4AJ1A

Rat ldha in complex with n-(2-(methylamino)-1,3-benzothiazol-6-yl) acetamide
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
330
structure length
327
Chain Sequence
ALKDQLIVNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
total genus 123
structure length 327
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4aj1A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4aj1A02
3GRPA 3ZWWA 1VI2A 1LI4A 4FD3A 1M66A 3CINA 1HE5A 1MLDA 2VHXA 2VWQA 1F14A 3WB9A 1PTJA 3W8FA 4MP6A 2D8AA 4R1NA 3FF4A 3KYDA 5TSDA 1W8DA 3ENKA 4CMCA 1DC5A 4Q3CA 1YDWA 4CM9D 1UXHA 1R0KA 3C8MA 4R41A 3PPIA 4TSKA 2GN4A 2DKNA 3D1LA 3H3JA 3JD4A 4J7CA 1BWSA 2GNAA 5U4QA 2ZTMA 1CQJA 1E0DA 1YBMA 2PTGA 1ORRA 3DOJA 4LISA 1LLQA 1UXKA 4ND3A 3HHPA 1NQ5A 4Z0TA 4MVJG 1ONNA 5L45A 3JTMA 4RPHA 3ZHYA 4S3MA 3ON5A 2I67A 1ISGA 2WWRA 4N54A 1Y7TA 2C0CA 3KSUA 1AXEA 3EDMA 3OQ6A 4WJZA 1NTOA 3FRJA 2O2SA 2OL4A 2YYYA 2X9GA 2GZ2A 4OM8A 4BNXA 3BHMA 1DC6A 1H6BA 1NQAO 3WJ7A 2TMGA 3AM3A 1DB3A 1FXSA 4ALNA 1YWGO 3C7CB 1FDSA 4UAGA 3EZYA 4CLRA 3GQVA 3L4SO 3V2UA 1AUPA 2H63A 5ADHA 2NVWA 3BMQB 1AGNA 4RVSA 2VN8A 3U3XA 2O3SA 4RDIA 3VTZA 5G4KA 1JA9A 2F00A 2BMAA 4E32A 2G0TA 3CE6A 1UJMA 3QE3A 5EMHA 4J9UE 4ZICA 3DMTC 4WCFA 5F21A 2PA3A 3INTA 2VRCD 2AE2A 1N7HA 4FN4A 3EMKA 3RIHA 4RPLA 1IULA 2X5OA 3ZWXA 1XEAA 4XKJA 4CMGA 2IZ1A 1I2ZA 5I7FA 4BNHA 4J7XA 2OBYA 3LC7O 3NEPX 3K73O 3UCEA 1WPQA 2UUOA 4RF2A 4FQ8A 3UGKA 5ICMA 4J4TA 4GMFA 4ZHSA 2DUWA 4J1SA 3WGQA 3OIFA 1LDMA 4I5FA 2PKRA 2YQ5A 1ISJA 1EE9A 5IDYA 1BDMA 1YS4A 4L9RA 1PR9A 3IP3A 1Z7BA 4FW8A 5KJ1A 1OAAA 3WSVA 2HJSA 4XRGA 1HYHA 3CZRA 3FR8A 1BGVA 3K2BA 4IJUA 1UP7A 1F0YA 2BKAA 5G0TA 3RC2A 2ZTUA 3VH3A 4NBRA 2I99A 4OOFA 3VC7A 1KEPA 4CUKA 3LT4A 4X54A 2CDAA 3INGA 1QSGA 2CMDA 1HDYA 2G17A 1R4MB 4K28A 4IPTA 2GERA 1YL7A 2QZZA 1HT0A 1Q7CA 3QHAA 3W8EA 1Z82A 5CEJA 2D3TA 3G49A 4GX5A 5ILGA 4JLWA 1YB5A 4Y98A 5BR7A 3PYLA 4HV4A 1ADFA 4D43A 4F6CA 1PJTA 3GZNA 2EHDA 2B4TO 3FHLA 4YR9A 2VQ3A 1XHLA 3GMSA 3KTDA 1NYTA 3DHYA 4H7PA 4IDGA 5THKA 4JJIA 3RBXA 5I9NA 5KIAA 1B8UA 1JWBB 4JGBA 5COBA 5DDIP 1Q1NA 5ES3A 3ZNQA 5DCYA 4DIBA 1LXCA 2WSBA 4IDDA 5DCWA 3ZU4A 4YBZA 1ENOA 1P45A 1C3VA 1MC5A 1JW9B 2NNLD 2BFAA 3ZN2A 1Z74A 4BNYA 2FP4A 4M8SA 4CODB 5CEFA 1D3AA 1VJTA 3M2PA 3I9OA 1PWXA 3H5NA 1RPNA 1E1KA 3LQFA 4AJ4A 3R6DA 3GGGA 1EVJA 5U1PA 2CD9A 3HJAA 3LT1A 1XSEA 2VZ8A 2E48A 5CP8A 2VT3A 4BMVA 4PGFA 1D1TA 4TKMA 3Q1LA 4UVHA 3V1UA 4MDHA 3OA2A 3SLGA 1DLJA 3KB6A 3KEOA 3ZZNA 1IPEA 4OO3A 2WYVA 4XGKA 3IIEA 5JY1A 2CDCA 3AWDA 1LRLA 1QG6A 2GRAA 4R3NA 5CDUA 3GZNB 4QT0A 1LBEA 4RF4A 4MIOA 3DAGA 4O63O 1U4SA 3HDJA 3PTZA 4LN1A 4ALIA 2D1YA 2FPGA 3GG9A 1GAEO 2EERA 1U5AA 2AEMA 4OGWA 3LC2O 4U6QA 4FDAA 2B36A 5A1TA 1MP0A 3NTQA 4A7PA 3E9NA 3UAGA 1ISIA 4NMHA 4OXYA 3X2FA 3PQEA 4MP8A 3MEQA 5JAQA 3VPHA 1H94A 3GN1A 3ZWCA 2BFOA 4EEZA 4KZPA 3R3SA 2A92A 4PLTA 3QVSA 3OJFA 4E2XA 3HZZA 2UDPA 4N7RA 2BRUA 5CDYA 1UZNA 3K8ZA 4XR9A 3GFGA 1Y8QA 3IKVA 3U62A 4H16A 5KVVA 1PU2A 1PIWA 3ZH2A 1E77A 1P74A 2H9IA 4XGNA 1UP4A 1M75A 4UUMA 1NR7A 1NWHA 1VJ1A 1X13A 2GSDA 3UXYA 4ZN6A 4ZQBA 5JE8A 2V6FA 1SB9A 1T1RA 5L4LA 2P9EA 4NK4A 4BS9A 5EQDA 3PHJA 2VHVA 3TFOA 5EQFA 5I8ZA 3NJ4A 3WLEA 3U5TA 4YQZA 1IHXA 5IZ4A 4DPLA 1SNYA 3OQ1A 2VYNA 4K9DA 1CF2O 3PHGA 1LDEA 4JXKA 1X15A 4YRDA 4R68A 3WDSA 1RYDA 1BW9B 3L0DA 1E1NA 1EFLA 4WUVA 3D3EA 5LDHA 4R4JA 1PJBA 4D41A 4IDFA 1NFQA 4BNFA 1HDCA 3FNEA 2W2KA 3VH1A 3RI3A 4LCEA 1GUFA 1PWZA 1SOWA 2OORA 1ULUA 2PD6A 4QX6A 4FC7A 1R4MA 1GEGA 1QORA 3O03A 4W9NA 2A9FA 3VPGA 4DTIA 4U8GA 4G81A 4YCAA 4CM4A 2Q4BA 3PLNA 4XQ9A 3CEAA 2RBEA 1G0OA 3CUKA 5JO9A 4BGIA 3D5QA 1MFZA 4GI2A 3ZWYA 3RKUA 3OHSX 3P7MA 3OJ0A 1MG0A 5DULA 2HLPA 5AYVA 1BSVA 4GKBA 1MV8A 3TZKA 3GGPA 5B37A 3PGXA 4E5MA 3WSWA 1GYQA 2E6UX 4G65A 2AMFA 3LT2A 1ENZA 2I3GA 5J23A 1UXGA 4IDAA 4U5QA 3KUXA 3PK0A 4GKVA 2PWZA 4AJ2A 3PGJA 3UKOA 4OL9A 2AXQA 3EVTA 4FPXA 4IIUA 1N2SA 4J90A 4BB5A 1E3WB 1GEEA 3KEQA 4FFLA 3E1KA 4R5MA 4OMUA 1X0XA 4CM7A 3S2FA 4CL3A 4LSWA 2VT2A 3K6JA 3RBVA 4E12A 4BNGA 1DRVA 1YONA 1DFGA 2Q45A 3TFQA 5EIOA 3LF2A 1PJ4A 5BSEA 1I0ZA 3G1UA 3GPDG 3S2IA 3LYLA 5HWSA 3TQHA 1V9LA 3E5MA 3N58A 4KWHA 2B37A 1GV0A 1EBUA 3PDUA 3UICA 4YT4A 4TZTA 2WDZA 4GH5A 3QVTA 3VZPA 3MTJA 4BNUA 3DMYA 3Q11A 4B79A 1E7SA 1YDEA 1V3VA 3HG7A 1OC4A 2DC1A 3GR6A 4J43A 1ZJZA 3AU8A 4ND5A 4IQ0A 1NFRA 4I08A 2FHSA 4QXMA 1HTBA 5FFFA 2D4AA 4ILKA 1LSOA 4QUKA 4YAJA 1GCUA 2VUUA 1E7YA 3GY0A 3JYNA 4E21A 3RSHA 1FF9A 4E0BA 2J3IA 5A02A 1IHYA 2VOEA 3JYQA 1E6WA 2QRLA 1L7EA 5IDQA 1X7GA 1YRLA 1NX6A 1PGPA 3W6UA 1Z6ZA 2FR1A 2BLLA 2GGSA 1CETA 3D4NA 3FWNA 3QWIA 1NAIA 4CV2A 4ND1A 1DIGA 4JBGA 5GZ6A 1XQ6A 3RC7A 4LVCA 4B8ZA 2J3KA 4P8RA 4CLOB 4CMHA 4B3JA 5G0UA 5IN5A 5C7IO 1E3EA 2I66A 3GVCA 5CDSA 4O59O 1T4DA 2NTVA 2W90A 1WAMA 3ONDA 1XIVA 1J4AA 2I5PO 3V5NA 1RYEA 3LU1A 4ZJUA 1E1LA 4D79A 3FBTA 1PGJA 3GDGA 4PLYA 3WYCA 1D1SA 5CPFA 4OSPA 1BTOA 2ZB7A 3QJ5A 3PHLA 5KVCA 2VHWA 3D4OA 3D3WA 3QY9A 1R16A 4Y8VA 2NSDA 3A14A 4HWKA 2W2KB 2Y0CA 4FFNA 3WGHA 1EDZA 1U28A 2D5CA 5I7SA 4P4NA 1MFPA 2OBNA 3L9XA 3RJ5A 1ENPA 2VNAA 5GY7A 3RFTA 2DUUA 1Y9EA 3JQ7A 4FIZA 3I9NA 1T2CA 4PG6A 2IEBA 3RUHA 7ADHA 4U7WA 1P1HA 2EGGA 4GL4A 5FI3A 1VL0A 4GLOA 3PFFA 3WIDA 1EVZA 3I9KA 3L77A 3ONEA 1P1KA 1SO8A 4R1UA 2X9NA 1HETA 5DNAA 4CR8A 2YZ7A 3BZUA 4FOOA 2X5JO 3HQ4O 3F46A 2IYOA 3E82A 3GF4A 1EK5A 1H2BA 3P19A 1ISMA 1ZMTA 3ROQA 4RL6A 2X1HA 2DPGA 4CMEA 1P0FA 3FN4A 5EL0A 4BIIA 5BSHA 5KJEA 3FNHA 4I9NA 1Q2XA 4WEQA 4DC0A 4EYEA 4NNJA 2GF2A 3BA1A 4RGBA 3VPFA 5A3VA 1ZSVA 3U4CA 3QVXA 3RU9A 1HDRA 4PLGA 3FBGA 2Q49A 2O3RA 4LCJA 3U4IA 3G0OA 3PP8A 2BELA 1VE9A 2JD2A 2PKQO 1J0XO 2NU9A 1RM4A 4J2HA 2EJWA 1ZZEA 1LSUA 3JD2A 1IOLA 4CLEA 2ZYDA 1BXZA 3ZDFA 1IY8A 4OHUA 3F5QA 4A26A 4LSMA 6ADHA 4J0FA 5KWEA 3QWAA 1A7KA 3JD1A 4JNKA 3TF5A 2YHIB 3OICA 3JQ7B 2V65A 1KVQA 3GGOA 3JV7A 3N7UA 3GDFA 1I3LA 1DJQA 5T5QA 3KSZO 5G0SA 3H9UA 1I32A 4UUOA 1W6UA 1E1MA 4W9NC 3RUEA 1XCBA 3LLVA 1C0PA 4NJOA 4J2OA 3F1KA 3R1IA 2Q1TA 2YV2A 1PJLA 5AXCA 3RVDA 4J6FA 1ADBA 1BVUA 2PGJA 3A06A 2OXIA 1H2HA 5C37A 4MJLA 3PDJA 3GUCA 2WYWA 2P91A 3DAFA 4URFA 9LDTA 3QVWA 3DZGA 3GEGA 4J91A 1P1RA 2OFPA 4DC1A 2HMSA 3LF1A 4GSKA 4M49A 4XYEA 3AI2A 5EJ2A 1YOVB 4AL4A 3NDJA 2OO5A 3DEYX 3JD3A 4E4YA 1E92A 2O48X 2VRCA 2I76A 4D0SA 3G79A 3MCVA 3VH2A 4GBJA 1ZSYA 4FFMA 3PJDA 1XLTA 5DBIA 3DL2A 4BKUA 1PS8A 3EGOA 4CLHA 5KOIA 3NAQA 5A03A 1N7GA 3KETA 3RQSA 4WLOA 3WLFA 1HRDA 1EUZA 1ADCA 1QV6A 3A4VA 4II2A 4YJGB 3L6OO 2DTDA 2PR2A 3AOEC 2CF5A 2FY8A 3OEWA 1C0KA 3VZQA 2DLDA 3PYXA 3JQFC 4Z9YA 4DPMA 3ORFA 1H9BA 3KLMX 4MVJE 4BO3A 3GEMA 2ZCUA 3CPSA 3HE3A 3ZWMA 1YB4A 4DUPA 1R0LA 2O4UX 2Y05A 1PS9A 2ZQZA 4U0KA 4Z3DA 4BO0A 4NQZA 5JAMA 1N1GA 5L51A 2PKQP 2NWQA 1GDHA 4KMSA 1VL6A 4UEKA 2EGHA 4EJMA 4DA9A 5IAAA 2VWPA 4DQVA 2Y1FA 3EW7A 1HLDA 4XYBA 1S6YA 4D3DA 8LDHA 3NX4A 1T2FA 2Y67A 2FPIA 1HEUA 1W4ZA 2C20A 5AXAA 3IC5A 3F4LA 4UVDA 1IPFA 2HMUA 5JC8A 1X7HA 2WD7B 1HDOA 2HK9A 1T2AA 3GNTA 5JCJA 4CM8B 1VSVA 2XXBA 1R37A 2IZ0A 3ZU2A 5KNLA 4W4TA 4QECA 4YAGA 1I33A 3OIDA 1CWUA 1GQ2A 2YHIA 3WGIA 3DBHA 1DIAA 4WLEA 2CFCA 3ANLA 1TT5A 3CMCO 4J3FA 4MVJD 4A73A 5I7VA 3GK3A 4YT8A 1E7WA 2ZQYA 3VAZA 2PH5A 1HZJA 1AXGA 1YB1A 4UUNA 3SC4A 3U4DA 3JSAA 4U6SA 4ALKA 3ULKA 1TA4A 2NV6A 3PYMA 1FMCA 1ZK3A 2NVUB 5K0ZA 3VDRA 1DIBA 4XGIA 2IEDA 2DVMA 4AVYA 1JKJA 5I9MA 2AE1A 2DM6A 2BFMA 2GZ3A 5A5FA 3K2EA 5L4SA 1HSZA 5A9RA 1TVEA 1YBAA 2YJZA 4PFJA 2EP7A 1V35A 1G0NA 5BQFA 3PQDA 1O94A 2ZTLA 4I1IA 3CMMA 3LDHA 4XYLA 1QYVA 5L40A 3Q9UA 3SXPA 3ENNA 4Q9NA 1OFGA 1U3UA 1QYCA 1A9YA 4L75A 1JKIA 4TRMA 1JKFA 4YACA 3HFSA 2UAGA 1KEUA 3JYOA 3WICA 1PZGA 3JQAD 4YAEA 4PN3A 4D7AA 4E5YA 5TT0A 1C0LA 3BMNB 2Q2QA 1QLJA 1OBFO 3WNVA 2EP5A 4KDFA 4LMRA 5ENVA 2YQ4A 1B3RA 1YO6A 1B3BA 1I5RA 3BTUA 3MOGA 3I1JA 4PLCA 3QRWA 1F8FA 3I9JA 4ZQGA 4W99A 3H2ZA 4P4LA 4DBZA 2CSUA 3C7DB 2HJRA 4ZQEA 3AU9A 1RM0A 3DC2A 2RIRA 3ZGYA 4TROA 4GPD1 5L7TA 1UZLA 4Z9FA 4NU5A 4K6CA 1EMDA 1KIFA 3P5SA 1DC3A 1F17A 2NQTA 4OKNA 3SX2A 4NG5A 1BDBA 1CRWG 5COAA 1MC4A 1FK8A 5DF1A 3MOIA 4IINA 3AUSA 1IE3A 2QRKA 5C7LO 3JQCA 5K9ZA 4YJHA 3KV3O 3SLKA 3QSGA 3BTOA 3WQRA 3Q9NA 1VKNA 1TT7A 2HU2A 1N9GB 3IS3A 5DBFA 1CQIA 3PIIA 3QA9A 9LDBA 5IDWA 4FBGA 3WQQA 1WDKA 1GZ6A 5CG2A 1X1EA 3ST7A 2JFFA 3EC7A 2GDZA 3H9JA 1Z75A 1R4NA 4QFCA 4NBUA 1XGKA 3KZVA 4XB1A 2DBZA 2YHUA 1H0KA 3FSRA 3EK2A 2DAPA 2PGDA 1QMGA 2XOXA 4RF3A 4KP7A 3BMCA 3S2EA 1YVEI 1DRUA 1QV7A 3GVXA 2Y1CA 1GL3A 1PQWA 3HDQA 3PWSA 4PG7A 4PCVA 4CM6A 3EHEA 3LT0A 3DBVO 5L53A 3E6AA 4MP3A 4BNTA 3F3SA 4A5OA 3L07A 3EUWA 4W7HA 5IJZA 5JAZA 2OP1A 2CVOA 4KQXA 1NWCA 3H65A 3WGGA 3OFSA 4UREA 1PJCA 4D45A 3H9EO 5JC1A 6LDHA 1R12A 1WWKA 2YFQA 3WJAA 1C14A 2VWHA 2DBQA 1BMDA 1YJ8A 1AHIA 4J7UA 2EF1A 4Y6PA 4BGEA 1H6CA 5A3JA 4HFJA 3H2SA 2NQ8A 1N9GA 1ZKMA 4M55A 3GVPA 1B15A 4IGFA 1MXHA 3L6DA 1OZAA 1QYXA 1I2CA 2X4GA 2J3JA 3CXRA 5IDXA 3AUTA 3DR3A 4B4WA 2X5KO 1U8XX 3JQBC 5H82A 3OP4A 4EDFA 5CDGA 4OSOA 3WYEA 4LRTB 1KVTA 3CTMA 4ZQFA 1U3WA 3ZV6A 3NDIA 4XJSA 3WTBA 1EQUA 1V6AA 4ALMA 1ADGA 2O4CA 4YJDA 2FPPA 4GVLA 1KC3A 4WLUA 4BNKA 3GG2A 2A4KA 4INAA 1PQUA 1HXHA 4UULA 1NPTO 1ML3A 2X0JA 3GNSA 4OIMA 4FCCA 4WEOA 2UUPA 3MTGA 1DSSG 1PX0A 3W4KA 3IJPA 2O50A 4FOSA 5HTOA 5JDIC 3GH3A 4ZRNA 3PWKA 4RVUA 1T2DA 2NU6A 3MJTA 2GN6A 1YKFA 5CAEA 4B3HA 1VJ0A 2AW5A 1WXDA 1B8VA 2BD0A 1NQOA 2W2LD 3BYZA 4PRLA 3AM4A 4OOEA 5AQ1A 1NXQA 3BHIA 1LA2A 3UOGA 1PJSA 5BSFA 3GT0A 3VDQA 1V0JA 1VM6A 1NAHA 1ZO8A 4XDYA 5G0VA 5CFZA 2OP0A 5TC4A 3WYBA 1P44A 3ASUA 3I9MA 2QIOA 1EDOA 2VHYA 2YV3A 3ETEA 4W82A 2C7VA 3I6IA 3WMXA 4CUJA 1UDAA 1GZ4A 4HFRA 4NJMA 5TRTA 3H5AA 2G1UA 1TLTA 1SEPA 5JYEA 3GUYA 2PLAA 4PRKA 4ND4A 4IDEA 4HNGA 4NPCA 1DEHA 5K6AC 5AOVA 4MIYA 1E5QA 4FFRA 1P77A 4WKGA 4NFYA 1E6EA 1LDGA 3CZMA 4LMPA 3TL3A 1EK6A 1E7MA 1DJNA 2DQ4A 5L95A 1G6KA 2ET6A 3H9GA 4W6ZA 3GA0A 4A2CA 4J49A 1I36A 1VC2A 3ZNNA 2ZB8A 1M67A 2HO5A 3AW9A 2Y1EA 3OQBA 2PZKA 1SEVA 5DP1A 4WNCA 2ZYGA 5ICSA 2GO1A 1DDOA 3JQFA 2POQX 2DFDA 4NDNE 2ZATA 3TZQA 2QW8A 1F06A 3IOYA 3F6YA 4PG4A 4CM8A 4YT2A 3PXXA 5IXYA 2X58A 4CR7A 4AG3A 2Q99A 4KUGA 3OA0A 1F12A 4YJFA 1QLHA 4UVGA 3JCZA 4RVFA 4RJTA 2QQ5A 3IKTA 3NRCA 4Q3NA 1EVYA 1VRWA 1YE3A 4BUCA 3B70A 2W2LA 1ISHA 5DOVA 5AXDA 3O4RA 1RM3A 4YEDA 4ZQHA 3WGOA 3DMTA 1EZ4A 4J9VA 2B83A 3STHA 5IF3A 3I23A 4IXTA 1BG6A 4E5NA 4PZDA 2JHFA 3ANMA 4BOYA 2HMTA 4UVIA 2QYSA 3RU7A 4ZGWA 3S2GA 4L73A 1YBVA 2BF7A 4YPOA 3DZFA 4FB5A 5B4TA 3G1TA 3GVHA 4IXWA 1X0VA 2B5VA 4XYGA 4D44A 1U7HA 2RCYA 2B5WA 4RDHA 1PGOA 1KEVA 4Y9DA 2D0IA 4J0EA 4YXFA 4YAIA 3TWOA 1HL3A 4LVUA 4GGOA 3PIDA 3E48A 4KOAA 2X0IA 1HZZA 3AFMA 4CQLB 4EUFA 4CLOA 1HWYA 2O23A 2PD4A 1CERA 1PR3A 3HDYA 4NJMB 5GZ1A 3AUUA 4OAQA 1Z45A 4W7IA 3RFVA 3AOEA 1K0UA 4BMNA 3ZW9A 4PG5A 5C7OO 5G2OA 4J4HA 1PL7A 5CG1A 3GPIA 2Q50A 1FJHA 4PVCA 1LQUA 4WCDA 2HK7A 1T1SA 1QR6A 1ID1A 1VLLA 4CM5A 4TRJA 5A9TA 1H93A 3SJ7A 4JBIA 1SMKA 2WD7A 5IG2A 1JAXA 2X9VA 3ITKA 2XPCA 2IZZA 3JQEA 3OSUA 4HX5A 4IGEA 4OYRA 3CH6A 1DC4A 4I9UA 3T4XA 4CV3A 2J6IA 4IMRA 1LC0A 3DTYA 4BO5A 1IYZA 1EUCA 4EGFA 4OJNA 1C1XA 5T8KA 4NR0A 2Y66A 3NGXA 1IZ0A 3RAJA 4B4OA 5EERA 1E3WA 4B4VA 1SOVA 2VYVA 2NVBA 5KKCA 4DQUA 3H7AA 1NPYA 1NFFA 2P4QA 1SB8A 2WEKA 2XXJA 4F3YA 4S1VA 4CM9A 1MA0A 2PY6A 4NH4A 4BV8A 3VZRA 4IY1A 3QV1A 2GZ1A 4XRRA 5TGDA 1GYPA 4MVJF 4EEXA 2ZJ0A 2EV9A 1B0AA 4FC6A 4EUEA 3M1AA 1UP6A 3S1LA 4CMAA 1GUYA 4R9SA 4BNNA 2X7HA 2UVDA 4R1TA 2OUIA 1U1IA 1LSJA 1TT5B 3RASA 4RPGA 1T2EA 3MWDB 2I3AA 5ER9A 3TOXA 5JFOA 4AJKA 1NHWA 4XZ3A 1NASA 1LNQA 4KTTE 2X8LA 3IP1A 5B12A 3IDSA 1MG5A 1FDVA 3RD5A 1K6JA 4HY3A 3WOHA 1M6HA 4FJ2A 3ZNPA 3UCFA 2J5KA 2I65A 3VVCA 2P4HX 1K3TA 4Z0HO 4Q3DA 3HDHA 2IODA 3EY4A 3QQPA 4LGVA 4WOJA 2VTDA 2VZ0A 3M2TA 3P2YA 4R3WA 5JNLA 5DN9A 3HUDA 3D4PA 2Q1WA 2V7PA 1I2BA 1ENYA 3LZ6A 2O3UA 5ENDA 5IZCA 2AQHA 5A9SB 3C1OA 1PZHA 3WWYA 1B16A 1O9BA 5EESA 3NT4A 5FEUA 3DBLB 1UR5A 3Q6IA 1SZJG 1A72A 3K31A 3WG9A 2NUAA 4RQUA 2ZCVA 1YL5A 3W4JA 3WIEA 3Q0EA 1LC3A 3W4IA 1XU9A 1Y8RB 3PLRA 5JDCC 1A9ZA 4PZCA 3WFIA 5DBGA 1I24A 3JQ9C 3WR5A 3UH1A 1XA0A 4JP3A 2GD1O 1NP3A 4DXHA 4HP8A 3JQBA 1ZK4A 2B4RO 3TOZA 4XR4A 2TMDA 2P68A 4HFMA 4XIYA 4RZIA 4JROA 4BGUA 1UXJA 4D3FA 5FF9A 4XWYA 4IQ8A 1GQYA 4R69A 2JAHA 3ONFA 3DHEA 2HRZA 1WW8A 2JCXA 2NM0A 1O8CA 1H9AA 5F5NA 4E6PA 3AI3A 3HNPA 2VYVD 1D7OA 2RH8A 5ITWA 2IXAA 4IIVA 3GMDA 4XDZA 4Y67A 2X23A 4MKZA 1F8GA 4LRSB 3VTFA 4D46A 1LU9A 1XKQA 5BNFA 2O3QA 2JD1A 2GCGA 3JQ8B 4N5MA 2W98A 2VWGA 3KRTA 4TMFA 1PL6A 3TSCA 4D3SA 3WWZA 1Y5MA 2VTEA 2HK8A 3KYCB 1N5DA 1ZIDA 4ALJA 4E2YA 3C1TA 2PZJA 3GOHA 2FZEA 3TZHA 2FMUA 2ZK7A 4MVJM 3DB2A 3P2OA 1I8TA 1RKXA 4IMPA 5A05A 1BVRA 5FWNA 4E30A 2WJPA 5BNTA 3LC1O 1AHHA 4C4OA 2DBRA 3OECA 4H15A 5BSGA 1WMBA 5TQVA 3ETDA 4B7CA 4Q39A 1ONOA 3V1TC 3PRJA 1C1XB 2J3HA 3I5MA 3V1YA 3PEFA 1LDYA 4H3VA 5JW6A 4DGSA 4Z6KA 1ZSNA 2JFHA 3UFXA 3ANNA 4OQYA 5A9SA 3M6IA 3D64A 2C2YA 3FWZA 1NQTA 1A71A 3FCOA 4DPKA 3AY7A 3A1NA 3C24A 4HADA 4XJTA 1C0IA 3ZHBA 4M54A 1ZEJA 2FWMX 4EJ6A 1O6ZA 3NDRA 3WGYA 2Y1GA 3MZ0A 1ZK0A 1V3TA 4ZD6A 1C1DA 3NTOA 4AJHA 3TN7A 4BQRA 1FDUA 4I8XA 4IDBA 1ZMOA 3ASVA 1M6WA 3W6ZA 1U3VA 3R3JA 1HDGO 2Y1DA 5THQA 4AICA 5HM8A 4L8VA 4QQRA 4RPKA 4ZA2A 4DVJA 1SAYA 4L0QA 4OKIA 5KJCA 2C5AA 3SBOA 4R51A 4TVBA 3HADA 3IQDB 2JKVA 5IZCC 2VCYA 3QWBA 2C2XA 2OGUA 5B4UA 1LLUA 4BNLA 1SC6A 4JK3A 3TZ6A 4AJJA 1EBFA 2OOSA 4IZIA 3W1VA 3HWRA 1ZVMA 1MUUA 4BGVA 3KYBA 3GHYA 3NUGA 3ABIA 1WMAA 1B8PA 3BAZA 2ZIZA 4RLHA 3GZ4A 2BHLA 4QO7A 4CV1A 3JQ6A 1J49A 1L1FA 4EITA 4PG8A 5L7YA 3A28A 3GDOA 1NVGA 1N92A 5T6BA 3UW3A 3PFWO 3DZKA 1JLLA 4CLXA 2CY0A 2XAAA 4FJ0A 1H6AA 4P22A 5F5LA 2ZJ1A 4O0LA 1XWFA 2DT5A 2O3TA 5LDGA 1LQTA 4MVJI 2VZ9A 3BMNA 2JCVA 1Y6JA 5G0WA 3NJ8A 1KVUA 1NHGA 3ROMA 4BO2A 4DLAA 1AN9A 3RFXA 1XYGA 4R54A 1KETA 1UH5A 3DBLA 3IMFA 2FSVA 4IJKA 2JAPA 4CR6A 2AQ8A 4C7JA 5TNXA 3WX0A 4BO1A 4FJ1A 1MX3A 1J6UA 1OOEA 2BFPA 3EVNA 3EYWA 4P4GA 2CNBA 3DFZA 1AE1A 5C5IA 4FGSA 3OBBA 4XQCA 3RC9A 4RV9A 4QTZA 4NBTA 2HDHA 5AVOA 1O95A 2FZWA 4NZ9A 3O38A 3OEYA 1BXKA 4WLNA 3MJEA 5JXWA 3FTNA 4YWJA 4PLZA 1I3NA 2Z95A 2FN7A 4IJWA 1TB4A 3RCBA 1JTVA 1O89A 1EEHA 2XF8A 4Y6SA 4J1QA 2JJYA 4Q3AA 5JY6A 2J8ZA 4U0JA 3PJGA 4NFHA 3WBBA 2YW9A 5ITVA 3IJRA 3NYWA 2F1KA 3ZHZA 3SC6A 4RCVA 5DOZA 1GD1O 4YJGA 1ZJYA 3CKYA 3OM9A 3RROA 1CIVA 3GHHA 3RUCA 4XQEA 3U0BA 4DIFA 4E5PA 3ZWBA 1GTMA 2UYYA 2B0JA 3C1AA 4HBGA 5BT9A 2BGLA 2Z1MA 1QKIA 3PHHA 1R0SA 3ZU3A 4PZEA 4E2WA 3PJFA 5I8WA 4MO2A 1YGYA 3AY3A 2VOJA 4E3ZA 4L4XA 1WLYA 4BO6A 2J5RA 4TRNA 2A94A 3I52A 3VKVA 5ER6A 1NNUA 2LDBA 4DWVA 5JCXA 1L7DA 3DBRA 3JQGA 1P1JA 1X7DA 4BNMA 2QX7A 1PEDA 1ARZA 3AI1A 1EUDA 1XQ1A 1Y5RA 3RUIA 3LVFO 3UF0A 3FPLA 5JCJD 3VH4A 1P3DA 2CUKA 4QEDA 1I3KA 1A7AA 2JCYA 5KJFA 4DREA 1ZK2A 3WFJA 1JN0A 5DP2A 2P5YA 1NVMB 4A0SA 4GGPA 3QP9A 4RVGA 4MVJH 4Z3KA 3ICPA 4YQYA 3VPXA 1D8AA 3EAGA 4RO0A 3D0OA 3BHJA 4D0RA 5GMOA 4GAEA 1HKUA 2GN8A 2HKIA 3IAHA 3E8XA 2OMEA 4C7KA 2G76A 2JHGA 2AQKA 3K96A 2VUTA 4BO8A 5G4LA 1U8FO 1NBOA 3I4CA 3PZBA 4HUJA 7MDHA 2NACA 2JD0A 4K26A 4K6FA 1CEQA 3VKUA 1JVSA 4CJXA 4JP2A 1JQBA 3JQ9A 4PLFA 1GADO 4BV9A 8ADHA 4Z9XA 3WBFA 3VVBA 2WMDA 4L74A 2AEFA 4N18A 3BMQA 4YA6A 4TZKA 1K6XA 4WE3A 1IB6A 1DIRA 3SEFA 3BTSA 4R9RA 3ICCA 2Z1NA 1U4OA 3QWFA 4DMLA 4E5KA 3JYPA 1UZMA 3O8QA 3DHNA 2HUNA 1EQ2A 3F1LA 3PQFA 4JIGA 5JSFA 1Q0LA 4IZHA 2I6TA 4PLHA 1DXYA 1LX6A 2E82A 1ZK1A 2YDYA 3E5RA 3PI7A 4WCFB 5KVQA 4AJOA 1P31A 3ZI0A 1UDCA 2Y1OA 1CYDA 3WTCA 5G4KB 1KYQA 1Y1PA 2IYPA 1LRKA 4WCFC 4OXKA 5F1KA 2C29D 4NK5A 3FNGA 3WMWA 5EN4A 1LUAA 3ZNOA 1SPXA 1TI7A 4CM3A 1A27A 2QHXA 4CMJA 1XDWA 3B20A 3N74A 1M2WA 4I5GA 3TPCA 4ND2A 2EKQA 1E3JA 1HE2A 2D5AA 3KM0A 4ID9A 2AA3A 4RLSA 4HFNA 4WPGA 1I01A 1WP4A 4DL9A 1T4BA 3FR7A 1P0CA 2LDXA 4RQTA 4AJPA 3L4BA 3SJUA 1P1IA 5T57A 3ADPA 3AFNA 4JJFA 1Y81A 4BNIA 5LCXA 2ZKLA 2C54A 4ALLA 4BNZA 5TJHA 2X0NA 2EXXA 4BVAA 4BHTA 4DIOA 2P5UA 2HAEA 2PK3A 4HKTA 4UVEA 2OZPA 3K5PA 4FFOA 3V8BA 1Q0HA 1ONPA 5TX7A 2O7QA 3DFUA 2YUTA 2NTJA 4EJ0A 2RHRA 4DLBA 5BNIA 1DAOA 2CF6A 1ZW1A 3AUAA 1JWAB 4BB6A 1TEHA 1LLDA 1VKOA 3Q2IA 3ZWAA 3RJ9A 2CVZA 1DOHA 4YYZA 1DFIA 1J5PA 3KHUA 4YT5A 3I9LA 3DAPA 3QLJA 1WZIA 3FI9A 2HRBA 4M86A 3G17A 2DTEA 1ZH8A 2BH9A 1LEHA 4BNVA 1N1EA 2UV8A 2DFVA 2J5QA 2E49A 2Q2WA 4XYMA 1DIHA 1CDOA 2P2SA 3U49A 4CQMB 1BXGB 2Y99A 3OIGA 3OH8A 3DBRB 2R2GA 3DOCA 3OJEA 4KWIA 1UAYA 2GASA 4NBVA 4LK3A 4M87A 3HN7A 3RC1A 1Z73A 1KC1A 2O3JA 1BW9A 4NHEA 2PNFA 3H9QA 3JQAA 3L6EA 4NBWA 1I10A 3AJRA 2X86A 1BHSA 4BKQA 3H4VA 1QRRA 4BNWA 2PZMA 4CLRB 1E3IA 3JYLA 1XU7A 1B2LA 2P9CA 1GCOA 5HRUA 1V3UA 2DBVO 4PIVA 1CJCA 4AFNA 3SVTA 3LSYA 3DWFA 1ZBQA 2VUSA 1GUZA 4AJLA 3D7LA 1B7GO 2O2YA 5A04A 5L7WA 4EZBA 4F45A 3C7AA 1HDZA 4J16A 1PJQA 4CMEC 1UUFA 3TNLA 1JAYA 4L4RA 4OH1A 5JMWA 3KYCA 2EW2A 3ZWOA 2GPTA 3TJRA 3S55A 3ETGA 2VNSA 4YTEA 1ULSA 4BKOA 4YB8A 5KTKA 3NT5A 4TWRA 1ZFNA 4ZRMA 5H83A 5JLAA 1HSOA 2IRWA 3R0IA 4GLLA 5IXSA 5HS4A 1RWBA 5T64A 4ESOA 4LW8A 3ZCXA 3O9ZA 3H3FA 1KOLA 4XB2A 4WECA 5B4VA 4KQWA 4DRYA 2PGLA 1GY8A 3B1FA 3S8MA 2ILTA 5LC1A 3C85A 2VHZA 3W8DA 4CQMD 1HLPA 2OHXA 4XIJA 2HSDA 1HF3A 3QIVA 5CEEA 4R1SA 2Y0EA 3GEDA 2B35A 1ZEMA 3DONA 3NT2A 4IS2A 5CHEA 4YVFA 5CDTA 5ILOA 2BI8A 1QYDA 1GV1A 2ZYAA 1MB4A 2EJVA 1Q7GA 3ZWNA 3E18A 4FGWA 4BKPA 3FD8A 1NR1A 5I9LA 1YQGA 4AJ1A 3O8QB 4N5LA 3DTTA 1WDMA 1U2DA 5AXBA 5DCUA 3JQAB 3U9LA 3G3EA 4YAKA 2ZTVA 1GPJA 3GN2A 5HS6A 1WDLA 5F1PA 1KVSA 4QO8A 2C82A 1DPGA 4RPJA 4I5DA 5I7EA 4PLPA 3CSDA 2WYUA 3ROPA 1LJ8A 3DQPA 4B7XA 3HB5X 2QZ9A 2ZB3A 1HE4A 1BXGA 4BO4A 1OC2A 1DHRA 4NI5A 5L3ZA 4E2ZA 3U09A 4FS3A 4TRRA 4Q3EA 4JX8A 1GU7A 1P1FA 3RUDA 3TDKA 3HFGA 1PL8A 4ROSA 4J1NA 5COQA 4CV0A 3D5TA 2YDXA 3CIFA 3L4BC 3E03A 3GAFA 3MJVA 4B7UA 2Q3EA 5U9CA 2O7SA 3DOOA 1PJ2A 4XEHA 2JFGA 5TT1A 4GQAA 5JPIA 4BKRA 4OQZA 4MVJA 1KERA 3VHRA 1YL6A 3DZIA 4KDEA 4YRAA 2R6JA 2Y93A 3HN2A 1ZXBA 3DDNA 3ITDA 5H81A 4DYDA 3JQ8A 4RORA 2VRBA 2RHCA 3T4EA 2WE7A 2FRDA 3OJOA 3KBOA 4RVHA 3DZJA 1A4IA 2Q1SA 5HA5A 3RBZA 4CQMA 1DRWA 1ZXLA 3PZRA 4YRBA 1B14A 2GUGA 4DMMA 2BGMA 2RAFA 4YJHB 3VPSA 3ZV4A 4B8WA 5JDIA 4A03A 4YJFB 4E33A 4EBFA 2DU8A 2B4QA 5C3MA 2NLOA 4TKLA 1R4NB 2X0RA 2AQIA 1UAGA 1WVGA 4HXYA 1D4FA 3B1KA 1YXMA 1EVIA 4GX0A 3H5RA 4UEJA 3MJ4A 2IXBA 4CMKA 3AM5A 1BRMA 2G5CA 1KS9A 1W0CA 5T67A 3UCXA 3RKRA 2C59A 2B69A 3F5SA 5FI5A 3ZV3A 4MPDA 4E13A 1K2WA 2WM3A 4BL5A 4GMGA 5DZSA 4F46A 1DO8A 1GR0A 1P33A 3BTVA 1U5CA 1IZ9A 4QSMA 4WLVA 4CLDA 5F1OA 1YQXA 2NU7A 4FFPA 1A5ZA 1GFSA 4D42A 1PSDA 1E3LA 4JCOA 3PWZA 1R15A 4O6VA 3OF2A 5TLSA 3F47A 4O5OA 1DLIA 1O0SA 5KKAA 2P9GA 3OETA 2QG4A 1PGNA 3IL2A 3KO8A 3NV9A 3F9IA 2GLXA 2V6MA 3ZHXA 3WXBA 4B4UA 4NIMA 3RWBA 1YOVA 4R01A 1KEWA 4PVDA 3UVEA 1NM5A 2E4AA 5GZ3A 1E3SA 3KOUA 3COSA 5A4DA 3K92A 3OMLA 1B26A 3X2EA 4I9HA 2G82A 4QFDA 5TS3A 1O5IA 3K30A 3MWEB 3NTRA 4WLFA 1UXIA 1YJQA 3KXDA 2VYND 4ONEA 3GRKA 2DPHA 4WK6A 2AG5A 4BNJA 1Y9AA 2C07A 4DLLA 3DBHB 4F6LA 4R5HA 4A10A 2CDBA 1R6DA 1QP8A 1EE2A 2Q46A 5JS6A 4MKXA 5TJ9A 1LSSA 4XCVA 1Y8RA 1V8BA 3DZHA 2EEZA 3HSKA 4RVDA 3WGZA 3JD0A 4EUHA 4JJGA 3AY6A 4CUZA 5JO0A 3FPCA 2PFGA 1YQDA 3JQDA 4DBVO 4B3IA 2AHRA 1XELA 2EKPA 1FDWA 1MGOA 3MJCA 3TZCA 5JAIA 3BMOA 2FR0A 5K6AA 3A9WA 4R16A 2BGKA 1SCUA 4JN6B 4XA8A 4Y6RA 1VSUA 2BI7A 3QW2A 5FYDA 2PH3A 3WQSB 2Z5LA 5JYDA 3PHIA 4IJVA 5KCZA 1K6IA 3GAZA 3KLPX 1OMOA 4AJNA 3GC6A 3ROKA 1JU9A 1G1AA 2H6EA 3FTPA 3IUPA 4CM4B 3L9WA 4OXNA 3H6KA 4N5NA 1LTHR 1QXSA 3I6QA 4BMSA 3B6ZA 2E37A 3BIOA 2CVQA 1HYEA 2HMWA 2SCUA 3C3XA 1EFKA 1M76A 1I3MA 3KYDB 1E5LA 2WTBA 4RF5A 4MIEA 1YH3A 4UUPA 2D59A 1DAPA 2AEJA 2W4QA 5JMPA 4IUYA 1WNTA 2GR9A 4CMBA 1S7CA 2YFHA 4L76A 1LLCA 4I5EA 5KJ6A 1HDXA 3TRIA 2Y0DA 2QRJA 1JDJA 4CPDA 3I3OA 1E7QA 3B1JA 2R00A 2QYTA 4TVOA 3BMCB 3INRA 1QYWA 2IDZA 2RH4A 4GWKA 2A35A 1T26A 3HB4X 3O26A 4GX2A 3I83A 3U4HA 2PD3A 1LRJA 3DO5A 3KSDO 3AK4A 1H6DA 3F4BA 4CMIB 2WE8A 2NU8A 1E6UA 3BMOB 3IUSA 5MDHA 3LLSA 4J1TA 4AJIA 1ZUD1 1A4UA 1T25A 4XQGA 4YDRA 4GWGA 3ZWVA 3DXFA 5B1YA 3EZLA 4CL8A 1XG5A 4NFSA 2C5EA 5IFLA 1PQPA 1W73A 4CM1A 2NTNA 3GLQA 3WGTA 1X14A 4GVXA 2X6TA 1XR3A 4BO9A 4DQXA 4Z0PA 1KVRA 2CZCA 1ISFA 5MGBA 1GYRA 2EWMA 3MJSA 4IBOA 1U2GA 2V6GA 2GN9A 4IQGA 4TQGA 1IUKA 4JQCA 2ZB4A 2I9PA 4K1LA 5EPOA 1DFHA 4CQLA 1LDBA 1Q0QA 3PJEA 4M89A 3NGLA 1X1TA 2EKLA 5JBIA 1IL0A 2NVUA 1PGQA 4MVJP 1VL8A 4KUEA 1PS0A 1VPDA 3OJLA 3H8VA 1FDTA 2R00C 1U7TA 5EINA 2YV1A 2Q2VA 4WNIA 1C1DB 4IS3A 1I30A 5A5EA 4HNHA 4DYVA 5L9AA 1KY5A 4J4BA 5JDCA 2D2IA 1SBYA 5CPBA 5A06A 2FSSA 3VOSA 1KBZA 3ADOA 3QWHA 3RUFA 2PV7A 4IDCA 2EG9A 2FR8A 1Q7BA 2H5LA 2HCTA 1GPDG 1OI7A 4KTVE 3Q2KA 4XX0A 3T7CA 4PLWA 2GYYA 1Y8QB 4GX1A 1WZEA 1K5HA 4GSLA 3T7EA 1U9JA 3ZWPA 1R66A 2Q4EA 4L4SA 1DBVO 4P38A 4AJEA 5TIIA 3GFBA 1K89A 1TXGA 1PZEA 4MOWA 2NADA 2WD8A 4ZVVA 4G5HA 5F3RA 3VZSA 4BO7A 5IN4A 5HBRA 1PZFA 1Z7EA 3WS7A 4G2NA 3I4FA 4WASA 5TF4A 3V2GA 4EW6A 1T24A 2IE0A 1LDNA 1PJ3A 2V6BA 3E9MA 2Q1UA 2W8ZA 4MINA 3V2HA 1JVBA 3GVIA 4II3A 3ZU5A 2X22A 4JBHA 2Y68A 3JQGB 1UDBA 4WGGA 1HE3A 2H1SA 2DTXA 4ITUA 3GNQA 2EW8A 4O1MA 3PVZA 4XD2A 3QVOA 1U3TA 1RJWA 3DZBA 4RZHA 3LK7A 4CMIA 3ZW8A 3FNFA 1HYGA 1GZ3A 4WOKA 5DT9A 2JL1A 1MXFA 3TL2A 2PZLA 5T8KC 4NU6A 1N8KA 3D3WB 1E7RA 3K9QO 3ZV5A 1ZNQO 5KVSA 1RM5A 2FOIA 1P9LA 5L4NA 4PLVA 3KVOA 4UEOA 4M1QA 4BQPA 4KUHA 4IM7A 3RUAA 4E31A 1H5QA 2YY7A 4A27A 1ZCJA 2AG8A 2HMVA 4FR5A 1NPDA 3M1LA 3UN1A 4MKRA 3WNQA 1NVTA 2EIHA 2HQ1A 3Q3CA 4FSHA 3NKLA 4Q3BA 1GQQA 4EI2A 2C7GA 3AOGA 1KY4A 3UUWA 3UHAA 3BXXA 1DHTA 4ZU3A 3E9QA
chains in the Genus database with same CATH superfamily
5LSAA 3GLVA 2O8CB 3CWZA 5IJAA 5LA6F 4M1OA 4RHUA 3TNYA 1PTJA 2H07A 2GEKA 5IP5A 2D8AA 1VCHA 4MULA 3GYBA 3FF4A 4R1NA 3SZ3A 4NICA 3ENKA 4YMUA 1J9EA 4YI3A 2CL7X 3ILVA 3IHKA 3OBIA 4CG1A 1UXHA 4CM9D 3G9QA 3M89A 3AM1A 4IXMA 1K5PA 3DC7A 3TNFA 1E9EA 3QHQA 5IC4A 2F3SA 3JZFA 3UPDA 2X2EA 1CQJA 1I6MA 2XLBA 1QIMA 2Y1KA 4HCJA 3WDLA 2RGUA 3EIEA 2WU1A 1ORRA 4UW9A 3WAGA 3WRWA 2AKYA 3UT5B 3S40A 2VP6A 1UXKA 3IV9A 2FQYA 2DB3A 2UXBB 4CGZA 2QM7A 4WESB 4X45A 3SIPA 2ZAMA 5DW0A 1ONNA 2IY9A 4QZVA 3JTMA 3MMZA 4BDSA 3AI7A 3IBTA 1PSWA 3ICOA 4BP1A 1IUPA 3UQYS 1SKUA 1ISGA 3SR3A 1KRHA 4UUQA 5CYGA 2XZTA 4RK5A 4DV3B 2GJSA 3LV8A 3NNDA 4I4TB 2RJOA 5ALUA 3OQ6A 3WK7A 1TM1E 1ABBA 2G08A 4AYXA 1FZQA 3SOPA 4HOYA 4UUAA 2W48A 1CR0A 1E98A 2O2SA 2OL4A 3SKXA 3W7AA 5L3SB 5HNKA 1DQSA 4AY6A 1T4CA 2FSPA 2GZ2A 4LBYA 1GZ7A 4Q05A 3TCNA 4PE5B 4OM8A 2WI8A 1NG9A 4N3AA 3BHMA 3K9CA 4MQBA 4PIMA 3TTTA 5AVRA 5IXJA 5CLHA 1IQ0A 4DILA 1X8KA 4UCQA 2JFNA 3CWQA 4N12A 5I7UA 2H7VA 1YWGO 3C7CB 4C7OA 1G2PA 4HHEA 2AFHB 1J25A 1KSJA 5ALIA 4EGQA 1F2UB 2WAXA 3D6HA 3V2UA 1JAIA 4YJ3F 2HLDA 2QAGB 5ADHA 1Y82A 1W25A 2R0QC 2VH5R 1R8XA 2PGNA 3BMQB 1KO1A 3RVPA 4DMCA 2P2CA 3SZGA 2WFLB 4DJFC 4S04A 1CV2A 2NZ8A 4WZ6A 2BMDA 2ILVA 4N3GA 5ULLA 3RIMA 1JA9A 3U6KA 3VR6A 4UAJA 4E32A 1P5HA 5I7RA 4IVPA 4DNPA 3A27A 4J9UE 4HDNA 3DMTC 2AB0A 1ORDA 4JASB 3EODA 4AMBA 1RWWA 1V48A 4IDHA 1Z4LA 3QUBA 5BVHA 2HW8A 4RPLA 1UOPA 3PRHA 5ELLA 1IULA 4TMWA 5JIBA 1XZDA 4XKJA 1WW3A 3IUMA 4NYMQ 4BNHA 2PUEA 4V0SA 4BVBA 3UCEA 4HDNB 1E4VA 4FKBA 1UDRA 4K86A 4DR5B 2ZRMA 3GRCA 2GFIA 4GMFA 3OIFA 2Q6LA 1LDMA 5SICE 2LNDA 4NDAA 2ES4A 1MB3A 1KI6A 2YQ5A 1EE9A 1DX6A 3NVMB 4N7MA 4TUYA 1UQUA 2W93A 4FW8A 3PXDA 3N8HA 4BZZA 1IBKB 1JEQB 3CZRA 3KJGA 3MINB 3SYLA 1BGVA 1F0YA 2C4HA 1T29A 2YHAA 2IITA 2ZTUA 4J16C 2I99A 5E7JA 5EHZA 1GKYA 3VC7A 4QGFA 4H1TA 3TNDA 5L8VA 3B1ZA 5FPQA 4X54A 2IUEA 3INGA 5TPZD 2BFFB 1JZSA 2HRDA 4J0IA 4ES6A 3FOCA 1HDYA 3D0RA 1R4MB 3E7FA 2P65A 2QZZA 3A2LA 4LSZA 1XLUA 3RNOA 3DUFA 1Z82A 1OREA 4EW2A 3G49A 5KB3A 2GZDA 5ILGA 5EIBC 3NYRA 1P4SA 4AROA 3IHWA 1DJOA 1G66A 1ADFA 3A9SA 5ABPA 1ORVA 3QKSB 1Y8ZA 3K1TA 2QTVA 3F9CA 1NNEA 3IT3A 3X1XA 3HA7A 3H9BA 2ERYA 3GMSA 2QNBA 3AHDA 4U6NA 1ZZGA 1CUXA 2OCGA 5C1PA 1GNQA 4TTJA 3NHSA 4IDGA 5KZMB 4JJIA 5KIAA 2VDMB 1B8UA 1JWBB 4TV8A 3OZRA 4GOXA 1Q1NA 5DDIP 3ZNQA 2YOGA 1R9GA 3BBPA 3EQ9A 2JI8A 3EQZA 4X1KB 4GOND 4HT3B 1OBCA 3ACDA 1Z4NA 5HFNA 1ESCA 1NVVQ 1P2DA 2X1VA 4OL0A 1C3VA 1MC5A 4GRIA 4RSGA 6GPBA 2F1JA 2Q9CA 2FP4A 4G6ZA 1MENA 2I54A 4Q4AA 1D3AA 1VJTA 4Y2JA 5TMPA 3I9OA 1EVKA 1ZGBA 4YRPA 4DLXA 5JALA 3QEAZ 1I2AA 5AD1A 1MZVA 1JNYA 3TL6A 4REOA 5FA8A 4J94A 3HJFA 1AY0A 3E9EA 2P90A 4N7JA 3LT1A 4AZTA 1Q22A 3ZD7A 2JJ1D 2E48A 4BMVA 4PGFA 1D1TA 4PS0A 2Y6UA 5KSYA 3Q1LA 4XTCS 2ZRIA 4CKEA 1KI1A 3SLGA 1DLJA 1KNQA 1MX5A 5T4FA 2C8KA 2GOYA 1IPEA 4OO3A 4ZZ3A 3NAZA 3K1AA 4XGKA 5CK5A 4Q37A 5JY1A 3SI7A 3OWOA 4MWDA 2FN8A 2GEVA 3VR5A 4D4GA 4R3NA 1GILA 5SV2A 5CDUA 3GZNB 3R8FA 5BN1A 2PYZA 4AG6A 3PC4A 1I6LA 3O3NB 4QJ4A 1J24A 4FGLA 1DAMA 1ECPA 3ER6A 3HDJA 5LD2C 1RKVA 1RPAA 1BEEA 1PSZA 2IPXA 3HDTA 2FF7A 1U5AA 1UFQA 2AEMA 2B6NA 4U6QA 2R1TB 4NAHA 4A8JC 2VDJA 4BLRA 3WK9A 4TWBA 3IEIA 3NIFB 3GT4A 1EGAA 3E7DA 1RC1A 3BT7A 2WZBA 4MCJA 3X2FA 3PQEA 2NXWA 4ETNA 2DY0A 1RQLA 2IU3A 2PGIA 1FSFA 3DPSA 3L0CA 3QE2A 3SYKA 3ZXXA 3MJFA 4KZPA 3O8CA 4G67A 2H16A 3D2BA 4KN5A 4ZCTA 3RRBA 1NBMD 4E2XA 3HZZA 1AUQA 3ZCQA 4M88A 2BRUA 4U2DA 1H8EA 1OLSB 2C2ZA 3K8ZA 1PG0A 1NW3A 2CLIB 4XR9A 3TEMA 3U62A 1DOAA 1L4MA 1XQXA 4Q0MA 3RG8A 4AI6A 1GGKA 1NULA 4WBNA 2VYQA 3MUNA 2M9MA 3L01A 4Z4EA 4HVAA 1QVWA 4GLBA 2ADOA 2MJLA 1X1BA 1E2QA 1TQ6A 3BSWA 3ONNA 5LBTA 4JFAA 1M75A 1VLVA 2QE7D 4LJLA 4UUMA 3ZPXA 4BECA 1VJ1A 5T7BA 1ZVJA 4ZN6A 1ECBA 4ZQBA 2ZRPA 2HUPA 1ZD1A 3WLJA 2AXEA 1Z08A 3VSBA 1E2MA 4XEUA 4EFDA 4LF6B 3FPKA 5EQFA 1I0IA 3VR2A 2GYVA 3TOVA 2RKWA 4C7OB 1EUYA 4YQZA 5CMLA 5IZ4A 4NMWA 4DVGA 1N0WA 4K9DA 4TUYB 2B5OA 2WV7A 4YRDA 3RFFA 4R68A 2SECE 4N0QA 4JMLA 3KQWA 3K6SA 1DQPA 4F21A 1SWWA 1CJMA 2WD9A 5REQA 3UBMA 4E1BA 1VJCA 1OBVA 2A9VA 3DG9A 4NOLA 4FQ5A 4D41A 1YB2A 5FBVB 3D6UA 3FNEA 4DV4B 4PNPA 4ZVKA 3N0VA 4LCEA 3DNFA 4EYOA 1ULUA 2CYBA 4EB8A 3TIIA 1XP8A 2AJLI 3JTEA 5EWJA 1JEOA 2QRZA 2NSLA 4C4YA 2VVTA 2GH1A 3U1TA 2Q8PA 5BVHB 3ZDAA 1SQGA 1TQHA 2FFBA 3IHTA 4MZDA 1U2TA 1O9HA 3VV2A 5AW1A 4B47A 3ABZA 4KR9A 1KOJA 2AMVA 2R68A 2Q4BA 3DAYA 3L7NA 1NVWQ 4B5LA 1T9CA 2RBEA 4L7QA 4LJ6A 4ZT5A 3DVLA 4DR6B 2OB2A 4LXIA 4OGGA 5JO9A 3SBXA 4BGIA 5CBPA 3ZWYA 4JLJA 4NX2A 3RKUA 3OHSX 2EARA 4XIYA 3HA5A 2WAYA 2GPWA 5DULA 2YJGA 2IYRA 2ZUBA 1ZOOA 2XDAA 4BY9E 4DR4B 1L5FA 4UU1A 3TZKA 4YV2A 3GGPA 3DHVA 5LB4A 2X2PA 4NENB 2OCXA 1QE3A 3U48A 1XZGA 3ZJTA 2E6UX 3OFKA 5FA5A 1EM8A 1Z15A 5FPTA 4X1YA 2CFOA 1XQVA 3A0RB 2FZGA 3PK0A 4C20A 1QFYA 3ZGLA 4AJ2A 2E6KA 1YUMA 2CXOA 5TPWA 5T41A 2MIIA 1LVGA 3GAMA 4RHCA 1HURA 3I92A 1N2SA 4IIUA 4J90A 4D5GA 1GEEA 5KMGB 3TFWA 3BJZA 2NPFA 3RC8A 1NT2A 2E2WA 4CM7A 4CEJB 2BV3A 3OZAA 4CL3A 4LSWA 4QRHA 2VT2A 3K6JA 2DYKA 3RBVA 5HF9A 4E12A 3FZYA 3F73A 1JEYA 3FAZA 2AR9A 1YONA 1DFGA 1HG1A 2Q45A 1OX4A 4LZWA 1F8XA 3PKIA 3LF2A 3M81A 4IOMA 3PF9A 1PJ4A 2C5HA 1N0UA 3R20A 4KNVA 3S2IA 1TF7A 2GDJA 2DUMA 1V9LA 1ZH0A 3E5MA 3BA6A 3HR8A 1U9IA 3N58A 4K1XA 5LP6B 1L2TA 3ISVA 2BEWA 5AM2A 5IYZA 1G5TA 1CZLA 4JEMA 1AV7A 5D01A 1PYGA 3EAFA 3G0IA 1VDMA 1MOQA 5HKKA 4OY3A 3R7AA 2QYOA 1E7SA 4I3GA 1V3VA 3HG7A 1YACA 1OC4A 1R64A 4WK0B 2F1IA 4ND5A 5A2QA 2GYUA 1NFRA 5HFAA 4I08A 2FHSA 1FBNA 3QTLA 4QXMA 2PWBA 2ORWA 4KMOA 5FFFA 2D4AA 3V1MA 4ILKA 4YAJA 4KRYA 4WRRA 3GFQA 5KKNB 3RSHA 4IXDA 1Z8DA 4MMYB 2ENUA 1G63A 3L7OA 4IEFB 1ZHFA 2QGZA 4QLOA 1Z6QA 2BKXA 3NWOA 2VOEA 3DBIA 2W6JD 4MUGA 1E0KA 2R97A 4AUMA 2NPIA 3IO5A 1X7GA 3I2JA 2EZUA 1PGPA 2OCIA 2BLLA 3FWNA 2IUFA 2XDQB 1RHUA 4CV2A 1DIGA 2XD4A 3QBVA 4P4SA 1HGXA 1Q50A 5GZ6A 3AKEA 2JB9A 4B8ZA 1P75A 2AFHE 1SGWA 2J3KA 4P8RA 4F92B 1IUOA 3GA7A 3WLKX 1VCMA 5ICFA 1SVIA 5IN5A 1E3EA 1SUPA 1RI1A 2FVXA 5BUCA 1MA3A 5CDSA 5K3OA 3CRQA 1T4DA 1N6RA 2NTVA 5EJ9A 4PONA 2WZCA 5J40A 1BKYA 4F1KA 2W90A 2VBFA 2IYUA 4PNZA 1QX4A 1J4AA 1Z07A 2GK4A 2I5PO 2H3HA 3TLKA 3SGLA 3V5NA 1RYEA 4HUTA 1IY0A 2NZ2A 3KEMA 1I7SB 5FPKA 4HPXB 3GDGA 4PLYA 3HA3A 3FXAA 3L0YA 1X3SA 3ZHRA 1D1SA 2O5RA 2ZGVA 1NVXQ 5JSQA 3H5VA 1E4OA 1H66A 4HTFA 4KRXA 1R16A 4B73A 5IUNC 1VE7A 4RMIA 2Z8XA 2MSDB 1FC0A 2VRWA 4F3KA 2CKMA 3VU1A 4W5JA 1AV6A 1W49A 3HUFA 6YASA 2CHQA 1T36B 4R2JA 4MWGA 1M0TA 3AFHA 1ENPA 2HC9A 2ZROA 3DE5X 3T5PA 2QLMA 5JSHA 1G98A 3P0RA 4IFIA 1RT9A 1T2CA 2PMWB 3R0VA 1IH8A 2BYTA 3M33A 3IH5A 1P1HA 5EG5A 2EGGA 3PG5A 5FI3A 3OTQA 4QREA 1OI2A 3PFFA 1Y4AE 2EIXA 3I9KA 5AKZA 1P1KA 5CXXA 5IBQA 3WIDA 3O73A 4EVQA 3ACCA 3NW9A 2WG1A 2CBZA 3CR8A 1Z0JA 4N6NA 1QRSA 3GFRA 3E82A 1M2EA 2OENG 4YUZA 3ROQA 1XNRB 2X1HA 3TAXA 4D74A 3KB1A 3E8SA 2B99A 4G0ZA 4R0NA 4E1AA 2HU8A 1UBTS 2KB0A 1Q2XA 1P4AA 2XY4A 2ZITA 4EYEA 5BVGA 1M2VA 5K3BA 3LQ2A 2GF2A 1K7SN 4ATNA 1YB6A 2M32A 5AI6A 3AV3A 4OQQA 3WV5A 2O3RA 2X42A 2ZYRA 1JE0A 3A8TA 1WZUA 1RDFA 2VJYA 3G0OA 3GUUA 4HRVA 4M98A 3PP8A 2BELA 3E61A 3BL8A 4PC6A 4RLFA 4Y9RA 3ZIAA 2NU9A 3WAJA 2ONJA 1NW7A 2VJQA 2OVFA 4EARA 1J33A 1PR5A 2ZYDA 4CFYA 4Y2YA 1Q77A 1Z8FA 2FE4A 3DCYA 1SVOA 4NENA 4DCSA 4A6XA 1P60A 2X76A 4GVPA 4JNKA 1TC2A 4DQLA 4OD0A 4AKGA 5ICGA 2OXFA 2XECA 3JQ7B 1QF9A 2LTAA 1ECCA 1JEJA 2ZUEA 4UE6A 2EGUA 1GOTA 2UZ3A 2WTNA 1JR3D 3NBFA 3PGA1 5BW4A 1QYRA 5ISMA 3GDFA 1V1JA 3A2NA 5CX1B 5GTDA 1I3LA 3THWA 3KSZO 1H3NA 1Q2UA 3UYLA 3D8SA 1I32A 4IWXA 1KAMA 3OE1A 5DJ5A 1CXZA 4BVGA 2XTZA 4XWGA 2CFRA 3CZ9A 3LLVA 1T10A 4BPRA 2Q1TA 2RH9B 2XUHA 5JI2E 3IEPA 3AL0C 4F2GA 1PLJA 3BAFA 2PGJA 3DF9A 3Q98A 1T0PA 5C37A 5JYBA 1JU4A 1JIJA 2ZLBA 3KPUA 4KX5A 1PW7A 3BF8A 3NM4A 1GG8A 1P8AA 2WYWA 2P91A 3K4PA 4L5IA 5FH9A 1BE1A 3QVGA 1TUBB 3DZGA 3GEGA 1J56A 1RLIA 2FPGB 4D82A 2FMTA 2O54A 2EFJA 1NL3A 3LF1A 3T94A 2UXDB 1WUHS 2EZ9A 3P45A 4DY4A 5LN1A 4JJ6A 5LU8A 1JPVA 4KYUA 2X3UA 1SVKA 3BWDD 5EJ2A 3STUA 2IXGA 3DEYX 4DQ0A 3G5AA 2O48X 1ST3A 3KD3A 2DECA 4I6JA 3VH2A 3B53X 3GLIE 1ZSYA 2VRNA 4FFMA 1ZYUA 4F3RA 1JAZA 3FZNA 3FPBA 3EGOA 1XLVA 1WKBA 2XKJE 2PRKA 1SXJA 4DOMA 3KETA 3WLFA 4EJFA 4P54A 2IH4A 1C7FA 2KPOA 1VECA 3WO0A 2PMDA 4ITVA 2PR2A 1DZ3A 2RGNC 1MKYA 4QYMA 5B3AA 5A6SA 2ETXA 2WWHA 2W43A 1BU8A 2JW5A 1MC8A 3WKBA 3ZBUA 3JQFC 1SWVA 4V2UA 1WUTA 3R3WA 1IM5A 1D4OA 1RRFA 1H9BA 3PF8A 1DJMA 4BO3A 4HLDA 3U26A 1V6CA 4U2FA 1S89A 1XTTA 1ESMA 3KZKA 4P6VF 1JXMA 3QF4A 4JP1A 4D4HA 1VOTA 1J00A 5LXTA 4WOCA 2AN9A 4NQZA 2ZVPX 3RYHB 4Q9AA 2PKQP 1VE3A 2RHTA 2CT8A 3IAS1 1Z7WA 3IMKA 2KJQA 5DXAA 2V3CC 2ZYIA 1O5OA 3D3NA 2O8BA 5FOUA 2EJBA 3HEBA 1HEUA 2LKCA 1WIWA 4JB8A 4QDJA 5AXAA 3DXYA 1AZWA 3F4LA 3W5IA 4ZC1A 4CKWA 1QGED 2HMUA 3FETA 4LDRA 5CH3A 1JR2A 1X7HA 1II0A 3TDMA 2HK9A 1U80A 1FLNA 1T2AA 4NEHB 4F96A 1WF3A 4WQMA 1HMPA 2DHQA 1P7ZA 2XXBA 4I1RA 1QC5B 1R0RE 1ZM7A 3HCNA 1EYZA 4W4TA 4ZRDA 3O2JA 1QVVA 1I33A 5BOVA 3VYRB 4U2BA 3KLNA 2YHIA 2PYDA 3QH4A 3COZA 3U3OA 4WLEA 1D9ZA 3ANLA 3THOA 3T7RA 4O4JB 4GI5A 2XQGA 1JYSA 3F7NA 1XZKA 3HO8A 2H2IA 3P8ZA 4MVJD 4P80A 3GK3A 4RXMA 5HR5A 3V80A 4QU9A 4DSTA 1E7WA 2JGEA 4PPQA 4YPFA 2QRVA 3VAZA 5AHKA 5JJBA 1DWQA 1NMEA 4RABA 4LIPD 1AXGA 1B6SA 1FSZA 5LYJB 4L6AA 2Q6VA 3SC4A 3VXKA 3MTIA 3CZPA 1ORIA 4I1VA 3K70B 2NV6A 2W6ZA 3PYMA 1FMCA 2WW8A 4MEAA 3OQIB 4BQNA 4DA0A 5K0ZA 4RYLA 5BMVA 3VDRA 5EJFA 3EPKA 3VNUA 1U6JA 4WZBE 2JLCA 4GOLD 5FADA 3RJZA 4EL0A 1G1MA 3TINA 1VXOA 1I94B 4TTSA 3C0KA 3K2EA 4X20B 1HSZA 4TS3A 4M3NA 2YJZA 5FULA 2Z83A 1KI6B 4YQEA 4C3OB 5DHSA 5DMXA 2EBWA 5EZQA 4ZEMA 2L19A 1V35A 3A1SA 4OGKA 2YBEA 3UJ7A 1XTJA 1W2HA 5MN5A 1N0VC 1XTPA 1AZLA 2DGDA 3LDHA 3WL8A 4OQFA 1ACMA 4XYLA 2EZ8A 5L40A 2Q6OA 4U2GA 1FFEA 3QX9A 3UB3A 4OBBA 1X80A 1U3UA 3Q9LA 3RTCA 4QUHA 1Z8NA 1X38A 5JFGA 1A9YA 4UTXA 3KHKA 3UPTA 4KWCA 4QHYA 2BN4A 4Y6GB 3ZIDA 2Y4OA 3WICA 1BH2A 1RHRA 3JQAD 2FW7A 4D7AA 1CUDA 3LL4A 4MYHA 1G3QA 3HP4A 1GSAA 1L7AA 5ADWA 2VK4A 1UDWA 1QLJA 1OBFO 1OBHA 2JIZD 4OHFA 1Z0AA 4LMRA 4EP1A 1BFUA 2EKDA 2QN1A 2B9VA 4K0RA 5IDVA 4A3SA 4ZGGA 5I3CA 4MPRA 3A2MA 2HA4A 5EKXA 2CLLB 1MJGM 3IOCA 1Z37A 3E2MA 5E4YA 3H3XA 3OJXA 4WKOA 1LWOA 4HK4A 3TBKA 1IUNA 3VYWA 1U04A 2CMGA 3MRTA 3LCCA 4TYQA 1Q19A 4G85A 2CUZA 3MPUA 3DC2A 4EEKA 1KZGB 3FB1A 3OCYA 3KZCA 4FMDF 5BWMA 3ZGYA 2FJ0A 2IYXA 4G1CA 3EVGA 4WTOA 3WMFA 4D96A 1LTKA 2R7NA 5TRTA 3OT1A 2PM8A 1C9YA 2HSZA 1AN0A 3E53A 2W2TA 1RWQA 2P0EA 4RFVA 1YJBA 4K6CA 3VYUB 3I8SA 1BCSA 4CEJA 1GA1A 4TTTS 1F17A 2CV0A 2XNJA 2WV9A 2VJDA 2FPIB 3AEQB 4OYLA 5ALEA 4BZQA 3P2MA 3UYKA 1I7QB 3SYNA 2EFYA 4QG3A 5AVQA 4OHYA 1IE3A 2QRKA 1N5JA 3ZHOA 3JQCA 3B12A 1IZYA 2BFDA 1JIQA 1TJ4A 1U7ZA 5CVUA 3CF6R 1VKNA 3NHLA 3ED1A 4LOKA 2H7YA 1W8IA 1W85B 2I4OA 2VKQA 1YE5A 4MEJA 2OHHA 4O3FA 4OXIA 1VBNA 4UPDA 4COOA 1KZ7B 2B1JA 4L5BA 5AVYA 1UIRA 1UMKA 2WJIA 9LDBA 5L6LB 4HLCA 3WQQA 1GZ6A 4GQBA 3WL4A 1N77A 2AOTB 2BIFA 3EHDA 3P9ZA 3PKJA 4BLTA 1WF6A 5JNVA 4YRGA 2R7MA 3VO2A 3LYHA 5D86A 1XGKA 1GDTA 4DLKA 2VCEA 5JOQA 1CY1A 3N9IA 1G21A 2ZS7A 4YGYA 3FSRA 2KHZA 5DX0A 1TZMA 2PGDA 3F8SA 5LQJA 4ZJYA 2HPZA 4NZZA 3ZDBA 5KVSA 5JFTA 4Z7NB 1JB1A 4RY8A 1DWUA 3UK7A 3RHZA 1SQ6A 1EM6A 3O75A 4Q9KA 4Y1EA 5JAZA 1Z2OX 2WLSA 1KRWA 2MMGA 4UD2A 1JHAA 3OFSA 5E8JA 4MYUA 1U8ZA 3GJ4A 2QJOA 3ABOB 4I66A 1WWKA 3WJAA 2YFQA 1VKHA 5FXMA 2YJNA 1P0IA 1EZZA 2ORIA 2GVZC 2HHJA 2EF1A 3Q8WA 4B82A 4BGEA 1D2EA 1TW3A 3HU1A 3WMRA 1TD9A 4Q4AB 2VFAA 4UATA 1FTSA 3D3JA 1ZKMA 1MOZA 1HFEL 1C8BA 2HQRA 4ZVLA 5J4YA 1C7IA 2D4HA 2Z3ZA 1FIUA 3KZNA 1MXHA 1Y0BA 4XM1A 3KQMA 4NCKA 3FSJX 3RYIB 1W59A 3U5ZB 4A4DA 1I2CA 1JV2B 1WVMA 4F9FA 1PFGA 3PFHA 2C98A 2CMHA 2R8BA 5IAJA 1M1NB 3I12A 4O29A 1CUJA 1U8XX 4B4WA 2Y0PA 3OP4A 4N0MA 4OHWA 4OSOA 1XXHB 3O4FA 4EDFA 4F4DA 4QQFA 1N57A 5CUQA 1YQEA 1QIJA 3CLKA 3NDIA 1EQUA 4E22A 2RHOA 3QZUA 5JQGA 2O4CA 2CYCA 2Z1DA 1S1MA 2YVQA 4BLQA 2BJHA 2DQKA 2R8PA 4WLUA 3B5EA 3FHJA 4RTSA 1DAIA 3KJNA 3UAWA 1HXHA 2JA1A 5JCZA 1GRCA 3HXMA 1XPRA 2Z0MA 5HK8A 2VK2A 1NPTO 1ML3A 1YA4A 1AQIA 3DMHA 2ABWA 3QXSA 1V5GA 1L4NA 2A1IA 5DHRA 1QG0A 2UUPA 4QYXA 1F4LA 1Z12A 1PX0A 3NJRA 4JJZA 3ZCSA 4EJ2A 4DCPA 5EVJA 1LX7A 2C95A 1Y4UA 2E85A 3O82A 3NAGA 2IQIA 3PWKA 3EXIA 2AUNA 2NU6A 1D6JA 1FFXB 2VJMA 3BPSA 3LOUA 3M5PA 1W76A 4QGBA 4EUKA 4RVCA 1TU0A 5K3DA 1HZZC 1VJ0A 4YAOA 5CM8B 2P3OA 3C43A 5JBNA 1B8VA 4MAAA 3BYZA 3DPUA 2IT1A 5BN4A 5MN4A 5HG0A 2JDID 1V1MA 5KHAA 4FZ3A 2CZGA 1RYYA 1LPNA 3CWCA 3UOGA 1PJSA 2WC1A 2AS0A 1SXHA 4DJDC 1FLAA 3AHJA 2LVBA 3ND9A 3AHIA 2OQ2A 4RMGA 5HKLA 5HIKA 4JDPA 4EECA 2OP0A 1WY5A 3MYRA 5FFNA 5TC4A 2C31A 2BC9A 4WFKA 4JC0A 1Z5UA 3I9MA 2QIOA 1EDOA 4TLEA 1Q17A 2OFWA 3U7QA 2RONA 4Y2GA 3WMXA 2NU9B 1XRNA 1E6CA 3NANA 5M34A 2P2ZA 3PX3A 1HV8A 4HX9A 4C6SA 3NIBA 1Y3CE 1JQLB 1OSNA 2G1UA 1X7ZB 2EQAA 4X1OA 1JBQA 4NMXB 5JYEA 1VYTA 2P41A 2W0MA 3A6GA 3PNBA 4R1OA 3LUKA 5CIYA 1HRKA 5AJWA 3ZHSA 3EYAA 4NPCA 3OLCX 4DDUA 1T9GR 1UMCA 1BMTA 1ZMXA 3L8HA 1E5QA 2ZJFA 2FP3A 3CH4B 5JJCA 3JWHA 3B2NA 4KK4A 1N2CB 2AUTA 2JANA 3HCAA 1R9JA 5FT9A 2PCJA 3TL3A 2GHRA 1GGFA 2DQ4A 1DV2A 2CLKB 4RK7A 2XGJA 3OZGA 1JG2A 1ODKA 4W6ZA 3GA0A 4C2AA 4A2CA 4J49A 1XZEA 1VC2A 3OJWA 2R6R1 1M67A 2VF4X 3W5UA 1ULBA 1E69A 3OQBA 5IT9A 5H59A 1DCMA 1DQZA 1SEVA 4MZXA 2YHBA 2ZYGA 3BH0A 5ICSA 3V8QA 1DXOA 2AN5A 3ZE6A 4BFCA 1MEOA 2CNKA 3TZEA 2POQX 3OY2A 4QEKA 1KDZA 3V34A 3MS4A 3T3OA 2ZATA 4MAFA 2R5WA 4O2AB 1F06A 3IOYA 3OESA 3QM1A 3C70A 3T9BA 2XWBF 2IYNA 4QICA 4CM8A 4CR7A 3FDXA 4AG3A 3K9NA 3OA0A 4KUGA 4O33A 4W7SA 1QLHA 4YJFA 2F2TA 1VG0B 4LCJA 2QQ5A 4FHGA 4MWTA 3UKJA 4RDXA 1I4WA 1VRWA 4CF5A 2OM6A 9GPBA 5HUJA 3E9RA 1NBHA 3LQYA 3WL3A 2BTQB 4O2AF 2VPPA 1Y48E 2J9GA 4G1BA 2QLNA 3O4RA 5AXDA 2I3ZA 2XXAA 2YJ3A 1MBZA 3B7GA 4M0CA 4ZQHA 4NKRA 2V96A 4KR0A 2IWHA 1TYCA 2BCEA 1FYWA 2H1CA 2REXB 1BG6A 3FPAA 4TWIA 3VFDA 3ANMA 2B30A 3DKPA 2QYSA 2G7ZA 2PWPA 2XHZA 4ZGWA 4I50A 3RPEA 3VNQA 2YVLA 4C4ZA 2IV7A 4P31A 4MRRA 3S1AB 3DZFA 3EPLA 3EWNA 3G1TA 1XEXB 3ORYA 3N2GB 1C7QA 4AWAA 2B4AA 1TM3E 2P6OA 4ZVNA 2RCYA 3ZHVA 2CYAA 3QV2A 1HT1E 2PZBA 4YCLA 5JNSA 2QUZA 3NTUA 2XZOA 4G4IA 4JU8A 1V47A 5JG7A 4Z99A 2BFWA 1H42A 1KEVA 1L5WA 1XMVA 2D0IA 2O2XA 3A1VA 4Y9DA 2OVBA 4EX6A 4PYLA 3U80A 1JG3A 4YXFA 3TWOA 4ZYUA 1NT4A 1D4AA 2RK6A 5AMXA 4LVUA 3KQPA 4GGOA 4L9WA 1MJNA 4KOAA 2K6GA 1B6TA 1ZUNB 2E1PA 1NC3A 3MWYW 5DRYA 1SZPA 4NBKA 5CA1A 1EB9A 1Q1GA 5KYUA 3OFND 3WHKA 4XFJA 4BFLA 1J39A 2IJGX 3CKLA 3IOEA 3BRCA 3T7JA 1Z2CA 2O23A 4BTVA 5BSWA 1RHMA 4EKNB 5ALLA 3HJUA 2DT8A 4ZOBA 5F64A 2JAOA 4ZCPA 5LA6A 1SJ9A 3RFVA 2O8CA 4LE2A 3I0ZA 1SK8A 1VFPA 2GPYA 1IXZA 4P7BA 3GFVA 1AA6A 1JQKA 3VYSB 2RI1A 1R74A 3JPWA 4EG4A 1N6OA 4XWKA 8ATCA 5FJJA 2Q50A 4HGYA 5FFMA 3AF6A 1LQUA 2O14A 5DWVA 2C84A 1ICEA 1P7VA 2XUJA 1T1SA 3O90A 2YWDA 5LZ9A 4M8KA 4F0JA 4QOIA 2GUWA 4BX8A 3QGMA 2X9VA 1DELA 1E0JA 1F2VA 2XPCA 4HX5A 4PG6A 5GAJA 4D92A 3U61B 2L18A 1DC4A 1L9XA 3T5MA 3CVVA 2RGXA 1D9XA 3NYQA 3NETA 4BO5A 1IYZA 1E5VA 1C1XA 1NXWA 4TSFD 1TTTA 2WAAA 1T6BY 3LUHA 2D00A 2FX3A 3FJOA 2VYVA 1E5XA 3OZBA 3IPCA 2VAMA 2WVGA 3QLVC 1RAGA 4MVWA 3FGNA 4QBIA 2V0GA 1WHTB 1SCUB 2PBRA 1IK4A 2GRUA 4F3YA 4UASA 4CM9A 2YMQA 5J47A 4XUGB 4G5QA 1F0KA 3IIJA 5LVAA 2XNDD 3SHTA 1M0SA 3DE6X 4IY1A 4OAPA 4JXZA 1K0FA 2D1TA 3VBCA 1FB5A 3KQUA 2GZ1A 3WKEA 2RHGB 5HMMA 1NDQA 3PUVA 3GLKA 3ZJ4A 4KO8A 4DNOA 1LPOA 1SUAA 2D2FA 1GT6A 4V1CB 1YR8A 2HYIC 1QS0B 3ZDRA 1Q20A 3BWXA 4PS1A 5ES4B 3MOSA 2EV9A 4CQJA 3HJBA 2A0YA 4FC6A 4EUEA 4B71A 4YR7A 4F97A 2J3EA 4YECA 4A92A 1CUEA 1GUYA 3ML1A 5JSYA 1EWTA 4QTYA 5CCDA 2O5VA 4LZOA 3S2SA 5BN5A 1CF4A 1VIMA 4LSGA 1O0CA 4B31A 2PKWA 5KNCD 4EENA 3ELWA 2BE7A 1JDTA 3Q8XB 3EXAA 4UBLA 1GN9A 3C6KA 2OZLB 1KMMA 1VG1A 1YRWA 4XZ3A 1M1XB 5AKEA 3MT7A 1LNQA 3NP9A 4G0QA 3IP1A 2Q6IA 2HF2A 4G09A 1FDVA 4YMWA 4QKQA 5EKUA 1V16B 3K32A 2C04A 2J5KA 2OG2A 3KJQA 2YHSA 1Q95A 2P4HX 3FPGA 4K46A 3VVCA 4Q3DA 1Y1LA 2CJXA 1M34B 2QTLA 4NZYA 3G2MA 1MRNA 4P92A 3QQPA 4FOTA 2CV2A 1GSOA 4P08A 2VZ0A 3P2YA 4HB0A 4PWZA 4R3WA 1DUVG 3QHPA 4X7RA 1C7RA 2ZUWA 1Q74A 3NBAA 4K9OA 2RBKA 1ENYA 4FSXA 1XTIA 5EY5B 1D2GA 1QNLA 4QUEA 3C1OA 4DNXA 3Q40A 1A77A 1XKTA 3D6NB 3ELBA 3L93A 3NT4A 4G9BA 3UJDA 2Z4SA 3VU3A 3ILXA 5MHTA 3FMOB 4LMBA 2QP9X 2ZI4A 1A72A 2M1XA 2PJUA 5DGCA 2WPDA 4DWJA 1F5SA 1YL5A 3H1AA 4JAVC 3WIEA 1Y3HA 3EBPA 1XU9A 2JVIA 4BE9A 5JDCC 4PZCA 1U63A 1U0BB 3IUNA 1R7RA 2ALJA 2I7XA 1QTRA 3WR5A 4ZXFA 3IR6A 4AMVA 1CNEA 2QVCA 4JP3A 1YFKA 4KI7A 4RK6A 4WW0A 2VPZA 1ML4A 5HVNA 3CUYA 3R4VA 4MMXB 4EMSA 3NALA 4HP8A 1E1YA 4J0HA 2ADMA 3IEKA 2OCKA 3NNSA 5LQUA 1GRQA 1NRIA 4DUGA 4D4MA 2H1HA 1APBA 3PXEA 4WKCA 121PA 2P68A 2IYTA 3HBLA 1RPTA 1TJ3A 1C9JA 1IDN1 2QUHA 4FOPA 1KJ9A 1ZH6A 1V6SA 4JROA 2QX9A 3SSNA 1U81A 5FF9A 3AEKB 3TXAA 5HKOA 5KEIA 1KKMA 2C2WA 2FFRA 2QX8A 2G72A 2XWSA 1Q12A 1X70A 4M7OA 3ZZTA 2XLCA 3DHEA 1DNPA 2H3EA 4HDKB 2NM0A 2QU7A 2HBYA 3E58A 4MQEA 4JVLA 3CR3C 2VPYA 4MLDA 3GUZA 3QKUA 3AINA 4Y2HA 3J81k 2F6RA 2X3FA 1A50B 1M2OA 4PHGA 1XD9A 1D7OA 2IYWA 5ITWA 5AM3A 2ZRQA 4DCNA 4HH1A 5JPDA 4DV6B 5DTJA 4IIVA 1ZHOA 1P5JA 2OTCA 3GMDA 3KALA 3QMPA 4XDZA 1W1WA 4D26A 5PNTA 5IHXA 1QDLB 3JAWA 3ZJVA 3WGVA 1F8GA 1UBNA 4CCYA 2AH5A 5T3YA 4D46A 1LU9A 3AFIA 3IESA 5ALZA 3EZ9A 4QXPA 2W98A 3OOWA 3PTAA 2VWGA 1XNQB 3QTTA 5LUAA 1QANA 3KOZA 3ZVRA 1GUDA 1SKAA 3MCTA 1T3HA 1BN7A 3INNA 4QYIB 1QU3A 5F7JA 4N5IX 3Q0IA 2OGSA 4B81A 1ZIDA 1CE8A 1GLVA 2AC4A 4MVJM 1U8UA 4ODIA 2EF0A 1K9VF 1RKXA 2C8JA 3I39X 1BE8A 5DIZA 4IMPA 4L4YA 1GT91 4KEAA 4QNNA 4L6IA 3ZTYA 3A1FA 5KTYA 4E30A 3LBHA 3EOBI 3LC1O 1AHHA 2WKWA 1Z29A 3FYHA 1T5BA 3Q41A 5TQVA 4QOFA 4MLCA 5EMLA 3REFA 3ZY6A 3ETDA 4PX9A 4DKXA 2HT6A 4FT4A 1F9AA 4I3HA 3A36A 5T4BA 5LZ7A 1C1XB 2Q3FA 2XSZD 1QS0A 3PEFA 1SULA 3FLBA 3MC1A 4C0SA 4DGSA 4Z49A 1QTQA 1DC8A 5FUBA 4DMHA 3OFJA 2JFHA 2WJZB 1XYYA 3QKTA 5H3HA 1W1UA 1XB2A 4B6OA 3GXBA 3KKOA 1EFVB 2B8EA 3HJGA 3QLEA 5HKBA 4R71A 4XGRA 4QJ5A 1CZUA 3CF2A 4L4ZA 3O91A 2YN4A 1AA9A 3D64A 5BXYA 2OV4A 1Z0SA 3FCOA 2AYXA 3AY7A 4HB4A 3TIFA 3ZDQA 3H16A 4F5ZA 1Y6GA 4G25A 4M54A 4YV0A 2FWMX 5A4FS 4GNRA 5KYKA 3PXAA 2FWIA 4IFBA 4C0XA 2YL2A 1ZJ4A 4EJ6A 2Z9BA 3L40A 3WGYA 1DAFA 2HIMA 2HK6A 2RBGA 4GPZA 2VH1A 5EWLB 1GGMA 1JH8A 3SQLA 1BS2A 4BQRA 4F2WA 3MWEA 4GQIA 2ZRGA 2Z6UA 3ACBA 2XMPA 4HDAA 4LECA 3Q6NA 1C9KA 3H83A 4GI3A 5KYGA 1ZI9A 4G0NA 5THQA 1HORA 1UWVA 2WSMA 1BO6A 3TTXA 4LX8A 4L8VA 4UDOA 4QOHA 4ZA2A 2CV1A 4QU5A 2HHHB 4FYKA 2C94A 1ISSA 1SC9A 4QC2A 3WADA 1RYMA 4QTUB 4R51A 3HADA 1AK2A 3DV0B 2ZWMA 3UT0A 1PL0A 2ODAA 5IZCC 3OO1A 3JWJA 2VCYA 3K0BA 3QWBA 4H6PA 1NP7A 2O2HA 1SC6A 2VJKA 2OC4A 2XW6A 2OOSA 1UIMA 2P1RA 1HE8B 4DV2B 3W1VA 2BZGA 2KE5A 3BEOA 2XNCA 1ZVMA 4I7EA 4L8GA 4X3CA 4BGVA 5KPDA 1QRUA 4B74A 1PT8A 4UPVA 1T0BA 3TPZA 3ZWKA 5K0LA 2ZIZA 4KLRA 1EJBA 2R751 2LCQA 3KPYA 4BBJA 1EUQA 4CV1A 1PUXA 1SH7A 3R7NA 3MVEA 4M8NE 3RIGA 2C0PA 1OILA 2NZUG 5LL6P 3HSSA 4W5NA 2FHPA 1LV7A 3GDOA 4LXUA 2WWGA 1PUIA 5AHRA 1YA8A 5I7WA 2PRIA 2MYPA 2PT7A 2XAAA 4GZ3A 3X1KA 3HCFA 2ZJ1A 1P2FA 4Z1OA 3ZXUB 2DT5A 5C51B 3N05A 1GZVA 1VGQA 2ZU0C 4C3ZA 1NQWA 2A9KA 3FYSA 4OHRA 2Q4RA 3ZR4B 4W8GA 2HMYB 3KR2A 3A1WA 4NE9A 3LGXA 1KVUA 1NHGA 2A5LA 2N1MA 4X6XA 5TPZA 4F8YA 3ROMA 4BO2A 2CL0X 4DLAA 2MSEB 5AW7A 1AD2A 2ISSD 4R54A 3OCCA 3IMFA 4IJKA 3KZMA 3KXLA 4YDQA 3ILSA 2YZMA 2RARA 4O2AA 5JRJA 3T7TA 1HQYE 1OOEA 4UEWA 4LRWA 3D43A 4H7KA 2F67A 3EYWA 4X6LA 5TPWB 1AE1A 4C7BA 2H4YA 4UDNA 5FV7A 3VKWA 2L17A 2RI0A 3RC9A 4DIDA 1YQQA 2JI6A 4RV9A 4QTZA