4AIVA

Crystal structure of putative nadh-dependent nitrite reductase small subunit from mycobacterium tuberculosis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
b'DIQVWTTACAYDHLIPGRGVGVLLDDGSQVALFRLDDGSVHAVGNVDPFSGAAVMSRGIVGDRGGRAMVQSPILKQAFALDDGSCLDDPRVSVPVYPARVTPEGRIQVARVAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE NITRITE REDUCTASE [NAD(P)H] SMALL SUBUNIT NIRD
publication title Crystal Structure of Nird, the Small Subunit of the Nitrite Reductase Nirbd from Mycobacterium Tuberculosis, at 2.0 Angstrom Resolution
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 21
structure length 113
sequence length 113
ec nomenclature ec 1.6.6.4: Transferred entry: 1.7.1.4.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13806 Rieske_2 Rieske-like [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4aivA00
4PD4E 2NVFA 2CKFA 3VCPA 5AEUA 3L73E 1KB9E 1UUVA 1EG9A 2DE5D 2HMKA 5HL4A 4HM8A 2B1XA 3H1KE 1VCKA 5KLVE 1SQBE 2FYUE 4QDFA 3BCCE 4NBCD 4P1BH 3EN1A 1O7NA 3GL0A 2E74D 1G8KB 4HM4A 3L70E 1G8JB 2YIUC 2A06E 3L71E 2YFLA 4HKVA 2QJPC 2B24A 1VM9A 3AZCA 2ZYLA 4H0LD 1BCCE 2QJKC 3H1LE 4H13D 1RFSA 2FYNC 2GBXA 2Q3WA 1Q90C 3GZYA 4NBGD 4AIVA 3H1JE 1SQPE 3GCEA 3GTSA 5BOKA 3DQYA 3CXHE 2XRXA 2XSOA 4HM1A 2HMNA 2ZT9D 4H44D 1O7GA 1JM1A 3GB4A 5CXMA 3H1HE 4QURA 4AAYB 1SQVE 3GOBA 3VMGD 4NBFD 2E4QA 1NU1E 3VMID 3FOUA 4NBHD 1ULJA 2BMQA 1VF5D 3EQQA 1O7PA 4QCKA 2NUMA 4EMJB 1RIEA 2JO6A 3N0QA 1SQXE 5AEWA 3L72E 1L0LE 4HM5A 3CX5E 4PV1D 4QDCA 3H1IE 1O7HA 3GL2A 1EZVE 2IBZE 2YFJA 4NBDD 2BMRA 1O7WA 1ZRTE 2E75D 2NUKA 4P1CH 1NTZE 5KLIC 3VCAA 2I7FA 4HM7A 1WQLA 2QJYC 2HMJA 1FQTA 3CWBE 4QUPA 2XSHA 4HJLA 1NYKA 3C0DA 3GTEA 1ULIA 4NB8D 4NBED 1SQQE 2XR8A 4OGQD 1UUWA 4HM2A 2NWFA 2DE6D 4QUQA 2BCCE 1O7MA 1PPJE 4NB9D 3L74E 1SJGA 3VMHD 1NDOA 1L0NE 4NBBD 2HMLA 4QDDA 2JZAA 4QDFB 4HM0A 5KKZC 2GBWA 2YVJB 1BE3E 3GKEA 4HM6A 3L75E 2E4PA 1NTKE 2QPZA 3TGUE 2HMOA 1KYOE 2D2CD 2DE7D 2NVGA 2YFIA 3D89A 3GZXA 4HM3A 1P84E 2HMMA 2BMOA 4U3FE 4NBAD 1PP9E 2E76D 2NVEA 1NTME
chains in the Genus database with same CATH superfamily
4PD4E 2NVFA 2CKFA 3VCPA 5AEUA 3L73E 1KB9E 1UUVA 1EG9A 2DE5D 2HMKA 5HL4A 4HM8A 2B1XA 3H1KE 1VCKA 5KLVE 1SQBE 2FYUE 4QDFA 3BCCE 4NBCD 4P1BH 3EN1A 1O7NA 3GL0A 2E74D 1G8KB 4HM4A 3L70E 1G8JB 2YIUC 2A06E 3L71E 2YFLA 4HKVA 2QJPC 2B24A 1VM9A 3AZCA 2ZYLA 4H0LD 1BCCE 2QJKC 3H1LE 4H13D 1RFSA 2FYNC 2GBXA 2Q3WA 1Q90C 3GZYA 4NBGD 4AIVA 3H1JE 1SQPE 3GCEA 3GTSA 5BOKA 3DQYA 3CXHE 2XRXA 2XSOA 4HM1A 2HMNA 2ZT9D 4H44D 1O7GA 1JM1A 3GB4A 5CXMA 3H1HE 4QURA 4AAYB 1SQVE 3GOBA 3VMGD 4NBFD 2E4QA 1NU1E 3VMID 3FOUA 4NBHD 1ULJA 2BMQA 1VF5D 3EQQA 1O7PA 4QCKA 2NUMA 4EMJB 1RIEA 2JO6A 3N0QA 1SQXE 5AEWA 3L72E 1L0LE 4HM5A 3CX5E 4PV1D 4QDCA 3H1IE 1O7HA 3GL2A 1EZVE 2IBZE 2YFJA 4NBDD 2BMRA 1O7WA 1ZRTE 2E75D 2NUKA 4P1CH 1NTZE 5KLIC 3VCAA 2I7FA 4HM7A 1WQLA 2QJYC 2HMJA 1FQTA 3CWBE 4QUPA 2XSHA 4HJLA 1NYKA 3C0DA 3GTEA 1ULIA 4NB8D 4NBED 1SQQE 2XR8A 4OGQD 1UUWA 4HM2A 2NWFA 2DE6D 4QUQA 2BCCE 1O7MA 1PPJE 4NB9D 3L74E 1SJGA 3VMHD 1NDOA 1L0NE 4NBBD 2HMLA 4QDDA 2JZAA 4QDFB 4HM0A 5KKZC 2GBWA 2YVJB 1BE3E 3GKEA 4HM6A 3L75E 2E4PA 1NTKE 2QPZA 3TGUE 2HMOA 1KYOE 2D2CD 2DE7D 2NVGA 2YFIA 3D89A 3GZXA 4HM3A 1P84E 2HMMA 2BMOA 4U3FE 4NBAD 1PP9E 2E76D 2NVEA 1NTME
chains in the Genus database with same CATH topology
4PD4E 2NVFA 2CKFA 3VCPA 5AEUA 3L73E 1KB9E 1UUVA 1EG9A 2DE5D 2HMKA 5HL4A 4HM8A 2B1XA 3H1KE 1VCKA 5KLVE 1SQBE 2FYUE 4QDFA 3BCCE 4NBCD 4P1BH 3EN1A 1O7NA 3GL0A 2E74D 1G8KB 4HM4A 3L70E 1G8JB 2YIUC 2A06E 3L71E 2YFLA 4HKVA 2QJPC 2B24A 1VM9A 3AZCA 2ZYLA 4H0LD 1BCCE 2QJKC 3H1LE 4H13D 1RFSA 2FYNC 2GBXA 2Q3WA 1Q90C 3GZYA 4NBGD 4AIVA 3H1JE 1SQPE 3GCEA 3GTSA 5BOKA 3DQYA 3CXHE 2XRXA 2XSOA 4HM1A 2HMNA 2ZT9D 4H44D 1O7GA 1JM1A 3GB4A 5CXMA 3H1HE 4QURA 4AAYB 1SQVE 3GOBA 3VMGD 4NBFD 2E4QA 1NU1E 3VMID 3FOUA 4NBHD 1ULJA 2BMQA 1VF5D 3EQQA 1O7PA 4QCKA 2NUMA 4EMJB 1RIEA 2JO6A 3N0QA 1SQXE 5AEWA 3L72E 1L0LE 4HM5A 3CX5E 4PV1D 4QDCA 3H1IE 1O7HA 3GL2A 1EZVE 2IBZE 2YFJA 4NBDD 2BMRA 1O7WA 1ZRTE 2E75D 2NUKA 4P1CH 1NTZE 5KLIC 3VCAA 2I7FA 4HM7A 1WQLA 2QJYC 2HMJA 1FQTA 3CWBE 4QUPA 2XSHA 4HJLA 1NYKA 3C0DA 3GTEA 1ULIA 4NB8D 4NBED 1SQQE 2XR8A 4OGQD 1UUWA 4HM2A 2NWFA 2DE6D 4QUQA 2BCCE 1O7MA 1PPJE 4NB9D 3L74E 1SJGA 3VMHD 1NDOA 1L0NE 4NBBD 2HMLA 4QDDA 2JZAA 4QDFB 4HM0A 5KKZC 2GBWA 2YVJB 1BE3E 3GKEA 4HM6A 3L75E 2E4PA 1NTKE 2QPZA 3TGUE 2HMOA 1KYOE 2D2CD 2DE7D 2NVGA 2YFIA 3D89A 3GZXA 4HM3A 1P84E 2HMMA 2BMOA 4U3FE 4NBAD 1PP9E 2E76D 2NVEA 1NTME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PD4 E;  2NVF A;  2CKF A;  3VCP A;  5AEU A;  3L73 E;  1KB9 E;  1UUV A;  1EG9 A;  2DE5 D;  2HMK A;  5HL4 A;  4HM8 A;  2B1X A;  3H1K E;  1VCK A;  5KLV E;  1SQB E;  2FYU E;  4QDF A;  3BCC E;  4NBC D;  4P1B H;  3EN1 A;  1O7N A;  3GL0 A;  2E74 D;  1G8K B;  4HM4 A;  3L70 E;  1G8J B;  2YIU C;  2A06 E;  3L71 E;  2YFL A;  4HKV A;  2QJP C;  2B24 A;  1VM9 A;  3AZC A;  2ZYL A;  4H0L D;  1BCC E;  2QJK C;  3H1L E;  4H13 D;  1RFS A;  2FYN C;  2GBX A;  2Q3W A;  1Q90 C;  3GZY A;  4NBG D;  4AIV A;  3H1J E;  1SQP E;  3GCE A;  3GTS A;  5BOK A;  3DQY A;  3CXH E;  2XRX A;  2XSO A;  4HM1 A;  2HMN A;  2ZT9 D;  4H44 D;  1O7G A;  1JM1 A;  3GB4 A;  5CXM A;  3H1H E;  4QUR A;  4AAY B;  1SQV E;  3GOB A;  3VMG D;  4NBF D;  2E4Q A;  1NU1 E;  3VMI D;  3FOU A;  4NBH D;  1ULJ A;  2BMQ A;  1VF5 D;  3EQQ A;  1O7P A;  4QCK A;  2NUM A;  4EMJ B;  1RIE A;  2JO6 A;  3N0Q A;  1SQX E;  5AEW A;  3L72 E;  1L0L E;  4HM5 A;  3CX5 E;  4PV1 D;  4QDC A;  3H1I E;  1O7H A;  3GL2 A;  1EZV E;  2IBZ E;  2YFJ A;  4NBD D;  2BMR A;  1O7W A;  1ZRT E;  2E75 D;  2NUK A;  4P1C H;  1NTZ E;  5KLI C;  3VCA A;  2I7F A;  4HM7 A;  1WQL A;  2QJY C;  2HMJ A;  1FQT A;  3CWB E;  4QUP A;  2XSH A;  4HJL A;  1NYK A;  3C0D A;  3GTE A;  1ULI A;  4NB8 D;  4NBE D;  1SQQ E;  2XR8 A;  4OGQ D;  1UUW A;  4HM2 A;  2NWF A;  2DE6 D;  4QUQ A;  2BCC E;  1O7M A;  1PPJ E;  4NB9 D;  3L74 E;  1SJG A;  3VMH D;  1NDO A;  1L0N E;  4NBB D;  2HML A;  4QDD A;  2JZA A;  4QDF B;  4HM0 A;  5KKZ C;  2GBW A;  2YVJ B;  1BE3 E;  3GKE A;  4HM6 A;  3L75 E;  2E4P A;  1NTK E;  2QPZ A;  3TGU E;  2HMO A;  1KYO E;  2D2C D;  2DE7 D;  2NVG A;  2YFI A;  3D89 A;  3GZX A;  4HM3 A;  1P84 E;  2HMM A;  2BMO A;  4U3F E;  4NBA D;  1PP9 E;  2E76 D;  2NVE A;  1NTM E; 
#chains in the Genus database with same CATH topology
 4PD4 E;  2NVF A;  2CKF A;  3VCP A;  5AEU A;  3L73 E;  1KB9 E;  1UUV A;  1EG9 A;  2DE5 D;  2HMK A;  5HL4 A;  4HM8 A;  2B1X A;  3H1K E;  1VCK A;  5KLV E;  1SQB E;  2FYU E;  4QDF A;  3BCC E;  4NBC D;  4P1B H;  3EN1 A;  1O7N A;  3GL0 A;  2E74 D;  1G8K B;  4HM4 A;  3L70 E;  1G8J B;  2YIU C;  2A06 E;  3L71 E;  2YFL A;  4HKV A;  2QJP C;  2B24 A;  1VM9 A;  3AZC A;  2ZYL A;  4H0L D;  1BCC E;  2QJK C;  3H1L E;  4H13 D;  1RFS A;  2FYN C;  2GBX A;  2Q3W A;  1Q90 C;  3GZY A;  4NBG D;  4AIV A;  3H1J E;  1SQP E;  3GCE A;  3GTS A;  5BOK A;  3DQY A;  3CXH E;  2XRX A;  2XSO A;  4HM1 A;  2HMN A;  2ZT9 D;  4H44 D;  1O7G A;  1JM1 A;  3GB4 A;  5CXM A;  3H1H E;  4QUR A;  4AAY B;  1SQV E;  3GOB A;  3VMG D;  4NBF D;  2E4Q A;  1NU1 E;  3VMI D;  3FOU A;  4NBH D;  1ULJ A;  2BMQ A;  1VF5 D;  3EQQ A;  1O7P A;  4QCK A;  2NUM A;  4EMJ B;  1RIE A;  2JO6 A;  3N0Q A;  1SQX E;  5AEW A;  3L72 E;  1L0L E;  4HM5 A;  3CX5 E;  4PV1 D;  4QDC A;  3H1I E;  1O7H A;  3GL2 A;  1EZV E;  2IBZ E;  2YFJ A;  4NBD D;  2BMR A;  1O7W A;  1ZRT E;  2E75 D;  2NUK A;  4P1C H;  1NTZ E;  5KLI C;  3VCA A;  2I7F A;  4HM7 A;  1WQL A;  2QJY C;  2HMJ A;  1FQT A;  3CWB E;  4QUP A;  2XSH A;  4HJL A;  1NYK A;  3C0D A;  3GTE A;  1ULI A;  4NB8 D;  4NBE D;  1SQQ E;  2XR8 A;  4OGQ D;  1UUW A;  4HM2 A;  2NWF A;  2DE6 D;  4QUQ A;  2BCC E;  1O7M A;  1PPJ E;  4NB9 D;  3L74 E;  1SJG A;  3VMH D;  1NDO A;  1L0N E;  4NBB D;  2HML A;  4QDD A;  2JZA A;  4QDF B;  4HM0 A;  5KKZ C;  2GBW A;  2YVJ B;  1BE3 E;  3GKE A;  4HM6 A;  3L75 E;  2E4P A;  1NTK E;  2QPZ A;  3TGU E;  2HMO A;  1KYO E;  2D2C D;  2DE7 D;  2NVG A;  2YFI A;  3D89 A;  3GZX A;  4HM3 A;  1P84 E;  2HMM A;  2BMO A;  4U3F E;  4NBA D;  1PP9 E;  2E76 D;  2NVE A;  1NTM E; 
#chains in the Genus database with same CATH homology
 4PD4 E;  2NVF A;  2CKF A;  3VCP A;  5AEU A;  3L73 E;  1KB9 E;  1UUV A;  1EG9 A;  2DE5 D;  2HMK A;  5HL4 A;  4HM8 A;  2B1X A;  3H1K E;  1VCK A;  5KLV E;  1SQB E;  2FYU E;  4QDF A;  3BCC E;  4NBC D;  4P1B H;  3EN1 A;  1O7N A;  3GL0 A;  2E74 D;  1G8K B;  4HM4 A;  3L70 E;  1G8J B;  2YIU C;  2A06 E;  3L71 E;  2YFL A;  4HKV A;  2QJP C;  2B24 A;  1VM9 A;  3AZC A;  2ZYL A;  4H0L D;  1BCC E;  2QJK C;  3H1L E;  4H13 D;  1RFS A;  2FYN C;  2GBX A;  2Q3W A;  1Q90 C;  3GZY A;  4NBG D;  4AIV A;  3H1J E;  1SQP E;  3GCE A;  3GTS A;  5BOK A;  3DQY A;  3CXH E;  2XRX A;  2XSO A;  4HM1 A;  2HMN A;  2ZT9 D;  4H44 D;  1O7G A;  1JM1 A;  3GB4 A;  5CXM A;  3H1H E;  4QUR A;  4AAY B;  1SQV E;  3GOB A;  3VMG D;  4NBF D;  2E4Q A;  1NU1 E;  3VMI D;  3FOU A;  4NBH D;  1ULJ A;  2BMQ A;  1VF5 D;  3EQQ A;  1O7P A;  4QCK A;  2NUM A;  4EMJ B;  1RIE A;  2JO6 A;  3N0Q A;  1SQX E;  5AEW A;  3L72 E;  1L0L E;  4HM5 A;  3CX5 E;  4PV1 D;  4QDC A;  3H1I E;  1O7H A;  3GL2 A;  1EZV E;  2IBZ E;  2YFJ A;  4NBD D;  2BMR A;  1O7W A;  1ZRT E;  2E75 D;  2NUK A;  4P1C H;  1NTZ E;  5KLI C;  3VCA A;  2I7F A;  4HM7 A;  1WQL A;  2QJY C;  2HMJ A;  1FQT A;  3CWB E;  4QUP A;  2XSH A;  4HJL A;  1NYK A;  3C0D A;  3GTE A;  1ULI A;  4NB8 D;  4NBE D;  1SQQ E;  2XR8 A;  4OGQ D;  1UUW A;  4HM2 A;  2NWF A;  2DE6 D;  4QUQ A;  2BCC E;  1O7M A;  1PPJ E;  4NB9 D;  3L74 E;  1SJG A;  3VMH D;  1NDO A;  1L0N E;  4NBB D;  2HML A;  4QDD A;  2JZA A;  4QDF B;  4HM0 A;  5KKZ C;  2GBW A;  2YVJ B;  1BE3 E;  3GKE A;  4HM6 A;  3L75 E;  2E4P A;  1NTK E;  2QPZ A;  3TGU E;  2HMO A;  1KYO E;  2D2C D;  2DE7 D;  2NVG A;  2YFI A;  3D89 A;  3GZX A;  4HM3 A;  1P84 E;  2HMM A;  2BMO A;  4U3F E;  4NBA D;  1PP9 E;  2E76 D;  2NVE A;  1NTM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...