUZ Q;  1JE5 A;  5C0X G;  4GN5 A;  4BA1 A;  1VQG A;  4LUZ A;  1HNX L;  4YHH Q;  3PO3 H;  1V1Q A;  2VY3 A;  3J81 j;  3M4P A;  5H1S E;  4BA2 B;  4DV4 L;  2Y0S E;  2VQF Q;  1CUK A;  1X56 A;  4DR4 Q;  5C4X H;  3J7A 5;  3CCQ A;  1C0A A;  1L0W A;  4MTN A;  3HOU G;  1GKH A;  1AE2 A;  4A3K H;  2ZM6 L;  2YTV A;  4GKK L;  4B3R L;  5M5X H;  4A4I A;  4B3S Q;  4R4I A;  4OO1 C;  4A76 A;  1YHB A;  3K7A H;  2UXB Q;  1VQ6 A;  4JI2 L;  3L0O A;  1VQI A;  2VQE Q;  3PO2 G;  2HH3 A;  1VQO A;  2IT1 A;  4PZ7 A;  2NVY H;  1UE5 A;  5IYC H;  3HOX H;  1HR0 Q;  3CCL A;  1N8R C;  4BA1 B;  1SN8 A;  4C3J H;  1V9P A;  4GLV B;  3CDI A;  3GO5 A;  2R7Z H;  3RLF A;  3HOY G;  2UUB Q;  4X65 Q;  4UP8 A;  2NN6 G;  2Q2I A;  4LF9 Q;  3OTO L;  3T1H Q;  4JI3 Q;  1HH2 P;  4KLK A;  2K14 A;  4APV A;  1SRU A;  2GN5 A;  2MNA A;  2BH2 A;  4DKA C;  2HIV A;  2NN6 E;  1M1K C;  2A19 A;  2MQH A;  1KD1 C;  1H95 A;  2KCT A;  4L5R C;  4X66 Q;  5C3E H;  1QZG A;  2BH8 A;  4LF6 Q;  4DV2 L;  3W1B A;  3M7N D;  3M85 G;  1ASY A;  3T1Y L;  2DGR A;  1L2F A;  1JB7 A;  5LMU L;  4QQB X;  1WCM H;  3BU2 A;  1XMO L;  1JJ2 A;  3HKS A;  4BBR G;  1YHQ A;  2F3I A;  2HIX A;  4LF5 Q;  1OXV A;  4DR1 Q;  1S40 A;  1DT4 A;  1QVC A;  4A93 G;  2C38 A;  1YJ9 A;  3I4O A;  1KRT A;  1PYB A;  3HKZ G;  4X64 Q;  1T9H A;  4IFD E;  1QVF A;  1EYG A;  4RMF A;  4OX9 Q;  3H3V H;  4WAN A;  3CME A;  4OXP A;  3FP9 A;  4AID A;  5IP9 G;  3J81 i;  1IBM L;  4JBJ A;  2NVQ H;  3A5U A;  3HKZ E;  1EIF A;  3I2Z A;  3AYH B;  1BKB A;  2LXJ A;  4NXM Q;  5GQO A;  3HOU H;  2VS1 A;  2P2R A;  3D0F A;  4JCV E;  5LMN Q;  3IRB A;  4A3L H;  2B29 A;  4JI5 L;  2FXQ A;  4WJ4 A;  4YWM A;  3VKE A;  1U0L A;  1BBW A;  3W5O A;  3KFU A;  2QGQ A;  5IYD H;  1WI5 A;  4X6A H;  4JBM A;  2CTJ A;  1I94 Q;  2CTK A;  3I4N H;  3G6E A;  5BR8 L;  2YU9 H;  2C38 B;  4JI6 Q;  1E3H A;  2ZJP A;  1SFO H;  2IY5 B;  2UUC Q;  3NEM A;  1VQD A;  3F2C A;  4A3I G;  1Q1B A;  3AFQ A;  1ZZK A;  4YHH L;  3HOY H;  4GN4 B;  4QGU A;  1KC8 C;  3GTQ H;  3GTP H;  1JT8 A;  4XTC S;  5C44 G;  1X6O A;  5FJ8 G;  3E9I A;  4DR7 Q;  2BL5 A;  1D7Q A;  1E7Z A;  1WOC A;  2XGT A;  4R1J A;  3I7F A;  2PO2 B;  2F4V Q;  5M3F G;  1EQQ A;  4TQU S;  4JC0 A;  1PH9 A;  1TWH H;  3J80 c;  2EXD A;  2NVX H;  3S24 A;  5C4J H;  4A3C G;  3RLO A;  4DV7 L;  4JI0 Q;  1HZA A;  3E0E A;  4LWC A;  4B3S L;  1VQE A;  2AMC B;  1YNX A;  1PH4 A;  1Z47 A;  5K36 A;  3RZO H;  3KRN A;  4X62 L;  1XNR L;  1NJI C;  1K9M C;  1HZ9 A;  1E1O A;  3I55 A;  2VQE L;  3U1K A;  3G71 A;  5C0X D;  2AHO B;  2PO1 B;  2WP8 B;  2N49 A;  3UE0 A;  1XPU A;  1I50 H;  1EIY B;  4NXN Q;  3W1G A;  4NBQ A;  3ER0 A;  4KHZ A;  1EOV A;  2UUB L;  1J5E Q;  1Y1W G;  2NN6 F;  4JI1 L;  1OXT A;  3T1H L;  4JI3 L;  1S72 A;  1C7Y A;  4A93 H;  4HID A;  4EX5 A;  5JEA A;  2JZX A;  4JI7 L;  2ATW A;  4DV0 Q;  1FL0 A;  4A3K G;  4YY3 L;  1JMC A;  4BY7 H;  1N32 Q;  1XMQ Q;  4L5T A;  2JE6 I;  1VQ5 A;  3A74 A;  1KQS A;  1YJN A;  4HJ8 A;  1LTL A;  3H15 A;  1PH2 A;  1SMX A;  1NMF A;  1X4N A;  3GCM A;  2Z6K A;  1VQP A;  3TRZ A;  4GKJ Q;  2JE6 A;  4DR2 L;  3PSI A;  1NMG A;  1ZZI A;  4LUV A;  4RG1 A;  3HOX G;  5IYB H;  4HJ9 A;  1KRS A;  1VQB A;  1GM5 A;  3G4S A;  2BA1 G;  1FVI A;  4LFB Q;  5C0X I;  5JJL A;  2R7Z G;  2NN6 D;  4IFD F;  3J81 c;  3PIO A;  1RL2 A;  1ZZJ A;  3I4M G;  4OWT B;  3GTM H;  4BA2 I;  2OQK A;  3RR5 A;  4DR1 L;  4WJ3 M;  3KJP A;  2AXY A;  2JA5 G;  4A3F H;  2CCZ A;  5C0X A;  3AFP A;  3KYH C;  1VS0 A;  1K73 C;  3PUW A;  3GTL H;  2HT1 A;  4LFA Q;  3CCU A;  2K75 A;  1VQF A;  2AWO A;  4Y7N H;  1NTG A;  1YVC A;  4BA2 A;  4A3E G;  3M85 D;  4K0K L;  5C44 H;  2R7F A;  2VW9 A;  2CTL A;  1X3F A;  5DLQ E;  1WE8 A;  5FJ8 H;  4POG A;  1I3Q H;  2C37 A;  5K36 C;  3TEH B;  1IBL Q;  4LF8 L;  4NXM L;  5HY6 A;  1PV4 A;  5M3F H;  2R92 G;  5JJK A;  1X9N A;  2K5H A;  1B70 B;  4DV5 L;  4A3C H;  1N33 Q;  1J6Q A;  2CTE A;  1HNW L;  4JG2 A;  1Y1V H;  1VCI A;  4L5Q A;  4KHP Q;  1UDO A;  5E7N A;  1KL9 A;  2Y0S G;  3S1Q H;  5JEA C;  5C0X B;  1I94 L;  4IJH A;  1E3P A;  1NE3 A;  2CWA A;  4OO1 G;  1I6H H;  2UUC L;  1N9W A;  4DUY Q;  1LUZ A;  3VDY A;  2PQU A;  2C35 B;  1OYP A;  2OPU A;  1M90 C;  2PY9 A;  1Y1W H;  3KDF B;  3NEN A;  4OWW B;  5IWA L;  4UP9 A;  4LNQ A;  1UWV A;  4DR7 L;  2C37 B;  4OO1 E;  1LYL A;  2Z6K C;  1VQA A;  3TS0 A;  1CKN A;  5AJ3 Q;  4A3D G;  1PH1 A;  4B3T Q;  1B7Y B;  3F2D A;  4IPG A;  4A3L G;  3M3Y H;  3M85 A;  1P16 A; 
#chains in the Genus database with same CATH topology
 1CK1 A;  3WU3 A;  2YYZ A;  1N33 H;  1F2Y A;  2UXD Q;  1Q3L A;  4FYD A;  1TS3 A;  1R9T H;  2KHI A;  3GDE A;  3QJY A;  3LPS A;  1Q8I A;  3AEV A;  5HGT A;  1TY2 A;  1KIX A;  2BE5 D;  4KHP H;  1BNZ A;  1J4W A;  5IYD G;  5DNF A;  1O7L A;  3E9H A;  3VA7 A;  3PO2 B;  1ZXN A;  1IBK L;  1Y4U A;  5IWA I;  1EQT A;  3BZK A;  2K5W A;  4JOI A;  2O3Z A;  1EYA A;  5C4Z A;  2R3V A;  2Z5C A;  3J7A M;  2O1V A;  1VQ7 A;  3GME A;  4DA2 A;  4DR7 I;  2YTY A;  4DR3 L;  2YU9 B;  4C2M H;  3I4N G;  4DV1 Q;  2R61 A;  4KKT A;  1N0V C;  5C0X C;  2K28 A;  3ZKD A;  4DU9 A;  3QB3 A;  1N36 Q;  3HS0 C;  2KCM A;  5CV5 A;  1CT1 D;  1IL2 A;  1A3T A;  1ZYR C;  2F4V I;  1CKO A;  5J22 A;  4IOC A;  3SDZ A;  2E5L L;  2L15 A;  2B63 H;  3H3V C;  1TQO A;  1N0U A;  3A8I E;  4DUY H;  4LFC L;  3HOY B;  1L0Y B;  4AIM A;  4DR5 E;  2X6G A;  3GQB A;  3Q0A A;  3GTQ B;  2NN6 B;  5IGD A;  4LW1 A;  4EQP A;  3GTP B;  4MNO A;  1Z0G A;  2AQ1 B;  3V2T A;  3SGI A;  2E2J B;  2ZXO A;  4KHV A;  4P52 A;  1E2W A;  3WOE A;  1CA6 A;  3I4M H;  4DPG A;  1PTO C;  1BCP B;  2KUM A;  2JA5 H;  4DV6 L;  2PI2 A;  2L5T A;  3OMG A;  2UXC L;  4CDE C;  1BUV T;  4PG3 A;  2L1B A;  4HIK A;  1KLG D;  4K2K A;  2A1A A;  2D0P A;  1OTC A;  3AMU A;  1U2R A;  4P75 A;  3Q6M A;  4B3T H;  4DR6 E;  4USM A;  1CKN B;  1SEB D;  4DR3 I;  4E6I A;  4FO2 A;  1XPO A;  1K47 A;  1TWH B;  4JI8 Q;  5T1G A;  2H5X A;  3I90 A;  1QB5 D;  2NVX B;  1D6T A;  5ELO A;  2UU9 H;  3AQQ A;  2G8Y A;  4N9P A;  5C4J B;  4IZJ B;  3P76 A;  1HR0 W;  3S2D B;  4ZK9 B;  4HTH A;  2EXZ A;  3C2P A;  3J81 L;  4UPA A;  3KF6 A;  2E5L I;  4GZY C;  5BN3 A;  4A3E H;  2UXD H;  5KRU A;  4LFC I;  3S1M H;  4AYB E;  1PH5 A;  2A6H C;  4C3I H;  1Q81 C;  2CQO A;  3TP7 A;  1V8Q A;  4K0K E;  4AQY L;  2XWJ B;  3U58 A;  3PGZ A;  1YI2 A;  1EWI A;  3ND8 A;  1H73 A;  4DV3 Q;  1JWS D;  3F1Z A;  3JAM c;  2BV3 A;  2X36 A;  4RGT A;  3AEV B;  4XT3 B;  3L2P A;  1RD9 D;  1X4M A;  1VQJ A;  3CC7 A;  1SYF A;  2TSS A;  1FGU A;  3V05 A;  5CMD A;  1B1Z A;  1GUW A;  2X06 A;  2R92 H;  4DV1 H;  2F0J A;  2F0I A;  4B3M L;  4DV6 I;  4FXG C;  3RN5 A;  1IXR A;  1EC6 A;  1X3G A;  2EIF A;  3HOW H;  2RCN A;  1N36 H;  3S1N H;  4BBR B;  4QNK A;  1ASZ A;  2VXW A;  2PMZ E;  4HY1 A;  3RF2 A;  4MDT A;  4DV5 E;  3QT6 A;  1N34 L;  4FF2 A;  1SDF A;  3CU7 A;  1KHI A;  1U5K A;  5C5M A;  4K8J A;  1K0R A;  4IFD G;  1U4L A;  2MFI A;  3R93 A;  4LF7 L;  3D31 A;  4NMZ A;  2A68 D;  1N32 I;  3PYF A;  4N3O A;  5DAU A;  4GQU A;  5NUC A;  4YCV A;  2A8V A;  4DR5 Q;  1WTO A;  4IPH A;  3F2B A;  1K28 A;  1BCP C;  4AQY I;  4A93 B;  4JYA L;  3CXC A;  1VI7 A;  3WU4 A;  1ZKO A;  4EQN A;  3D4J A;  3HOV G;  3B6Y A;  4KY6 A;  1VQH A;  1BDO A;  2GO4 A;  1GD7 A;  2K50 A;  4HR7 B;  2I0Q A;  2Q2T A;  2NPF A;  5JEA J;  1FJG E;  3GV3 A;  1R4P B;  4JV5 L;  1A62 A;  1IHZ A;  3PMF A;  4B3M I;  5KNC A;  3KOJ A;  4OO1 H;  3J80 E;  4JI8 H;  3R3O A;  2RF4 A;  2K7V A;  1VQ9 A;  4XQQ A;  3CCJ A;  4BY7 G;  1JJG A;  1QZH A;  1Z0B A;  2QW7 A;  1HNX E;  2OQ0 A;  1EYC A;  3TP6 A;  2DJF C;  4LFA L;  4DR6 Q;  3QIA A;  1NY4 A;  4TSS A;  3PYE A;  1Q12 A;  1N34 I;  1EY7 A;  3HKM A;  2Z5E A;  1FKA H;  3KF6 B;  2E74 C;  4LF7 I;  4A3G G;  4DFA A;  4DV4 E;  1XNQ L;  3S2H H;  4DV3 H;  4HCE A;  1VQM A;  2A69 D;  2ANR A;  3H94 A;  4C56 C;  2ZT9 C;  5IWA E;  1MD2 D;  1HUM A;  1OXX K;  2PO2 A;  3DWQ A;  3OET A;  1YZ6 A;  4C1N K;  4JOI C;  4JBK A;  4JYA I;  1R6L A;  4A3D H;  1Z5B A;  5J39 A;  1H9S B;  2K1B A;  4LPF A;  1H9K A;  5IYB G;  3D4R A;  4YWK A;  5GAD C;  4C3H B;  2F0U A;  2BA1 D;  4IUQ A;  1VQL A;  2ZM6 E;  3DHQ A;  3QOJ A;  5M5W B;  3NSW A;  4DNI A;  4L5S A;  4GKK E;  4B3R E;  2BR2 A;  3M7N A;  1BVS A;  4IUV A;  4LFA I;  4DPT A;  3PCO B;  1Q7Y C;  2ICE C;  4LCH A;  2A2D A;  1NBW A;  4P74 A;  4FW3 A;  3QG1 A;  2ANN A;  3K5O A;  4DR5 H;  3TP8 A;  1ZM9 A;  2JA8 H;  2B2W A;  1HNZ L;  2F0S A;  4A3F G;  2JEB B;  4KJN A;  3H09 A;  1YBY A;  2ASB A;  3ONA B;  4JI4 Q;  2NYZ D;  3DMU A;  3PUZ A;  2PO1 A;  2WKC A;  2WP8 A;  4DR3 E;  2G9H D;  4A3I B;  4H7B A;  4DUZ L;  3GTL B;  1I4P A;  5GAG C;  3OSO A;  3U50 C;  4OGQ C;  2K5D A;  2RQX A;  2JEA I;  4OO1 F;  3S17 H;  4DR6 H;  5LMN W;  4LFC E;  2NZH A;  2ZTE A;  4FWG A;  2PQE A;  4KY5 A;  1SE2 A;  4QMF B;  1HQM C;  2X6L A;  4LF4 Q;  5GME A;  5C44 B;  1ZM4 A;  4Q5V A;  2PNL A;  4R4Q A;  3UDI A;  1HNX Q;  2QA4 A;  3I56 A;  1N33 I;  1I3Q B;  2RCF A;  3KK7 A;  5C5L A;  1RRE A;  2VQF L;  3OTO E;  4YCW A;  2O5J C;  4R9W A;  1Z0T A;  2JEA A;  3CP0 A;  4DR4 L;  2VKC A;  4O0A A;  2UXC E;  5M3F B;  3G6J B;  2Y3M A;  2LTL A;  1WVL A;  2PNZ A;  1GUG A;  3QT7 A;  1IW7 C;  5ELC A;  3DM1 A;  3OWE B;  1S3O A;  1E0B A;  3D4D A;  4FN5 A;  4DUZ I;  1YJW A;  1MJE A;  1Q82 C;  2CH4 W;  3MXP A;  1SYE A;  1TWG B;  1KXL A;  4RPF A;  2XRS D;  2B3G A;  3GTK B;  2ZBK B;  1TS4 A;  3E0J A;  1NCV A;  4XTJ A;  1VF7 A;  1Q8K A;  4R4C A;  2HHH Q;  4NW2 A;  2BR2 B;  4UTG A;  1KDA A;  4HJ7 A;  1STA A;  4OWX B;  2ZM6 Q;  1Y1V G;  2BE5 C;  4XT1 B;  1W3S A;  2YV5 A;  2UXB L;  1V1P A;  2QIL A;  3GP7 A;  1PRT F;  1LT4 D;  2VQF I;  5IP7 G;  5JJI A;  3N6R A;  2YTX A;  2E2I H;  2EY1 A;  2QKI C;  3T1Y E;  2EZV A;  4JI4 H;  2F1D A;  1EEF D;  2UUA Q;  1RHP A;  5LMU E;  2BA0 G;  5A35 A;  2BA1 A;  2WB1 E;  4QMG A;  4B3M E;  2N8N A;  4JI2 Q;  3MZ5 A;  1SLJ A;  1B3A A;  1EI1 A;  5J3B A;  3J81 C;  1BF4 A;  1XMO E;  1I6H B;  3EBE A;  4GLX A;  1B9N A;  1HR0 L;  1H9R A;  3LWE A;  4KI0 A;  1AP0 A;  4B3T I;  5JPN C;  3B8H A;  1FJG H;  5KNB A;  1N34 E;  1WYD A;  4U3B A;  5BN4 A;  5A2Q C;  1Y1W B;  4X65 L;  2I07 B;  1HNX H;  4IUR A;  2KA7 A;  3JAM L;  3WOF A;  1U4P A;  3PF5 A;  1CZW A;  4LF9 L;  4KD3 A;  4I7A A;  4CDF C;  3ULJ A;  4A3J H;  1LT3 D;  3D6C A;  3DEP A;  3HOV H;  2UXB I;  1QE6 A;  1O7Y A;  3CCV A;  2F3W A;  4WAL A;  4DV4 H;  3OYY A;  2JEA B;  1DD2 A;  1I4G A;  2C9O A;  4E9J A;  1B4O A;  1W6J A;  4OZE A;  4A3K B;  3CCR A;  2RHQ B;  2C39 A;  2R93 G;  3NBH A;  4JV5 E;  1AN7 A;  3M3Y B;  2PNZ B;  5M5X B;  4DV1 I;  2RDG A;  3CDJ A;  2NZ1 D;  2BCO A;  1D2B A;  1II3 A;  1K0S A;  1HR0 I;  4ZCK A;  3SXH A;  3KDG A;  4X66 L;  5ELB A;  1VQ4 A;  3CC4 A;  4DK1 A;  1PFM A;  3PUX A;  4LF6 L;  4A3G H;  2ZM6 H;  4LK1 C;  1DOL A;  5M3M H;  4GKK H;  4B3R H;  4GNX B;  4X65 I;  3VYU A;  1GOZ A;  4PMW A;  1WJJ A;  1UUP A;  1XNQ E;  2JQO A;  2M00 A;  3MXU A;  4LF9 I;  2HK3 A;  4DV2 Q;  1V1P B;  4OON A;  2B2W C;  1JE4 A;  3PIP A;  4C2M B;  3B78 A;  4IO9 A;  2XWB B;  3HOX B;  2PT7 G;  4NZR M;  3KBX A;  2NVT H;  4JI2 H;  1E2V A;  5GAH C;  1BBU A;  3EIV A;  3T1Y Q;  2CPQ A;  1UDS A;  1RHY A;  2B63 G;  2R7Z B;  1G6Z A;  4JI5 E;  3Q8D A;  5LMU Q;  5K36 G;  4JI8 I;  2A68 C;  2R6G A;  3J81 W;  3P3C A;  2FMC A;  1QOH A;  1WTR A;  1ENF A;  1STN A;  3NQT A;  1XMO Q;  4LF5 L;  4FF1 A;  2HDL A;  3P20 A;  3HOZ H;  1D8L A;  3H3V I;  1GUS A;  3I4M B;  2OCE A;  5EPL A;  1VQ8 A;  3FKI H;  4KKU A;  3BZC A;  4PMC A;  2JA5 B;  5A2Q W;  3SB1 A;  4WRD A;  4P71 A;  3I0P A;  3UI2 A;  4RCO A;  1Q86 C;  1X3Q A;  1HNZ E;  4UP7 A;  3PYG A;  5K36 E;  2HH2 A;  1G91 A;  3OTO H;  3A55 A;  5BR8 E;  2JA9 A;  4G4K A;  3PS2 A;  1LM0 A;  4X64 L;  2F0H A;  4DPU A;  1O7Z A;  3RN2 A;  1I4H A;  4B8C D;  1A3U A;  2C39 B;  3NBH B;  1PVG A;  4BY1 G;  3CCE A;  3E3X A;  2VUM G;  2KVM A;  1DGS A;  1NHJ A;  5IT9 W;  4A3E B;  4OX9 L;  5IT9 c;  4YHH E;  1F9P A;  2QND A;  2KEN A;  1SJE D;  3OIP A;  3KDF A;  3J7A K;  5ELW A;  2Z4I A;  2CGE A;  2F0T A;  4C3I B;  2HK2 A;  3P7J A;  3TBI B;  3Q6S A;  4ZUJ A;  1EWH A;  3CC2 A;  4P2C B;  5JEA G;  3Q24 A;  1SAP A;  1EY6 A;  1L1O A;  4A75 A;  4ZKB B;  3CKI B;  3K7U C;  2EVB A;  2VQF E;  2F0M A;  3ERS X;  1OXU A;  4DV2 H;  1A15 A;  5I6W A;  1ML0 D;  1PFS A;  1IBM Q;  5FLX W;  2R92 B;  1WCM B;  4BBS H;  1HHV A;  3EQL C;  5FLX c;  4DR4 E;  1TU2 B;  4XIG S;  1C48 A;  3HFZ B;  2OF1 A;  3HG9 A;  2K01 A;  3D3R A;  1S5F D;  3S1N B;  1YIJ A;  3HOW G;  4MIU A;  3A56 A;  3M4Y A;  2F1M A;  3T1Y H;  4X64 I;  2ZXR A;  1VMP A;  5LMN L;  5JEA E;  1AEX A;  4IFD D;  2VL6 A;  5LMU H;  4IN3 A;  1Q90 A;  1E24 A;  4DV7 E;  4DK6 C;  4DXL A;  4IPD A;  3S15 H;  5EPJ A;  3KLS A;  4V0B A;  1B8A A;  1XMO H;  1S5C D;  4KN4 C;  5IY0 A;  4H44 C;  4I7Z C;  4OX9 I;  4B3S E;  3L9A X;  3D4W A;  2G5D A;  4QIW E;  2HQE A;  1K1G A;  1USV A;  1KDB A;  4JI5 Q;  3I72 A;  2NN6 I;  1TY0 A;  1ET9 A;  5IP7 H;  4GOP A;  2UXB E;  4NKL A;  4AM3 A;  2Y0S B;  1ZM3 A;  5EKL A;  4X62 E;  4A3M G;  3RZD H;  1XNR E;  1PH3 A;  1HK7 A;  4HAC A;  3EN2 A;  2BM1 A;  1S5D D;  3MEH A;  5DNX A;  2VQE E;  1E2Z A;  4DXF A;  1YNJ D;  5C3W A;  3I70 A;  1TUA A;  3M4O H;  3GLL A;  3K0Y A;  2OWO A;  1JWM D;  4JI6 L;  1JOQ A;  3K81 C;  1Y60 A;  3OW2 A;  1PZK D;  1G2T A;  4XYO A;  2NN6 A;  4ME3 A;  1U4R A;  2F0W A;  5LMN I;  1X3P A;  1JOR A;  5GRO A;  2K04 A;  1JJC B;  5ELN A;  3SE0 A;  4MZ9 A;  4Y52 H;  1SNC A;  2UUB E;  4LF4 L;  3FPU B;  4X65 E;  4F87 A;  3ZZU A;  2QF7 A;  2ZJQ A;  4ISA A;  3UOE A;  3CPF A;  4JI1 E;  4LF9 E;  2VZA A;  2BDO A;  3CPW A;  1L1O B;  1OYR A;  4H02 A;  5I9O A;  4MTK A;  3T1H E;  4JI3 E;  5JVG 3;  1IBM H;  2MUY A;  4TVA B;  2WNR B;  1DZ1 A;  4A3B G;  2KEE A;  1YH8 A;  2JA6 H;  3RNU A;  4JI7 E;  2F4V L;  1MSH A;  4JVY A;  4HCS A;  2R93 H;  1O7I A;  2K5N A;  4JI4 I;  1C9O A;  2LSS A;  1EY0 A;  1VQN A;  3NE5 B;  2UU9 Q;  5C0X E;  4IZ8 A;  1RIP A;  3MAQ A;  1EU4 A;  4RGN A;  3JAM C;  3A0J A;  1Y4S A;  4X66 E;  4JI0 L;  2K32 A;  4BS9 A;  2CKZ B;  1ENC A;  5FWK A;  2HHH L;  4L8J A;  4IFD I;  2RBM A;  4RKB A;  4LF6 E;  3SEB A;  2CTM A;  5G3L D;  4JI5 H;  1IKM A;  3RUZ A;  3UDG A;  4HMJ A;  2DUD A;  1UG8 A;  2WAQ G;  4DV7 Q;  3LNU A;  4LF4 I;  2JA8 G;  3TS2 A;  3LNN A;  4M8A A;  3I4N B;  4GOP B;  2CH4 A;  2F0E A;  3FEW X;  3NZK A;  1LAB A;  4DR2 E;  1B62 A;  1F77 A;  2EYM A;  1SFO B;  2JK8 A;  4HAC B;  2BM0 A;  2UUA L;  1DCZ A;  3Q6N A;  3MTS A;  1LTT D;  1FNV A;  2QEJ C;  2IWH A;  2KHJ A;  2DY7 A;  4IFD A;  2WP8 J;  3ERO A;  3NUC A;  4HIM A;  3ERQ A;  4X62 Q;  2ALY B;  1XNR Q;  1CSP A;  3S17 B;  1HPC A;  3DLL A;  2O2L D;  4EGV A;  1WFQ A;  5K36 H;  2Z0S A;  5BR8 H;  3Q22 A;  1NUC A;  2WAQ E;  1GJX A;  2JYO A;  4LIJ A;  4NXN L;  5IGC A;  1AZQ A;  3KLS X;  3CF5 A;  4EMD A;  1MU5 A;  3KLW A;  1DTJ A;  4WFN 3;  2Z8L A;  1LT5 D;  2R42 A;  4LF5 E;  2Q8I B;  2CW0 C;  3DM3 A;  4JI0 I;  3I4L A;  3DXJ C;  1J5E L;  3STB D;  2HHH I;  3J80 i;  3UE1 A;  1L1O C;  4YHH H;  2CWH A;  4R4T A;  1OYS A;  1PDQ A;  3K0X A;  4DR1 E;  1XHK A;  3J7Z C;  5EBC A;  4AYB G;  2IHE A;  2IOQ A;  2VES A;  4ZAI A;  5FO8 B;  4CBV A;  1OO9 B;  2WKD A;  5M5Y H;  3NCV A;  3J7Y W;  3FPP A;  1AW7 A;  2Q8R E;  3DWA A;  1JOK A;  3KUP A;  4L6T B;  5D3D A;  4PZ8 A;  4JI1 Q;  4PMB A;  4KTA A;  1CFM A;  2B2T A;  2MGS A;  4DV0 L;  1J8I A;  2UUA I;  1AH9 A;  4BY1 H;  2HCI A;  1ONL A;  4DAM A;  3ULP A;  2VUM H;  1N32 L;  4JI2 I;  4F8M A;  1XMQ L;  3IAY A;  2KEC A;  5IGB A;  4JI7 Q;  1STY A;  1EQR A;  2B2U A;  2H4O A;  2SOB A;  1SE4 A;  1YIT A;  3F0N A;  4YY3 Q;  4NXN I;  5JEA H;  2NWG A;  3RZO B;  4HMI A;  2B2V A;  1Y14 B;  3L3O C;  3MC0 B;  3JAM W;  5ELD A;  5A2Q L;  2ZQE A;  1NNX A;  3K57 A;  4DV7 H;  1Y8N B;  4X3S A;  3TZU A;  5EAY A;  3PV0 A;  1H74 A;  5IIF A;  1M4V A;  5CBE E;  2NBF A;  3VR4 A;  1J5E I;  1F9Q A;  2MJ8 A;  2IES A;  4GOP C;  1H9S A;  3N52 A;  3QO2 A;  4B3S H;  4LF8 E;  4GKJ L;  2PNR C;  2M6Q A;  1JB3 A;  4YWL A;  2A6E D;  5IGF A;  5DRQ A;  4GS3 A;  2BA0 D;  4NXM E;  2D9U A;  3OIQ A;  2FFM A;  3WWV A;  2MJH A;  3KBG A;  1EZ8 A;  2CFM A;  1UEA B;  1X3E A;  3G48 A;  2JEB I;  4X62 H;  2EY2 A;  4M1U B;  1XNR H;  4N8F A;  1I50 B;  4HIO A;  5IT9 L;  1L0X B;  4IFD B;  1BO0 A;  4P73 A;  4DR2 Q;  4DV0 I;  4ZLT F;  1IYJ B;  3A5Z B;  2VQE H;  1UEK A;  2NN6 C;  4LFB L;  1SMY D;  1OXS C;  1BR9 A;  2LRR A;  2DNC A;  1UEB A;  1B50 A;  5K36 F;  1XMQ I;  4QJF A;  2N3S A;  4J8Q A;  5J1Z A;  1YHC A;  5COY A;  2EDG A;  1ZXM A;  4KV6 A;  4IS9 A;  4LCG A;  3GTG H;  2HQL A;  4QL5 A;  1HNW E;  1PKP A;  4BXX G;  1ELO A;  1MKH A;  1W2B A;  1MI2 A;  2JEB A;  1EUJ A;  4A3J G;  5M9O A;  4UT4 A;  2EYJ A;  3HOV B;  1RKN A;  5FLX L;  1HZB A;  2RKS A;  4A3M H;  3HKZ B;  1S16 A;  4AH6 A;  4K5W A;  2UUB H;  3GR5 A;  1EY8 A;  1D5M C;  5LL6 R;  4DK3 C;  4GKJ I;  4JI1 H;  1I94 E;  4DV2 I;  3J7A F;  2V8P A;  1UE7 A;  3KF8 A;  3T56 B;  4BY7 B;  3T1H H;  4JI6 E;  4JI3 H;  5FLM H;  1IYU A;  4EQ5 A;  2PQA A;  2WIN B;  1DM0 B;  1R6M A;  2UUC E;  4ZKC B;  2MPM A;  2FMM A;  4JI7 H;  3CCM A;  4IJL A;  3BVZ A;  3BJU A;  4POF A;  4KQV A;  1NSN S;  4MU4 A;  4TRD A;  2JSO A;  4FXK C;  3TZD A;  4A3G B;  1GVP A;  4LFB I;  2CWF A;  4YY3 H;  4DN4 M;  3RLN A;  2F0L A;  3HRZ C;  1RTN A;  4KD4 A;  5M3M G;  1A3V A;  1KAA A;  3TDQ A;  3NP8 A;  3X3N A;  5JEA F;  1UDN A;  1EWC A;  1RR9 A;  5HUR A;  1EFI D;  2IW3 A;  3JC6 6;  3NXW A;  4ULL A;  3SK8 A;  4DR7 E;  3M9B A;  4A3B H;  3A7A B;  4H0L C;  1IBL L;  4K0K Q;  3CW2 C;  1BKN A;  2Q2H A;  2L9H A;  1PXU A;  4KMU C;  4S3S A;  4F88 A;  5IOC A;  2JA7 G;  1PFN A;  3K80 C;  2I5L X;  4ZVI A;  2F4V E;  4Z7Y A;  2EY5 A;  3UDX A;  1TS2 A;  2PI2 E;  1TWC H;  4IFD C;  5JOB A;  1A0I A;  2K6A A;  4LF8 Q;  4L63 B;  1HJP A;  1DAR A;  1STB A;  2M9V A;  3FMC A;  2M8W A;  4DR2 H;  3PIO 3;  5K36 D;  1PQX A;  1PTO H;  1ESR A;  2XTI A;  1KLU D;  3M4Q A;  3VR6 A;  1XRH A;  1YNN D;  2DEI A;  4U68 A;  1N33 L;  2O1T A;  1Z0W A;  1CQV A;  4LUO A;  1GO3 E;  2PYK A;  4DF7 A;  3HOZ G;  2V2Z A;  4DV5 Q;  1SE8 A;  4RHR A;  2J7Z A;  2RSN A;  1LTI D;  3GTM B;  5EBD A;  3FKI G;  3ICE A;  2YQR A;  1CA5 A;  2VF3 A;  4A3F B;  2BA0 A;  1TWA H;  4KHP L;  3OW7 A;  1P8L A;  1IBK E;  1EIH A;  1K8A C;  4QF4 A;  1S03 G;  1HNW Q;  1YNJ C;  5C0X J;  1HFG A;  3CWV A;  1STG A;  4KKS A;  1IBL I;  1AE3 A;  3H1C A;  1IBM I;  2FMR A;  4DR1 H;  4Y7N B;  2B2T C;  3KF8 B;  2AUK A;  2MO0 A;  2K1H A;  1XWE A;  3HJC A;  4FW9 A;  2E5L E;  3PO2 H;  1UDQ A;  2PQA B;  3SK4 A;  2SEB D;  4NB3 A;  1PHJ A;  1FJG Q;  4DUY L;  3LX0 A;  4GLA C;  3J80 Q;  3NTK A;  5JJZ A;  1C4Q A;  2XRQ D;  1YHA A;  3SK5 A;  2B2U C;  1K3B C;  2CWP A;  2NTT A;  5JEA D;  2E8G A;  3DWP A;  4JG4 A;  1LT6 D;  1Z7T A;  3URY A;  3A8K E;  1PVO A;  5C0X F;  1G8Z D;  2QEX A;  2B2V C;  1BXT A;  3MXN B;  1ZM2 A;  2IX0 A;  2RSO A;  2Q2U A;  2O1U A;  4DAY A;  1ZTG A;  4U67 3;  3CAM A;  2D62 A;  4DV4 Q;  3PS3 A;  4DV6 E;  4BBS G;  4K0K H;  4KHP I;  2GVB A;  2KBN A;  3C1F A;  4G7Z C;  2EYO A;  3F8T A;  1XTD A;  1RF2 D;  1ROD A;  2PO0 A;  3S14 H;  5IWA Q;  5AJ3 L;  2E2J H;  1HA5 A;  1STH A;  4B3T L;  2XVS A;  5ELE A;  4IZK B;  3U4V A;  2ZTD A;  3K8A A;  1SJH D;  3J7A V;  1LLR D;  1S5E D;  1PA6 A;  1ZXT A;  3VYS A;  4Z7C A;  1KAW A;  4LF8 H;  3BDL A;  1CKM A;  1SYB A;  3H0G G;  4NXM H;  4JBW A;  1G29 1;  1IL8 A;  3K6O A;  5EPK A;  1MGS A;  1DOK A;  2UU9 L;  2AE8 A;  1A63 A;  2WB1 G;  2AWN A;  3J81 E;  1N32 E;  1Q1E A;  1VBI A;  1XMQ E;  2IX1 A;  3OMC A;  1PTO F;  1Y1V B;  2UXD L;  4GNX A;  1PH8 A;  1LV9 A;  1SNO A;  3TRE A;  4DUY I;  1K8M A;  1X54 A;  4DV5 H;  1Z0E A;  2KCC A;  4FJS A;  4R8N A;  2XIW A;  3MEF A;  4GKK Q;  4B3R Q;  3CD6 A;  4DNT B;  4AQY E;  2D0O A;  1HQR D;  4G08 A;  1TT2 A;  3PUV A;  3V96 A;  2GVA A;  5A2Q E;  4ZYS A;  4LJZ C;  3WU5 A;  3NWS A;  1CI3 M;  3HGB A;  3S2D H;  3S1Q B;  1E22 A;  4I65 A;  1S4Z A;  1HNW H;  1SRO A;  2HKJ A;  5DRR A;  4PQX A;  4DAP A;  5CV6 A;  1EFW A;  3MWY W;  4DGZ A;  3M4O B;  2FJ2 A;  4DV1 L;  1JWU D;  3M7N G;  1KTK A;  4OO1 D;  1RCV D;  1PYW D;  3BZD B;  2IHF A;  1N36 L;  4IPC A;  3U4Z A;  4TKO B;  1IBK Q;  2JT2 A;  1EY9 A;  2K4K A;  1ILQ A;  2GQ0 A;  1PLF A;  4XQN A;  2E2H H;  3R2I A;  1RDP D;  4DR3 Q;  1I94 H;  4J15 A;  5DRO A;  2E2D C;  2E76 C;  2NZO A;  1E1T A;  5IGE A;  1G6P A;  1WD0 A;  4R1F A;  4ILW A;  2UU9 I;  1DXM A;  4LF7 E;  1X0A A;  2A5H A;  2RDF A;  1V9N A;  1HRJ A;  1KNE A;  1M8A A;  4Z9C B;  3NEL A;  3LGJ A;  2UUC H;  3STB C;  4BXX H;  3D8G A;  2V2Q A;  2UXD I;  4YIJ A;  2E5L Q;  4BBR H;  2AQ2 B;  2VB2 X;  2HDM A;  4PZ6 A;  3GTO H;  4LFC Q;  4ALP A;  3PO3 G;  1VQC A;  4JYA E;  5FKA C;  2KQ3 A;  4JVH A;  4JK1 C;  4FXD A;  1PH6 A;  1F9R A;  1WVN A;  3V69 A;  4KY7 A;  4DAY B;  3L7Z A;  3LWU A;  3OTO Q;  4FVM A;  4UY8 C;  2JA6 G;  4P7A A;  3GAB A;  2R93 B;  5IT9 C;  5IWA H;  2I5H A;  3S1R H;  2HKE A;  1DJR D;  4RH6 A;  1LTB D;  1PYS B;  2DJG C;  2RDH A;  4K6D A;  2PO0 B;  4DR7 H;  4FJU A;  5IGG A;  4JI8 L;  2JXM B;  4DV6 Q;  1YEZ A;  2UXC Q;  1I4Q A;  5C4X G;  1N36 I;  1LAC A;  1QG7 A;  2MO1 A;  3SK6 A;  4HJA A;  2EOT A;  4LFA E;  1I6U A;  1K8G A;  1ZEQ X;  1MG7 A;  1R9T B;  4GN3 B;  5ELF A;  3PUY A;  1BCP F;  2K52 A;  1QUQ A;  2ES2 A;  4LMQ D;  2I5M X;  2KHS A;  1PRT D;  5FLX C;  1EOT A;  4CJ2 C;  3U9O A;  4CKC A;  2OXP A;  4CKE A;  3ULL A;  1F2L A;  3KJO A;  4FW6 A;  1K83 H;  1A6X A;  1CM9 A;  3PQI A;  4DV3 L;  3PF4 A;  2QCP X;  2EQS A;  4RFB A;  2CHB D;  4CDD C;  2A6E C;  1MJC A;  2O1W A;  3ZJY C;  5IP9 H;  2B8G A;  3TQY A;  3UDF A;  2JA7 H;  1IBL E;  4AQY Q;  2F52 A;  1CSQ A;  2LXK A;  1D1K A;  4CJ1 B;  2ZIT A;  3M6A A;  1QIL A;  2B63 B;  3QOL A;  4FW5 A;  1IBK H;  2F0O A;  4B8T A;  1XX8 A;  4IFD J;  2ZTC A;  5K36 B;  4R4O A;  4DR3 H;  1KHM A;  2JVZ A;  1XPR A;  5CYU A;  4OO1 I;  2D5D A;  4B3M Q;  2GS8 A;  4MQY A;  3VYR A;  2LKV A;  3ND9 A;  2R7D A;  4EQO A;  1IZ6 A;  2D9I A;  1SSO A;  1N33 E;  3CQZ H;  5IYC G;  5DM7 3;  4LOM A;  3KDK A;  3GKU A;  2E5L H;  2F0D A;  4M1K A;  1F9S A;  1HZC A;  3T16 A;  4C3H H;  2OTL A;  5LL6 X;  1N34 Q;  5IE8 A;  4LFC H;  3K5L A;  1K3R A;  4C3J G;  1MIU A;  5M5W H;  5CGK A;  4DR5 L;  4FDB A;  4LF7 Q;  4AID A;  3CCS A;  1SNP A;  4V19 0;  1TWF H;  1H7S A;  4DV3 I;  1CQF A;  5GAE C;  4OO1 A;  2B8F A;  5M5Y B;  3J7A G;  2LTM A;  4NP5 A;  1I5F A;  3QR8 A;  1XJV A;  1X65 A;  3NBI A;  1VIH A;  3L7Z B;  4QY7 A;  2OI2 A;  4DUZ E;  3BYT B;  1EY5 A;  3ZZ0 A;  2AUJ D;  1UE1 A;  4JYA Q;  4BY1 B;  4DV6 H;  2UXC H;  3JAM i;  2VUM B;  4NPS A;  3FHW A;  3GTJ H;  1TXY A;  4OEM B;  2DNE A;  2OTJ A;  4DR6 L;  3S1M B;  4JV5 Q;  4WUD A;  5E4X A;  5JEA B;  4H13 C;  5I2X A;  3S16 H;  4A3I H;  1UE6 A;  4GNX C;  2A69 C;  1GUN A;  1QUQ B;  5COR A;  2K5V A;  3KLR A;  3VR5 A;  1H9M A;  3P3E A;  2E3U A;  2RHS B;  5HGQ A;  2WNR A;  4Q0F A;  5C3E G;  2ZXP A;  4YCU A;  4PDB A;  2OEO A;  4DR5 I;  3CRK C;  2AJ4 A;  4RWS C;  3HOW B;  4AQY H;  3NHH A;  3B4T A;  1CZG A;  1XNQ Q;  2VNU D;  3CMA A;  3DD6 A;  5IOD A;  2JJQ A;  5EQ0 A;  2AKW B;  1SND A;  4B3T E;  3H0G H;  1A2U A;  4JPB W;  2CTF A;  1YNN C;  1SXT A;  4FP5 D;  4B3M H;  1VQK A;  3NTI A;  4IOA A;  1PH7 A;  1WCM G;  2PNH A;  4LCF A;  4HJ5 A;  1SNM A;  2JE6 B;  1VIG A;  3AU7 A;  1Z9F A;  2Z4H A;  4OHJ A;  4DR6 I;  1FWK A;  1J5K A;  1OJ4 A;  4DNR B;  1N34 H;  4K8I A;  1V43 A;  4O2D A;  1LO5 D;  4IQZ A;  4A3M B;  4LF7 H;  4QUC A;  1SR3 A;  1TWG H;  2I46 A;  4P72 A;  1FNU A;  3GTK H;  1DYQ A;  2XN9 C;  4PRV A;  4ABN A;  1A8V A;  3C1E A;  1PZI D;  4RAU C;  2J7K A;  4BA1 I;  4JI4 L;  3T13 A;  1H9J A;  2F0Q A;  3L7Z C;  4OO1 B;  4B9W A;  1X55 A;  1VMC A;  3GD7 A;  4DV1 E;  3QWN A;  4PV1 C;  1D5Z C;  3I3C A;  2N88 A;  4IUT A;  5FLM G;  4K0K I;  4JYA H;  2V1C C;  2WFW A;  1Q46 A;  1QVG A;  1HNZ Q;  1HR0 E;  4FNF A;  1B44 D;  2N78 A;  5BR8 Q;  2DGY A;  2ZJR A;  1GHK A;  1FR3 A;  1G51 A;  3T51 B;  3Q1Q A;  4JV5 H;  2OPV A;  2ID0 A;  1FJG L;  4NZT M;  4DUZ Q;  1JQY D;  1JE5 A;  5C0X G;  4GN5 A;  4BA1 A;  1VQG A;  3AB9 A;  4LUZ A;  3S2H B;  2NUC A;  5FK9 C;  3JAM E;  4DU7 A;  1HNX L;  1A6F A;  4LFA H;  4DU8 A;  5DT9 A;  4YHH Q;  5F2D A;  1V1Q A;  3PO3 H;  3FRP B;  4I3H A;  2VY3 A;  3EVQ A;  1CHQ D;  3J81 j;  2F0P A;  2V34 A;  1EZ6 A;  4A3B B;  1Y6Z A;  1MX0 A;  3M4P A;  4ID6 A;  4A3D B;  1MHW C;  5H1S E;  4BA2 B;  2QDL A;  4DV4 L;  2HCC A;  1QCB D;  1B63 A;  2LY7 A;  1XNQ H;  2Y0S E;  5DM6 3;  2VQF Q;  3BYY B;  1CUK A;  3SR1 A;  1TWC B;  1Y8O B;  2DY8 A;  3F2U A;  1B3Q A;  1GUT A;  1X56 A;  3BDC A;  4DR4 Q;  5C4X H;  3TSS A;  4JI8 E;  3J7A 5;  3CCQ A;  1DOM A;  1L0W A;  1C0A A;  4MTN A;  2EY6 A;  3HOU G;  1GKH A;  2B2Y A;  1UNS A;  1HTL D;  1PRT B;  1AE2 A;  1LTG D;  4DPY A;  4A3K H;  1FJG I;  2ZM6 L;  1BOS A;  2WAQ B;  2YTV A;  3EFX D;  3NQI A;  2JA8 B;  4GKK L;  2PO4 A;  4B3R L;  5M5X H;  2Z5B B;  4IUU A;  1JCK B;  3RD4 A;  1HNX I;  1FI4 A;  2L55 A;  4A4I A;  4PNY A;  4B3S Q;  4N9T A;  4DV3 E;  2WW4 A;  2BOS A;  5I9P A;  4R4I A;  2A74 C;  4OO1 C;  4A76 A;  2IL8 A;  1YHB A;  4FWH A;  3K7A H;  3IKJ A;  4OEL B;  2UXB Q;  1VQ6 A;  3NWT A;  4DV4 I;  4JI2 L;  3L0O A;  1HNZ H;  1VQI A;  3HEJ A;  4QCL A;  2PW7 A;  5KIX A;  1Z2I A;  1JR0 D;  2VQE Q;  1CTM A;  3PO2 G;  2HH3 A;  1VQO A;  2IT1 A;  4PZ7 A;  2NVY H;  4DUZ H;  4IUN A;  5FO7 B;  1EU3 A;  1UE5 A;  2V2V A;  4QNJ A;  5C3X A;  5IYC H;  3HOX H;  4WOR A;  4C1N I;  1HR0 Q;  1Z0C A;  1U4M A;  3CCL A;  1N8R C;  2CG9 A;  4BA1 B;  1SN8 A;  4C3J H;  1QZR A;  2PZW A;  5CV4 A;  1V9P A;  1WTV A;  2ZM6 I;  1H7U A;  4GLV B;  3CDI A;  4AYB B;  2L0C A;  4XQJ A;  3PRY A;  3GO5 A;  2R7Z H;  4GKK I;  1HXY D;  5EKI A;  3RLF A;  3HOY G;  2UUB Q;  2DN8 A;  4B3R I;  2JP1 A;  2K03 A;  4MYU A;  2A1S A;  5LL6 S;  4X65 Q;  3G7L A;  4UP8 A;  2KOL A;  2NN6 G;  3T53 B;  3JAM Q;  2Q2I A;  3W2D A;  4ZUI A;  2F03 A;  3S14 B;  4URL A;  2VQF H;  1KDC A;  4LF9 Q;  4ED4 A;  4MU1 A;  3OTO L;  4X64 E;  2NB0 A;  3T1H Q;  4JI3 Q;  1HH2 P;  3S9W A;  4DR4 H;  4KLK A;  4G7H C;  1Z59 A;  3U1Y A;  1S4E A;  3EA6 A;  1G2S A;  2K14 A;  4APV A;  4DK0 A;  5C6A A;  1SRU A;  2GN5 A;  1NR4 A;  1EA6 A;  2PMZ B;  4OX9 E;  3HZX A;  2MNA A;  2BH2 A;  4DKA C;  2HIV A;  1PRT C;  4MYT A;  1WHR A;  2WV6 D;  2NN6 E;  4QUF A;  1VDZ A;  4OKG A;  1XYI A;  1M1K C;  1HFN A;  2CVE A;  2A19 A;  2MQH A;  1KD1 C;  1H95 A;  4LAA A;  2KCT A;  4MHE A;  2E2I B;  2X7I A;  4L5R C;  4X66 Q;  1SYG A;  4KK7 A;  5C3E H;  1QZG A;  2BH8 A;  4LF6 Q;  4DV2 L;  3W1B A;  1ILP A;  3OPO A;  3R8B A;  3M7N D;  3M85 G;  2A2C A;  2KED A;  4K5X A;  1NHI A;  2UXB H;  2EYF A;  1ASY A;  3ZKB A;  3A7L A;  4O42 A;  1KNA A;  3OTO I;  3T1Y L;  2E2H B;  2IER A;  2DGR A;  5I6Y A;  5LMN E;  1L2F A;  3A8J E;  4DPW A;  4PRX A;  1JB7 A;  4HSV A;  5LMU L;  2LJP A;  4QQB X;  1WCM H;  3BU2 A;  1HA6 A;  2Z5C B;  2UXC I;  2LMC B;  1XMO L;  3OSS D;  1HR0 H;  2PCF B;  1JJ2 A;  4DXG A;  3HKS A;  4A3J B;  1BBX C;  4BBR G;  1YHQ A;  3GTO B;  4K14 A;  2F3I A;  4UHV A;  1T5E A;  3K17 A;  4B08 A;  2HIX A;  2F0V A;  1STE A;  1EL0 A;  3ZYY X;  4LF5 Q;  2SDF A;  4FW4 A;  4X65 H;  1ODH A;  5ISR A;  1Y8P B;  3S1R B;  1PMR A;  1OXV A;  4LF9 H;  4JI4 E;  2AQ3 B;  3W3A A;  2CVR A;  4OIJ A;  4OD6 A;  1FGB D;  4DR1 Q;  2CZ9 A;  1S40 A;  1DT4 A;  3EZJ A;  1IBK I;  5CBA E;  2RVL A;  1KVK A;  1QVC A;  4RA8 A;  4A93 G;  2C38 A;  1YJ9 A;  2GO3 A;  1HCZ A;  3I4O A;  3I73 A;  1KRT A;  3T1Y I;  5GMD A;  1PYB A;  5CV9 A;  1NR2 A;  3HKZ G;  4R8I A;  4X64 Q;  1T9H A;  1Z5C A;  5E3F A;  4IFD E;  3P75 A;  1MSZ A;  5C0X H;  2B2Y C;  3QD7 X;  5LMU I;  1EQV A;  5M3M B;  4FF3 A;  3MXN A;  1QVF A;  4FWD A;  5DNL A;  1K83 B;  2JN4 A;  3IL8 A;  5T1I A;  4LF4 E;  1XMO I;  3PIP 3;  1NZ0 A;  1EYG A;  2ENB A;  4RMF A;  4OX9 Q;  4X66 H;  1O80 A;  3H3V H;  4B9X A;  4WAN A;  3TN2 A;  1LTA D;  4LF6 H;  1SYD A;  3CME A;  2L4N A;  4OXP A;  3FP9 A;  3K58 A;  3NTH A;  2LS0 1;  3VYT A;  2JA7 B;  1USU A;  2L12 A;  5IP9 G;  3J81 i;  1IBM L;  4HYM A;  4G57 A;  3OWF A;  2LFN A;  2NVT B;  4IZK A;  4HAE A;  4JBJ A;  2NVQ H;  3A5U A;  3HKZ E;  1EIF A;  3I2Z A;  1HTP A;  3AYH B;  3BS1 A;  1F2M A;  1BKB A;  1D6E C;  2LXJ A;  4NXM Q;  1B9M A;  4MU3 A;  3C46 A;  5GQO A;  3J80 C;  2Z1C A;  2HFS A;  3HOU H;  2F3V A;  3DUZ A;  3HOZ B;  2VS1 A;  3PS1 A;  2P2R A;  3D0F A;  3CQZ B;  2UUC I;  4JI0 E;  2HHH E;  3T4A C;  3D6W A;  3FKI B;  4JCV E;  5LMN Q;  3IRB A;  1AFP A;  4ODG A;  4C3H G;  2EJG C;  3SVM A;  4A3L H;  4JV5 I;  2B29 A;  4HED A;  4JI5 L;  1GUO A;  2G9D A;  2FXQ A;  4WJ4 A;  1XXE A;  4YWM A;  2PW5 A;  1VF5 C;  3H6M A;  1TWF B;  3VKE A;  4LF5 H;  3OOC A;  1PFB A;  3TME A;  2EPB A;  5KEE A;  1I6V C;  1U0L A;  1BBW A;  3W5O A;  3KFU A;  2N55 A;  1WTW A;  2UUA E;  2QGQ A;  5KYI A;  4G7O C;  2FHT A;  2CPM A;  5IYD H;  5FOB B;  1WI5 A;  5JPM C;  4X6A H;  4JI2 E;  2F0K A;  2R3Z A;  1XNQ I;  3GTJ B;  4QB4 A;  4JBM A;  5EGT A;  2J4X A;  2CTJ A;  2X69 A;  2IOP A;  5LL6 b;  1I94 Q;  2H1E A;  1ICF B;  2CTK A;  3I4N H;  2XEX A;  3G6E A;  5BR8 L;  4X64 H;  2YU9 H;  2C38 B;  4JI6 Q;  4NXN E;  5AFW A;  1AZP A;  1E3H A;  2ZJP A;  1SFO H;  3S16 B;  2IY5 B;  2K5Q A;  2UUC Q;  3NEM A;  1VQD A;  3F2C A;  4A3I G;  4EC5 A;  1J5E E;  2F0F A;  1Q1B A;  2P5Z X;  3AFQ A;  2IPK D;  4OX9 H;  1ZZK A;  4YHH L;  2CQA A;  3HOY H;  4BBS B;  1TS5 A;  4GN4 B;  4JI5 I;  4QGU A;  1KC8 C;  1SE3 A;  3GTQ H;  2NN6 H;  1S5B D;  3GTP H;  1JOO A;  1JT8 A;  1C8C A;  1WTX A;  4EVO A;  4XTC S;  5C44 G;  1X6O A;  5TSS A;  5FJ8 G;  3E9I A;  4DR7 Q;  3H0G B;  2NTS A;  4DV0 E;  3X3M A;  5K5P A;  2BL5 A;  5EKW A;  1D7Q A;  1E7Z A;  2WB1 B;  1FYC A;  5KGU A;  1WOC A;  4HXZ A;  3ITP A;  1D1I A;  1ESF A;  3H91 A;  2TMP A;  2XGT A;  3MFG A;  4R1J A;  3S15 B;  3I7F A;  2BDN A;  4XXE A;  2HD3 A;  2PO2 B;  2F4V Q;  3QT8 A;  1HNZ I;  2C5C A;  2VB3 X;  3H4L A;  5M3F G;  1EQQ A;  1R4Q B;  3BVM A;  5BR8 I;  4TQU S;  4JC0 A;  1PH9 A;  4WUC A;  3J80 W;  1TWH H;  5LMN H;  3J80 c;  1XXG A;  2M2L A;  3NPP A;  2CTL A;  2EXD A;  4UAI A;  4XYQ A;  2NVX H;  1KTV A;  2V4D A;  3S24 A;  2O4C A;  1SNQ A;  2QDB A;  5E1F A;  3P3G A;  1WTP A;  5C4J H;  3RZD B;  4A3C G;  3RLO A;  4DV7 L;  2K05 A;  3IFT A;  4JI0 Q;  1HZA A;  1SYC A;  3E0E A;  4IUP A;  4LWC A;  4YHH I;  3WDN A;  4B3S L;  4GKJ E;  5CC4 A;  1VQE A;  1PZJ D;  4DV2 E;  2AMC B;  1YNX A;  1PH4 A;  3SHL A;  1Z47 A;  4UDU C;  5K36 A;  4MU0 A;  2EE1 A;  3DEO A;  3RZO H;  3O13 A;  4RKL A;  3KRN A;  2EYP A;  4X62 L;  1XNR L;  4USK A;  1NJI C;  1K9M C;  3BVG A;  5IT9 E;  2EJM A;  3ZM7 A;  1HZ9 A;  1E1O A;  1QNK A;  3I55 A;  4LFB E;  2EJF C;  2VQE L;  5BN5 A;  2E1R A;  5I2Y A;  2J0T D;  4JI6 H;  1KIJ A;  2PZU A;  4DR4 I;  2XNA C;  4ZQ3 A;  3U1K A;  1QWY A;  3G71 A;  2AHO B;  5C0X D;  3VA5 A;  3FDT A;  2PO1 B;  1LTR D;  1EEI D;  2WP8 B;  3PO3 B;  2DEJ A;  2N49 A;  2Q8T A;  3UE0 A;  1XPU A;  1I50 H;  1ZYR D;  1EIY B;  4IFD H;  4NXN Q;  2K33 A;  1Z6H A;  1WD1 A;  5FLX E;  3FVQ A;  4RGO S;  3W1G A;  5EJW A;  4NBQ A;  3ER0 A;  2JA6 B;  4KN7 C;  1Z5A A;  2SNM A;  4KHZ A;  4HSP A;  4DV7 I;  1EOV A;  4LF4 H;  2UUB L;  1EY4 A;  1RTO A;  1J5E Q;  1Y1W G;  5E4W C;  4CGY B;  2NN6 F;  4B3S I;  4JI1 L;  1ICW A;  2CW0 D;  1OXT A;  5C4X B;  1F2Z A;  1Y5Y A;  3T1H L;  4JI3 L;  2WAC A;  1S72 A;  1C7Y A;  1GHJ A;  4A93 H;  2F0N A;  1PTO D;  4HID A;  4EX5 A;  5JEA A;  3PYD A;  1HUN A;  4X62 I;  1XNR I;  2LF0 A;  2F4V H;  2B39 A;  4JI7 L;  3C3L A;  1P42 A;  1TR5 A;  3ZZT A;  2JZX A;  2FIN B;  3UHM A;  4RGM A;  2ATW A;  1SEI A;  4DV0 Q;  2VQE I;  2RA4 A;  2Z9H A;  5KND A;  1FL0 A;  4A3K G;  4YY3 L;  5C4H A;  3E6Z X;  1JMC A;  4BY7 H;  4J3D A;  1IKL A;  1N32 Q;  1V1O A;  3J81 Q;  3HUL A;  3MHB A;  1XMQ Q;  4L5T A;  2JE6 I;  1VQ5 A;  3A74 A;  4K5V A;  4OL7 A;  4DPX A;  4JI0 H;  1KQS A;  1X9Z A;  2HHH H;  1YJN A;  1Y69 U;  4HJ8 A;  1LTL A;  2EYH A;  4X3T A;  2EYL A;  3K7A B;  1IBM E;  1IYV A;  5A2Q Q;  3RMH A;  3H15 A;  4ZRZ A;  2A6H D;  4U3D A;  5D14 A;  1PH2 A;  2J65 A;  2UUB I;  5L37 A;  1SMX A;  1NMF A;  1X4N A;  3GCM A;  2Z6K A;  1SMY C;  1VQP A;  4JI1 I;  3TRZ A;  2IX3 A;  1EYD A;  4GKJ Q;  1TKW B;  2ICI A;  3VR3 A;  2JE6 A;  4DR2 L;  3K85 A;  3T1H I;  5D65 A;  2NVY B;  4JI3 I;  3A54 A;  4ME5 A;  2UUA H;  1KKH A;  3PSI A;  3K59 A;  3QT5 A;  1NMG A;  1ZZI A;  4LUV A;  4CHT B;  4RG1 A;  3MFY A;  3HOX G;  3MXG A;  5IYB H;  4HJ9 A;  5L3J A;  1Z0V A;  3R2T A;  3V5R A;  1KRS A;  3MA2 B;  4JI7 I;  1VQB A;  5LHY 1;  1NXU A;  5IT9 Q;  1GM5 A;  1W6K A;  4C3J B;  3G4S A;  4RHS A;  2BA1 G;  3OHX C;  4X3K A;  1FVI A;  4LFB Q;  4YY3 I;  5C0X I;  5JJL A;  4NXN H;  5CV8 A;  1TII D;  2R7Z G;  4KHP E;  2NN6 D;  4IFD F;  3J81 c;  3PIO A;  1RL2 A;  3B82 A;  3K1J A;  5JVH 3;  4X66 I;  1J5E H;  3U9S A;  4LF6 I;  5FO9 B;  2IJ0 A;  1ZZJ A;  3I4M G;  5FLX Q;  3IFD A;  4OWT B;  3M7G A;  3HP3 A;  4DAV A;  3GTM H;  2FPH X;  4BA2 I;  2OQK A;  3RR5 A;  4DR1 L;  4WJ3 M;  3KJP A;  2AXY A;  1BCP D;  1WTH A;  4X3U A;  4A3F H;  2CCZ A;  2JA5 G;  5C0X A;  4JVZ A;  3K5N A;  3AFP A;  3MVV A;  4DUY E;  1KAB A;  1JIC A;  3KYH C;  4DR2 I;  4DV0 H;  1VS0 A;  1K73 C;  3PUW A;  4O1N A;  3CHB D;  3GV6 A;  4NDX A;  5EKK A;  2O5I C;  1TVX A;  3I91 A;  4JW0 A;  3GTL H;  4BWG B;  2HT1 A;  4LFA Q;  1RJT A;  1N32 H;  3CCU A;  5EL9 A;  1XMQ H;  3VR2 A;  1ET6 A;  4J6H A;  1VQF A;  2AWO A;  2K75 A;  2XSC A;  4Y7N H;  1NTG A;  5C3E B;  1YVC A;  5D3I B;  4IZJ D;  4F7X A;  4QIW B;  4BA2 A;  3NK9 A;  4PU9 A;  1NAP A;  2F0G A;  3FAU A;  1BQQ T;  4A3E G;  3E5S A;  3M85 D;  1J9O A;  4HN7 A;  3GON A;  4K0K L;  5C44 H;  3P1H A;  2R7F A;  1QJO A;  4XDX A;  4C3I G;  1X3F A;  5DLQ E;  1I4X A;  2VW9 A;  5FJ8 H;  2GA4 B;  4POG A;  1K8O A;  4LF5 I;  1WE8 A;  1I3Q H;  4OIK A;  1DON A;  2C37 A;  1EIG A;  5K36 C;  3TEH B;  2PNM A;  3TP5 A;  4GKJ H;  2E75 C;  4J1M A;  4RCN A;  1IBL Q;  4LF8 L;  4H8A A;  4NXM L;  2UU9 E;  5HY6 A;  4DR1 I;  1PV4 A;  5M3F H;  2R92 G;  1JC7 A;  3EJI A;  5JJK A;  3GTG B;  1WUU A;  2UXD E;  1X9N A;  5CV7 A;  1MBY A;  2K5H A;  4KJO A;  2Z5B A;  1B70 B;  1XTC D;  1V8C A;  4DV5 L;  4FF4 A;  2HUG A;  3P06 A;  4LFB H;  4A3C H;  4FW7 A;  1N33 Q;  3BG3 A;  2Z6B A;  1J6Q A;  4WUB A;  5DRP A;  5CR3 A;  2O4X A;  1ENA A;  3Q23 A;  1F0X A;  1GXD C;  1FWL A;  1HNW L;  2CTE A;  4JG2 A;  1Y1V H;  1PIE A;  3I8Z A;  1VCI A;  4L5Q A;  1FNW A;  4KHP Q;  1D5X C;  1UDO A;  5E7N A;  1N36 E;  2WII B;  1A2T A;  4WJW A;  5G3L F;  1KL9 A;  2OT2 A;  4MN3 A;  2A73 B;  3LTO A;  1O78 A;  4N8X 1;  2Y0S G;  3S1Q H;  4IAL A;  4LF8 I;  5JEA C;  5C0X B;  5I4D A;  1I94 L;  4NXM I;  4IJH A;  1WTJ A;  1E3P A;  3J80 L;  1I4R A;  2KCN A;  1NE3 A;  2CWA A;  4OO1 G;  4OCH A;  1I6H H;  3K5M A;  2UUC L;  1N9W A;  2D2C C;  4DUY Q;  2PZT A;  1FNM A;  4DV5 I;  1LUZ A;  2MHV A;  3VDY A;  2PQU A;  1H72 C;  1X32 A;  2C35 B;  1OYP A;  3WU6 A;  2OPU A;  1M90 C;  4K2L A;  2NVQ B;  1MSG A;  1Y1W H;  2PY9 A;  2Q2E B;  2EFG A;  3V2U C;  3KDF B;  1S20 A;  3NEN A;  1B2T A;  1B53 A;  4OWW B;  5IWA L;  1FD7 D;  1HNW I;  5KYL A;  2FFK B;  4UP9 A;  4LNQ A;  1CHP D;  1UWV A;  1SBB B;  4CJ0 B;  4DR7 L;  2C37 B;  1LYL A;  1PTO B;  4OO1 E;  1IBL H;  1QNU A;  2Z6K C;  1VQA A;  2HFU A;  3HOU B;  1VIS A;  3BDO A;  1T5X D;  1CKN A;  2F4I A;  3TS0 A;  2PPB C;  4CKB A;  5AJ3 Q;  4A3D G;  1UAP A;  1WTQ A;  1PH1 A;  1AN8 A;  4K6L A;  4B3T Q;  2KJX A;  3CRL C;  1B7Y B;  2L11 A;  5DEH A;  2SNS A;  4IZJ A;  1I94 I;  1FKA E;  1LTS D;  1IW7 D;  3F2D A;  4IPG A;  4A3L G;  2MP1 A;  4YY3 E;  1U9R A;  3M3Y H;  4JI6 I;  1TWA B;  4CDC C;  5JAV A;  1NHH A;  3M85 A;  1P16 A; 
#chains in the Genus database with same CATH homology
 2YYZ A;  2UXD Q;  1R9T H;  2KHI A;  3GDE A;  3AEV A;  1KIX A;  1J4W A;  5IYD G;  3E9H A;  1IBK L;  3BZK A;  4JOI A;  3GME A;  1VQ7 A;  2YTY A;  4DR3 L;  3I4N G;  4C2M H;  5C0X C;  4DV1 Q;  1N36 Q;  2KCM A;  1IL2 A;  1CKO A;  4IOC A;  2E5L L;  2L15 A;  2B63 H;  4LFC L;  4AIM A;  2NN6 B;  4LW1 A;  4MNO A;  3SGI A;  3I4M H;  4DPG A;  2JA5 H;  4DV6 L;  2PI2 A;  2UXC L;  4PG3 A;  4HIK A;  1OTC A;  2A1A A;  2D0P A;  4P75 A;  1CKN B;  1XPO A;  4JI8 Q;  2H5X A;  5ELO A;  3AQQ A;  1HR0 W;  4UPA A;  3KF6 A;  4A3E H;  3S1M H;  4AYB E;  1PH5 A;  4C3I H;  1Q81 C;  2CQO A;  4AQY L;  3U58 A;  1YI2 A;  3PGZ A;  1EWI A;  4DV3 Q;  3F1Z A;  3JAM c;  3AEV B;  3L2P A;  1X4M A;  1VQJ A;  3CC7 A;  1FGU A;  2R92 H;  4B3M L;  3RN5 A;  1IXR A;  1EC6 A;  1X3G A;  2EIF A;  3HOW H;  2RCN A;  3S1N H;  1ASZ A;  2PMZ E;  1N34 L;  4IFD G;  1KHI A;  1U5K A;  1K0R A;  2MFI A;  4LF7 L;  3D31 A;  4YCV A;  2A8V A;  4DR5 Q;  4IPH A;  3F2B A;  4JYA L;  3CXC A;  3HOV G;  3B6Y A;  1VQH A;  1GD7 A;  2K50 A;  2I0Q A;  2Q2T A;  5JEA J;  4JV5 L;  1A62 A;  3KOJ A;  2RF4 A;  1VQ9 A;  3CCJ A;  4BY7 G;  1JJG A;  1QZH A;  2OQ0 A;  4LFA L;  4DR6 Q;  1NY4 A;  1Q12 A;  3HKM A;  3KF6 B;  4A3G G;  1XNQ L;  3S2H H;  1VQM A;  2ANR A;  1OXX K;  2PO2 A;  1YZ6 A;  4JOI C;  4JBK A;  1R6L A;  4A3D H;  5IYB G;  4YWK A;  5GAD C;  2BA1 D;  1VQL A;  4DNI A;  4L5S A;  2BR2 A;  3M7N A;  1BVS A;  3PCO B;  1Q7Y C;  1NBW A;  4P74 A;  2ANN A;  2JA8 H;  1HNZ L;  4A3F G;  2JEB B;  1YBY A;  2ASB A;  4JI4 Q;  2PO1 A;  3PUZ A;  2WP8 A;  4DUZ L;  5GAG C;  3U50 C;  2JEA I;  4OO1 F;  3S17 H;  5LMN W;  2NZH A;  2ZTE A;  4QMF B;  4LF4 Q;  4R4Q A;  3UDI A;  1HNX Q;  2QA4 A;  3I56 A;  2VQF L;  4YCW A;  2JEA A;  3CP0 A;  4DR4 L;  4O0A A;  2PNZ A;  1S3O A;  1YJW A;  1MJE A;  1Q82 C;  1KXL A;  2B3G A;  4R4C A;  1Q8K A;  2HHH Q;  2BR2 B;  4HJ7 A;  4OWX B;  2ZM6 Q;  1Y1V G;  1W3S A;  2YV5 A;  2UXB L;  5IP7 G;  5JJI A;  2YTX A;  2E2I H;  2UUA Q;  2BA0 G;  2BA1 A;  2WB1 E;  2N8N A;  4JI2 Q;  1SLJ A;  5J3B A;  3EBE A;  4GLX A;  1HR0 L;  4KI0 A;  1WYD A;  4X65 L;  3PF5 A;  4LF9 L;  3ULJ A;  4A3J H;  3HOV H;  3CCV A;  4WAL A;  3OYY A;  2JEA B;  3CCR A;  2RHQ B;  2C39 A;  2R93 G;  2PNZ B;  3CDJ A;  4X66 L;  1VQ4 A;  3CC4 A;  3PUX A;  4LF6 L;  4A3G H;  5M3M H;  4GNX B;  4PMW A;  1WJJ A;  2JQO A;  4DV2 Q;  4OON A;  3PIP A;  4IO9 A;  2NVT H;  5GAH C;  1BBU A;  3EIV A;  3T1Y Q;  2CPQ A;  1UDS A;  2B63 G;  3Q8D A;  5LMU Q;  5K36 G;  2R6G A;  1XMO Q;  4LF5 L;  3HOZ H;  1D8L A;  3H3V I;  2OCE A;  1VQ8 A;  3FKI H;  3BZC A;  4P71 A;  1Q86 C;  4UP7 A;  5K36 E;  2HH2 A;  2JA9 A;  1LM0 A;  4X64 L;  3RN2 A;  2C39 B;  3NBH B;  4BY1 G;  3CCE A;  2VUM G;  1DGS A;  4OX9 L;  5IT9 c;  2QND A;  2KEN A;  3KDF A;  3CC2 A;  5JEA G;  4A75 A;  1L1O A;  3K7U C;  3ERS X;  1OXU A;  1PFS A;  1IBM Q;  4BBS H;  5FLX c;  4XIG S;  3HFZ B;  1YIJ A;  3HOW G;  5LMN L;  5JEA E;  4IFD D;  2VL6 A;  1E24 A;  4DK6 C;  4IPD A;  3S15 H;  1B8A A;  5IY0 A;  4QIW E;  1K1G A;  4JI5 Q;  2NN6 I;  5IP7 H;  4GOP A;  4AM3 A;  4A3M G;  3RZD H;  1PH3 A;  3EN2 A;  1TUA A;  3M4O H;  3GLL A;  4JI6 L;  2OWO A;  3K81 C;  3OW2 A;  2NN6 A;  4ME3 A;  5GRO A;  1JJC B;  5ELN A;  4MZ9 A;  4Y52 H;  4LF4 L;  2ZJQ A;  3CPF A;  2VZA A;  3CPW A;  1L1O B;  1OYR A;  4H02 A;  4TVA B;  2WNR B;  4A3B G;  2JA6 H;  3RNU A;  2F4V L;  4JVY A;  2R93 H;  1O7I A;  2K5N A;  1C9O A;  2LSS A;  1VQN A;  2UU9 Q;  5C0X E;  1RIP A;  3A0J A;  4JI0 L;  2CKZ B;  2HHH L;  4IFD I;  2CTM A;  3UDG A;  2DUD A;  2WAQ G;  4DV7 Q;  2JA8 G;  3TS2 A;  4GOP B;  2JK8 A;  2UUA L;  2KHJ A;  4IFD A;  2WP8 J;  4HIM A;  4X62 Q;  2ALY B;  1XNR Q;  1CSP A;  3DLL A;  1WFQ A;  2Z0S A;  2WAQ E;  4LIJ A;  4NXN L;  3CF5 A;  3KLW A;  1DTJ A;  3DM3 A;  1J5E L;  3STB D;  3J80 i;  3UE1 A;  1L1O C;  4R4T A;  1OYS A;  3K0X A;  3J7Z C;  4AYB G;  2IHE A;  5M5Y H;  4PZ8 A;  4JI1 Q;  4DV0 L;  1AH9 A;  4BY1 H;  4DAM A;  2VUM H;  3ULP A;  1N32 L;  1XMQ L;  4JI7 Q;  1EQR A;  1YIT A;  4YY3 Q;  1Y14 B;  5EAY A;  3PV0 A;  4GOP C;  4GKJ L;  4YWL A;  4GS3 A;  2BA0 D;  3WWV A;  2MJH A;  2CFM A;  1X3E A;  3G48 A;  2JEB I;  4HIO A;  4IFD B;  4P73 A;  4DR2 Q;  1IYJ B;  3A5Z B;  2NN6 C;  4LFB L;  1OXS C;  1UEB A;  5K36 F;  4QJF A;  2N3S A;  3GTG H;  2HQL A;  4QL5 A;  4BXX G;  1MKH A;  1W2B A;  2JEB A;  1EUJ A;  4A3J G;  1HZB A;  4A3M H;  4AH6 A;  4DK3 C;  1UE7 A;  5FLM H;  4EQ5 A;  2PQA A;  1R6M A;  3CCM A;  4IJL A;  3BJU A;  4POF A;  1GVP A;  3RLN A;  5M3M G;  5JEA F;  1UDN A;  3JC6 6;  3M9B A;  4A3B H;  1IBL L;  4K0K Q;  3CW2 C;  2Q2H A;  2JA7 G;  3K80 C;  2I5L X;  3UDX A;  2PI2 E;  1TWC H;  4IFD C;  1A0I A;  4LF8 Q;  1HJP A;  5K36 D;  3M4Q A;  2XTI A;  1N33 L;  4LUO A;  1GO3 E;  3HOZ G;  4DV5 Q;  1SE8 A;  3FKI G;  3ICE A;  2YQR A;  2BA0 A;  1TWA H;  4KHP L;  1P8L A;  1K8A C;  1HNW Q;  5C0X J;  1AE3 A;  3H1C A;  2FMR A;  3KF8 B;  2MO0 A;  3PO2 H;  1UDQ A;  2PQA B;  4NB3 A;  1PHJ A;  1FJG Q;  4DUY L;  4GLA C;  1YHA A;  2CWP A;  5JEA D;  2E8G A;  1PVO A;  5C0X F;  2QEX A;  3MXN B;  2IX0 A;  2Q2U A;  1ZTG A;  3CAM A;  2D62 A;  4DV4 Q;  4BBS G;  2GVB A;  2KBN A;  3F8T A;  1XTD A;  2PO0 A;  3S14 H;  5IWA Q;  5AJ3 L;  2E2J H;  4B3T L;  3U4V A;  2ZTD A;  3K8A A;  1PA6 A;  1KAW A;  1CKM A;  3H0G G;  4JBW A;  1G29 1;  2UU9 L;  1A63 A;  2WB1 G;  2AWN A;  1Q1E A;  2IX1 A;  2UXD L;  4GNX A;  1PH8 A;  3TRE A;  1X54 A;  3MEF A;  4GKK Q;  4B3R Q;  3CD6 A;  2D0O A;  3PUV A;  2GVA A;  3S2D H;  1E22 A;  1SRO A;  1EFW A;  4DV1 L;  3M7N G;  4OO1 D;  2IHF A;  1N36 L;  4IPC A;  3U4Z A;  1IBK Q;  2K4K A;  2E2H H;  4DR3 Q;  4J15 A;  2NZO A;  1E1T A;  1G6P A;  3NEL A;  3LGJ A;  3STB C;  4BXX H;  2E5L Q;  4BBR H;  4PZ6 A;  3GTO H;  4LFC Q;  4ALP A;  3PO3 G;  1VQC A;  4JVH A;  1PH6 A;  1WVN A;  3V69 A;  4DAY B;  3L7Z A;  3OTO Q;  4UY8 C;  2JA6 G;  2I5H A;  3S1R H;  1PYS B;  2PO0 B;  4JI8 L;  4DV6 Q;  1YEZ A;  2UXC Q;  5C4X G;  2MO1 A;  4HJA A;  1K8G A;  4GN3 B;  3PUY A;  2K52 A;  1QUQ A;  2ES2 A;  2I5M X;  3ULL A;  3KJO A;  1K83 H;  4DV3 L;  3PF4 A;  2EQS A;  1MJC A;  3ZJY C;  5IP9 H;  3TQY A;  3UDF A;  2JA7 H;  4AQY Q;  2F52 A;  1CSQ A;  2LXK A;  4B8T A;  4IFD J;  2ZTC A;  5K36 B;  4R4O A;  1KHM A;  2JVZ A;  1XPR A;  4OO1 I;  4B3M Q;  2R7D A;  1IZ6 A;  3CQZ H;  5IYC G;  1HZC A;  4C3H H;  2OTL A;  1N34 Q;  5IE8 A;  1K3R A;  1MIU A;  5M5W H;  4DR5 L;  4FDB A;  4LF7 Q;  3CCS A;  1TWF H;  4OO1 A;  5GAE C;  1I5F A;  1XJV A;  1X65 A;  1VIH A;  3L7Z B;  4QY7 A;  1UE1 A;  4JYA Q;  3JAM i;  4NPS A;  3FHW A;  3GTJ H;  1TXY A;  2OTJ A;  4DR6 L;  4JV5 Q;  5JEA B;  3S16 H;  4A3I H;  1UE6 A;  4GNX C;  1QUQ B;  2K5V A;  2E3U A;  2RHS B;  5HGQ A;  2WNR A;  5C3E G;  4YCU A;  3B4T A;  1XNQ Q;  2VNU D;  3CMA A;  3DD6 A;  2JJQ A;  2AKW B;  3H0G H;  2CTF A;  1VQK A;  4IOA A;  1PH7 A;  2PNH A;  1WCM G;  4HJ5 A;  2JE6 B;  1VIG A;  1Z9F A;  1J5K A;  1V43 A;  4O2D A;  1SR3 A;  1TWG H;  4P72 A;  3GTK H;  1A8V A;  4BA1 I;  4JI4 L;  3L7Z C;  4OO1 B;  1X55 A;  3GD7 A;  5FLM G;  2V1C C;  2WFW A;  1Q46 A;  1QVG A;  1HNZ Q;  2N78 A;  5BR8 Q;  2DGY A;  2ZJR A;  1G51 A;  2OPV A;  2ID0 A;  1FJG L;  4DUZ Q;  1JE5 A;  5C0X G;  4GN5 A;  4BA1 A;  1VQG A;  4LUZ A;  1HNX L;  4YHH Q;  3PO3 H;  1V1Q A;  2VY3 A;  3J81 j;  3M4P A;  5H1S E;  4BA2 B;  4DV4 L;  2Y0S E;  2VQF Q;  1CUK A;  1X56 A;  4DR4 Q;  5C4X H;  3J7A 5;  3CCQ A;  1C0A A;  1L0W A;  4MTN A;  3HOU G;  1GKH A;  1AE2 A;  4A3K H;  2ZM6 L;  2YTV A;  4GKK L;  4B3R L;  5M5X H;  4A4I A;  4B3S Q;  4R4I A;  4OO1 C;  4A76 A;  1YHB A;  3K7A H;  2UXB Q;  1VQ6 A;  4JI2 L;  3L0O A;  1VQI A;  2VQE Q;  3PO2 G;  2HH3 A;  1VQO A;  2IT1 A;  4PZ7 A;  2NVY H;  1UE5 A;  5IYC H;  3HOX H;  1HR0 Q;  3CCL A;  1N8R C;  4BA1 B;  1SN8 A;  4C3J H;  1V9P A;  4GLV B;  3CDI A;  3GO5 A;  2R7Z H;  3RLF A;  3HOY G;  2UUB Q;  4X65 Q;  4UP8 A;  2NN6 G;  2Q2I A;  4LF9 Q;  3OTO L;  3T1H Q;  4JI3 Q;  1HH2 P;  4KLK A;  2K14 A;  4APV A;  1SRU A;  2GN5 A;  2MNA A;  2BH2 A;  4DKA C;  2HIV A;  2NN6 E;  1M1K C;  2A19 A;  2MQH A;  1KD1 C;  1H95 A;  2KCT A;  4L5R C;  4X66 Q;  5C3E H;  1QZG A;  2BH8 A;  4LF6 Q;  4DV2 L;  3W1B A;  3M7N D;  3M85 G;  1ASY A;  3T1Y L;  2DGR A;  1L2F A;  1JB7 A;  5LMU L;  4QQB X;  1WCM H;  3BU2 A;  1XMO L;  1JJ2 A;  3HKS A;  4BBR G;  1YHQ A;  2F3I A;  2HIX A;  4LF5 Q;  1OXV A;  4DR1 Q;  1S40 A;  1DT4 A;  1QVC A;  4A93 G;  2C38 A;  1YJ9 A;  3I4O A;  1KRT A;  1PYB A;  3HKZ G;  4X64 Q;  1T9H A;  4IFD E;  1QVF A;  1EYG A;  4RMF A;  4OX9 Q;  3H3V H;  4WAN A;  3CME A;  4OXP A;  3FP9 A;  4AID A;  5IP9 G;  3J81 i;  1IBM L;  4JBJ A;  2NVQ H;  3A5U A;  3HKZ E;  1EIF A;  3I2Z A;  3AYH B;  1BKB A;  2LXJ A;  4NXM Q;  5GQO A;  3HOU H;  2VS1 A;  2P2R A;  3D0F A;  4JCV E;  5LMN Q;  3IRB A;  4A3L H;  2B29 A;  4JI5 L;  2FXQ A;  4WJ4 A;  4YWM A;  3VKE A;  1U0L A;  1BBW A;  3W5O A;  3KFU A;  2QGQ A;  5IYD H;  1WI5 A;  4X6A H;  4JBM A;  2CTJ A;  1I94 Q;  2CTK A;  3I4N H;  3G6E A;  5BR8 L;  2YU9 H;  2C38 B;  4JI6 Q;  1E3H A;  2ZJP A;  1SFO H;  2IY5 B;  2UUC Q;  3NEM A;  1VQD A;  3F2C A;  4A3I G;  1Q1B A;  3AFQ A;  1ZZK A;  4YHH L;  3HOY H;  4GN4 B;  4QGU A;  1KC8 C;  3GTQ H;  3GTP H;  1JT8 A;  4XTC S;  5C44 G;  1X6O A;  5FJ8 G;  3E9I A;  4DR7 Q;  2BL5 A;  1D7Q A;  1E7Z A;  1WOC A;  2XGT A;  4R1J A;  3I7F A;  2PO2 B;  2F4V Q;  5M3F G;  1EQQ A;  4TQU S;  4JC0 A;  1PH9 A;  1TWH H;  3J80 c;  2EXD A;  2NVX H;  3S24 A;  5C4J H;  4A3C G;  3RLO A;  4DV7 L;  4JI0 Q;  1HZA A;  3E0E A;  4LWC A;  4B3S L;  1VQE A;  2AMC B;  1YNX A;  1PH4 A;  1Z47 A;  5K36 A;  3RZO H;  3KRN A;  4X62 L;  1XNR L;  1NJI C;  1K9M C;  1HZ9 A;  1E1O A;  3I55 A;  2VQE L;  3U1K A;  3G71 A;  5C0X D;  2AHO B;  2PO1 B;  2WP8 B;  2N49 A;  3UE0 A;  1XPU A;  1I50 H;  1EIY B;  4NXN Q;  3W1G A;  4NBQ A;  3ER0 A;  4KHZ A;  1EOV A;  2UUB L;  1J5E Q;  1Y1W G;  2NN6 F;  4JI1 L;  1OXT A;  3T1H L;  4JI3 L;  1S72 A;  1C7Y A;  4A93 H;  4HID A;  4EX5 A;  5JEA A;  2JZX A;  4JI7 L;  2ATW A;  4DV0 Q;  1FL0 A;  4A3K G;  4YY3 L;  1JMC A;  4BY7 H;  1N32 Q;  1XMQ Q;  4L5T A;  2JE6 I;  1VQ5 A;  3A74 A;  1KQS A;  1YJN A;  4HJ8 A;  1LTL A;  3H15 A;  1PH2 A;  1SMX A;  1NMF A;  1X4N A;  3GCM A;  2Z6K A;  1VQP A;  3TRZ A;  4GKJ Q;  2JE6 A;  4DR2 L;  3PSI A;  1NMG A;  1ZZI A;  4LUV A;  4RG1 A;  3HOX G;  5IYB H;  4HJ9 A;  1KRS A;  1VQB A;  1GM5 A;  3G4S A;  2BA1 G;  1FVI A;  4LFB Q;  5C0X I;  5JJL A;  2R7Z G;  2NN6 D;  4IFD F;  3J81 c;  3PIO A;  1RL2 A;  1ZZJ A;  3I4M G;  4OWT B;  3GTM H;  4BA2 I;  2OQK A;  3RR5 A;  4DR1 L;  4WJ3 M;  3KJP A;  2AXY A;  2JA5 G;  4A3F H;  2CCZ A;  5C0X A;  3AFP A;  3KYH C;  1VS0 A;  1K73 C;  3PUW A;  3GTL H;  2HT1 A;  4LFA Q;  3CCU A;  2K75 A;  1VQF A;  2AWO A;  4Y7N H;  1NTG A;  1YVC A;  4BA2 A;  4A3E G;  3M85 D;  4K0K L;  5C44 H;  2R7F A;  2VW9 A;  2CTL A;  1X3F A;  5DLQ E;  1WE8 A;  5FJ8 H;  4POG A;  1I3Q H;  2C37 A;  5K36 C;  3TEH B;  1IBL Q;  4LF8 L;  4NXM L;  5HY6 A;  1PV4 A;  5M3F H;  2R92 G;  5JJK A;  1X9N A;  2K5H A;  1B70 B;  4DV5 L;  4A3C H;  1N33 Q;  1J6Q A;  2CTE A;  1HNW L;  4JG2 A;  1Y1V H;  1VCI A;  4L5Q A;  4KHP Q;  1UDO A;  5E7N A;  1KL9 A;  2Y0S G;  3S1Q H;  5JEA C;  5C0X B;  1I94 L;  4IJH A;  1E3P A;  1NE3 A;  2CWA A;  4OO1 G;  1I6H H;  2UUC L;  1N9W A;  4DUY Q;  1LUZ A;  3VDY A;  2PQU A;  2C35 B;  1OYP A;  2OPU A;  1M90 C;  2PY9 A;  1Y1W H;  3KDF B;  3NEN A;  4OWW B;  5IWA L;  4UP9 A;  4LNQ A;  1UWV A;  4DR7 L;  2C37 B;  4OO1 E;  1LYL A;  2Z6K C;  1VQA A;  3TS0 A;  1CKN A;  5AJ3 Q;  4A3D G;  1PH1 A;  4B3T Q;  1B7Y B;  3F2D A;  4IPG A;  4A3L G;  3M3Y H;  3M85 A;  1P16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...