4AJ2A

Rat ldha in complex with 5-(2-chlorophenyl)-1h-tetrazole
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
330
structure length
327
Chain Sequence
ALKDQLIVNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
total genus 117
structure length 327
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4aj2A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4aj2A02
2W98A 3WLEA 4ALKA 1XCBA 5JAQA 3KLPX 2Y93A 4E32A 3M1AA 3QWFA 3OECA 3I9OA 4FQ8A 3PHLA 5CPFA 5FI3A 2NQ8A 3OBBA 4O0LA 4DL9A 1DB3A 3L4BA 1YJQA 4HV4A 2Q46A 4TVBA 3F4LA 3UF0A 4RPHA 4KTVE 3ZV4A 5TLSA 1UJMA 1E7QA 1Z82A 1PZGA 3DC2A 3U4CA 5IFLA 1YB1A 4TZKA 1NR1A 3ZWNA 4J49A 3B1FA 3DBHB 1FXSA 1LNQA 1UAGA 3IOYA 1EE9A 1IPEA 4GGOA 1RWBA 2WD7B 3WDSA 4EUEA 3CMMA 4WJZA 3TWOA 1O89A 3SVTA 4XCVA 2CUKA 4PFJA 1B14A 5I9LA 5JPIA 1LRKA 1DXYA 4I1IA 2BELA 3GAFA 4NNJA 1VSUA 1TT5B 3NDRA 1EZ4A 3GDOA 4FC7A 2VYND 3K30A 4JBHA 3ZU3A 1CQIA 5H83A 1GQQA 1SB8A 2PKQO 2QIOA 3GT0A 4XB1A 4FSHA 4IY1A 4NBWA 1I3NA 3JQ8B 3LSYA 1E77A 4BO1A 4WEOA 2DBRA 4BO0A 4HFRA 4U5QA 1L1FA 1BWSA 2GASA 2OORA 3QLJA 5JY6A 2Q4BA 2BFPA 1KEVA 2BRUA 2WJPA 4RVSA 3IP1A 2E37A 3AY6A 1PJTA 1EFKA 1PEDA 2HMWA 2EKLA 3M1LA 4LCEA 2C20A 4IM7A 3U9LA 4E2XA 3FTNA 4IDCA 4J1QA 2PKRA 3EZLA 1WNTA 4PCVA 4BKOA 1HYEA 2YDYA 1V3VA 3RUDA 2QW8A 4JX8A 4JNKA 3PZBA 2A94A 5L4SA 1M6HA 4CV2A 3F5SA 5EMHA 3CMCO 3OA2A 4S3MA 4PZEA 1ZBQA 3UCXA 4OGWA 4BNUA 9LDBA 4Z0PA 3R1IA 4TRRA 2XF8A 1KBZA 3I1JA 3ZH2A 2GNAA 2J5RA 3C1TA 4MO2A 4TRNA 1P0FA 1OZAA 5JDCA 2LDBA 1GZ6A 3VVCA 4W9NC 4CLDA 4RF5A 5HRUA 4P4NA 1UXGA 2W2KB 4AG3A 4DLBA 4IIVA 1LLUA 4YCAA 3BMQB 1ISMA 4OSPA 4EI2A 3LT1A 5ITWA 4QFDA 3MOGA 1I3MA 3P7MA 4YRAA 1ZSVA 2EXXA 1J5PA 3RUIA 1O6ZA 3JD2A 4TVOA 2GGSA 3VH3A 4J0EA 4BNYA 1H2HA 1IB6A 5AXAA 5C7OO 1P33A 3GN2A 4DBZA 1U1IA 2DUUA 3E48A 5ICSA 5DN9A 1HE5A 1YQXA 2X9GA 4NK5A 5CFZA 4O63O 2O7SA 4NZ9A 5AXBA 1HYHA 1O5IA 3EC7A 4HFNA 5JCJA 4RZIA 1JKIA 3JQBA 5GMOA 3AOEC 3GMDA 2NVUA 2OBYA 3T4XA 3O03A 3WGTA 3DOJA 3FBTA 3PHJA 2X58A 2BLLA 1NWHA 2WM3A 4CPDA 5C7LO 2BGLA 1EDZA 1HDOA 1E6WA 5CG1A 1C0LA 3ENNA 2VZ8A 3PDUA 3TQHA 1I01A 1DLIA 1PU2A 1ONPA 3BXXA 1N9GB 2NVUB 3H9JA 2VRBA 1UDAA 3PWKA 2C2XA 1MUUA 3AM5A 1U9JA 3IUPA 2VQ3A 2PK3A 1NFRA 1QKIA 4WLVA 4UVDA 1W73A 3HDQA 4M87A 4GVLA 5LC1A 1U5CA 4IMRA 2G0TA 3TZ6A 1MV8A 2D4AA 3I6IA 4L4SA 3D1LA 2I3AA 4BGIA 3G49A 1D7OA 4D41A 2ZB3A 5I8ZA 5FYDA 3RKUA 3MJCA 5A3VA 4IZHA 4TROA 2FZEA 1Z7BA 4R16A 4WLNA 5H82A 1B8UA 2P9CA 3WXBA 5ADHA 1P1IA 5LDHA 1N5DA 5L7YA 4FBGA 4G5HA 1B2LA 3R0IA 1EVIA 3LF1A 5THKA 5GZ1A 1YQDA 2IZ1A 1XU9A 2VT2A 3RBVA 4QUKA 4RGBA 4ZA2A 2X5OA 4QEDA 5B37A 2IEDA 2P68A 4AVYA 3EGOA 4NFSA 1ML3A 3QP9A 4J91A 4PLGA 2BKAA 4BS9A 1GAEO 3DBRA 3DWFA 1IHXA 1LEHA 4FFOA 1SMKA 2CZCA 3M6IA 2ZYAA 3Q3CA 3STHA 1R4NA 4YJDA 2CVZA 4ND3A 1NPDA 3ZNOA 1W4ZA 4JJFA 3BTUA 3T7EA 3S55A 1U7TA 1LU9A 3I4CA 2ZB8A 4BNZA 1HLDA 4BO9A 1YO6A 2R00C 1C3VA 5CDYA 5TT0A 4YXFA 4YT8A 5ES3A 2JCYA 1Y5MA 3KRTA 1A7AA 4YPOA 1KS9A 4JBGA 1YWGO 4N54A 1RJWA 2V7PA 1GZ4A 4ZHSA 3LC2O 4YJHB 3MZ0A 3U09A 2Y1EA 2Y0EA 2NACA 2FMUA 4LGVA 3E18A 4M1QA 1TA4A 2O3RA 2XPCA 3VPFA 1ZK3A 4W9NA 3M2TA 1VSVA 3D64A 3BMNB 3IMFA 2X7HA 3K73O 2JAPA 3GVPA 1SPXA 3ZV6A 3ICCA 1N8KA 4DYDA 2Q49A 3H5AA 5IZCC 1V3UA 5I7EA 4RVUA 2O3SA 5L45A 4ZRMA 2GLXA 2AEMA 3CZMA 4II2A 3ZWVA 4J2HA 4EDFA 3GG9A 4AFNA 1K2WA 2IYPA 2RHRA 1ISHA 2VUTA 4Y6SA 4DVJA 5A1TA 4PIVA 4L0QA 1EVZA 2Y1GA 3JSAA 1XYGA 5JAIA 3EUWA 1ZK0A 3BHIA 2JAHA 1PZEA 1R6DA 4XD2A 5HA5A 2Q1WA 3GOHA 2Y1FA 1BXZA 5K6AA 5TX7A 5FEUA 3BMOB 1PQPA 3SC6A 1GD1O 3U4IA 4LMPA 3AJRA 3WSWA 4I5EA 1LSJA 4R5MA 4BQRA 4EZBA 2VNAA 1I2ZA 4HKTA 1C1DB 5IDWA 1A27A 3VC7A 4YJGA 1ADFA 1PS9A 2JD1A 3FWZA 3GFBA 4FFLA 2Y67A 3JYLA 3VDRA 3E8XA 1NNUA 3ETEA 4Z0HO 2CSUA 4HFMA 3ADOA 1HYGA 1PJ4A 1OBFO 1KVSA 1MX3A 3PJEA 3FSRA 3E82A 3KSDO 1XGKA 1Q7CA 1VI2A 1WW8A 1W0CA 2POQX 2XAAA 4XQEA 5JFOA 3SLGA 5L51A 2ZIZA 1JWBB 5KJEA 2WWRA 4A03A 4GMFA 1DC4A 1XA0A 2J8ZA 2JD0A 4CLOB 3HADA 2OMEA 3H3FA 3NGLA 4I9NA 3SJUA 5KVSA 1YB4A 2EERA 3ROQA 2X9NA 5K0ZA 3VKVA 1O8CA 2YUTA 3W1VA 3PYLA 2NWQA 3L4BC 3HDJA 2AMFA 2I9PA 4EBFA 1FDVA 4DTIA 1T2EA 4XGNA 3H6KA 1U3WA 5FFFA 1A5ZA 4NG5A 4XYGA 1X13A 2RIRA 1XDWA 4AJHA 5TNXA 3LC1O 4AJ4A 2DFVA 4IIUA 4QFCA 4N5NA 2Y0CA 3FF4A 4TWRA 1XR3A 2DT5A 5JCXA 1JU9A 2B5VA 4IGFA 2J3JA 4J7XA 2D8AA 4GSLA 5COBA 1HDYA 2OGUA 2E6UX 1Q0HA 1JW9B 3TZHA 3ZNPA 2O2SA 3KSZO 4QT0A 3OETA 1U2GA 3GNTA 3TFQA 3ANMA 4J90A 4MVJM 3L07A 4R9SA 2YQ4A 4W4TA 4DXHA 4CJXA 4J43A 3NT4A 3D5QA 3E9MA 1HE2A 3IS3A 3G17A 2EKQA 1VKNA 4IJUA 2Q3EA 5F3RA 3RUAA 1PS8A 1LC3A 3NUGA 3ZW9A 4XZ3A 4WOKA 2B83A 3ZWBA 2CD9A 2UVDA 3F46A 3H7AA 4BO3A 3RU7A 3H4VA 1ZEJA 1IY8A 4Q9NA 1BSVA 2H1SA 4TSKA 5HS6A 4WGGA 1Q0LA 3M2PA 5C5IA 2C7VA 5DP2A 5ILGA 4J9VA 3KYBA 1I2CA 1MC5A 4ND2A 3TOXA 2Y1OA 3ABIA 3RU9A 4N7RA 5H81A 1WMAA 1Z6ZA 4RQUA 2J3HA 1VL8A 4DPLA 3QVTA 4CLRA 2PD6A 3QQPA 1I0ZA 3MJEA 4DGSA 4YJGB 4E5PA 3DZIA 3HFSA 3HE3A 3K2EA 4EYEA 1VRWA 4K9DA 3CEAA 1Y8QA 4OXYA 4D46A 1EFLA 1LRLA 5T57A 3H9QA 1TVEA 2NU9A 4IDEA 3HUDA 3ANNA 2FSSA 3DMTC 1MP0A 1QORA 3OEYA 2R2GA 5JO9A 1QR6A 2G82A 3RFVA 4RJTA 3BA1A 2ZJ0A 2Q1SA 1HRDA 1LQUA 4NBUA 2A4KA 3I9JA 4F3YA 3UHAA 1WWKA 3NT2A 3LT4A 2X1HA 3ONFA 5ENVA 3PFWO 5J23A 3QY9A 4K1LA 1GY8A 1QYXA 4HWKA 3JV7A 4BB5A 1Z74A 1O0SA 3FPLA 3QA9A 4YVFA 4FFNA 2HO5A 4F6CA 3NGXA 4GH5A 4CM4A 3UFXA 4L76A 4K6CA 1ULSA 1YXMA 3AUUA 3DXFA 3IKVA 2WYUA 1PJBA 1ZW1A 1A7KA 1DC5A 1C1XB 1D1TA 3JD4A 4U7WA 3JQ7B 4JQCA 3ZWOA 3KVOA 1FDSA 3I4FA 1P1FA 2ZKLA 4DYVA 2Q2VA 2FR1A 3PQEA 1PS0A 3WGGA 2JKVA 4IBOA 3RAJA 3TF5A 3PQDA 4RVFA 4DPMA 4KOAA 4OQZA 5I8WA 2JCVA 4YAIA 2JL1A 2Q1TA 3HJAA 1F8GA 1Q2XA 3RBZA 5KJFA 3TRIA 3CIFA 1Q1NA 1ZIDA 2DBVO 3DHEA 3LT0A 1CIVA 4W6ZA 5A9SA 5KKCA 1H6BA 1PJLA 1XKQA 4YEDA 1WDMA 4ZRNA 1IHYA 4BO2A 5JY1A 1EK5A 3TDKA 1CJCA 1ZSYA 4WLFA 4Y6RA 4D79A 4IDGA 4R41A 3VTZA 1G1AA 2VOEA 1NFFA 4H7PA 4HXYA 3HDYA 5G2OA 1AXEA 4A10A 4U8GA 5IZ4A 1MA0A 3IJPA 3LK7A 4I5GA 4B4UA 5HBRA 2VYVA 5GZ3A 2BMAA 4MIYA 4L73A 4L74A 4M8SA 5DCWA 3TFOA 4L4RA 3WJ7A 2IZZA 4EJMA 4H16A 1YGYA 2E49A 4BB6A 2HK9A 1DIRA 5EJ2A 3GVIA 1J4AA 3BMCB 4EUFA 1N92A 2J3KA 5IF3A 1GEEA 2P5UA 1NQ5A 4WLEA 3NV9A 1LDNA 3QSGA 3JYNA 3VH2A 4DMLA 5L7WA 3V8BA 4JP3A 2W8ZA 5T5QA 1X7HA 3KZVA 2PY6A 3I5MA 4UUMA 1NHWA 4UULA 2OUIA 4WE3A 3HFGA 2P2SA 3OEWA 5TRTA 3FI9A 2FN7A 4XRRA 1AE1A 5G4LA 3DZJA 2Q45A 1LI4A 1N9GA 4CL3A 1NVTA 3DL2A 1L7DA 2D3TA 4GI2A 1TXGA 4Q3AA 2PZKA 1ORRA 2VT3A 4WNIA 5JMPA 3VPXA 3NTOA 4CM8B 1OOEA 3LLVA 2G5CA 3GNSA 3ZGYA 3OIGA 2IE0A 4E12A 1LSSA 1RM5A 4Q3EA 4CR8A 5HM8A 3OMLA 4MVJP 5T8KA 4PG5A 1CYDA 3WICA 3PGJA 2W2LD 4WPGA 2NTJA 1K6JA 1I8TA 4GX0A 1QXSA 1WZEA 3WFJA 4HP8A 4PG8A 3IAHA 1P1RA 1QYCA 1JVSA 2JFHA 2TMGA 1U28A 4I5FA 5G4KB 3FN4A 2X0IA 1R4NB 1I33A 1XQ1A 4J4BA 3IUSA 4OIMA 2PH3A 4IJWA 3AI3A 1KC3A 4GVXA 2OFPA 4KUEA 4JXKA 3RC2A 3WBFA 1PJ2A 4E5YA 2DFDA 3V2HA 1Y81A 4XDZA 1PZHA 1P0CA 3SEFA 4ONEA 2GO1A 2ZATA 1BW9B 2A92A 1R0LA 4P4LA 4JP2A 1I10A 1GL3A 2VTDA 1HEUA 3AFNA 3GQVA 3RJ9A 1PX0A 1GUFA 1Q7BA 4FJ2A 2EW2A 4F46A 1HE3A 3RFXA 3QVXA 1Y6JA 2WD8A 3C24A 4GLLA 1PR9A 5BT9A 2Q99A 3PHHA 3JQAB 1UDCA 2FRDA 2AG8A 1B7GO 1T2CA 2H5LA 1W8DA 1QSGA 3CH6A 3UXYA 3PHGA 1H93A 4TKLA 5JDIC 2VWHA 4UUNA 3WFIA 3DBLB 4GX5A 1PJQA 3KEOA 3ASUA 4J1TA 3GK3A 4B7XA 4FGSA 3BZUA 2FHSA 4JLWA 1PL7A 5BQFA 4E5MA 1H6CA 1PL6A 4MPDA 1F14A 2GCGA 3L77A 3QWIA 4ZD6A 4FR5A 1DPGA 1ZVMA 5KJ1A 5AXCA 4MP3A 4LRTB 3DR3A 4M55A 1KOLA 3UICA 3PQFA 4K6FA 4IDAA 1IZ9A 2DTEA 3AFMA 2JJYA 3N58A 4HX5A 4DRYA 2E48A 3WSVA 5JAZA 3DAFA 5C37A 3BHJA 4UVHA 4Q39A 5CPBA 4R01A 2EP5A 3INTA 2DBZA 2O3JA 2HCTA 1NWCA 2AE1A 3F47A 3VH1A 4JGBA 1QV6A 3QVOA 4LSMA 3DZFA 5A03A 1XG5A 3F3SA 3V2GA 1GV1A 1SEVA 4B8ZA 1KY5A 4GWKA 4B4OA 4NQZA 1LBEA 4DIBA 3ZV5A 3TPCA 1I36A 1MC4A 1P44A 1YOVB 2D5AA 5TS3A 4OOFA 3LZ6A 4BL5A 3WGIA 4PRKA 4RPKA 4EW6A 1F17A 4CM6A 4IDDA 4R4JA 4J1NA 2I6TA 4ND4A 4XJSA 2PGDA 3CPSA 3GGOA 3H9EO 6ADHA 1R37A 4LCJA 1HZZA 3GG2A 4YAGA 2BFOA 1VLLA 1TLTA 3GUYA 5BSGA 1PR3A 5GY7A 4JJIA 4NH4A 3FBGA 2HJRA 3WIEA 4EITA 3TSCA 4IJKA 5BSEA 3O9ZA 4YRBA 2P91A 3GLQA 3MEQA 1K0UA 1PGOA 4ALLA 1KEWA 5KVVA 2GF2A 3AOEA 1QYWA 1T1SA 3CSDA 3ETDA 4MKZA 3ZHXA 2P5YA 5IXSA 3KYCB 4PN3A 4ROSA 3B6ZA 1M6WA 1C0IA 1HLPA 3ONDA 2H6EA 5KJCA 2VYVD 3U49A 3I9KA 1T4BA 4R51A 2FR0A 2X0RA 3MJVA 3FNHA 3D4PA 4DBVO 5DULA 4ALIA 3DMTA 4YT2A 4YB8A 1LDMA 3V1YA 3KV3O 3OIFA 1E7MA 5TF4A 4W99A 1DSSG 4A2CA 3DMYA 3VZPA 3AU8A 2DQ4A 3A4VA 3Q11A 2OO5A 5CEEA 2CNBA 3GRKA 3S2FA 1LDYA 1VJ0A 3U62A 4YYZA 8ADHA 1Z73A 1B26A 1HWYA 3SXPA 4XYMA 5ENDA 1WZIA 1H0KA 1ZJYA 1MLDA 4J2OA 4D3DA 1NP3A 1ZXLA 2RAFA 3BAZA 3OFSA 4N18A 1JDJA 1KIFA 3QWHA 5IDQA 4PLCA 2IODA 3VOSA 2V6BA 3O8QA 4PZCA 1F8FA 3DDNA 2OXIA 4XR9A 2B35A 4LK3A 4MOWA 2EJWA 2I5PO 4IQ8A 5DOZA 2PR2A 4HY3A 5ICMA 3PLNA 3I9NA 1SAYA 5LDGA 4J0FA 4RF2A 3RSHA 5B1YA 3D3WB 5K6AC 3D4OA 5IDXA 3GEMA 1CRWG 2BGKA 2FZWA 4J9UE 2PTGA 5T6BA 3VPGA 3FNEA 3QRWA 4E4YA 4ZQEA 3DBHA 4NK4A 1EBFA 3TZKA 1UZLA 1UR5A 5A3JA 2PZLA 3VZRA 1NPYA 5A05A 3PXXA 4B3IA 1FF9A 1PIWA 3D7LA 2W90A 3O8QB 4E30A 4LSWA 1I2BA 1JAYA 1E6UA 3DOOA 3KEQA 4HNHA 4C7KA 2LDXA 2PNFA 3L0DA 3ZHBA 2PKQP 2YY7A 3K6JA 2BD0A 4ZVVA 1A72A 4BHTA 4CMJA 2I99A 3RD5A 4PG6A 3H5NA 1UAYA 1BRMA 4OJNA 2X5KO 2ZTLA 4ILKA 1HSZA 4PLVA 4J1SA 3EVTA 3WNQA 3QWAA 3PLRA 1QV7A 3NTRA 1ISJA 1WAMA 3BTOA 4CR6A 1E1KA 3ANLA 1IZ0A 1BXKA 4EGFA 1E3LA 3ITKA 4LVCA 1T4DA 2H63A 4WNCA 3Q0EA 5CEJA 4IPTA 4DIFA 1O95A 3ON5A 2DM6A 3JCZA 2AQIA 5L9AA 1M76A 5CHEA 1XIVA 2PZJA 5TIIA 4UUOA 4CM7A 1NTOA 4J3FA 3RIHA 2C2YA 2Q50A 4XQGA 1HSOA 1U7HA 3D3WA 3IP3A 3VVBA 3F4BA 3R3SA 1R66A 3RASA 4YT4A 3DFUA 5GZ6A 2YHIB 2O3UA 4MVJD 2RH8A 4ND1A 5L95A 1MFZA 3D3EA 3S8MA 4E31A 1ZUD1 2YHIA 3F9IA 1XWFA 5B12A 1S7CA 1YRLA 2UUPA 5LCXA 5DZSA 3OHSX 3PK0A 4KUGA 3HN2A 4J7UA 1K6XA 4ALJA 1OFGA 4O5OA 4LN1A 2BHLA 2QQ5A 4A5OA 3AM4A 1ISGA 1C14A 2ZJ1A 3GDFA 1ZJZA 2GSDA 1UP7A 3DTYA 4J6FA 3AUTA 5G0WA 3W8FA 1FK8A 3QVWA 4CR7A 4IQ0A 2HUNA 1T26A 4R9RA 2C59A 1GQ2A 4PLHA 4MVJF 3Q9NA 3TZQA 3GPDG 1AN9A 1HTBA 5B4VA 1K89A 4FFRA 1U8FO 1A4IA 4NBTA 2DC1A 4B3HA 5MDHA 2EEZA 5EQDA 4E6PA 1XU7A 3WG9A 1A9YA 1P3DA 1QP8A 4E2ZA 2BFAA 5KNLA 1ZMTA 3NAQA 3O4RA 4IQGA 4BNXA 1H2BA 5IXYA 2HMTA 3OP4A 1EVJA 4FOSA 3WQQA 1E92A 1I30A 3WYBA 4G2NA 1DAOA 4ZQFA 3AOGA 4PGFA 3C8MA 2XXBA 2RBEA 2Q2WA 4XWYA 7ADHA 3NRCA 3NDJA 2W4QA 4EJ6A 2VZ0A 4PG7A 4ZICA 1GYPA 2WYWA 1T2FA 2JHGA 3CXRA 2X4GA 3PHIA 4Z0TA 1NHGA 4BGUA 4BOYA 4JBIA 5TT1A 5C7IO 4RLHA 2GN8A 4TQGA 1QLHA 1DJNA 1NX6A 2VHZA 3I83A 5CP8A 1TB4A 3JQ9C 3A28A 1DHTA 3A06A 1BVRA 3R6DA 1FDTA 1E1LA 4XYBA 1QRRA 1W6UA 3P2YA 3G3EA 5EERA 5EL0A 5JDCC 5KTKA 4XA8A 1LUAA 2IZ0A 2DU8A 1OC2A 4AJIA 3UGKA 3KHUA 2YV2A 3PIDA 1H6AA 1DRVA 4XQCA 4RCVA 4CMBA 1HDZA 1UXKA 4R1TA 4RVDA 5KOIA 1GV0A 2C07A 4BV9A 3SX2A 1N7GA 1DC3A 3ADPA 1A71A 3OQ6A 4J7CA 5ER9A 4XGIA 2CVOA 1YL6A 1J0XO 4PG4A 2JCXA 3JQFC 3PJGA 4B7UA 4RLSA 2V65A 1UP6A 4G65A 4M86A 4BMNA 4IZIA 3SC4A 4KDEA 5I9NA 1N2SA 2WEKA 3FHLA 4PRLA 4Z6KA 3Q1LA 3EW7A 2EF1A 2CVQA 2O3QA 2QRLA 4CLRB 3GVHA 1P45A 1WLYA 2UAGA 2XOXA 4NDNE 5AVOA 4L4XA 1DFIA 4C7JA 1SZJG 1WDKA 4KQWA 1V3TA 1YDEA 4MVJA 4BVAA 4N5MA 4QO8A 1GQYA 4YA6A 3ZWWA 4BKUA 3GEDA 2YZ7A 1M67A 3P19A 1V35A 4BKPA 2HQ1A 3KM0A 4GL4A 3AI1A 4GQAA 1PQWA 1E7RA 1EK6A 1E3WA 3WNVA 1H5QA 1JVBA 2P4QA 2HAEA 3PRJA 4GBJA 2VRCA 1GTMA 4E21A 1YKFA 1E3WB 4FC6A 3IQDB 4W82A 3O26A 1NFQA 1BW9A 1BHSA 1H6DA 3CINA 3H2ZA 3ITDA 4KUHA 2Y66A 1D4FA 1CWUA 1ZKMA 2I67A 3K96A 5IDYA 4M89A 1I24A 4IINA 1GPDG 2FWMX 2WMDA 3I3OA 5CDUA 4MVJG 2HMVA 3IJRA 1Y8RA 2X0NA 2EP7A 4DA9A 4OXNA 4DREA 3VZQA 5BNIA 3KXDA 3C1AA 3WOHA 3WQSB 1KC1A 5DF1A 1K6IA 1TI7A 2PLAA 5JYEA 3W8DA 4BKRA 1YOVA 2JFGA 4U0JA 4XKJA 3ROMA 1XHLA 3C7AA 3GGPA 3W4JA 1ADCA 3GZNB 2O4CA 1YJ8A 1EUDA 1FMCA 3JQCA 1SOWA 3RC9A 4D7AA 3KETA 3JQ6A 4Z3DA 1VL0A 3T7CA 3VZSA 1P1HA 3WTCA 3LU1A 3ZI0A 4D44A 1B8VA 4YRDA 3I52A 3GAZA 3L6DA 3GGGA 4WKGA 1BMDA 1Y5RA 4WK6A 3RFTA 3C1OA 3JTMA 2NTVA 5AQ1A 4K26A 1HDRA 1NYTA 4ZQBA 4XJTA 5B4UA 5JC1A 1Y9AA 3DONA 3C3XA 3DOCA 3L9WA 2RH4A 3N74A 1UXIA 1WVGA 2C54A 2YDXA 3NX4A 4FFPA 3DZGA 2BGMA 4GLOA 1DAPA 4DPKA 6LDHA 1U2DA 2A35A 2CDAA 4DMMA 1RYDA 4NJOA 1ZK2A 5KWEA 4CM9D 5KVCA 4CLEA 3I9MA 5DBGA 2GRAA 3A14A 2ZB7A 3DZBA 2EWMA 2I76A 4W7HA 3RCBA 3IIEA 3GHYA 1I32A 1AHHA 3H3JA 1HDGO 1JA9A 4RPGA 4UVIA 1ENZA 1NQAO 5THQA 4B79A 4YTEA 5U4QA 1CQJA 3DAGA 5L4NA 3ROPA 4JCOA 4CMEC 4R5HA 1SOVA 1BGVA 4Q3CA 1EE2A 3HQ4O 1ZCJA 2DTDA 2CY0A 3LVFO 3MWDB 4UVGA 3UVEA 7MDHA 1E7WA 1TT5A 1CDOA 2OHXA 4FS3A 3WGQA 3AUAA 1IPFA 4XRGA 5DT9A 5A9TA 4OL9A 2I3GA 4YBZA 1GEGA 4E2YA 1U5AA 3FR7A 5MGBA 5F1PA 1EEHA 2AHRA 4C4OA 2HK8A 4CV3A 4QECA 4NJMB 1CEQA 4I08A 4MVJH 1NBOA 2OZPA 3KBOA 1B3RA 1MXHA 1B16A 1PGJA 3IDSA 3RI3A 3SBOA 2YFQA 2E82A 1ZH8A 1J6UA 3GNQA 1P74A 3F5QA 2DPGA 3NTQA 4CUKA 4H3VA 3F1KA 1ZK4A 4BO5A 4GKVA 2GR9A 1RM0A 5JE8A 4ITUA 4QO7A 4JJGA 3RBXA 3U3XA 3VHRA 3W4IA 4YR9A 4XEHA 1ARZA 3W6UA 4J4HA 4CM9A 1MGOA 2WYVA 3JQBC 2VTEA 3LF2A 3AI2A 5ER6A 3UOGA 5BSHA 1T25A 3ZNQA 4Y9DA 4FFMA 4I8XA 4FCCA 3ZZNA 4IDBA 4YT5A 3CE6A 3RROA 4FIZA 2DLDA 2J5KA 3JQ7A 5T67A 1GCOA 1T1RA 4CQMD 2VWPA 2VWQA 1X7GA 1LRJA 1YS4A 4GWGA 5DNAA 1JAXA 3UUWA 3COSA 5ITVA 4BNNA 4B3JA 1F06A 4XX0A 1DOHA 1F12A 1EBUA 3OJFA 2Q2QA 3OJLA 2FPIA 3GPIA 2VCYA 3VDQA 4ESOA 5ILOA 3ZWXA 4BNJA 2J6IA 2GD1O 1ID1A 4HADA 4CQMB 3WGHA 3WQRA 1N1GA 3GRPA 4NJMA 3HZZA 1IE3A 5I9MA 2HK7A 3WMXA 4W7IA 2HJSA 2J5QA 3FWNA 3WLFA 4MINA 1BVUA 4GX2A 3ZDFA 1IUKA 2FOIA 2AEFA 3G1UA 1BG6A 4FPXA 4KWIA 4YJFB 4KDFA 5A5EA 4NMHA 3DBRB 2VOJA 3BMNA 3LC7O 4LMRA 4HBGA 3PYXA 4R1SA 4R54A 4YJFA 2PA3A 4D3FA 3A1NA 4BO8A 3BMCA 2WTBA 9LDTA 4GKBA 1DIGA 1X0VA 1DC6A 2GN4A 1NR7A 1YB5A 2GPTA 3JYOA 4D0SA 4TKMA 1QYDA 2VHYA 1GCUA 4U6QA 1B0AA 2UUOA 2JFFA 4GAEA 2VYNA 5G0TA 4XYEA 4DQVA 4FD3A 1OI7A 1K5HA 3L9XA 4QXMA 4MP6A 4IS2A 5HS4A 4BKQA 5I7VA 1RM4A 2ZB4A 4D0RA 3RUEA 4R68A 1HXHA 1HT0A 3ASVA 3RWBA 3JQAD 3E9NA 4I9UA 3TN7A 5IAAA 2NV6A 3P2OA 4A27A 5G4KA 1ZNQO 4ZU3A 3O38A 2NU6A 4AJJA 2JHFA 1WPQA 1X1TA 1OMOA 2VRCD 4A26A 3K92A 4J4TA 4QQRA 1E3EA 2ZK7A 5KJ6A 1WXDA 3WYEA 2YV3A 5B4TA 4YAKA 4F6LA 1ZXBA 1JTVA 4PLWA 1IL0A 3VKUA 1ENYA 1GUZA 4OKIA 3OSUA 4AJ1A 2YQ5A 5CEFA 1T2AA 2Z1NA 3AWDA 3PJFA 3GMSA 1YBVA 4Q3DA 4R69A 2HRBA 4DC0A 2HMSA 3UW3A 2BI7A 2EG9A 3PYMA 3NJ8A 4OHUA 3TOZA 2W2LA 5A5FA 1I3LA 3CTMA 1MG0A 5DP1A 1D3AA 4D3SA 3VH4A 2WE8A 3ENKA 5DDIP 2HLPA 1GYQA 2X6TA 2AQKA 5G0UA 3ZWAA 1X7DA 2IYOA 3WWYA 4YQZA 3G0OA 4D43A 1KVRA 4PLTA 4DWVA 3S1LA 2RHCA 1KETA 1LTHR 3K9QO 4PLZA 3C7CB 4URFA 4JROA 4P4GA 1DIHA 2PZMA 3OQ1A 2D0IA 5DOVA 4ALNA 4WASA 4WUVA 5IJZA 3FR8A 1A9ZA 2R00A 4MKRA 2D1YA 4ND5A 4Q3BA 4Y67A 4RVGA 4MVJE 4OH1A 1UZMA 4RL6A 3TNLA 5AOVA 4P38A 2I65A 2B5WA 1Z7EA 1L7EA 5CDGA 3ZU4A 4YWJA 1PJ3A 2PH5A 4WCFB 3GC6A 3MJTA 1R0SA 4YACA 3JQGB 3W8EA 1E1NA 3LQFA 4BNGA 3E5RA 1VE9A 1KEUA 4PLFA 4M49A 2OP0A 4B4WA 3JQGA 2AW5A 4BNWA 4GX1A 3LT2A 4FDAA 2O2YA 3ZWCA 4E3ZA 2WE7A 1QYVA 4B4VA 2QZ9A 3FCOA 4O6VA 1EUCA 2X8LA 3X2FA 4GSKA 1HL3A 1PL8A 4E5NA 1Z45A 1ZEMA 1RPNA 1ZSNA 5EIOA 3QHAA 1MXFA 1QMGA 3QV1A 3VTFA 1DRUA 1JN0A 2FY8A 1X15A 4ZJUA 2W2KA 5F5NA 4O1MA 2O3TA 1HDCA 2PFGA 5U1PA 4H15A 4XQ9A 3OJEA 4TMFA 3WR5A 2BI8A 3V1UA 1HZJA 2EW8A 4RDHA 4ZGWA 4DQUA 3MWEB 5JBIA 4CM8A 1DDOA 3GZNA 3ZNNA 4BNFA 4YDRA 3AUSA 4CUJA 1KYQA 5IN5A 2C7GA 3PVZA 3INGA 1WMBA 2AXQA 2IXBA 4UEOA 2TMDA 4RZHA 1XQ6A 2D2IA 4MJLA 2YFHA 1F0YA 4WCFC 5JXWA 4KZPA 1C1XA 3EHEA 4OKNA 2AQ8A 1ZO8A 2GN6A 5A04A 2J3IA 4YAJA 3HDHA 3WBBA 5JSFA 1Y9EA 3OIDA 3KYDB 3F6YA 1KY4A 5DBIA 4G81A 2CMDA 2ZYGA 5EESA 1HF3A 3KYCA 2NSDA 3GA0A 1Y1PA 3X2EA 4PZDA 2CDCA 1E5QA 2GYYA 1LLQA 2GZ3A 3ZN2A 3RQSA 2EHDA 1JWAB 2I66A 3K2BA 4ZQGA 5KCZA 4M54A 3DB2A 3KO8A 4Y6PA 4E2WA 3JQ8A 3ULKA 4BQPA 5A4DA 3H65A 3PWZA 4IXWA 1GPJA 4E33A 3HHPA 4CMIB 5JS6A 1G6KA 3H2SA 3I23A 4CMHA 1PWZA 2Y05A 4IGEA 3ZU5A 3W6ZA 4HFJA 2B36A 1LDBA 1M66A 3OJ0A 3PGXA 4Q3NA 4Z9FA 1YQGA 3VPHA 5L40A 3GN1A 2QHXA 1LSUA 1PGQA 1BTOA 2NVWA 3GUCA 3VPSA 3HN7A 4J16A 3UN1A 4GMGA 4CQLA 1NXQA 5JAMA 4MP8A 4Z9YA 3WIDA 1Z75A 3AK4A 3DZHA 4PLPA 3BHMA 1KVTA 1GYRA 2JD2A 2XXJA 1ISIA 2O50A 3H5RA 5JW6A 2D59A 3C85A 1E3SA 1IOLA 4S1VA 4CM5A 4D42A 3A9WA 3DTTA 4L8VA 4NFYA 1UP4A 4P8RA 4KMSA 2NUAA 4BNHA 4A73A 4LRSB 1C1DA 4DIOA 3CZRA 4WCDA 1ZMOA 2B69A 2BF7A 5A9RA 1CETA 1DIBA 1G0NA 5TJ9A 1D1SA 1XSEA 3KLMX 1Q0QA 5COQA 2F00A 2FP4A 4JIGA 5C3MA 3PDJA 4BO4A 1HETA 4BMSA 4CQMA 4YAEA 1YH3A 3WGYA 3ZHZA 3KYDA 1FDUA 1NASA 3JQEA 1LA2A 2Q1UA 3G1TA 3QE3A 1SEPA 3BMQA 4R3WA 4BUCA 2VZ9A 1DRWA 4FGWA 3ST7A 2EKPA 2OL4A 2H9IA 4MVJI 3HG7A 3RVDA 4BNKA 4HNGA 2ZCVA 2O7QA 3DBLA 3BTVA 1DJQA 3GVCA 2G17A 3AW9A 2EV9A 2QRKA 2ET6A 3EYWA 1E0DA 3INRA 4IUYA 2OOSA 3OJOA 5U9CA 3GFGA 3B20A 2X5JO 4GGPA 2NADA 2ZQZA 4TRJA 2IRWA 4BGEA 4JK3A 1PGNA 4FN4A 1H9AA 3KSUA 3OH8A 1P9LA 4PVDA 4AJLA 3JD3A 3ICPA 3KTDA 2NLOA 4DC1A 3PIIA 3PEFA 2UV8A 1GADO 4CL8A 2BFMA 4NHEA 4BNTA 1LXCA 4UVEA 4CMAA 4FJ0A 2OP1A 3PTZA 4NU5A 4CM1A 4IXTA 2YYYA 2NNLD 4B7CA 1A4UA 3D5TA 2C82A 1LLDA 3KUXA 1DIAA 3E9QA 5IN4A 2YV1A 4E13A 3FNFA 4LVUA 1SCUA 5JCJD 4BO6A 1MG5A 1O9BA 5BR7A 2GZ1A 1PWXA 1DBVO 2V6GA 3V5NA 4IDFA 5L53A 2P4HX 2C29D 2YHUA 3MTJA 4UEKA 1PQUA 3WB9A 4NBVA 1B3BA 2HKIA 3IL2A 1P1KA 3Q9UA 4X54A 3GEGA 4A7PA 3S2IA 1YONA 3DHNA 4R1UA 4XDYA 2EGHA 3R3JA 5COAA 4HUJA 4RF3A 1YDWA 4WLOA 4RF4A 1X0XA 1T2DA 1S6YA 3B70A 3WYCA 5JMWA 3H9GA 1NAHA 4BNIA 2P9GA 4AJNA 4CLHA 1BDBA 1ADGA 2IEBA 2PD3A 2G76A 2Y1DA 5TJHA 1YBAA 2ZQYA 4I9HA 1EMDA 1AHIA 5DCUA 1ENPA 4FJ1A 2QYSA 1I5RA 3RUCA 5A02A 4DUPA 2PD4A 1IYZA 5FF9A 1BXGB 1YL7A 5AYVA 2DVMA 3W4KA 1DFGA 4UREA 1NPTO 3L6EA 3DFZA 2B4TO 1M2WA 1NVGA 3ROKA 2D5CA 4ID9A 2CF5A 1QLJA 3WX0A 2HDHA 3JQAA 3JD1A 1DFHA 1K3TA 4WLUA 4AJ2A 4RDIA 5JLAA 4BMVA 1SC6A 3PI7A 2NM0A 3C7DB 2X9VA 4I5DA 4QSMA 4WOJA 2Y99A 3NJ4A 1Y8QB 5KKAA 5I7FA 1JQBA 3FNGA 4OYRA 3U4HA 2HRZA 2Y1CA 4YJHA 3ZWMA 4FB5A 4CUZA 5FWNA 3WWZA 2NU7A 4NIMA 1HDXA 4E0BA 2R6JA 1DLJA 2O23A 5CAEA 4NR0A 3DZKA 4K28A 1U3UA 3GZ4A 3OA0A 4RO0A 1E3JA 4U6SA 2GERA 4EJ0A 3PJDA 3Q2KA 1E5LA 1TEHA 3AU9A 2O48X 3OICA 4CMIA 4CM4B 1VM6A 1ISFA 2B4RO 1E6EA 3S2GA 3UH1A 1M75A 1LDGA 1V6AA 3ZU2A 3QW2A 1I3KA 4KQXA 1VJTA 4PVCA 5CG2A 2NTNA 4F45A 1ONNA 3IC5A 3K5PA 1H94A 4R1NA 1B8PA 3L6OO 4IS3A 1XEAA 5TSDA 3V2UA 2FR8A 2CFCA 1WP4A 1U8XX 1VC2A 1PSDA 4A0SA 4CMCA 3PPIA 3MOIA 1R4MB 3HB4X 4CLXA 2QRJA 2ZTVA 1G0OA 1EQ2A 4JN6B 1NVMB 1YE3A 4UAGA 1P1JA 1ZZEA 3EK2A 4BNMA 1AUPA 4XGKA 2B37A 1DEHA 4OSOA 2B0JA 2PGJA 3TL2A 1OC4A 1JKFA 3VAZA 8LDHA 4RQTA 1RYEA 1R16A 1TT7A 5F5LA 5L4LA 2Z5LA 2PWZA 4MIOA 3V1TC 1GDHA 4XYLA 3K8ZA 2X23A 1DO8A 1UXJA 2VWGA 1YL5A 3OQBA 2ZCUA 4BV8A 2DKNA 3U5TA 1N1EA 3GH3A 3LDHA 4BGVA 3EVNA 3NKLA 3RUHA 3QIVA 3EZYA 4IMPA 1E7SA 4EEZA 4D45A 2G1UA 1LLCA 3ZWYA 3OM9A 1P31A 3DO5A 4MIEA 4RVHA 3KB6A 1N7HA 1PTJA 1U4SA 2Y0DA 3NT5A 4IJVA 2HU2A 2C5AA 4Z3KA 1EUZA 5HWSA 1QG6A 4AJOA 2A9FA 5HTOA 4TRMA 1GU7A 1X1EA 4CV1A 3JQFA 2AG5A 5F1OA 5K9ZA 1MFPA 2AEJA 2NU8A 1ZFNA 4LW8A 1R12A 2CDBA 4ZN6A 4YQYA 3GHHA 1B15A 5TGDA 1LSOA 3ZW8A 3AM3A 3WJAA 2PV7A 2UYYA 1SBYA 4UUPA 2OBNA 1WDLA 1IULA 4B8WA 3EY4A 1HE4A 3DEYX 5DCYA 3AY7A 1VPDA 4DLLA 2WSBA 2Y68A 4XR4A 5F1KA 1YVEI 3UCFA 4Z9XA 5G0VA 4INAA 5T64A 4OM8A 4BIIA 2VNSA 3ZV3A 1PJSA 1V9LA 1DHRA 2NVBA 4BNLA 1NQOA 3F1LA 3FD8A 2FPGA 2DPHA 4RV9A 3RC1A 1SNYA 2EIHA 2ZYDA 3K31A 3QJ5A 5L3ZA 3JQ9A 1JKJA 1X14A 2DUWA 3U4DA 3MJ4A 2YW9A 4KTTE 1VKOA 2HMUA 3RKRA 1UXHA 1LJ8A 1UUFA 2VHVA 4CMEA 5BNFA 4OO3A 4AL4A 1XELA 3GDGA 1EVYA 3NYWA 4WECA 1V8BA 3B1KA 2ILTA 1Y7TA 1PZFA 3G79A 4OQYA 1EDOA 5JC8A 2AA3A 4CV0A 5JYDA 1U3VA 4PLYA 3LYLA 1UH5A 2B4QA 2AE2A 1CERA 2FSVA 1BXGA 5A06A 2GUGA 3E6AA 4NU6A 2C0CA 4CODB 5BSFA 3NDIA 1E3IA 5EQFA 3DBVO 3DQPA 5FI5A 3S2EA 5JDIA 1C0KA 3FTPA 3UKOA 3P5SA 5A9SB 1RM3A 2HSDA 3HB5X 2NQTA 2RCYA 1UZNA 2VUSA 3JD0A 4DLAA 2C5EA 2F1KA 3H8VA 4AJPA 1ENOA 3FPCA 1KEPA 3N7UA 3ORFA 4RPLA 5F21A 3AY3A 4UEJA 3KOUA 5IG2A 1LX6A 4XIJA 3ZCXA 3EDMA 1P77A 1NM5A 1HKUA 3SLKA 3NEPX 1GR0A 3GF4A 1ZK1A 5EN4A 3WTBA 3E1KA 4CM3A 1AXGA 2VUUA 3CKYA 5EINA 4CLOA 3EAGA 3B1JA 3SJ7A 2VN8A 3ONEA 1E1MA 5TQVA 1C0PA 1FDWA 4WEQA 3PFFA 2CF6A 5EPOA 5JO0A 3OF2A 1GUYA 4EUHA 2GDZA 5L7TA 1LC0A 1Y8RB 3BIOA 1ULUA 2Z1MA 2IDZA 2PGLA 4AICA 3T4EA 1XLTA 4WCFA 1VL6A 3ZWPA 2QX7A 5KVQA 3MJSA 5TC4A 3I9LA 5CDTA 3Q2IA 4FW8A 3RC7A 3DHYA 4RPJA 2SCUA 1BDMA 1SO8A 1R4MA 2QG4A 3HSKA 3I6QA 3D0OA 5BNTA 1H9BA 1OAAA 1VJ1A 4GPD1 4MKXA 1R15A 4CMGA 4Y8VA 1RKXA 5G0SA 2IXAA 2DBQA 1EQUA 1T24A 1U3TA 2FPPA 4LISA 1AGNA 3E03A 2V6FA 5CDSA 3WMWA 4L75A 2O4UX 3GVXA 5AXDA 3BMOA 1NQTA 1R0KA 3BYZA 3HNPA 1FJHA 4MDHA 1J49A 1SB9A 3QWBA 5I7SA 2X86A 3JQDA 3PP8A 4L9RA 4O59O 3RJ5A 1U4OA 2GZ2A 3EMKA 3PZRA 3UAGA 1E7YA 5KIAA 2EGGA 2QYTA 2VHWA 4U0KA 5T8KC 3JYPA 4DQXA 4ALMA 3RUFA 4BO7A 4CMKA 4QX6A 4OAQA 2WDZA 3UCEA 2V6MA 2BH9A 2ZTUA 3TZCA 1NAIA 1MB4A 3HWRA 4AJEA 5IZCA 2EJVA 1UDBA 4E5KA 2AQHA 1D8AA 3ETGA 4Y98A 4OOEA 4NPCA 1O94A 4TZTA 4KP7A 3IKTA 1PJCA 3GY0A 4AJKA 3GR6A 1V0JA 3JYQA 4KWHA 1KERA 1Q7GA 3LLSA 4QTZA 3MTGA 4XB2A 2X22A 4N5LA 3ZHYA 2X0JA 4ZQHA 1PGPA 2WD7A 4NBRA 4EEXA 2QZZA 1CF2O 3L4SO 4P22A 3CUKA 1YBMA 2VHXA 3TJRA 3WS7A 2P9EA 2YJZA 4NFHA 3WGOA 2DTXA 3Q6IA 1LQTA 3H9UA 4NI5A 2ZTMA 3TL3A 4XIYA 1ADBA 4RORA 2DAPA 2GN9A 4II3A 4CQLB 3FRJA 3BTSA 2Q4EA 3E5MA 1GFSA 1GZ3A 2E4AA 2UDPA 1KVUA 1KVQA 2Z95A 3QVSA 1LDEA 4OXKA 5DBFA 1JLLA 3DAPA 1ONOA 5JNLA 3MCVA 3WGZA 4R3NA 4FOOA 4OMUA 3PWSA 4BNVA 3U0BA 3D4NA
chains in the Genus database with same CATH superfamily
1RKUA 4ALKA 2Y0PA 5JAQA 2IUEA 4JI6B 1YDMA 2ZRCA 1ACMA 3M1AA 3PQ2A 4BLVA 5KX5B 3PHLA 4HPXB 1K7YA 2NQ8A 1E96A 2GCEA 4K9QA 3WB2A 2OYCA 3QH4A 1WTAA 2Z9BA 1K5DA 2GAFA 4O0LA 1J8FA 1WOYA 2Q46A 3TUZC 4TVBA 1BE6A 4R40A 4RPHA 2F4NA 3UF0A 5B53A 5IYZB 1NY6A 3FCUB 1KE2A 5TLSA 3SJZA 1P9OA 5DI9A 1XXHB 1Z82A 3DYBA 3KKKA 3TD2A 5IFLA 3BRSA 1Q6YA 2XB6A 1KQNA 4ECAA 5BPFA 4Q18A 1R10A 1FRFS 1TTHA 1UAGA 2JH8A 3W9UA 2R68A 3M6FA 3GLTA 2FZ4A 2GEFA 3MRXA 1QNFA 1YMUA 3V4PB 4Y3UA 4ZEXA 1QFJA 4PHHA 2FNAA 2IH5A 4YRMA 2CJPA 2D0DA 5ILQA 3TWOA 4ARBA 4ZGGA 3OD1A 3SVTA 2Y27A 2JLZA 1BU8A 1RBQA 3WGNA 5KYXB 2O8EB 4HX9A 1LRKA 1VG1A 4I1SA 4I1IA 4QWWA 1WEKA 6ABPA 2O8CA 1AIPA 1TT5B 4D9JA 2BGUA 2C4WA 2JFZA 4FC7A 4A8JA 4WA8A 4Y2UA 3UM9A 1E3DA 1NVDA 2PO5A 3EASA 4IJMA 4MUGA 5KTSA 4MLZA 4CE6A 1WXEA 3E9RA 4JKYA 4J03A 3BGOS 4NBWA 1I3NA 1L7PA 4QYXA 5BSVA 2NIPA 3ZVMA 4BO1A 5I9IA 1WBDA 2YXNA 1GNTA 1WSDA 4WEOA 5JWHA 3I9FA 2PRYA 3Q3VA 1M8KA 5DSTA 1IPHA 4WNYA 5H7XA 3WHKA 4C05A 1DWPA 2I7VA 2Y6UA 3AJ8A 3BE8A 5E1MA 2HDNB 2WJPA 4CF3A 3B6KA 1DV2A 3PKZA 2E37A 2JNWA 4K9MA 1PJTA 1QCCA 3C3MA 4NE2A 1T4GA 3DV0A 4LCEA 4IDHA 3U9LA 4E2XA 4EHBA 2RGGA 4IDCA 1TGYA 1J5XA 2A88A 3SZRA 3EZLA 1G2PA 3JZMA 4PCVA 1HYEA 1KORA 2W6JD 1JU3A 1V3VA 3RUDA 1VCHA 2OYRA 2G5GX 1CNMA 2CD7A 4FQ7A 5KYNA 2HJVA 4JEMA 2GCOB 4MCHA 3DAOA 3IR6A 4EY5A 4F4UA 4UARA 1V8ZA 2EJBA 2VPXA 3M6XA 5CDFE 2ZCJA 3CMCO 4MDEA 4Z0NA 5DSXA 4PZEA 1G4UR 4OGWA 3SHTA 1CUJA 4MQFA 4HAYA 4W8GA 5DLYA 4ZU1X 3WLHA 1A9SA 4QM7A 1RW4A 3HO8A 5DTMA 1Z5ZA 2YZ2A 1SXGA 2OM6A 4RAQA 4TRRA 4F2DA 3AKCA 3OLQA 3UENA 3RVQA 2GNAA 1F6DA 5CLQA 1EUYA 5JDCA 4G0WA 2PUHA 3GGSA 2ZIUB 1Y1LA 4X90A 3HXLA 2LDBA 2GPYA 2HXGA 3K0AB 4CG2A 1R00A 4RF5A 3EGEA 4P4NA 5HKBA 1UT6A 1RPZA 3NBYC 4DLTA 1NM5C 4ZVOA 2NN3C 1JFTA 4WY2A 4R7ZA 1QH8B 4AO7A 1QIHA 4W5TA 4EHAA 1AKUA 4EABA 3SC3A 3T9DA 1L4KA 1QO9A 2J3LA 4BY9E 3LQ1A 4ZAWA 3MOGA 1I3MA 3V34A 4AP5A 3CF4G 2EXXA 1J5PA 1EJBA 3AUYA 4RLQA 1O6ZA 4N0MA 1Z16A 5ALHA 3JVVA 1Z0IA 2IXDA 5AW9A 4BFLA 2H0RA 5HUHA 1KH3A 4R8MA 2ZYRA 3O73A 3SE0A 4PX2A 3AZQA 3QUSA 4WFKA 4NK5A 1Z18A 4JUFA 4HYYA 1HYHA 5DXFA 3EC7A 3ZHBA 2QTHA 3GJ6A 3BAFA 1JKIA 2XNDD 3AFIA 3H5LA 4MLDA 3AOEC 3W04A 4E22A 2F1JA 1JBEA 3T4XA 2QMOA 3DMRA 3LBIA 3U7EB 1CUYA 2NUTA 3PHJA 3K20A 1LK5A 2G72A 4ZXPA 1US8B 2G7ZA 1TNDA 3USZA 1RI3A 4HLQB 5CG1A 1C0LA 3ENNA 5E9WA 3WDLA 3K9GA 3QE4A 4OHCA 1OFTA 1DLIA 5C34B 3QXCA 1C5KA 3MB8A 3X44A 1KA9H 3BXXA 3NAZA 3STTA 3NANA 1AS3A 1BE1A 1E64A 1QZTA 1T5SA 2ZTHA 3GRUA 3PWKA 3VJLA 4DE5A 3OKCA 1KH1A 2CXHA 2B7BA 3RYCB 1ODTC 4JT9A 3DYIA 1CG6A 3G7UA 2AC4A 1MIHA 4C0HA 4HR7A 4LRQA 1KJIA 2G0TA 5TGTA 1OZ0A 2Y71A 4HEQA 3TD6A 3RGGA 2UXBB 3H5OA 3TLKA 3DDUA 3IH5A 4KJZA 2ARKA 1EHYA 2FV8A 2P9YA 3NNSA 4BE7B 4AI6A 1ZU5A 1MR3F 1UJCA 5K0LA 1USWA 4HGRA 4JUAA 3ZCPA 4BQQA 1V5IA 4E15A 2XR1A 1GT91 3CU5A 3U7HB 3TKLA 1XN4A 1EK0A 2FWAA 4HN2A 5CW1A 2ZLBA 1N5DA 2GT1A 2QLJA 5L7YA 1RZVA 1MQSA 2NSYA 4G5HA 2HR1A 3R0IA 3LF1A 3G2IA 1YQDA 2FEXA 4PFKA 3BS4A 4RGBA 4RD0A 4YCDA 5ALQA 2WAXA 1CY2A 4NBKA 1VSQA 5CCDA 5BXQC 4JQOA 4OGKA 4QWMA 2IEDA 4WXYB 4HEHA 3TZBA 5LJLA 3EGOA 2QSJA 3VKGA 3QP9A 5DFAA 1FW8A 1RIIA 1XQ9A 2OO5C 1YAJA 3NH9A 3DWFA 3U13A 3RAEC 2XTAA 3EFOA 1A3CA 2PGXA 5CA1B 4FFOA 4DUGD 1KDZA 3ANTA 2GUWA 3WRWA 1G7CA 1S3IA 4YJDA 2OK8A 5JJ5A 5CX1A 1D6SA 3HRKA 4ZHQB 4QYWA 1JIQA 4JJFA 2WFZA 3IA2A 5A62A 2BZ0A 3I4CA 1JEJA 1DAGA 2ZB8A 1EFUA 1W47A 1HLDA 4GZ5A 4KRGA 5DXAA 1I6LA 4DY6A 1G19A 2GSWA 2PA0A 3DMFA 3VR4H 4TLDA 5TT0A 4YXFA 1R0YA 2DFTA 3GBSA 1C8KA 3R5KA 3MJFA 4OXQA 4EG3A 1IBRA 1HT2E 3OD5A 4G5RA 1TU0A 2QRHA 1N0IA 3K05A 4M8NE 1RJWA 1KYIA 2V7PA 3RC8A 2P0YA 4M0UA 4K6GA 1QB7A 1NYRA 3CQ9A 3R0ZA 3VVMA 4B6QA 4B6FA 1EKXA 3X2SA 3MZ0A 3D7SA 4DEVA 2NACA 5D5HA 1V6CA 4RVNA 3HUTA 4LGVA 3I2GA 3QPUA 5IBCA 2IYQA 2A86A 3PUWA 3C3DA 5BSKA 5I01A 1YFLA 3BH7A 3QVGA 3FYHA 4EUKA 5DVZA 3TTSA 3YASA 5KVAA 1NKTA 2ADOA 1V5EA 3L18A 4DSAA 2ZUTA 4AKTA 1E0KA 4DFDA 1U8EA 3D64A 4I1YA 3BMNB 3QF7A 1GP2A 3IMFA 2X7HA 2HSJA 2WLTA 3GVPA 1SPXA 5JS8A 1N8KA 3H5AA 4B80A 1MKYA 2YJGA 2UYGA 3QOWA 2O3SA 2AFHA 2OGSA 5AKGA 4ZRMA 2C7QA 1ZR2A 1CDDA 1UEIA 2YXPX 2IYPA 3ZZUA 3UC5A 1ISHA 4FN5A 4BMZA 4FUTA 3DDWA 3QNUA 4H0FA 4PS0A 5FA5A 1AD2A 3BJIC 1DKLA 1E8NA 1LBTA 1XRMA 5D3MB 4LMAA 4Z9BA 2XECA 1AQNA 4DDHA 3L7MA 3MWFA 1G21E 1G18A 1FYDA 1RI4A 1XYGA 3EUWA 5DLDA 3W9BA 3L7LA 2JAHA 4FE7A 4ARZA 4Q02A 5JAIA 3EWNA 3JARB 1LCIA 2F64A 5TX7A 4F5WA 1E8DA 3BMOB 3OZDA 4F3NA 2JFQA 5LZ7A 3TVYA 4XPIA 3QOFA 4Z8XA 4ESVA 1W5EA 4IHAA 2FPPB 1RKVA 4FXOA 4AZ0B 5EXDA 4RZXA 2OHJA 5E6SB 4HZUB 1WZCA 2ZPTX 4KQMA 5IDWA 1A27A 3AF1A 2R1TA 4NU8X 1ADFA 3FWZA 4EQ6B 2CXRA 1RRCA 1EM6A 2EW1A 3D7MA 4PNZA 1PHPA 1NNUA 1T36A 4UCWA 1ZRHA 3AVQA 3RSQA 4PC7A 3QX9A 4EVRA 3HSYA 3HVUA 3ORQA 5AW6A 1GPNA 4ZYWA 3KJIA 2AFRA 1Y5LA 4NHOA 2FN3A 3QMMA 4B3CA 2Z2ZA 4LZPA 1PJ4A 2MDTA 1W35A 3FSRA 2XQGA 3E82A 4F4HA 1SVMA 2Q5IA 1OFIA 3EBPA 4G5FA 5F7XA 2I4OA 4H77A 2C78A 3AEKA 2HBQA 1WM1A 2BHNA 2ILVA 1MH1A 4XQEA 4KQHA 4A1OA 1SOAA 5K0EA 3O47A 2FW7A 2X6RA 1A7JA 1JSRA 3FAKA 3RANA 3SLGA 2H29A 1O6CA 4IH1A 1BMFD 3T1NA 1CYEA 1JWBB 4RKEA 5KJEA 5A3QA 1T10A 4A03A 2QM8A 1ESNA 4GMFA 5ALLA 3H5TA 3IHWA 1XA0A 2EBFX 2JD0A 3T7JA 4ZZ3A 1IG0A 3L7BA 3NRBA 4DKXA 5HEKA 3NGLA 4FOPA 3B7GA 5B7NA 1RI1A 1WU7A 1H2ZA 1OREA 2ALJA 3CWCA 4QTTB 4ZVPA 1ZUNB 2EERA 4YQEA 3ZHTA 1RZRD 3V8QA 3VKVA 4B3MB 4ZOEA 3N3AC 3PYLA 4TVKA 1JLLB 1T6BY 1V2HE 2GM3A 2A9VA 3CLUD 1ZGZA 1U3WA 4C2BA 1P62B 1GKUB 2FQQA 2VVTA 2WUWE 2XHZA 2ZUBA 3L1HA 4KLAA 4OXXA 5E38A 5C3UA 4A3SA 1YZYA 5TVGA 4AJHA 3K4PA 3L7AA 4RZ3A 2BE7A 4IIUA 3C3EA 2NAFA 5KQMA 3P0HA 3VR4A 3WP0A 1Q1AA 1SJ9A 3O3CA 4O0MA 4TWRA 2V7VA 2PS1A 3A3KA 4CWAA 5IKOA 1EQAA 3EQ2A 3T99A 1XDSA 4U9HS 1G60A 3TQTA 2QSYA 4IGFA 2ESRA 4RFVA 2J0QA 2BSAA 2YRXA 1T3TA 4O4IA 1QTIA 1KFJB 1Y1TA 3IEXA 3TE7A 4UTOA 5AVZA 1XPJA 1OXXK 2JFBA 2R6GA 2Z57A 3B2QA 3S6JA 4EB6B 1FP4A 4IIYA 4AMUA 5K7SA 3ANMA 5IKMA 4J90A 2INGX 1H3EA 4UNIA 2BJVA 3NEAA 1U63A 4B47A 1RWPA 5FBKA 4F91B 1OH5A 4J43A 1ZM9A 4RXMA 3D5QA 3NIWA 3S44A 1CZHA 3TEMA 2AWOA 3G17A 2EKQA 3LOPA 4WK0B 1I13A 2Q3EA 1U4NA 1PS8A 4Z4IA 3HR8A 3T1OA 3ZWBA 3F67A 3K0EA 4F38A 1ZICA 3H7AA 3RK4A 1PN3A 4D4HA 4Q9NA 1IY8A 1P0IA 2HV8A 2H1SA 3BM5A 3KVNA 4YMIA 4TSKA 5CX4A 4YY3B 1K75A 1V8PA 4WGGA 1X1RA 4HQ6A 2XJ9A 2JASA 4KB5A 3ETCA 1W36B 1T9GR 2Q5OA 3DXZA 2BSXA 1R6AA 4OY3A 1I2CA 3TOXA 2WF6A 1JJAA 4LOKA 3M3DA 3WLNA 1ZCZA 1DPFA 4N7RA 4PZYA 1WMAA 4RQUA 1E5TA 1VL8A 3CEPB 4GPIB 1ACLA 4DPLA 3QVTA 2PD6A 1PLKA 3UO8B 4BQEA 3MJEA 4KGXA 4QNRA 3DZIA 1ODJA 2ZUVA 3LPLA 1VRWA 3P4YA 4OXYA 2FQWA 4ZDKA 5IMSA 5T57A 4MQLA 1QZXA 1GQFA 4M60A 4M88A 3LDGA 1MQ8B 1M6VB 2I3BA 1E79D 5EJGA 3D6TB 3DMTC 3HEBA 2QLFA 1MP0A 1QORA 4J76A 5HF8A 1PFGA 2VF7A 5K4AA 3R9KA 2C88A 4D8WA 4DZTA 3SBDA 5KTYA 4QGHA 2KBFA 2IYUA 3BA1A 4IOMA 2ZJ0A 1ZI6A 2C57A 1LV7A 4PV7A 4YFYA 3AILA 2Q1SA 1HRDA 4P33A 3UMBA 4B8YA 5CFNA 3RWOA 4RANA 1VL2A 4W7SA 3OZGA 1WWKA 1XPUA 1N32B 2DT8A 3U3DA 4OEHA 4FYYA 2H65A 4Y7DA 5J58A 1Q12A 2VZEA 3ONFA 3QEKA 4LJ4A 3K5IA 4B34A 1JT2A 3GLGA 3T1YB 2LNDA 1IHPA 3QY9A 4YCSA 2DY0A 4DDTA 5J23A 4QYTA 1OIXA 3V48A 1GY8A 5C53B 3L7JA 4YI3A 4C4RA 2C94A 3LP6A 3QYJA 4YVFA 4F6CA 2HO5A 2AW3A 5CXXA 4GH5A 1VA4A 4L76A 2WU1A 1WCV1 1WULS 4WZ6A 2MSWA 1BJRE 4X1IA 4X1YB 1E79A 3QI7A 3T34A 2W7TA 4GO1A 1KK2A 4AYXA 3K72B 1YTLA 5AW5A 2HFJA 4Y9SA 1E59A 3JQ7B 3KVOA 2EGUA 3LFTA 5CT9A 1CUVA 3OLYA 4WI1A 4DWJA 3B5JA 3PQDA 2XJ4A 1VXOA 4RVFA 3RO7A 2HWUA 1RQ2A 2VDKB 3L6BA 2M2IA 3A1CA 4KSYA 4YAIA 2X76A 1DBQA 3A6GA 2BJWA 3K1YA 2EFEB 1MJGM 3BJZA 3KJNA 2ZRPA 2PNJA 1PNQA 4DA4A 4FMCB 5UKDA 5KNBD 1MMFB 4RKRA 1PJLA 4ZRNA 3AZOA 3WP1B 3MC1A 2VJAA 3C3BA 4C4PA 2PL3A 1XVLA 1CJCA 2HBZA 3G8DA 3QU5A 1G66A 1GSOA 1MN6A 3G02A 3UTCA 4D79A 4NNPA 5LZ4A 4R41A 1IAVA 4M7RA 2VOEA 2YJ5A 3QVMA 4H7PA 4I36A 3SHFA 3D6AA 4N0EA 1OZGA 1VPEA 4RQAA 5EMJA 5G2OA 1AXEA 4YQFA 3CV3A 4A10A 1MDFA 3F6CA 1MA0A 1UBOS 1USVA 3IJPA 5JU6A 2R7LA 3PEEA 3VKHA 4B4UA 1NLMA 1PG2A 1T2NA 3C3PA 7REQA 1XCPA 1JPJA 4M8SA 2I78A 3NMUF 3VGPA 2RGEA 2EDAA 2DH6A 1V8DA 2H7VA 4H16A 3WFZA 1BJTA 2CK3D 1F60A 1EJ2A 2QT1A 1TJYA 2HK9A 4DIDA 2GXUA 5EJ2A 3CLHA 2QE7D 4ER0A 3BMCB 2J07A 4UOZA 2J3KA 1S7GA 1DKRA 2P5UA 4IX9A 4WLEA 2G40A 1C3LA 1K9SA 1ZONA 3I1IA 1ESEA 3JR3A 1XNGA 3BD6A 3JYNA 1RTTA 4I7EA 3X1MA 4DMLA 4QGSA 3PL5A 3O95A 5L7WA 1T3LA 4JP3A 4D9IA 3E8MA 4DSOA 2XUPA 4TLMB 3KB1A 1OIWA 2G5PA 1NVFA 4KPUB 2Q0QA 3KZVA 4IGKA 3R7FA 2E4XA 1PZNA 2PS0A 3I5MA 4R0VA 4RWZA 3GXBA 4UUMA 5LP6A 1FP2A 2AN1A 2OUIA 2ZWIA 4HD8A 1WCIB 2ATIA 3HKDB 5TRTA 1QTQA 2FN7A 1VI5A 2QLBA 4TS1A 2V0CA 5LP6B 1YGPA 1M8GA 3DZJA 1HG1A 1U9IC 3HCNA 1LI4A 2HXYA 3QA3E 1L4GA 4Q3AA 1L5KA 5JMPA 4K9LA 2VDRB 3NTOA 1GPUA 3IP5A 4JBXA 1GPMA 3E3AA 3EYAA 4HEJA 3U17A 3TXXA 4Y18A 2IE0A 2IP4A 2WQ6A 3RRMA 1ZITA 3FIUA 1TIKA 1NRWA 4CR8A 9GPBA 1RADA 1ZD2P 3F78A 1OKKD 1SR8A 3OMLA 2FUCA 4UM9D 3TW0A 4GYWA 1IJKA 1CYDA 4V3BA 1JJVA 4ND8B 4ROTA 3CW8X 3UMRA 3WGVA 3CGGA 1H8ED 4U2KA 4NEQA 2ZJFA 5AI4A 2W2LD 4DV2B 2OG2A 3VOBA 1FBTA 1L8OA 521PA 2NPFA 4ENSA 2WKRA 3S0JA 3O90A 1J22A 2BMEA 4LYFA 1KZYC 5CK5A 1ONSA 5FIUA 2FGJA 4A0GA 3F6EX 5CBKA 3HKCB 3N9IA 3IX7A 3UHPA 3D2CA 4G3XA 1EWQA 2CC2A 1WUHS 1IDOA 2NZXA 2ZJOA 3IPCA 1QAOA 2ZDGA 3KVVA 4W63A 4TYQA 4L3WA 2O8CB 3ZY2A 5HRAA 5KSYA 4URHA 2K4MA 1L8XA 3QFCA 3KOZA 3S8EA 1XZLA 5AJVB 1GZUA 1GIAA 1H0RA 2H9YA 3NBFA 4OIMA 5EJAA 3SJCA 1PYDA 1KC3A 2OBBA 3GYBA 1KDPA 1PV2A 2X8BA 2ZJ3A 3PPWA 2QRVB 3LA6A 1M34B 3L0YA 2GN2A 1QGED 2FRXA 2GPWA 2BR3A 3EXG1 1Y81A 4RM2A 5A4JA 3OQMA 3VYSB 4IIDA 3SEFA 2ZATA 3S2YA 3QFFA 4TMZA 4HQRA 1EWYA 5DYYA 1F9AA 4UPVA 2VTDA 1M1YA 3PUKA 3AFNA 1VFNA 3GQVA 3QITA 3RJ9A 4ZDIA 1BU5A 4XLTA 3QX8A 2EW2A 3WLJA 4EKGA 3EHDA 2D0PB 3FPBA 3RFXA 1E9AA 1E5XA 3EISA 4G1FA 1R7RA 2H2FA 1V45E 2C58A 4HDCA 1YA8A 1ZMXA 1NLYA 4L02A 2A1UB 2QL6A 3DQQA 4JSYA 5CJJA 3SKXA 1K88A 5E4TA 1IY9A 2H5LA 2J41A 3DCJA 4IHKA 1UDXA 4B6RA 1DI0A 3IUBA 1YAHA 1H93A 4TKLA 1KOGA 3AL2A 2IYEA 2E2WA 3N8KA 4TV8B 1EUQA 2RJOA 5KS2A 4UU7A 3WFIA 4DA8A 2QVBA 4X3OA 1N2ZA 3ASUA 4DDMA 2LZ0A 4J1TA 3N0VA 3GK3A 4I3GA 1TTTA 2YS7A 4B7XA 3QV2A 2HHHB 1YFJA 3R7DA 4DCVA 3BZUA 4XFDA 1VGVA 2FHSA 2XQKA 3FB1A 1V7CA 4YROA 1KYWA 1KYXA 4QPDA 5LQDA 1PL6A 4KAXA 2AVDA 4MZDA 1QHXA 3AKZA 4YRQA 1L5GB 1MIOA 5T7BA 3U60B 1RP1A 2JZCA 3MUOA 4PYMA 1Z0FA 1W9MA 5CM9C 2Z08A 4ZD6A 3RGWS 1N33B 1DPGA 3ZD7A 1OBVA 1X7WB 4N39A 4MP3A 2CVPA 4LHVA 2CL6X 5DRYA 1KOLA 1DXQA 3BZWA 2FDXA 3R6WA 4FCVA 1IZ9A 4K6FA 1JI3A 1T36B 3TCKA 2G0AA 3UTDA 4XD7D 3DMDA 3CVWA 4MH0R 1K0FA 3BHJA 5IKEA 1M1NB 2H4ZA 4R01A 5B3KA 4R7TA 1JAZA 2DH5A 2FZKA 5BMOA 1VHWA 3NWEA 4N3NA 3RVMA 4F9GA 1HDEA 1H23A 3HLTA 4RIHA 5ALFA 3VM6A 4AZ0A 1NWCA 3KTFA 2W71A 5IAJA 4XTRA 3L4JA 2FSHA 2JGKA 2R3SA 3O9VA 3QVOA 3EXHC 2V3VA 4JGBA 3SBXA 3SJAA 3V2GA 5B6IA 1E9BA 1CUIA 2B1QA 2RC5A 4M1WA 3HRHA 3L7IA 4B4OA 3UIEA 1LBEA 2IIVA 1FSPA 3WMFA 3INYA 1I1HA 4MZXA 1ODKA 1B43A 1I36A 1U7XA 3HB9A 1YOVB 2QUZA 2B2NA 3BQMB 1GPAA 2NW6A 3DE3X 5TS3A 3HJGA 5GWXA 1KSGA 1K8QA 1M73E 1CUGA 2R5NA 1ABEA 3RJZA 1YC2A 3LHKA 1OLXA 2HWWA 3MT7A 4KN9S 2D2VA 3MNFA 4TS4A 4OQLA 4URZR 1W94A 3QPBA 4PAWA 1PNVA 5GGYA 3RRJA 1RWKA 1M1ZA 4DBLE 4XJSA 2PGDA 4OJYA 3H9EO 4G89A 3REOA 1R37A 1SRQA 4FYMA 3VPCA 3VZCA 4MDFA 1L7MA 5GV7A 5AFSA 1TLTA 4JOCA 1PR3A 2F9LA 3ZVNA 4LYGA 4NH4A 1YT5A 3FBGA 4FYHA 4B48A 2IEGA 1EX6A 2L19A 3RM3A 1WV1A 1WSBA 2FF7A 4MKFA 3TSCA 1S2DA 4U8HA 3GA5A 3ZWKA 2PJRA 1ECJA 1MB9A 4KGVA 3H8JA 5M04A 1K08A 5KPJA 2J3MA 1QYWA 1T1SA 3HY6A 3ETDA 4JCCA 2FFQA 4MKZA 4D8VA 1H9CA 2P5YA 4HDSB 4KX5A 3KYCB 3EFHA 3TGLA 3MFYA 4CEJB 1X1CA 1UMKA 2VYVD 4M1MA 1YZ3A 2CNLA 1T4BA 2E4VA 2ODQA 3I9KA 3K70D 3SZOA 4R51A 3H04A 1JEAA 3MJVA 1MPXA 3Q3IA 5HFJA 2ZANA 1NOKA 4F6RB 4ALIA 1LDMA 3CLTC 4NPHA 5D8DA 4CF4A 4LC9A 3Q7PA 2XY4A 4W99A 4AAYA 1GQOA 3W06A 3FZYA 3DMYA 3VZPA 3AU8A 1EGQA 3Q5EA 3IURA 3TIXB 3A4VA 3Q11A 2OO5A 3GRKA 2GHTA 3S2FA 3ESRA 3S7ZA 1DEXA 1DBRA 1CHNA 1IEQA 3SM3A 2GXSA 2HTEA 1CHDA 4QDXA 4YYZA 4ZK6A 8ADHA 1BE0A 4XYMA 2XNJA 2HU8A 1H5NA 1KI8A 4ISBA 2ZSEA 3LPAA 4OQ4A 1JIVA 4LJKA 4M37A 2REQB 5FNVA 4K9SA 1OAKA 1ZXLA 4LV5B 3OFSA 2Q8QA 4JH0A 1JDJA 1L0BA 4N18A 3AVXA 2Q07A 2P67A 4ZCIA 5AK0A 2IODA 2NU6B 1EYZA 4G4IA 3VOSA 5IDQA 1NQVA 3HU2A 5BR1A 2VDWA 1JHZA 2B35A 2XT6A 3IP8A 3DLTA 5DOZA 3BJEA 3S99A 3ABQB 1ICEA 3PLNA 5B55A 3I9NA 1SAYA 3OUTA 4RF2A 4KQJA 4RK6A 3CR8A 4KLCA 5D3QA 1XJ0A 3D3WB 3IMCA 5B1YA 3HO1A 4HSGA 4KSCA 3D4OA 5IDXA 3PPYA 3IEPA 1CRWG 2A67A 2UKDA 3CLSC 4DMFA 1UK7A 4C30A 1FLNA 2FPWA 4D0GA 1I6MA 2BF4A 3QRWA 4E4YA 3I6BA 3QKWA 1H42A 1N75A 1EBFA 2O14A 5B1SA 3TZKA 2XE8A 3CRRA 1F8YA 1WDWB 3D6JA 5BUZA 5HK9A 3K71B 5BSWA 4JD5A 5KQGA 1U8ZA 3RVNA 3JY6A 4ZC1A 3KYIB 5A05A 2PVSA 4B3IA 4QU5A 3D7LA 3V1MA 2W90A 2BMVA 2WU3A 3K35A 4JV5B 4LSWA 2XRYA 2G67A 2HRCA 4Q00A 1S2MA 2LKDA 2P9ZA 3O74A 3ABRB 2WIGA 5C0OE 4FYJA 2PKQP 2WZQA 2YY7A 2P9FA 3L7DA 1G2IA 5GQSA 1T1GA 1Z56C 1BRMA 3PEVA 2ZTLA 1HSZA 4HNVA 3I2KA 4PLVA 1M2GA 1UEXC 3U0VA 6CHYA 4O2AB 4J1SA 4PYJA 3EVTA 1YQEA 3LFUA 3E35A 4M1EA 3PLRA 3HU1A 3NHBA 1HTWA 4GUDA 4BVKA 1S2NA 3N7AA 3UK2A 1KYYA 2FDCA 1DKMA 4G4SO 2IYSA 4CR6A 1ZN7A 3VSCA 2Q5HA 4EGFA 5TMEA 3ITKA 4HB0A 3VV2A 2QU7A 1H8HD 3D7NA 2H63A 1SURA 5JALA 3CVUA 3AONB 4IDNA 2YWEA 3ON5A 2GCOA 2GTPA 2W2TA 1DARA 5L9AA 5TIIA 1XIVA 2PZJA 3VTAA 2C42A 2ACEA 2ZXFA 1YZFA 4WW0A 1TCCA 4K0RA 4UUOA 2WWVD 3VU9B 3PRKE 2ZJZA 3ZY3A 4ZYXA 2C2YA 3ZDAA 2JF0A 1XTKA 3D3NA 2VHQA 4FIDA 4TV8F 3P0RA 2QXUA 4CFSA 3ONNA 3NEJA 1J1IA 3FI0A 4LXTA 4W5QA 5E4FA 1V71A 1B6GA 3R3SA 1R66A 4JVOA 4YT4A 4YBRA 1SC4A 1RLUA 2QRUA 5GZ6A 4ZJPA 4J8PA 3KVYA 2EBWA 3NATA 4AO8A 2WHEA 1MFZA 4DNXA 5A6VA 1JDTA 4QATA 5E3IA 1OI3A 2Z3ZA 3S8MA 3K9FC 1OZHA 1XWFA 3F9IA 3OM0A 4NOMA 1GZVA 2C4TA 4JYAB 2H0QA 2MINB 2QXYA 3OHSX 5DZSA 5JJIA 1K6XA 2QMEA 4DSZA 4ALJA 1OFGA 4O5OA 3R8XA 5AOCA 4G0PA 4A5OA 3FDFA 1ISGA 3AM4A 3GDFA 4J0IA 4J6FA 4LNUA 4OHWA 3DTYA 5JG7A 5HR5A 3FLBA 4FWTA 2ZU6A 2A3NA 2EYQA 1FK8A 2J3EA 2P4EA 5J5VA 2A2ZA 1Z7YA 4R9RA 4KYTA 2VPZA 1I7PA 2X5NA 4KIUA 4AMBA 1ZH2A 1V39A 2CE2X 1ULTA 2P3QA 5LZ8A 2HHLA 1NG9A 1AN9A 1F4LA 1XN1A 2A9QA 1GLNA 1SCQA 4Q9KA 3SDBA 5MDHA 2EEZA 2P9HA 5DHTA 4E6PA 3WG9A 1A9YA 1KFBB 1QP8A 2E5WA 4KOEC 3RRXA 3ZXUB 1RRFA 2W2XA 3IYLW 2DR3A 1ZMTA 2FZCA 3O4RA 4IQGA 4TV9B 4BNXA 5KNLA 1H2BA 2BWJA 1QX3A 3HCOA 1SZPA 2G1JA 3B7PA 5FPSA 4PGFA 1M1XB 3K8OE 4XWYA 1QGOA 3BXEA 5HIMA 3H83A 1FNMA 4LK2A 2ZPUA 3DVAB 2O8FA 2XNCA 2TYSB 1GYPA 3IAM6 4QFMA 2JHGA 2BMFA 3CXRA 5EP4A 3P0EA 2BFCA 2HLDA 1NHGA 3ONVA 4Z0TA 2SCUB 5TT1A 2IYLD 1U65A 3KKEA 4C87A 5KB3A 4AZSA 2F8TA 4TQGA 2VTBA 3GJ5A 2VHZA 3NKVA 4XJVA 1RZ3A 5B7GA 3NIFB 5CP8A 5A71A 2WSSD 1AX9A 1Z8DA 3JQ9C 2GRUA 5AI5A 1OB5A 1W76A 2OECA 4TTQA 1U80A 4BKMA 1U31A 5AP9A 5AVXA 5HVNA 3R6DA 1ZM4A 4MGYR 1J8YF 2CHFA 3MCUA 1T6YA 2F90A 4YALA 3M5DA 5A6SB 4RH3A 5K0TA 1IG3A 1FTQA 5EERA 3R3XA 1SOUA 5EZ5A 3DKKA 3AVWA 3C87A 5IEBA 3UEOA 4HUQB 4CFZA 1WF3A 4X8MA 1E2UA 2IZ0A 4KACA 1O6BA 1SQGA 1FTGA 1K6MA 3E9CA 4P92A 2E7ZA 4Y1RB 4X63A 2YV2A 5HZGA 1O54A 4PZUA 2P4UA 4HH0A 4FUQA 5JD3A 1Y7PA 1C4KA 1JLHA 2IPLA 3B5IA 4UUAA 1UXKA 2A9PA 4FFDA 3AEUB 3PR3A 2OWEA 4R2IA 4RVDA 3SBEA 4C6SA 1EXMA 4BV9A 5C52B 3SX2A 1DC3A 1HORA 4GKAA 3RNOA 1XTIA 1MU0A 2GXQA 1G7SA 4C76A 2Z6VA 4EYSA 3W5HA 5I3CA 5TDHA 3GNLA 1L6RA 4QU0A 5DM4A 3N2EA 3QIAA 5HXAA 3A6PC 3PNSA 3EVFA 4NDAA 1P5ZB 2L42A 5K3SA 4KR9A 3T35A 1UP6A 1VRCA 1ZOPA 3A31A 3DUFB 4F2HA 4KO1S 4WV3A 4XWOA 4G65A 3W2GA 4KDEA 5I9NA 3CUVA 2WEKA 4BTEA 3D8SA 1QKKA 5C1OA 5J4VA 1EA5A 2BFEB 3EW7A 2EF1A 3KLBA 5F51A 3UWOA 4QE3A 3WLRA 2O3QA 1P45A 4L0DA 2JI8A 4QVGA 5JADA 3TIGA 3HGTA 3WWDA 3PGLA 3RSGA 4N5MA 5KAPA 4JU9A 4QRDA 5I7UA 3M7IA 3P19A 4UCXA 2AZ4A 3RYTC 1E9RA 1IBKB 3EGDA 4GIBA 3MA0A 4GL4A 2WVHA 3AI1A 4GQAA 2GTHA 2GEUA 3I2YX 3B1VA 1EK6A 3HWWA 1E3WA 3QBDA 3WNVA 2PX8A 1P6XA 3PRJA 2HAEA 4KEAA 2P4SA 4DDUA 2QTWB 2Y0BA 3QEMB 1ADJA 4PC1A 4E21A 1E3WB 4FC6A 4C0XA 4U7PB 4BP9A 2XZPA 2WK1A 3HV2A 3I04A 2GZRA 3O26A 1KSFX 4MR9B 5I7RA 1IXSB 2PSSA 2Z1DA 1R9JA 1BHSA 1H6DA 3CINA 3ITDA 4WZAB 5CA0A 4KUHA 3T0GA 3TBHA 3TBKA 1BMTA 4Q5IA 2Y66A 3WYAA 2I67A 4HBZA 3QLVC 2WYHA 3FYCA 4DV0B 3F7OA 5F52A 1QCDA 1DTSA 3A37A 3I3OA 4ERXA 4NJEB 4GOKA 4MVJG 3IJRA 1A98A 1YHZA 2HU7A 4JT2A 2XCQA 1NBHA 3AEQB 1PKEA 4QDTA 4JZYA 2ZT7A 3A1FA 1S8OA 2CXPA 4YLYA 3P2KA 3WOHA 5BNIA 2AJTA 3SNHA 3W05A 1J2TA 3F97A 3J80A 3EVCA 1K6IA 1CJMA 1Z0DA 5I7HA 1JSLA 2PLAA 1JSXA 3W8DA 4BKRA 2QMYA 3T94A 1Q7TA 3WK9A 3S8YA 1I4LD 1V5FA 4ZAGA 4DQKA 1YJ8A 5IAKA 4AKIA 1F2TA 1FMCA 2V4ZA 3JQCA 3LP5A 2MYPA 4L8YA 8AT1A 1NT4A 2HWKA 5AM5A 4L6IA 3I12A 1KDVA 3KETA 1VL0A 1P1HA 4HX2A 3ZI0A 4D44A 1O94C 1YQUA 3IE0A 1UFOA 3I52A 3KEGA 4FE4A 4KQ6A 5AUNB 4IQ4A 4WK6A 4MI3A 3IUNA 3I39X 1SXJA 1H2EA 1W5TA 2XUGA 1FLVA 4K26A 4REMA 1HDRA 1NYQA 1KPIA 3OZBA 4TPKA 5JC1A 5B4UA 1P7CA 1Q84A 4G2TA 2QVXX 5DNUA 4XDHA 2PANA 3EZ6A 4UD6A 3TQQA 3HJNA 2B94A 2JLCA 4RA6B 1DAPA 5HDBB 4I81A 1FTNA 2CDAA 2AMVA 1J1ZA 1E0JA 1NXVA 1ZK2A 2K87A 2WIAA 1ES9A 3ER6A 4F2WA 1KFKB 1ONBA 1BH6A 2GRAA 2WPDD 3N0RA 1J70A 5HZMA 4DZZA 3FZGA 1LFDB 4FHDA 2P5SA 1CC1S 3A3OA 5IDVA 2G88A 2EWMA 4KWTA 3WIOA 3GHYA 1QGYA 4LZJA 1I32A 4KREA 3HL0A 1KRXA 3K32A 1QE0A 3UBTA 1C7RA 5AJUA 5U4QA 1IEWA 1CQJA 2QVYX 3D2LA 2H8GA 3ROPA 2A9KA 4JCOA 1XMJA 4UPDA 3STUA 4E94A 4F7DA 1FIUA 2C9BA 1RQXA 3ZJYA 4DR3B 3INNA 1Z0SA 2XNKA 4FONA 4WN3A 2V58A 1SHTX 1EE2A 2OCKA 3A05A 2OVFA 1CQIB 3KOXA 1GNPA 4Q48A 2CY0A 3LVFO 4QG7A 4XVUA 1SG6A 1SXJE 4UVGA 4DNOA 5CITA 4MUAA 3WGQA 3WYDA 1ZVVA 1EIWA 3U44B 4MLPA 5AKYA 4XRGA 1VIDA 2WTMA 2XAUA 4GMKA 4Z4GA 1CNEA 2A30A 5AW8A 4E2YA 4TV9F 1O7JA 2EOAA 2L0XA 5AW3A 5IEJA 3HJHA 4POOA 5F1PA 2AZXA 3WOVA 4TTIA 3WK7A 4QECA 2IOHA 4DR6B 3LWZA 2ZJ4A 1L5VA 5TPZD 2QE7A 5KC8A 1YJAA 3KBOA 4JEHA 3RI3A 3N05A 1KE1A 1WE2A 1J6UA 4MUEA 1BFKA 1JAIA 1NONA 2DPGA 3G8BA 3KZXA 1EFPB 1ZK4A 1U11A 2FQXA 2ZT8A 1XYVA 2V3WA 1SCAA 1KYVA 3D3KA 3P9IA 2KLBA 2Z2KA 4GKVA 5DE3A 3VC3A 1GPKA 1PD0A 1OLUA 1X87A 3RDPA 3CX3A 4PHGA 1AKTA 5EJEA 3W6UA 2QIPA 1EESA 2HK6A 2BEVA 3L84A 1R0WA 3GRYA 4UHKA 3STXA 2AN3A 4AQDA 4DCGA 1STOA 3F2VA 5LUAA 2JZNA 1T25A 3ZNQA 4DLXA 4I8XA 2QSUA 1XL1A 3DP7A 2G04A 4HS9A 3KT3A 1K7SN 4KE7A 2F3QA 2YZGA 4LY0A 3U3ZA 1E6KA 1ESCA 5DGCA 4H6VA 1GCOA 1AQYA 1THTA 1KGSA 2OILA 1IBMB 1TUGA 2NSJA 4KXLA 2VWQA 3MGCA 4GWGA 2GEKA 3IE2A 5DNAA 1G2OA 1BD3A 2VDQB 4HH4A 2MHCA 4B3JA 3AFGA 4DV4B 1F06A 1DV1A 4EY3A 3L92A 3THOA 1RCTE 1SKAA 3BIWA 3VNBA 1UDWA 4EFLA 4Q66C 3MGKA 3OJFA 2K6GA 1O97D 3OJLA 3WWCA 5LM3A 1J42A 3AVYA 2VCYA 4QUBA 4MPPA 1GTRA 4PANA 2VKTA 2V97A 2P6UA 3FFXA 1MZVA 4Y7CA 2II6A 4BNJA 1SUSA 5JZSA 1RAFA 4PSUA 1L7AA 2GD1O 2PXCA 3EF1A 4GZLA 4WK4B 1IWPB 4YAFA 1YDGA 2ZRBA 3L5OA 1YUBA 1N1GA 1R5NA 3JZIA 2W48A 4R1QA 4AS1A 5I9MA 5FBWB 4F8YA 5AVRA 2WC1A 4B46A 1N6KA 1X80B 4WY8A 4JJ4A 2Z4SA 5I5EA 1USGA 5BOSA 3FUTA 2FOIA 1WB9A 4M8IA 1Z5PA 3LCVB 4P53A 4JYZA 3MT0A 2CVFA 4KDFA 4FDUA 4C1NA 4NMHA 1JHPA 1NJFA 3BMNA 1Y3IA 1PJAA 2R8ZA 3SHOA 1KQGA 2Z5GA 1TJ3A 4IVQA 1NV8A 2PA3A 4OUKX 5A4KA 3BMCA 5PGMA 1DIGA 3NIBA 3OPYI 2GN4A 3JYOA 1DBIA 4O2RA 2VHYA 5IULC 2QTRA 1GCUA 4C89A 3SR4A 2Q6LA 4U6QA 2UUOA 5AWFC 2CMFA 2JFFA 4U7DA 1KKLA 3G5LA 4KFCA 3L8ZA 3MN1A 4ES6A 4FD3A 4MR7B 4PHTA 4BVLA 1XDZA 3HV0A 4EKIA 4WA7A 1V47A 2V0GA 1PW5A 3H4TA 2QL7A 2ZJ2A 5HS4A 2TMYA 1PT9A 2GQ0A 3B1ZA 5DASA 1G8PA 2R7KA 4N5DA 5G02A 4CCYA 3EE6A 3OWOA 1RFLA 5IBRA 4OKSA 2W42A 4LDNA 2BISA