4AJ4A

Rat ldha in complex with 4-((2-allylsulfanyl-1,3-benzothizol-6-yl) amino)-4-oxo-butanoic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
330
structure length
330
Chain Sequence
b'ALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
total genus 113
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4aj4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4aj4A02
3DZGA 3GVPA 3N58A 4AG3A 1OZAA 4IJWA 4CM3A 3W8FA 2G0TA 3FNFA 4E30A 1YH3A 4R1TA 3F4BA 1K6XA 1E7RA 2Q4BA 2IZZA 4IS3A 3DBVO 1DJQA 3QVOA 5T57A 1U8XX 4DC1A 1F8GA 4BNLA 1DSSG 4AJPA 1U3UA 3FI9A 4BNUA 4XB2A 3L07A 2NVUA 1DIAA 5KKCA 3HUDA 3KRTA 3PVZA 5AYVA 1BXZA 3FCOA 4TRJA 2C07A 5DNAA 3WFJA 3PI7A 1QORA 3NJ4A 5EN4A 3K92A 2X23A 3GPIA 4NQZA 2Q2VA 2Q45A 4K1LA 4YAGA 2VHXA 4P22A 4DMLA 4BO9A 3I9JA 1BWSA 3OHSX 4TVBA 5DN9A 4CR7A 4BNNA 3KLPX 2R2GA 4KZPA 2UUPA 2X1HA 1B16A 3WFIA 1E3IA 4B4WA 5TJ9A 3PEFA 4ALNA 4XKJA 3UN1A 1UXKA 2VQ3A 2X0NA 3OETA 2FN7A 4D3FA 4EI2A 1QV6A 4CLRA 1LQUA 4MP6A 1U28A 1YRLA 2DKNA 1E1NA 3DOCA 3I52A 1YVEI 4I5EA 1PZHA 4OIMA 3IJRA 4YCAA 4XYGA 1I36A 5A9SB 1B7GO 1H6CA 4IXTA 4G5HA 3X2EA 3GDGA 1DLJA 3ICPA 2B4QA 3NT2A 4MVJA 3C1AA 2DT5A 1AXGA 2P2SA 5U1PA 1VSUA 1YWGO 3OH8A 4G65A 5CP8A 3OJEA 5CDUA 1LDEA 1GQ2A 1KOLA 5THQA 2X5OA 3TOZA 4JGBA 1MG0A 4N18A 2DQ4A 3PHHA 2PZMA 2HK8A 4KP7A 2AXQA 1U1IA 2BGKA 5AVOA 1M66A 3KETA 1O95A 4ND5A 1TVEA 3D4NA 2YJZA 2V65A 4WKGA 1NX6A 3LQFA 3NAQA 4QX6A 2B36A 2VHVA 1HDZA 4WNIA 3Q11A 3GT0A 1I10A 2YDYA 1AN9A 2CF5A 4MIYA 4R1UA 5LDGA 4JROA 5CAEA 1KVUA 4W9NA 4C4OA 1YBVA 3AK4A 4CMBA 5B12A 4B8WA 2AQHA 4BL5A 3GNTA 3GR6A 4OO3A 1SB8A 4IJVA 2AQIA 3D7LA 3NT4A 3PYMA 4XZ3A 2HK7A 4RO0A 1RPNA 1NPYA 4OOFA 4XIJA 1E3JA 1M75A 2O48X 2X58A 4JN6B 5LC1A 3PWKA 3C7CB 3H6KA 1P44A 1YONA 1B8PA 3OQ1A 4J90A 3QVTA 1KEUA 2ZJ1A 3L6EA 4ALJA 2JCVA 4RQUA 3MTGA 2FR8A 3GFBA 1L1FA 4BNZA 1Y8QA 4BO0A 3ZV3A 4AJ2A 2DTEA 4H15A 4R01A 2NWQA 3UH1A 5TSDA 4DPMA 3JTMA 4FFNA 2AQ8A 1MXFA 1BVRA 3KUXA 3QA9A 5A1TA 1NFQA 4IZIA 4CLXA 2GZ3A 4CMAA 1ZH8A 4ZA2A 2NVUB 4Y6PA 3ROMA 3OBBA 3SXPA 2Y0EA 3DOJA 2QRKA 3EGOA 3KV3O 3D4OA 1JTVA 3TF5A 1MFPA 3DMYA 1X13A 1ISFA 1B3BA 1N5DA 4J1TA 1BMDA 1CDOA 1GQYA 3UFXA 3S2EA 1DHTA 1YOVA 3VPSA 3ZWPA 4D0RA 2Y93A 4B4VA 2ZYDA 1PGQA 1T2AA 3E03A 3G49A 3WTBA 5JC1A 3ONDA 2WYUA 3GAFA 5L4SA 2I76A 4TSKA 1M76A 1HL3A 3WGIA 4Q3EA 3PQEA 4H3VA 2OBYA 3RFXA 2IEDA 1HYGA 4FC7A 1ADGA 4E6PA 3QVXA 2WD7A 4XQGA 5IZCA 2NTVA 4NBTA 1FDWA 5I8WA 4KQWA 5MGBA 1P1IA 2DU8A 4YAIA 1D1SA 1KC1A 4J2HA 3BMQA 2YV1A 4BO4A 1A7AA 3FWZA 4DLBA 4Y8VA 3D5QA 1DPGA 4RPKA 1AHHA 1CETA 1DAOA 2IEBA 2NU9A 5I7SA 1O8CA 1LXCA 1VE9A 2B37A 4FC6A 4TKMA 2PD3A 5L53A 3BYZA 2QYSA 4YXFA 1YO6A 4WCFA 2PA3A 3E18A 1WDLA 4WLEA 1NHGA 4UAGA 1EUCA 3ZWNA 1PJSA 3ZZNA 4TZKA 4A27A 2C29D 1V3UA 2FPPA 4QFDA 4BO6A 3RUHA 2O3UA 3PWSA 1ZKMA 1PJTA 2BH9A 3BMNB 2EF1A 2D1YA 2PR2A 3F1LA 4WEOA 5U4QA 2BLLA 2HAEA 4I9UA 1N2SA 3V1TC 1I2BA 4CMEC 4EBFA 1RKXA 4KTTE 1XU7A 3E5MA 1HSOA 3H2ZA 4MO2A 5TT0A 1R66A 3EYWA 4LCEA 4DA9A 5F5NA 1E1LA 2CF6A 4KQXA 1NQ5A 2ZTMA 4CV1A 4WJZA 1WMBA 1ORRA 5K6AA 4MKXA 1DRWA 1GR0A 2Y66A 5CG2A 1F17A 4AJEA 5G0SA 1DC6A 4QFCA 3QWFA 2HDHA 3LC2O 4CMIA 3DAPA 1GDHA 1I01A 2PY6A 3KZVA 5TJHA 4UEOA 3P5SA 1T26A 1UZMA 3U62A 3RC2A 4N5LA 4EUHA 2GN9A 4GWGA 5CDTA 4RPHA 3AY7A 5ITVA 2C54A 2BGLA 4A0SA 3TN7A 3F9IA 1YQGA 4M49A 1Y8QB 3KVOA 2OOSA 4OKNA 3C1OA 2VHYA 1E7QA 1ZK4A 1WAMA 3B70A 3H2SA 1JVBA 1E6WA 3Q2KA 6ADHA 4RDIA 5KIAA 3IP1A 3I1JA 4BKQA 4EJ0A 4BNGA 1ZK0A 3ITDA 4BGEA 2GDZA 2BFPA 2CY0A 1V35A 3DZHA 5AXDA 3NDIA 3SEFA 2ZB3A 5CFZA 1X0XA 3C8MA 4IDAA 4OH1A 4AVYA 3HSKA 3UKOA 1HZZA 1LRKA 1PGJA 4BO5A 3V1YA 1R12A 2VWQA 1GCUA 3H7AA 5TX7A 4XRGA 4HADA 3GN1A 5ER6A 5C7OO 3VTFA 2WYWA 3KLMX 3D0OA 1NPDA 4GI2A 5DOVA 2FMUA 2WTBA 3I23A 4E32A 2WD7B 1VLLA 5DBIA 4PG5A 1HDYA 2EIHA 3LLSA 1KVSA 2RHCA 4IDEA 3W4IA 3UCXA 4FFRA 4O6VA 1ONPA 1XA0A 4H16A 4MJLA 2BI8A 1NFRA 1ML3A 3BMQB 4ZRNA 3IJPA 4CR6A 2PZKA 3N74A 1ENOA 3V2HA 3U4CA 1OI7A 4JBHA 1KC3A 4BIIA 4EEXA 5HWSA 3ZU3A 1IHYA 4MP3A 3I9LA 3KB6A 3U4IA 3VVBA 1H5QA 2D0IA 2DPGA 4J7UA 4RLSA 1GYPA 4YJHA 1Z75A 4YACA 4WEQA 4WCFB 1GFSA 3WGQA 1U2DA 2E48A 1H6DA 3B6ZA 4PLYA 4E5PA 1E0DA 2C5AA 3A06A 3CINA 3ZCXA 4XYBA 4HY3A 1MXHA 4AJNA 4TWRA 4PLPA 1VL0A 1QYWA 2C7GA 3RQSA 2DFDA 3WG9A 1HDGO 2VCYA 4FGSA 4WNCA 3WBBA 5B1YA 5IJZA 3U4HA 1UAGA 5C7LO 1TB4A 4L73A 3RUFA 3VKUA 2VOJA 4WUVA 3CTMA 1T2CA 5H82A 3RJ9A 2P4HX 4GPD1 3A28A 4J9UE 5T64A 4BGIA 3PIDA 4KUGA 5ICMA 1Y9AA 1TEHA 3VPGA 1NBOA 3I3OA 3HG7A 4WASA 1LA2A 4NBUA 2GN6A 4Y6RA 4OQYA 4FJ0A 1UXHA 3ORFA 2AMFA 3LVFO 2DUUA 3GGOA 1F14A 3K31A 4YAKA 3COSA 3KEOA 1DIHA 2I6TA 2AG8A 3PZBA 1U7TA 4PLVA 3W4JA 1NR1A 2BF7A 4LISA 1MUUA 4KWHA 4B3IA 4TRMA 3BTUA 1NASA 2VNSA 4BNKA 2FPIA 1U7HA 3BZUA 1IL0A 2DVMA 3KYCA 4BNJA 2GLXA 1LC0A 4ZQFA 3HDQA 1W8DA 2P9GA 2B35A 1CYDA 1B3RA 1B2LA 2O3SA 2CMDA 4M87A 2QYTA 1ZZEA 1EMDA 4CR8A 1QSGA 1E3WA 4ZQGA 5ENDA 1GZ6A 5T67A 4BV8A 1U3TA 2CDAA 3V8BA 2HRBA 1WLYA 4DYDA 1E5QA 1PSDA 5IAAA 4DYVA 2X9GA 4F46A 1H93A 4ILKA 1PQPA 1WWKA 2XPCA 3ZWCA 3OIFA 3LC7O 3K5PA 4E21A 5A03A 3JQEA 4R5HA 2O3QA 3OJOA 3TZ6A 2H5LA 3O8QA 2GYYA 2HMVA 5EQFA 1C1XA 2X9NA 1NP3A 3QIVA 5JS6A 4PLGA 2W90A 3KHUA 2V6BA 1QYCA 1R16A 1MV8A 2D5AA 2YW9A 1OAAA 2XF8A 4OXNA 1UP4A 3WJAA 3ADPA 3HQ4O 4ND3A 5L3ZA 2JD1A 2V7PA 3ONFA 3HWRA 4XDZA 2GNAA 2JHFA 2X9VA 3C24A 2I65A 5AXCA 3H9UA 2FOIA 4L8VA 2Y1GA 3BMCA 2Y1CA 2JKVA 3GHYA 2J3IA 1Q0QA 1T25A 1NTOA 1PS8A 4RVHA 4Y9DA 1RWBA 3EY4A 1T24A 3ZU2A 3HNPA 3V2UA 2VHZA 1P77A 4M55A 4BKRA 1DIBA 1W0CA 4FGWA 5HBRA 2OXIA 3GEDA 3JQFA 1FDVA 3ZDFA 4ESOA 3LC1O 4ONEA 1H9BA 5IZ4A 4NBVA 3PQDA 4JP3A 4OSPA 1QMGA 4L74A 1D1TA 1ZO8A 4OGWA 4PVDA 1Y5RA 2CFCA 2OUIA 3E1KA 4WLNA 4YJHB 2GASA 1P9LA 3U5TA 4YRBA 4M8SA 5JE8A 5JMPA 5L7YA 4D0SA 1EDZA 1BTOA 3L4SO 1ISGA 4IJKA 2UDPA 4NNJA 3QY9A 4BNTA 2Y68A 3L6DA 3FTNA 3GHHA 1G6KA 2PLAA 4YJFB 5DP1A 3VZQA 2PD4A 1VM6A 3VPHA 4AJIA 1XQ1A 3ETGA 4E3ZA 4DREA 2AHRA 2VUUA 1BGVA 4WOJA 1ZCJA 4OAQA 4L9RA 4B4UA 3IMFA 2EV9A 2EW8A 4CLHA 1YL7A 4MDHA 4B3JA 4L75A 1BDBA 4DLAA 4J7XA 4GX2A 5TF4A 3QJ5A 1LLCA 2GZ1A 3HE3A 1QKIA 3RUIA 5JAIA 1Y5MA 2A4KA 1I33A 3FPCA 5G0UA 4EITA 1SB9A 2VTEA 1EK6A 4RPLA 2D8AA 2Y1EA 2QZZA 1EK5A 3TJRA 2CDBA 2OZPA 3WIDA 3GA0A 2G76A 2OP1A 5BT9A 5CG1A 3MJCA 3ZGYA 4BKOA 1XWFA 1XCBA 4MP8A 3RAJA 4P38A 4FOOA 4K6CA 1KETA 3F47A 4BNMA 2IXAA 3EAGA 3W4KA 4XA8A 1Z45A 1KIFA 2CVZA 5K9ZA 1PL6A 1GUFA 4E2XA 4E4YA 1DBVO 2WWRA 4S1VA 1WDKA 3TPCA 3VPXA 4HBGA 3WWZA 1JWAB 5A3VA 1WZEA 1FK8A 3JQ6A 3PYLA 3VC7A 2WM3A 1EVJA 4CUKA 2ZJ0A 5BSFA 4MVJD 1F0YA 3MJ4A 2ZCVA 1SEPA 3BIOA 1O9BA 1VJ1A 5ADHA 2AEMA 1NQTA 1P1RA 3IUSA 4XJSA 4G81A 3WQQA 1C1DA 1PGOA 1PL7A 1Y1PA 4JIGA 4UVIA 3JQBC 1E7YA 3M2TA 4Y98A 3JQAD 3B1JA 2YFQA 1T4BA 2ZB4A 3WGTA 1NXQA 1JQBA 1MFZA 2PH5A 3BMOA 3QSGA 2IE0A 4E2WA 5L9AA 4WK6A 1C1XB 2V6GA 4H7PA 2I9PA 3D3EA 4Z3KA 3WTCA 2AG5A 4ZD6A 1P1JA 3PYXA 3E9MA 1KERA 1ZJZA 4BQPA 2GERA 4CL3A 5A5EA 1PQWA 2R00A 1HF3A 5G4LA 4W82A 3GAZA 3IKTA 4WLUA 1GZ4A 3H9EO 1P74A 3DHEA 3ZWWA 3IOYA 3NJ8A 1FF9A 4AJJA 3RU9A 3F5QA 1SMKA 4X54A 1Q7GA 4D43A 1I3NA 4J7CA 4R68A 4FR5A 5JY6A 3CMMA 3JQ9A 1J6UA 3DHNA 5ER9A 1SBYA 4RJTA 2FR1A 3DL2A 1PEDA 5JYDA 1P33A 2G17A 2VWPA 4BO1A 2D3TA 1Q7CA 3GLQA 4JX8A 3B20A 2A92A 3OIGA 4IXWA 4EEZA 1P0FA 5BSGA 5TIIA 1T2DA 1EBFA 1YB4A 2LDXA 4FCCA 4YQZA 3MOGA 4QQRA 3L4BC 5A05A 4OKIA 4Z0TA 5KTKA 4YA6A 5A06A 4EUEA 2YHUA 2FSVA 5T5QA 2BRUA 1EQUA 2GSDA 2RHRA 3WLEA 1E1MA 4EJ6A 5JDIA 3JD4A 1UP7A 3KSDO 1UR5A 3AFMA 1NVMB 3HN2A 1K0UA 1GV1A 4R16A 3V5NA 4CUJA 3KEQA 5CPFA 1VJTA 1SNYA 1T4DA 4JLWA 1J0XO 4HUJA 4K28A 1JA9A 4IBOA 4YVFA 3RSHA 1V9LA 5F1OA 2I3AA 1ZIDA 3FBGA 1DDOA 1C0PA 4PLZA 1PJ2A 2UV8A 4A73A 4GSKA 1LEHA 3O38A 4FD3A 3VZSA 4GMGA 4FQ8A 5DULA 1T1SA 5KOIA 3ZWXA 2CDCA 5JAQA 4PVCA 5FI3A 5JDCA 4M1QA 5JW6A 4MVJP 3ZV6A 1DC3A 2AA3A 4L4XA 2EGGA 3A14A 4J4TA 3WYEA 5B4VA 1EVIA 4HKTA 8LDHA 1V3VA 2BHLA 3IUPA 3CZMA 4XDYA 3EVNA 3VZRA 3OM9A 2G82A 3G1TA 1Q0HA 4BS9A 2OBNA 1D3AA 4XQCA 3D3WB 4TROA 4XD2A 2DAPA 2IZ1A 3B1FA 1SZJG 2QRJA 1ZMTA 4CM7A 1KEWA 2BGMA 2Q50A 4J4HA 1BG6A 4D44A 3TQHA 2B0JA 3TL2A 4IDCA 4W4TA 3UXYA 1P1HA 2W98A 1KBZA 3AOGA 1IZ9A 3TNLA 5KVSA 4EJMA 1PS9A 3DOOA 1VKOA 3I9KA 4QSMA 1DIRA 2H63A 3KO8A 1LSJA 4NJMA 1PGNA 3L9WA 3FSRA 3T7CA 1ZUD1 4ZRMA 3PRJA 3A9WA 7ADHA 1PJLA 3HFSA 1ZW1A 4FFOA 3RROA 4ZHSA 3FPLA 2I5PO 3PHLA 1ZMOA 1SEVA 4IQ0A 2DM6A 1IY8A 1N9GA 4KMSA 1I8TA 3JQAA 4BO7A 5IDQA 5BNIA 4YYZA 1EZ4A 1WNTA 2XAAA 3K8ZA 4UEKA 3AWDA 5ILOA 3RIHA 1Y8RA 5JLAA 4O59O 4WECA 1LLQA 2RAFA 4XIYA 3I9MA 5JO9A 1XU9A 4YTEA 2CNBA 1JAXA 1LDYA 1Z73A 3ANLA 4IMRA 4PGFA 5BNFA 4S3MA 3TDKA 1X0VA 5TC4A 3RUCA 3RASA 2FZEA 3DFZA 3GG2A 4UUOA 3K2BA 2I66A 4AFNA 4NBWA 3ANNA 1X7HA 4DGSA 2Q1WA 5FI5A 2PFGA 5JCJA 2Z1NA 1P3DA 4CM8A 1OOEA 2BFMA 4P4NA 1B0AA 4KDEA 3WLFA 2ZK7A 2PKQP 2B4RO 3DZBA 2FY8A 4GBJA 3GVHA 1X1TA 1NWCA 1RM4A 3EMKA 4EYEA 1NHWA 1VL6A 1MA0A 2PTGA 4B3HA 5JBIA 4D79A 3LT0A 2CD9A 1WW8A 1O6ZA 4AJLA 4YT2A 1HE2A 2ZQZA 4W7HA 2QQ5A 1E7WA 1P1KA 4FJ1A 2J5QA 2FZWA 2Q46A 4BNFA 3OJ0A 3JYOA 2GRAA 1DC4A 4FDAA 3QW2A 2EKLA 2QIOA 2FR0A 3Q0EA 5AXBA 3GNQA 4CQLA 1HETA 1I2CA 3BXXA 4IM7A 5GY7A 2CVQA 2AEJA 2X6TA 3ZI0A 4L76A 3UICA 4W9NC 3OEWA 3L0DA 1FMCA 2YQ5A 5I9LA 2HMTA 5IN5A 1ZNQO 3F5SA 3U9LA 4AJKA 3UHAA 1UXIA 4PRKA 4GMFA 4MINA 4RPJA 1BDMA 2AE2A 3PJFA 3ZV4A 1N8KA 4B7CA 3PGXA 2C5EA 1ZK1A 4Z3DA 4BNXA 4I08A 5AQ1A 1UDBA 1KVTA 1K3TA 1XDWA 4FJ2A 4PG4A 5FFFA 5G4KA 1LDGA 4Q39A 3T4XA 1PZGA 1I2ZA 2PK3A 3OQBA 4IS2A 5L7TA 1C0IA 2D4AA 4Z9XA 3FWNA 4CLRB 3EZYA 5TNXA 1ZBQA 2JCYA 4NK5A 4UUNA 4GKBA 3HADA 3Q9UA 2CVOA 1VRWA 1YXMA 1V3TA 5A5FA 1UXJA 5F1KA 2PH3A 3OMLA 5DCWA 4N54A 1LDMA 5H81A 2WSBA 3DHYA 1U2GA 5EMHA 1PWZA 1K6IA 1DFHA 1QYVA 1ZJYA 3WMXA 5L4NA 1QYDA 3DO5A 2W2KA 1ULSA 4PG8A 3D5TA 3I9OA 3NRCA 4G2NA 2UUOA 1M67A 2HKIA 4XYEA 3E9QA 4MVJM 2B5VA 4Z6KA 3G0OA 3IC5A 5B37A 2GN4A 1C14A 3JQGA 3ENNA 1EE2A 4GL4A 3OJLA 2AEFA 4RGBA 5EESA 1SPXA 2ZTVA 1UXGA 5IXSA 2XXBA 4NU6A 4R5MA 2SCUA 3MEQA 4DXHA 4BB6A 1LDBA 4FW8A 2J8ZA 1GADO 5IZCC 1OFGA 2A35A 2GZ2A 4CLDA 4PZDA 3VPFA 4RZHA 3UAGA 3PDJA 3WR5A 3DQPA 4ZU3A 2NNLD 1GY8A 3WQRA 1AHIA 3FTPA 4CL8A 4MVJF 4CM9A 3Q9NA 5GZ1A 2EHDA 2RIRA 4JBGA 1ZSNA 4HXYA 4ZQHA 2PNFA 1HDOA 1CRWG 4IDDA 4PIVA 3GY0A 1CERA 3RC1A 1PGPA 1U3WA 3PK0A 1GQQA 4UREA 3HJAA 2QG4A 2ZIZA 2EJVA 4IGFA 4WCFC 1GL3A 4WOKA 3ZWBA 5IDWA 4BGUA 4OSOA 1G0NA 4JK3A 9LDTA 1GV0A 4WPGA 3TL3A 1O89A 5CPBA 5BSHA 3ZNPA 1MP0A 4J1QA 1RM5A 4CM6A 2O7SA 1DB3A 3I4FA 5DCUA 5HS6A 3K2EA 3K96A 2VTDA 4QTZA 1EFLA 1HLDA 3WMWA 5COAA 1LTHR 2Q2QA 4PG7A 2O2SA 4ZGWA 3BA1A 4RF3A 4DPLA 1UUFA 3EDMA 3UVEA 5HS4A 4FSHA 4XX0A 1U5CA 1CQJA 1B8VA 3R3JA 3OQ6A 3E9NA 4DL9A 3O03A 4RVGA 2VZ0A 4KTVE 2PKQO 1NM5A 2BKAA 1M6HA 5K6AC 2EKPA 1YOVB 2BFOA 3K73O 3S2FA 1UJMA 2NU6A 2QHXA 4D45A 4DQXA 1OC2A 2YHIA 2E82A 1PIWA 4LMPA 1NYTA 4RLHA 1ZSVA 4YAJA 5G4KB 1Q0LA 1HTBA 3SJ7A 4MKZA 1YJ8A 1JKFA 1VI2A 1NFFA 2H1SA 3DEYX 1U4OA 4NDNE 1V8BA 4XYMA 3SLKA 3PLRA 1LRJA 4Q3AA 1B8UA 3ENKA 1CWUA 2PWZA 1EBUA 2B83A 2EKQA 2IYPA 3BHJA 3RUDA 4ZN6A 4Z0PA 1D7OA 3ZNOA 1NAIA 4NFYA 3AUUA 4Y6SA 4CMKA 3CIFA 2WD8A 5IFLA 4PZEA 2GO1A 2NLOA 3PJGA 1BXGA 4R51A 3NTRA 1ONOA 5L95A 3PIIA 3JD2A 1LSOA 5B4TA 1E5LA 2W2KB 2EW2A 1GAEO 4EUFA 2YQ4A 4NU5A 1ZK3A 4FN4A 5DOZA 1H2HA 2EJWA 4UVGA 1ISHA 3EVTA 2Q1SA 3O4RA 3JQ8A 1QLHA 4J16A 4YBZA 3GFGA 3PP8A 2Q4EA 1YDEA 3HHPA 3WNVA 3LU1A 1DEHA 3GG9A 4GSLA 2QX7A 2Q99A 3NGLA 2CZCA 3PWZA 3QVWA 3LF1A 3IAHA 4K6FA 3FHLA 1L7EA 3ZWVA 3JYPA 3KOUA 5G0WA 1H6AA 4GLOA 1N92A 3E48A 1D4FA 4U0JA 3TZHA 3WS7A 1PS0A 3FBTA 3OFSA 1GUZA 5I7EA 5ITWA 4NR0A 1MG5A 3TRIA 1XQ6A 1GUYA 1H9AA 4LN1A 1CF2O 3RUAA 3ZWOA 1I3MA 4LW8A 4O1MA 1FDTA 4RORA 5T6BA 2HLPA 3AM5A 3OA0A 3ZN2A 5DP2A 1TLTA 2WEKA 4CMIB 3GUYA 1P31A 4LGVA 2ZTUA 5CEEA 1O94A 1V6AA 2CSUA 3D1LA 3ZW8A 4DMMA 2AE1A 3PJDA 5JFOA 4D3DA 3S2IA 3MWEB 1QYXA 2D5CA 4QXMA 4RL6A 1T1RA 2W2LA 4BV9A 4HNHA 2ZYAA 3W6UA 1EUDA 5TS3A 1MGOA 3C7AA 2RBEA 3ADOA 3LT2A 2X4GA 5GZ6A 2EXXA 2ZKLA 2Z1MA 1JVSA 1IZ0A 4U0KA 1E6UA 2O23A 2J5RA 3GZ4A 3SVTA 3GPDG 4FBGA 1AE1A 5EL0A 4NMHA 1TXGA 3H3JA 4J3FA 2WE8A 3ASVA 3CUKA 3GGPA 1GD1O 2NU8A 5A04A 1WXDA 5IG2A 4E31A 1I32A 4XGKA 4II2A 2OMEA 1TT5A 4BO2A 4CM4A 5I7VA 4ITUA 4J2OA 4ALIA 3AI3A 2VYVD 3U09A 4DPKA 3BTVA 3Q3CA 2YHIB 1PL8A 3AOEA 1EE9A 2J5KA 1HZJA 4Z9YA 2NTJA 4J49A 4JJIA 3PXXA 3D4PA 3BAZA 2Z95A 2Q49A 2JFFA 3LF2A 2FRDA 1YB1A 3P2YA 3WICA 2IDZA 4BB5A 1QV7A 3WGOA 3ZU4A 5KVCA 3NTOA 1QXSA 2P4QA 3LDHA 1A9YA 3NV9A 5FEUA 2EERA 3QWIA 1HWYA 5H83A 3JYLA 5IDYA 3RC7A 3RC9A 2VWHA 5HTOA 3U3XA 1E3EA 2WE7A 1G1AA 4DC0A 3H9JA 3GRKA 3AY3A 3WGYA 1R6DA 1B15A 1DFIA 2HRZA 1I5RA 1A72A 1ISMA 1E3SA 4LVCA 4CV2A 1DJNA 1QP8A 2I67A 3JQ8B 2GF2A 5BSEA 1XKQA 5KJEA 5T8KA 4RF4A 3I6IA 4U7WA 4NI5A 2UVDA 2TMGA 5AXAA 4M54A 3G17A 1BW9A 4GWKA 3IDSA 1YQXA 1YBAA 3ZNNA 4B7XA 2NV6A 1E7SA 1QLJA 2DBRA 3ST7A 3DFUA 5COBA 1DO8A 1JKIA 4CMHA 3IQDB 3GDFA 2BD0A 3Q1LA 4O63O 4BNWA 1FDSA 5JPIA 1Y81A 3KYDA 3JQFC 4ROSA 2RCYA 2ZB8A 3CXRA 4J4BA 1G0OA 1ADBA 1JWBB 1ARZA 1DRUA 1Q7BA 3GK3A 4ZQEA 1NPTO 3OF2A 3FN4A 4DVJA 3KYCB 5I9NA 2ZCUA 2DC1A 4R1SA 1DHRA 4D3SA 3JQBA 4NIMA 3NX4A 2X86A 4PN3A 5KWEA 5G0TA 1VPDA 4MIOA 3VVCA 2OORA 5GMOA 1B26A 3W6ZA 4WLFA 3DR3A 4J1SA 2VZ8A 3SBOA 4FFLA 4R3NA 2O50A 1E3WB 4JNKA 3VDRA 1ZFNA 1YL6A 3E82A 4CMJA 4NG5A 4K26A 5CEJA 5F5LA 1BXKA 3EW7A 2Y0CA 4C7KA 4DQVA 3PHGA 3DZFA 4B79A 3ICCA 1DAPA 4NFSA 1JW9B 2VNAA 3VH1A 5F3RA 4KOAA 4I8XA 4EGFA 2VT3A 2JJYA 1GZ3A 2B4TO 3O8QB 1R4MA 1GPDG 3U49A 2F00A 1TT5B 4ND4A 3TFQA 3NT5A 2IXBA 1U3VA 2BELA 4N5MA 2HMWA 4XYLA 1XSEA 2XOXA 4Q3NA 3E5RA 3RCBA 4XQ9A 2X0IA 3MTJA 3HB4X 3JQCA 1ZXLA 2C7VA 3CMCO 2PD6A 1IYZA 4LCJA 3DBLA 4Q3BA 1E6EA 1T2FA 2C59A 3RJ5A 4A03A 5JCJD 4NBRA 1XELA 4GVLA 3BMCB 1DFGA 3INTA 3MZ0A 1UZNA 1R4NA 1BHSA 1U9JA 3TZQA 1ZEMA 4B8ZA 3DZIA 5DDIP 2O3TA 4MVJG 1N7GA 4L4RA 4FOSA 3C7DB 4YRDA 2AQKA 2O4UX 4J6FA 2P9EA 2EWMA 4RVDA 2G1UA 3GMSA 2DTXA 1VSVA 3TSCA 2VYVA 4TMFA 5MDHA 3PJEA 4YWJA 3WGZA 4YJGA 3VH2A 2DBQA 4E33A 1ZEJA 2JFGA 2WMDA 3BTOA 2E49A 3FRJA 1L7DA 2GPTA 1U5AA 2P91A 1FJHA 3E6AA 2R00C 1XR3A 1LDNA 3H5RA 5ILGA 4CJXA 1BW9B 4OHUA 2HO5A 1VL8A 4M89A 2EG9A 4RQTA 3A4VA 1JDJA 3DAFA 5ENVA 3WYBA 1HT0A 4U5QA 1ID1A 2Y0DA 4CLEA 5IXYA 2ZYGA 1Y7TA 2I3GA 2C2XA 4E5MA 1PJ3A 3DBHA 4AJHA 3VOSA 4ZICA 1X1EA 3G79A 3JQ9C 1EQ2A 1U8FO 2EP7A 2YDXA 3KYDB 3QWHA 4YDRA 3DMTC 5KJ6A 3S2GA 3U0BA 1HRDA 3GZNA 1R0SA 4GLLA 4OJNA 3LYLA 2X0JA 4CPDA 5JY1A 2Y1DA 1HDRA 4GX0A 2F1KA 1DXYA 4YB8A 3PHIA 1W73A 2J3KA 3MWDB 5KKAA 4CQMD 4CLOA 1HE4A 4Q3DA 1CQIA 3EK2A 1X14A 4DUPA 1I0ZA 1A7KA 3MCVA 4ND2A 3ANMA 3EZLA 1FXSA 2P5YA 1CEQA 3OEYA 1V0JA 3AU9A 3S1LA 4W7IA 1C0LA 3PHJA 3PLNA 2FSSA 2Q1UA 4BKPA 4TKLA 5DT9A 5AOVA 4INAA 4PFJA 4DQUA 4MOWA 4D41A 1GTMA 3KTDA 2UYYA 4CV0A 4OXKA 3ZU5A 5A02A 1I3LA 3SX2A 1ZVMA 3JQDA 1C1DB 4JJFA 3TOXA 5JDIC 2A94A 1H0KA 4GGPA 3UCEA 4YEDA 4OOEA 2A9FA 2J3HA 1Z6ZA 2HSDA 2YFHA 4E13A 4OM8A 1OMOA 4UVHA 4QO7A 5J23A 1LX6A 1Z7BA 1R4MB 2YUTA 3AW9A 3BMOB 1W6UA 3X2FA 2IZ0A 5BQFA 2JFHA 4UULA 2PGDA 3DWFA 4NJOA 5A9TA 4WE3A 4UUPA 3HDHA 2WJPA 4LMRA 1DIGA 1ADFA 3L9XA 4UVEA 2JAHA 3AI2A 3DBLB 1R0LA 3EC7A 4CM9D 5EJ2A 3M1LA 5JDCC 4MIEA 3T7EA 1F12A 3OSUA 2ZTLA 3QP9A 1K5HA 5COQA 4ZQBA 3PTZA 2ILTA 1IUKA 3ZHXA 1R4NB 1KY5A 3OECA 5HM8A 4IQGA 1KY4A 4RDHA 1JU9A 3O9ZA 5JSFA 2OHXA 2YV2A 7MDHA 4I5DA 1K6JA 3ZWAA 1RYEA 3ROKA 3K9QO 1YDWA 4PLFA 3GF4A 1TA4A 4YJGB 4Y67A 3P2OA 3M2PA 1X15A 4GGOA 5HA5A 1YBMA 3AM3A 4CMCA 3VH3A 5U9CA 4GQAA 3RU7A 1S6YA 3DBRA 3P19A 4ND1A 1MC5A 3G3EA 5FWNA 3BHIA 3BMNA 1UAYA 4F45A 4Q3CA 4JXKA 1JAYA 1EVYA 1XEAA 4NK4A 1LSSA 3SC6A 4Q9NA 2JL1A 2W8ZA 2VUSA 3Q6IA 3I6QA 2YYYA 5TGDA 5JAMA 1ZK2A 2YY7A 3GH3A 2GR9A 3DBHB 3SJUA 1JKJA 2TMDA 4PLTA 1HLPA 4ZVVA 3CKYA 3ZV5A 3GZNB 1I24A 4TRNA 5L45A 2FP4A 1NVTA 2O7QA 2ZATA 1IHXA 3HFGA 1Y9EA 2FWMX 4CLOB 5A9RA 1GCOA 4IIVA 5ICSA 3MJTA 2Y1OA 3NGXA 3WYCA 3WXBA 1VKNA 3U4DA 5JO0A 4GX5A 4J0FA 2Y05A 4JP2A 2C20A 1OC4A 4DBZA 4HV4A 5BR7A 5I7FA 5JMWA 3IL2A 3ITKA 5L51A 3G1UA 4A5OA 4BNIA 4I1IA 1EDOA 3A1NA 1HYEA 4IY1A 2V6MA 1RM3A 4R3WA 5KVVA 5L40A 2RH8A 3MJEA 3DZKA 4XCVA 2XXJA 2OFPA 3C1TA 4LSWA 1LLDA 3F4LA 2WDZA 1U4SA 4QEDA 3ZHZA 3ROQA 2H6EA 3NTQA 2IODA 4BGVA 3H3FA 4CQMA 3RUEA 4Z0HO 4DRYA 4QT0A 3GOHA 1HDXA 3UCFA 3QVSA 3WNQA 1K89A 1B14A 3GRPA 1A4IA 4RVUA 1F8FA 1YS4A 4PLHA 2WYVA 3I83A 3H5AA 4FIZA 4NJMB 2PGLA 4XGIA 2NQTA 5DBGA 5K0ZA 3K6JA 2P68A 5I9MA 1P1FA 4IINA 4WCDA 4CMEA 1AXEA 2X8LA 2NACA 4ALLA 1PJQA 4QECA 3BHMA 3VAZA 3GVXA 1E7MA 1J5PA 3CH6A 4BNHA 2DTDA 1XYGA 5JYEA 4Z9FA 1RJWA 1N9GB 2HJRA 4F6CA 4MPDA 3JQAB 2YV3A 3HDJA 1X7DA 3KBOA 4KUHA 5DBFA 2W2LD 4R54A 1YB5A 1Y8RB 3NDRA 1NQAO 2JCXA 4LVUA 2I99A 4RPGA 1E92A 4F3YA 1SO8A 1NNUA 3UF0A 2VT2A 3VKVA 4TVOA 2ZB7A 1Y6JA 4JCOA 3V1UA 2H9IA 4E5NA 6LDHA 1IPEA 1KYQA 2J6IA 3RVDA 4RVSA 2FPGA 2QRLA 2X0RA 2G5CA 3CE6A 3ZNQA 2PKRA 3VZPA 1A9ZA 1BRMA 4E5KA 4HX5A 4CM8B 4P4LA 5B4UA 3FNEA 3DBRB 4YT5A 4R1NA 1PJ4A 3VH4A 1LC3A 4W99A 1PTJA 2NSDA 4R69A 1IPFA 1T2EA 3AJRA 3GNSA 1KEVA 4IGEA 1GYQA 3H4VA 1M2WA 4AICA 3K30A 3TZCA 3JSAA 1HE3A 1QR6A 2UAGA 1NVGA 2BI7A 4OYRA 1P0CA 2ET6A 5KJFA 5F21A 3PZRA 1E3LA 1K2WA 1ISJA 4XGNA 1IOLA 1AGNA 1N1EA 3FD8A 2D59A 1PR9A 2E6UX 4E2YA 3WX0A 4A10A 1LSUA 4IUYA 3C3XA 1HKUA 3JYQA 4PLCA 4XWYA 3M1AA 3JD1A 4E12A 2VRBA 3PQFA 3I4CA 1ENYA 4K9DA 4YT4A 1ADCA 3FR8A 1Q1NA 2YZ7A 3AUSA 4NH4A 1GU7A 4CQLB 4CV3A 3CEAA 4HWKA 1EEHA 1JLLA 3SC4A 2NM0A 3RD5A 4DLLA 4HNGA 5KVQA 4PLWA 1HEUA 4A2CA 1CJCA 4AJOA 4TRRA 3QRWA 1XLTA 1Z74A 3H9GA 3AUAA 4GAEA 4MVJI 3W8DA 3NDJA 4HFRA 4ALKA 4E0BA 3I9NA 5F1PA 3ZWMA 3ETDA 3CPSA 3NEPX 4JBIA 4E2ZA 4RF2A 1R0KA 5TT1A 5JCXA 4FFPA 2OO5A 3R1IA 4W6ZA 1PX0A 1N1GA 2QZ9A 3AU8A 3WB9A 3GVCA 1YGYA 4BQRA 3JD0A 4CQMB 1EUZA 3JV7A 3R3SA 3SLGA 1GPJA 4ALMA 1X7GA 3F1KA 2FHSA 3LT1A 4XR9A 3C85A 2VYND 3MJVA 3LZ6A 1WP4A 2HUNA 3DTTA 5GZ3A 4J9VA 4RF5A 3V2GA 4AJ4A 1UH5A 3INRA 4RVFA 4U6SA 4GVXA 2GUGA 2C82A 2JAPA 1HSZA 3QE3A 4LRSB 5KNLA 2E37A 3ZH2A 5C37A 1WMAA 1LU9A 4IJUA 1EFKA 2X5JO 2O2YA 3JQGB 3LK7A 3ON5A 2B5WA 4O5OA 4CM1A 3H65A 4BNVA 4I9HA 5L4LA 3T4EA 1Z82A 1YJQA 3RFVA 4DTIA 3D64A 4YPOA 4R9SA 5JAZA 2PV7A 4BVAA 3W1VA 2D2IA 2VHWA 3LT4A 1RYDA 3UW3A 3F3SA 5CHEA 1OBFO 2PGJA 2GD1O 1LI4A 1WVGA 4D7AA 4F6LA 5KCZA 4U6QA 3RKUA 3OJFA 1GEEA 3QHAA 4II3A 3OA2A 4A7PA 4IZHA 2DBVO 4YJFA 1IULA 1PR3A 3F46A 1A27A 3RBZA 3TFOA 2C2YA 4YAEA 3JYNA 4CMGA 4UVDA 3IS3A 4QO8A 4BHTA 1VC2A 2P5UA 1C0KA 3OIDA 5EERA 5THKA 1XG5A 3NUGA 4L4SA 1E77A 3OP4A 1HDCA 1NR7A 3UGKA 4HFJA 5CDYA 4J0EA 5IDXA 4DIOA 5LDHA 4DWVA 1ENZA 1LQTA 4BKUA 3QQPA 3PFWO 3ETEA 3VHRA 3WSWA 4HP8A 5KJ1A 1O5IA 3NYWA 4BO3A 4C7JA 4EDFA 1YE3A 3KM0A 2POQX 5CDSA 1UDAA 3GEGA 3BTSA 2BFAA 3ABIA 2Y1FA 1VJ0A 5A4DA 2JHGA 1AUPA 4LSMA 3DZJA 4XB1A 2X5KO 3KSZO 3ZHBA 3IP3A 3GVIA 2NVWA 8ADHA 4M86A 5JC8A 5I8ZA 3ZW9A 3UUWA 1GEGA 3WGGA 1W4ZA 3WSVA 1KVQA 1LBEA 5TLSA 1R37A 1MX3A 2GGSA 3DC2A 4IDGA 4WGGA 5C5IA 1QRRA 3KYBA 3QWBA 4TZTA 4XQEA 1S7CA 1C3VA 1LRLA 2HU2A 4OQZA 3RWBA 5L7WA 4UUMA 3IIEA 3P7MA 4BUCA 4HFNA 3LSYA 1BSVA 3WIEA 2VRCD 1JN0A 2R6JA 3H8VA 4PG6A 4U8GA 3WQSB 1XIVA 3RI3A 1WDMA 3R0IA 1ZSYA 4XJTA 1LJ8A 3RBVA 2VZ9A 5CDGA 4TQGA 2NQ8A 3AM4A 1NQOA 2BMAA 2V6FA 5JNLA 3DTYA 1M6WA 3WDSA 3ROPA 3CZRA 1NWHA 2EGHA 3WJ7A 4R4JA 4BMNA 2VUTA 4NFHA 2VWGA 1SAYA 1Q2XA 4IDFA 5FYDA 4R41A 3M6IA 4BOYA 4CM5A 4YR9A 3UOGA 4OL9A 1BXGB 2P9CA 4J43A 5DCYA 1KEPA 5HRUA 4P8RA 1UZLA 1PJCA 3H9QA 4D42A 4LRTB 3GN2A 1H2BA 4QUKA 1PZEA 4NHEA 3L6OO 1HYHA 1YL5A 3JCZA 3MOIA 4UEJA 1DLIA 4MVJH 1RM0A 4R9RA 1PJBA 4XEHA 5JXWA 3FNGA 1IE3A 1ULUA 3GQVA 2NADA 2HQ1A 3DONA 3AOEC 4NPCA 3HN7A 1I3KA 4BMSA 2JD2A 3AUTA 4B4OA 1NAHA 9LDBA 3GEMA 2DBZA 2J3JA 3DXFA 5C7IO 1GYRA 4I5FA 2Q2WA 3AI1A 3JQ7A 3STHA 3WWYA 5LCXA 2VYNA 2DPHA 4MVJE 3O26A 4YRAA 3LLVA 1YQDA 1A5ZA 5G0VA 4KWIA 4KUEA 1SCUA 2OGUA 1Z7EA 4XR4A 2DUWA 2EEZA 2X7HA 3E8XA 2HMUA 3GDOA 2IYOA 3ULKA 5A3JA 1D8AA 3DAGA 4I9NA 4J1NA 4RZIA 1MC4A 2VN8A 3L77A 1DOHA 4BO8A 5BNTA 4GKVA 4FFMA 3ASUA 3RKRA 3PDUA 2OL4A 1WZIA 1DRVA 2IRWA 2CUKA 4KDFA 4WLOA 3WOHA 5KJCA 3S55A 1SOWA 5T8KC 1WPQA 5EIOA 3R6DA 3FNHA 4IQ8A 1H94A 2Q3EA 3DB2A 4FB5A 2E4AA 4P4GA 3IKVA 4XRRA 4B7UA 1PU2A 3ONEA 3B1KA 3KSUA 4EZBA 4FPXA 1R15A 3S8MA 1ISIA 1ZXBA 4IIUA 4A26A 4BMVA 2LDBA 1QG6A 3VDQA 2HK9A 1PZFA 1MB4A 1SC6A 5C3MA 3ZWYA 4JJGA 3PPIA 4CM4B 2Y67A 3VTZA 4BNYA 4HFMA 2ZQYA 3Q2IA 5IF3A 1IB6A 3AFNA 4GX1A 1N7HA 2Q1TA 3TWOA 1HXHA 1E1KA 3WBFA 4WLVA 2NUAA 3CSDA 1J49A 5ES3A 4IMPA 3TZKA 4J91A 1BVUA 5DZSA 3HB5X 3D3WA 3FR7A 2VOEA 4RCVA 4YT8A 2W4QA 1A71A 3GGGA 1HE5A 2HCTA 3I5MA 2GN8A 3QLJA 4LK3A 4YQYA 4DIBA 3OICA 3L4BA 5EPOA 5EINA 3PFFA 2EP5A 1LNQA 1PWXA 3MJSA 3N7UA 3RFTA 4DIFA 3HDYA 1YKFA 4MKRA 5A9SA 3HZZA 4E5YA 1CIVA 1UDCA 3ZHYA 5EQDA 1MLDA 4URFA 4N7RA 4L0QA 1UP6A 1LLUA 3F6YA 5IN4A 2O4CA 1FDUA 2PZLA 3GMDA 4CUZA 3EUWA 2JD0A 2HMSA 2B69A 2VRCA 3QWAA 2PZJA 4ID9A 5TQVA 3INGA 3QV1A 2Y99A 4YJDA 2HJSA 1XGKA 1LUAA 4NZ9A 3DMTA 1DC5A 5FF9A 2NU7A 3JD3A 5G2OA 4O0LA 2OP0A 4CODB 5CEFA 1EVZA 1XHLA 3H5NA 1A4UA 4AL4A 5DF1A 2RH4A 3JQ7B 3PGJA 4DBVO 1PQUA 1O0SA 2X22A 4PZCA 2QW8A 4PRLA 4EW6A 2GCGA 3DDNA 3GUCA 4IPTA 4N5NA 3EHEA 4D46A 4PCVA 3KXDA 4RV9A 3NKLA 1F06A 4AJ1A 1I30A 2O3RA 1SOVA 1KS9A 4I5GA 2Z5LA 3RBXA 4JQCA 4FS3A 2NVBA 2O3JA 2DFVA 2C0CA 1ENPA 4OXYA 3GC6A 1J4AA 1TT7A 2DLDA 3W8EA 3WGHA 3FF4A 4OMUA 1P45A 2AW5A 3AY6A 4IDBA 5TRTA 1ONNA 1H6BA 2NTNA 4GH5A 1KVRA 4ZJUA 1TI7A
chains in the Genus database with same CATH superfamily
1TM5E 2WIFA 3EH2A 4U2CA 1OZAA 4CM3A 2JF0A 4J03A 1JR3D 2G0TA 3W8FA 1YH3A 4NLLA 3WV5A 3ANXA 1E7RA 2Q4BA 1G8SA 2P7IA 3TTVA 1NW4A 3N76A 5FADA 3OE7D 1U8XX 4BNLA 3BWYA 5DW0A 2H7VA 3LY7A 4AJPA 1U3UA 3FI9A 3VDMA 4BNUA 1C8LA 1F5SA 1I2AA 4GS5A 1ZOLA 1WSBA 2K87A 3AJ8A 3L07A 5KUTA 5DNYB 1DIAA 1MV5A 4B87A 1WQ4A 4H7HA 4Q48A 1Q12A 4BTEA 4JGIA 4KKVA 1IB0A 4TRJA 5JXJA 4YJ2A 2C07A 2D1FA 1RWWA 4PC2A 1II0A 3WFJA 3PI7A 1QORA 3PLAE 2IYLD 4V0ME 1I4OA 3NJ4A 4MK4A 3CZ4A 5D84A 5IM4A 3EFHA 4XM1A 2F59A 4X91A 4CNBA 5KX5A 1A8IA 1YR2A 3GLIA 3DT6A 3EVAA 4OQFA 5K6AA 4JUIA 5EXEA 1JHRA 2Q5CA 4BWYA 4CR7A 3QVKA 3M5CA 4NENA 4RTPA 2GHRA 1CUAA 3L41A 2GDJA 4KZPA 4M1EA 3TSAA 5CXUA 2ZJZA 3WFIA 1NW5A 3PEFA 1OWNA 4WFIA 3P2EA 4G86A 2FN7A 2O06A 2Q9BA 4D3FA 2LBPA 2ZJBA 3FX2A 1MDFA 1Y1LA 2AR7A 1QV6A 2WF9A 5AKXA 3T3IA 5EJ4A 2R6CA 4ML3A 5LL6P 4MP6A 2DKNA 2HF9A 1SHTX 3OKCA 1KYVA 1E1NA 4PZLA 3I52A 2EW1A 2OHGA 3AHFA 4MS3B 5B7PA 2PXHA 5DYTA 1I36A 1KF0A 2V9PA 3B36A 4IXTA 5TQJA 2Q5QA 4G5HA 5JZOA 5TEVA 4Z7QB 3GCXA 4NE7A 5C8YF 2ZT5A 2V8BA 4CCSA 2F6RA 4MVJA 3T41A 3L8GA 1FMLA 3N2YA 5JFGA 5K45A 1XZAA 4BCCA 3CUVA 1II8B 2JIMA 4G65A 2H18A 2JI7A 1SUAA 3OJEA 5CP8A 2X40A 4F60A 5CDUA 3ZH9B 1QOQB 3MT0A 3QXHA 5F1YA 3ROTA 3K09A 4E15A 4JGBA 1MG0A 1QS0B 1FMJA 4TN1A 3MD0A 4ZZ2A 5NLLA 4TV9F 1QHFA 2HK8A 2YMMA 2YJ5A 3LBFA 1M66A 1N5LA 2M1XA 3OOHA 4TWAA 5CUQA 4ND5A 5AFSA 3S8YA 1RJDA 2Z2JA 3ZZUA 2HSGA 4WKGA 4Q02A 1NX6A 5FJJA 3LQFA 2AN5A 3NAQA 3W3ZB 1C41A 1JXAA 2WFLA 1PG2A 3Q11A 1YRYE 3GT0A 3DULA 2JEZA 3R0ZA 3SIXA 1M6NA 1V1MA 4D02A 4XFJA 2V1UA 1I10A 1KFKB 4R1UA 2CF5A 2E4YA 4D8VA 4R8RA 1TO6A 2ZSHA 1OH7A 2D3WA 3FCSB 3AK4A 1HNXB 4JZKA 3O21A 4K3UA 4B8WA 2PXCA 3IQEA 2BISA 3QNUA 4OO3A 1LS1A 3I4LA 3L0SA 4IJVA 3HP4A 1OBCA 3NOVA 2GS9A 4RO0A 3V7UA 1GTSA 3UGQA 2WWIA 1O6CA 5GONF 3T3EA 1OLXA 1YRQA 3RS4A 2MU1A 3IUMA 4LWQA 2QTRA 1M75A 3IX7A 3WRYC 2O48X 3NVKI 1FS5A 2V1XA 4KQIA 3PWKA 4BYGA 3H6KA 3M6WA 3GU3A 2A3RA 3E8SA 1N75A 1Y3HA 1B8PA 4QL3A 5BNWA 1IHDA 1KEUA 3QVTA 2YNMC 3IIMA 2N75A 2PSDA 1KZ1A 4ER7A 3O31A 3GFBA 2VYQA 3FMGA 1ISPA 4BO0A 3WNDA 2FQXA 1SIWA 4W9NC 3ZV3A 3WGMA 5FOQA 1BEUB 1XPRA 1HNWB 4H15A 5CT8A 3NMUF 4R01A 1G5FA 4PQRA 4GOXA 5IVIA 4HNUA 3WOVA 2VYCA 3JTMA 5AICA 1USKA 2AQ8A 1F6DA 1GL6A 3QA9A 4P54A 4DCSA 1NFQA 1Q0ZA 4IZIA 4RD1A 4CLXA 1ZH8A 1QC5A 4Y6PA 3PNVA 1GAQA 3W04A 2XZOA 3SC2B 3CVUA 2O2EA 3QG1A 2O0HA 4RESA 3N0RA 4BE4A 5JHGB 3A9VA 1BHJA 1WSAA 4U39A 2O52A 4P32A 4GI3A 3RYTC 1KWGA 4I1YA 1VIYA 3DMYA 2WHPB 1ISFA 3DPSA 1FC0A 2EFEB 1BMDA 4GP7A 3UFXA 1D4ZA 3B38A 4KRFA 3GFVA 3IOMA 4KODA 5TPWA 2H5EA 2Q3CA 2WC1A 4DE5A 3K1JA 3R9WA 1FS6A 4DNFA 4NCXA 1EJ6A 1T2AA 2ZSKA 2F48A 3E03A 3KT8A 3Q8KA 3LHDA 2AMYA 4OBBA 5C5CA 4TXLA 2ZKIA 4MULA 2IEDA 3OWXA 1YC2A 4HLNA 4HNQA 4KQGA 2FGKA 2WD7A 2OENG 5IP5A 2FWJA 2NTVA 1OFUX 3L8EA 5I7AA 3UJ3X 5FUQA 3NP7A 1M7HA 2Z4RA 2L19A 2OV4A 4KQWA 1G59A 3MWJA 4XFKA 3I1IA 3DEAA 4R7GA 3VO2A 1VB5A 5JQGA 3F97A 1D1SA 2P11A 3H42B 2PRZA 3CZ9A 4J2HA 3LQ2A 1QHNA 3L4EA 4Q9LA 1R9GA 1A7AA 4Y8VA 5TE9A 4B83A 2XWQA 1Y0BA 1EFDN 1AHHA 1FTYA 1GPBA 1QTNA 1HEIA 3CSUA 1H3FA 1X3SA 2QMZA 4PNPA 4KQ6A 4ER5A 3U16A 4TKMA 2AFIE 3BRSA 4DA7A 1R64A 3IVRA 3HV2A 3UMMA 2R44A 3BIJA 1P7WA 1X87A 5DIZA 4YXFA 1COZA 1VLQA 5B6JA 1K6MA 4GICA 2PA3A 3ABQB 2HA6A 1WDLA 3BBLA 4TUYB 2FQYA 3N5KA 5AIAA 1GNLA 4OJYA 1EUCA 4TX1A 1PQYA 4XGRA 1F4LA 4IQFA 1OTYA 2GPNA 4KO1S 5KMGA 3A32A 2PL9A 4ZXFA 2IDKA 1T4CA 3GXOA 1Y33E 3LWBA 4FE4A 4AD8A 2BBSA 3QW4B 3SEAA 3HLKA 3NLLA 5GADl 1PJTA 2BH9A 2R9VA 3BMNB 4DF3A 2BC9A 3FGPA 3KHKA 3NANA 4WEOA 2I4NA 1NNI1 4I9UA 5DM2A 4EBFA 4HUQB 5E6RA 1SHZA 2O19A 1RKXA 4OCZA 4BU1A 4KSBA 1XU7A 3HFJA 4Q01A 3E5MA 3H83A 1HSOA 1FX0B 4TVKA 1TUBB 4BAZA 1NR5A 1K68A 4OUKX 1TECE 4C22A 1XTTA 1G5HA 3GJQA 4DA9A 3QM1A 4D57A 4KQXA 1J5XA 5HX7A 2RGNA 2EFGA 5LSAA 1OILA 2E85A 3QPUA 3OOJA 1ORRA 1VJRA 1XA3A 4MLPA 1DRWA 2JFWA 2ZWPA 3NETA 4AKEA 4DNPA 1GR0A 2ERXA 4JLSA 2G06A 1F17A 2ZROA 3PDHA 5CG2A 2CXUA 2NX2A 3QWFA 4OXXA 4GNKA 4H4EA 3IBFA 4QFCA 1GDHA 1I01A 1IVNA 1GPAA 1J2YA 3KZVA 3QPBA 2QMUA 4JLPA 3FETA 3BS4A 3P5SA 4XDGA 2Q21A 1R0YA 1VE3A 4N65A 5JZSA 3RC2A 4FWIB 3AZOA 3MGBA 4RPHA 2D1QA 1HE8B 5MFZA 2FPLA 3U1VA 3SS9X 2W83A 3CLTD 3TW4A 4M49A 3MTQA 4OKNA 4HEA6 3C1OA 2O8CB 1WAMA 5CM2Z 3JU3A 4FSDA 5DLDA 1VKZA 4YV1A 2CDNA 1QYIA 2XKBA 3CUUA 3Q2KA 5CLIA 3WWCA 5BUCA 5KIAA 5EKDA 1DG9A 1KFEB 3IP1A 3JVVA 1E1DA 3P27A 4M1YA 1DBPA 3SS7X 4AY4A 4BKQA 4EJ0A 4KB5A 5CYOA 1NMQA 1I7QB 5IH7A 1I51A 5FO1A 1GAXA 2BFPA 1WNFA 1V35A 2CCKA 2CY0A 2DFPA 4MNTA 3VNSA 3ZDXB 1IH8A 3DXXA 3NDIA 5BP7A 3S28A 4L8FA 4HK4A 2ZB3A 2J0EA 5TARA 1I7PA 4M0KA 4IDOA 3G85A 4L16A 1QGUA 4G36A 3SHOA 5KNDH 1HZZA 5EMKA 1U6IA 2BGRA 1PGJA 1SFRA 3T15A 2OB1A 1CJUC 3E3NA 4DG5A 5TX7A 3X1XA 2X0FA 1E2EA 5TMEA 3RJMA 2J4CA 1CDZA 4CMEA 3IO5A 3K5WA 1BWPA 2DHRA 2QRMA 3PI6A 1Y6QA 4A6PA 5E7IA 3IV6A 3VTFA 3CNQS 3D0OA 4GI2A 2FSFA 4HDNA 4YN3A 3HL0A 4EO4A 1CZKA 5DOVA 2FMFA 3I23A 3K9HA 2W4IA 3TEFA 3VOBA 1F8XA 1FJGB 5DBIA 1KOFA 1GTL1 1HDYA 2EIHA 1HFJA 3IILA 5EE3A 4YRKA 1IBKB 4IDEA 2GCOB 3UCXA 3V46A 1RPAA 1VHDA 4FFRA 4IV5A 1N5IA 1XA0A 1KKMA 1CP2A 4I50B 4DJAA 4EX6A 2VA9A 3B51X 1NM5C 2JZNA 2QAGB 5I01A 4K9SA 2ZITA 4Q12A 3IJPA 1WY7A 2G9ZA 1ENOA 2ANBA 4EEXA 1OI7A 5A5VA 5B57C 2NU9B 4MP3A 4S1WA 2CYBA 2FK7A 2JFVA 1PNQA 2H7YA 4FDMA 2AN1A 2M1ZA 1MORA 3S27A 3VAYA 3VKWA 2CDRA 2QJTA 4F2WA 2QUJA 2P62A 3GA7A 4L57A 2DPGA 1Q1BA 2GM3A 4J7UA 2Q5OA 1W88B 1KYWA 1M0SA 1ZXXA 2I4LA 2FUCA 4YJHA 1AV6A 1U2DA 4LYHA 1H6DA 2M6KA 4PLYA 1E0DA 3A06A 1EZ1A 3OAAD 5AKGA 3X0DA 4D6XA 4ARIA 4XYBA 2PGXA 1MXHA 1ILWA 2YWHA 1KI6A 4S1TA 4U9UA 4AJNA 5M5BA 4JBNA 5YASA 1L3CA 1QYWA 2DFDA 2IEIA 1GRCA 2P77A 4FGSA 3WBBA 5BR4A 4NQRA 5DNDA 1MX1A 2ZR8A 4D92A 5C7LO 1TB4A 3WKAA 1NF9A 4UE2A 4V3BA 1XE3A 1TD1A 3RAFC 1UKBA 2XZLA 4R8SA 5KYXB 1DTEA 2RHGB 4PYRA 4J9UE 3A28A 3U7GA 2OV2A 3O2SB 4BGIA 2NSHA 3PIDA 4KUGA 4V0QA 2FWIA 3QU5A 1Y9AA 3VO9A 4RJ2A 2NPFA 3WLQA 4F9FA 2G71A 2PFSA 1LA2A 3GGSA 3TW8B 3GJSA 3DCYA 4MV7A 4Y6RA 2PNJA 2VNHA 4NABA 2WB4A 5ALSA 4DA4A 4FJ0A 1XVTA 3HNOA 5C3UA 3ORFA 2AJTA 4HB4A 1FCJA 3RYIA 3K31A 1HT2E 3COSA 2V0CA 4G8CA 3KEOA 2UZAA 1U7TA 4PLVA 2HDWA 5LOVF 3TQRA 1NUSA 5DNWA 4LYFA 5K0LA 5K8JB 2ACEA 3VJMA 2V7BA 4L02A 4WJKB 4D9BA 1CBUA 3BTUA 4ZOLA 4MUBA 2VNSA 1U8EA 1U7HA 5J4KA 1RC0A 4U7HA 4BNJA 4IKEA 5LB4A 3HDQA 5DSXA 3NM5A 1XROA 2D0DA 3R44A 3O75A 4FKBA 1CYDA 4HPJB 1B2LA 2RGAA 4B3SB 2QTZA 2CMDA 3P9SA 4OHZA 4M87A 3MG9A 4P3KA 3FZNA 5JBNA 2UUCB 2GD0A 4CU2A 3GFRA 4OIFA 4BV8A 3VC3A 4G5OA 4HO1X 2VR1A 1WLYA 3C45A 1FW8A 4Y9RA 3V8BA 4C20A 1GPUA 5AUPB 2LPMA 2UVPA 5SZIA 2GK3A 3EXHA 4DYVA 5BNZA 4CKWA 1ABFA 3D6NB 1UJCA 5CIQA 2VLBA 3AEKB 2VP6A 1NF3A 3P9ZA 2Y2UA 3LC7O 3K5PA 1KI9A 4IILA 4E21A 4YMLA 3D7KA 4KL8S 4ENWA 2E18A 4JA2A 4R5HA 4BP8A 3N0XA 3ZJ5A 3OJOA 1H22A 1Y3CE 3O8QA 2GYYA 4N3CA 2NYRA 3AVQA 3Q3JB 4ZREA 1OH6A 1C1XA 4IWYA 1IJBA 4F8EA 2W90A 4YQFA 2CGEA 3L8CA 4LDNA 1K4YA 4U2BA 2ZUCA 1PVOA 3U3DA 1OAAA 1UP4A 3C7KA 2IYYA 2OUKA 2VATA 4LJYA 3ADPA 2VC2B 4E1AA 1Z7YA 2PGNA 4ND3A 5LQRA 2XGGA 1NJ1A 1R74A 3JWJA 2X41A 2JI4A 5FR2A 4ARVA 2BMVA 4UBKA 2Q3MA 1XMJA 2X42A 2QZPA 4DR7B 1X3LA 3H9UA 2B9EA 3FVRA 4XI9A 3SQWA 1UBRS 1VBMA 3QYAA 2Y1GA 2EGUA 4JUAA 1ZH2A 2Y1CA 1YS6A 2A59A 2RKOA 4C05A 2J3IA 5ELXA 1T25A 1Z28A 1ZGJA 4IH9A 1WHSA 3AO0B 1T24A 3TI9A 1QJ4A 4CW7A 2ZWAA 3V2UA 3P26A 4UW9A 3W78A 4DDMA 4EYQA 2X3UA 1W0CA 3OLVA 5J2UA 1EGVB 3LVQE 3D8UA 4IH4A 5EIHA 3ABZA 1DZ3A 1OB2A 1H2RS 1N2EA 1CEYA 1YS2X 3G0DA 4EMUA 3VMFA 2RGEA 3KKLA 1HI9A 1N8TA 3PQDA 4NC9A 1QMGA 1D1TA 1AGPA 1RZ3A 1J20A 1EU1A 4IP0A 3IHLA 2MSCB 2OUIA 2P67A 4WLNA 4FYJA 2JJ2A 2C8LA 2ZRBA 5IAGA 4F86A 4RY8A 5JE8A 3UENA 3W5AA 2QX8A 1F4PA 5JMPA 1EDZA 1KAEA 5A0FA 1IG0A 1XNGA 4BNTA 5GVSA 1JA1A 3L6DA 2PWAA 3FTNA 2P40A 5EE9A 4ZI2A 1FUUA 4YJFB 3R9IA 2KS6A 3QKTA 3EQ9A 1RMTA 2XQKA 3NORA 1VM6A 5AWFC 5BW4A 2P4SA 1XQ1A 3ETGA 4PHGA 4R1LA 3H87A 4NHOA 3TOSA 4TYYA 3LWDA 4B4UA 1QQAA 3FG9A 4S2UA 4B3JA 4PX5A 2R6GA 3CZPA 4RXMA 2EDCA 1M0TA 3ZE6A 1WVIA 4K6MA 2RGGA 4RHXA 3FOZA 3QTTA 3FTDA 2XECA 2VTEA 2ZEJA 2QZZA 3T7JA 3MC1A 1K7XB 3AB3A 3HXMA 3HDVA 4TPKA 4UNSA 1QAQA 2I2BA 3U3OA 3GA0A 5LQJA 3CH4B 5L3SA 5K3AA 2OP1A 3KAKA 3ZV7A 3MTBA 8GPBA 2VZLA 4HS4A 3EIXA 2G83A 3A6PC 3CUSA 2HA0A 3HJBA 3GJ7A 4WA8A 1XCBA 4MP8A 1Y3BE 3FFAA 3KBBA 4H77A 2PUWA 3A2MA 4LHYA 5HUHA 2P2GA 1PT5A 4FOOA 4K6CA 1S2MA 4B46A 2BFDA 1RJ9A 1PVDA 4Q3OA 4UQLA 4NY1A 2R1VB 1UT8A 3EAGA 4KXQA 3J7TA 1XAIA 2CVZA 3PXBA 1TAHA 4Y1RB 5K9ZA 2R7MA 4FONA 1GUFA 1HY3A 3VISA 121PA 2VTKA 2WWRA 3CR3C 1K5PA 4S1VA 3GLHE 4TMZA 3VPXA 1JWAB 3BXPA 4K8RB 1P81A 3JQ6A 3VC7A 4R1QA 4RH0A 3WB1A 1A82A 1YSCA 2COKA 2WM3A 3LX4A 3QLTA 4ZIRA 5CA1F 2ZJ0A 3LSTA 5BSFA 4MVJD 3ICEA 1F0YA 3KFXA 3ZBQA 3MJ4A 3REFA 5IF9A 2VJLA 1EDEA 2ZIGA 2R1TB 1JPNA 3N2KB 1P1RA 1PV2A 2XDAA 2BEWA 1OH5A 1PGOA 1ZG3A 4X6UA 1IWOA 4JIGA 2ZVQX 2JLCA 4H0CA 3W0LB 1T9BA 2BVNA 5F2KA 1KWKA 1NNLA 3M2TA 4J0KA 1XQXA 3B1JA 1XEXA 1M34E 2YFQA 1HNZB 4YALA 3ZCSA 1VKJA 1DO2A 4EG8A 2IE0A 3FJOA 1RI1A 4WK6A 2JARA 4DJ5X 4D9NA 1YBHA 1L7QA 2BAGA 1PWEA 4FKZA 3WADA 3ND7A 4Z3KA 1I4DD 2MYPA 4ZZ3A 3FHOA 2HTFA 4ZD6A 2M9MA 1KERA 4OK6A 3AHHA 5A5EA 2VHQA 1OE0A 2J0VA 3BIWA 3O9VA 5G4LA 3ISJA 2B3TA 2OCBA 3CQ9A 3U7RA 4LXQA 4RUKA 1FFHA 1GZ4A 1W44A 3H9EO 3SF0A 1P61B 2FLWA 1JDZA 2GHTA 3DDHA 3WIBA 3QVVA 1D8TA 1JQDA 1QGAA 1KJJA 3ABSB 3CO5A 4JASB 1GT6A 4RELA 2DUMA 4XM2A 1UWKA 4AJJA 4IIFA 2QNBA 3HU2A 1Q7GA 1N0WA 4FR0A 4IIBA 4D43A 2H0AA 4J7CA 4R68A 4JMLA 1LBIA 1TCUA 4RV5A 3JQ9A 1J6UA 1SU8A 3GFOA 3LDGA 4RYLA 1QUFA 4PHFA 2H57A 4OQNA 3NHRA 2K4MA 2V58A 4WXYB 1ONBA 1QO0A 2VWPA 2XYQA 4IHJA 1XLWA 5ALDA 1P4SA 4BX2A 3VGJA 2BI4A 5FV4A 4BO1A 2GYUA 2PKXA 3RWMB 1M7BA 1W85A 3B20A 3Q7PA 4FEYA 1B8OA 1T6YA 4IXWA 2AZDA 1ZGGA 3Q8LA 3MAJA 2GARA 2EQBA 4RIHA 4D4MA 1BDHA 1P0FA 4DNQA 2VDUE 3B53X 1YB4A 3I6ZA 4YQZA 1KAOA 3OLCX 1IOVA 2XZPA 2VHJA 3MOGA 1GDTA 4CQNA 4JEHA 4AI6A 3L4BC 1JFFA 4QGGA 2DGDA 4Z9AA 1EX1A 3ZLVA 4ETIA 4WERA 3VQTA 3L05A 1D0VA 2BRUA 2GT1A 1GM5A 3MQ2A 4ZMSA 5ALVA 2WPDA 5DN6D 5JDIA 3R3XA 3KSDO 4NXNB 1QRTA 1UR5A 3AFMA 3DMHA 3IE2A 4G3XA 4A15A 4U9IS 3MT7A 4YRSA 3KEQA 5CPFA 3L6UA 4F12A 4NKRA 4ZGBA 1T4DA 2F90A 4Y0VA 1QVWA 1XQWA 4YUWA 4JLWA 3GLFA 2V7XA 1GNSA 1TZKA 2R97A 2IXTA 2O2HA 2QT0A 1JG7A 3FYHA 3UHJA 4D9IA 3O0TA 4GPBA 5F1OA 3JWIA 4FGZA 1V7QA 5BXYA 1E9RA 3ZIAA 2JPDA 3OJWA 3BE5A 1Y1RA 2CVHA 3QBEA 1SVIA 5FTJA 2YCBA 3ZBUA 1GXSA 2RHWA 3D9QX 4GSKA 3V4PB 3ILVA 3IT1A 4CIDA 4E07A 1ZR4A 4W5JA 5J2TB 1QUEA 1G64A 4EO7A 2HIAA 2IHJA 3NYRA 3P0FA 5E4JA 4DXDA 3VMMA 1IIRA 2GVDC 4G1MB 4PVCA 4ARAA 4JLNA 4HUTA 4M1QA 5JW6A 3P2MA 3ELYA 5FA5A 1Z38A 4ZCTA 4E70A 3ZLJA 1SHKA 4HEJA 4P35A 1JEQA 4EH1A 1X1BA 1EVIA 1X2BA 3BWMA 4CZ2A 4EG0A 1MW9X 3IUPA 5DJ5A 1WKBA 3CZMA 1PFQA 3LY5A 1H2EA 1X7YA 1X9GA 3V8RA 4LNAA 4LC1A 2F3PA 3GDHA 3ZDZB 4Q34A 2G82A 4IF6A 5F51A 3QEMA 3NDPA 3CKKA 2R751 3VC1A 3TX6A 4XQCA 2IYZA 3D3WB 5HFJA 2XCUA 4JITA 2XYVA 1SZJG 1N2GA 5T6MA 1CUVA 2JIZD 4I1OA 4WOBA 2ACWA 4QXQA 2C9CA 2BFBB 3TXAA 3TQHA 2WYOA 5EJAA 1DKPA 1Q0RA 1ZOPA 3MTDA 5FBKA 2B0JA 4DIKA 5GIPE 3DD5A 5JQWA 3SZGA 1P2UA 4OFBA 1D07A 4RK5A 3VU1A 1K8ZB 2WVJA 3AOGA 3P0JA 4MITA 2JJQA 4DWOA 5KVSA 1W2GA 4DSTA 3BQNB 3DOOA 4P7GA 1N2OA 4QSMA 3UWPA 2B7BA 3KO8A 1F2TB 1N78A 3IP5A 1PGNA 3FSRA 3W7VA 1GKKA 3VX3A 3LTEA 1Y42X 3A9RA 7ADHA 1PJLA 3Q1KA 4MAMA 1ZW1A 2XTNA 2WICA 1EK1A 3L04A 4FFOA 4MW7A 5JD3A 4A8HA 3TR5A 3BKXA 4M36A 4ZHSA 3I28A 1F3LA 3FPLA 2XA2A 1QNFA 3JRXA 5CB4F 3DE6X 3TG2A 3WGVA 1HOXA 1N9GA 2LUOA 3PCRB 5GM1A 4BY9E 3JQAA 3L93A 4BO7A 3SXUA 3TD6A 5IDQA 5EPUA 3K8ZA 1H4TA 3GGJA 4IRUB 4GMFA 1GDDA 5CK5A 2JFYA 3AWDA 5FUMA 4QEKA 4RV4A 4FBLA 5TQ2A 3ZWQA 3H19A 2C4UA 4CDGA 1W36C 4IG4A 3UJAA 2FPOA 3ANLA 1WXIA 3K2IA 3GO4A 3A9UA 4FEEA 4PGFA 3LK6A 4DCCA 4OD0A 1Y82A 2CK3D 5H3CA 4KIWA 2WDPA 3PDIB 1Y4AE 4RFLA 3VNUA 1IY9A 1D4OA 1ZM2A 5DYYA 4DGSA 1ZLXA 2K2QB 2Q1WA 1JP7A 3DTVD 4U7TB 4OFXA 5JCJA 1FA9A 4EMSA 4QJ3A 1I1HA 1OOEA 4P4NA 5EHZA 4DG8A 3OM1A 1XK7A 2OCXA 4KDEA 1R8SA 1T5IA 2IGTA 1RW4A 3AEXA 3DTNA 3DZBA 1GLVA 1QPBA 5BSMA 1LQ2A 1AU9A 4CEIA 4TYMA 3RREA 4F6RB 4ZEMA 2GA8A 5DXJA 5CJJA 3WWOA 1NWCA 4GLFA 2EKZA 1G2QA 4ISBA 4WK4B 1ETHA 1OBOA 2EFHB 2QF7A 1SXJC 1NHWA 3CS3A 3NGMA 4EYEA 1KP2A 5JBIA 2HEGA 2KE5A 4B5KA 4OQXA 3KQUA 1SUBA 1TPZA 1W96A 2FLKA 2OQ2A 2P2DA 1KH1A 3EVFA 4GECA 1VPLA 2OCAA 1OPXA 1FLNA 2GCPA 4WZAB 4XX1A 4C03A 4D82A 1IBMB 1CUGA 5LMCA 2Y9MB 3HB1A 3PNPA 3TTSA 4UKDA 2C8VA 2QQ5A 4OP3A 3ZY5A 3PSAA 2LVBA 2ZREA 3ED1A 5IEBA 3VKFA 1P1KA 3CSSA 3ZQJA 2IBMA 2Q46A 5EJ7A 2Y0PA 2TECE 3B48A 1IAVA 3DQQA 1KZ4A 3JYOA 3OJ0A 4MEAA 1DT5A 3LXRA 2R8RA 4KIGA 4CETA 1DC4A 5JYCA 5JUWA 2Z9BA 3AVYA 1B0UA 1JXQA 3CF4G 3CX4A 3Q0EA 3GNQA 5AW6A 1JH9A 1HETA 3QYJA 4IM7A 1GZDA 1E1RA 5GY7A 2AEJA 2X6TA 3WIUA 2H1WA 2OD7A 3V97A 1H4VB 1SCJA 2SBTA 1DWOA 1GCIA 1PQ4A 1P91A 1DX6A 1Q3KA 2EATA 2VEDA 2WF6A 3L0DA 4H6WA 1CHNA 4PNEA 4EJ2A 5JR3A 3IEIA 3HVRA 1KJ8A 1P5ZB 2AJCA 1BE6A 3HCDA 3OQJA 3C6BA 4F4HA 3F5SA 3URMA 2D74A 3QVUA 4LDZA 1Z4JA 1BDMA 4POAA 4WRRA 2Q0HA 3ZV4A 4B7CA 4Q1BA 4EUNA 3ZGZA 2C5EA 1ZK1A 2OD9A 2ZPAA 3IPXA 3AKDA 3OX4A 3OPYB 4MZXA 5AQ1A 1UDBA 1ST2A 1KVTA 1XDWA 1J8DA 4ZO6A 2J6BA 1CV2A 1XCGB 4REQA 1PZGA 3D02A 1B74A 2X0EA 3T4XA 4ZYVA 1HPLA 1Q50A 3H8SA 3IMKA 1QWSA 4Z9XA 1IXYA 3FWNA 4KFCA 3RAPR 1NRJB 2JLAA 4OPMA 2ZQ5A 1ZBQA 2HCFA 1G4HA 1SRQA 2JCYA 4UUNA 1ZU5A 4W7SA 4XASA 1DWPA 4GKBA 1H3EA 5CLQA 2O2DA 3Q9UA 4Q93A 2NP6A 1XD2A 2RDMA 1VRWA 1Z4KA 2PT5A 2YASA 3FFTA 1K08A 4I4CA 5F1KA 4DV6B 1FSPA 3OMLA 2H16A 1L4LA 2QN9A 5LA6F 4AS3A 3HZHA 1XAJA 5FPSA 1RXUA 4AKSA 2Q7DA 1LDMA 1AT1A 5LZ9A 3EUEA 3DHYA 1U2GA 2V6IA 3CONA 5EMHA 4C4RA 3IDAA 2ZRNA 5EJGA 5L4NA 1YAHA 3DO5A 1MAUA 2JGFA 3NVAA 4PG8A 3D5TA 4G2NA 1WKCA 1M67A 4WQMA 4XYEA 1Z17A 1CUZA 3RYCB 1XOIA 3E9QA 2B5VA 1HQDA 4IHQA 5FPPA 1RHRA 3MXOA 5B37A 1JDSA 2XZTA 2J46A 3O82A 1EQAA 2KM1A 4NOJA 2VNKA 1SPXA 3HB7A 5ARDA 3WGUA 3UJ8A 2WAMA 4DTCA 2XXBA 3O94A 4NU6A 1OT5A 1NL3A 1N0UA 2YWRA 3EUAA 2H1OA 3MEQA 4DXHA 4FNGA 1LDBA 4TQ9A 5B1IA 5IRCD 3TE7A 1G63A 2A35A 2EZTA 3VSAA 5IZCC 3DEZA 2XWPA 2FZLA 4Y6GB 4RSGA 3PITA 1RMYA 2Q27A 3O1HB 3Q88A 4OHWA 2PUFA 1JQAA 4EI9A 3SJZA 4M6WB 1GY8A 2CNOA 2AR0A 4J0QA 5CAEB 2PX4A 4G8DA 3IB6A 4CM9A 1T5DX 1AB6A 3E05A 3KT6A 2PS0A 4H7EA 4H7JA 5GZ1A 1U1FA 3AHDA 4TUYF 4ZQHA 1ZSNA 1TKRA 2PNFA 3DLPX 1J1IA 2JATA 2WG1A 2WMYA 3FYDA 1PGPA 3H7IA 3HGQA 5B30A 1U3WA 4C4SA 3SYKA 4MGEA 1IUOA 2IY7A 3MJRA 2HO4A 4M9XA 5K3FB 1C1YA 4PO9A 1M9NA 5D3QA 2ZIZA 5AK6A 3VI3B 1NZDA 4WCFC 4V0OA 1GL3A 4WOKA 1OZGA 4B3FX 5B2FA 2G5GX 1Z33A 1VRCA 3JAKA 3HEMA 1YQ9A 2X9QA 1B1CA 2J30A 3B1YA 4G1BA 1O89A 2ISQA 1IZ7A 3GFTA 1VDZA 5AOBA 3TL3A 3UJ6A 1U7WA 4P83A 3AUYA 4YAFA 3D0QA 3K2EA 3T9AA 1ABEA 2HBQA 4HMPA 4QTZA 3TZBA 1EFLA 1HLDA 3UH0A 3ZEIA 3E0XA 1ESDA 2Q2QA 3HU1A 5IAKA 3U7HB 1G6Q1 3FCYA 2O2SA 2CW5A 4ZGWA 3HCWA 3ZGNA 4CFSA 4DPLA 2G80A 4B2PA 3UVEA 2C9MA 3TTWA 4F2PA 5HS4A 2C2HA 1J2TA 4QXOA 1SXPA 1CU1A 4KLNA 1CQJA 3GLGE 1B8VA 2LTAA 3EMBA 2BFEB 2H4XA 3R3JA 3OU6A 3OQ6A 3P0RA 5H1YA 1PUXA 2VZ0A 4E51A 4QQFA 3LO5A 4AYXA 2PKQO 1JL3A 3EPLA 1I1OA 1HKHA 1NYLA 3F90A 3PRYA 2O07A 1YOVB 3N8HA 3O4JA 1RDFA 3PHBE 3KB2A 2NU6A 3S2FA 1AQNA 2RHHA 4G4GA 4G9BA 3FKQA 3OZEA 2PUBA 4PIPA 2XB4A 3SVLA 3DFMA 2GD6A 4FZ3A 1DU4A 5JECA 2QM3A 1BROA 2JGLA 4I7EA 3TXYA 2B20A 4LYYA 3SJ7A 1DKQA 3HABA 4N0QA 4REMA 1YJ8A 1VI2A 1NOJA 2EQAA 2H1SA 4G1FA 1U4OA 4KBYA 4LZWA 5T6BA 4V1CB 4L8WB 1I4LD 4P81A 2ODAA 4GI7A 421PA 1XTRA 3ENKA 3G0CA 2PWZA 1SG6A 2B83A 2NZ2A 4OTZA 4TKUB 1E4EB 4ENSA 2OB2A 3RUDA 4MQMA 4Z0PA 3ZNOA 1WCV1 4M83A 4TZ6A 5LZ4A 3PCXA 3AUUA 3FW1A 1LTKA 4P9NA 1DXOA 3JARB 2K5UA 4I6JA 5LZ7A 3DW1X 3JZIA 1VJCA 1HFEL 3PX2A 4HXEB 5C1PA 3CA8A 2NLOA 4DY4A 2YZMA 3H75A 2DUNA 4R51A 3R23A 3HEAA 4YRTA 7GPBA 3PXDA 3RGGA 1GQRA 3KQOA 3PIIA 1OIXA 1DTSA 4K86A 4RLFA 1L4UA 4Z2AA 3CVYA 5CXXA 2UU9B 1LSOA 3HJNA 4YY3B 1GAEO 1KJYA 2YQ4A 3RTCA 4EUFA 5HXAA 2JEOA 4MQFA 3IFSA 1C2YA 5JU6A 1A77A 1O4WA 1ZM9A 1T6NA 4ZU1X 3PP8A 5G1NA 3AXSA 5JD6A 2JH3A 3PR2B 5AW1A 4O2RA 4JI3B 1ZCAA 4W5RA 4R31A 4XSGA 1OA1A 1TTTA 1FMTA 1DXHA 2D1TA 1XXHB 4QU5A 4AMYA 3PWZA 7REQB 1PW5A 4KVZA 1NRWA 1MA3A 3QVWA 3Q41A 4LJ9A 4X20A 5A3SA 3ZUGA 3D31A 2XUIA 3LUJA 5AP9A 1L7EA 5ETJA 1P18A 1GO2A 2J0SA 4DR4B 2O20A 3JYPA 1KSFX 1H6AA 3L7JA 4GLOA 4K9MA 1XTKA 1T3SA 3K0EA 3LUFA 3O3NB 3TZHA 5LQCA 2YZGA 3FGNA 5ITWA 4NR0A 4JLAA 1MG5A 1BMFA 1SVMA 2QTCA 4TTAA 4DIUA 1GUYA 4UDXX 1CF2O 3RUAA 1A5BB 1FVOA 3GJXC 4YMIA 3RSFA 1REQA 1C3OB 1P4AA 2E7ZA 1EFCA 2QPOA 3ZN2A 4OBXA 2H8KA 2WEKA 3QBTA 3KSBC 1P31A 1PT8A 1WPXA 2X14A 4LGVA 2HSWA 4OHBA 1PJ8A 1MIOA 4R3UC 4E09A 5CEEA 2CSUA 3D1LA 2AE1A 3F67A 2VQFB 2YHSA 3VYSB 1H66A 2K2WA 4C0AC 3KSMA 2D5CA 3ECSA 5GJVC 2VXYA 2ZUUA 4RL6A 1T1RA 3WKBA 2PKCA 2IH2A 3D1JA 1L4BA 4ESHA 1NUQA 2ZYAA 3W6UA 3G7SA 5P8WA 3QKRB 4QPJC 3QXSA 4C2TA 2GXQA 3C7AA 2OPBA 2REQA 5EJ6A 1OT3A 2RBEA 1WBJB 2EXXA 3SQOA 4Q15A 4QG3A 1S4MA 4JLOA 2Z1MA 3CWCA 3OTGA 1UBFA 2OG2A 3NATA 3O8BA 1RWVA 4NU8X 3GD7A 4U0KA 5B58T 2C7QA 2YUIA 4MHTA 2CBGA 5EL0A 1RAEA 2KI5A 2D2XA 3H3JA 5EFZA 4J3FA 5IYZB 1DKOA 2E9SA 5A4MS 1QIJA 1A50B 2WTEA 1G5PA 1AO3A 1K97A 1GD1O 1R5NA 1ZMBA 3KT3A 3P9RA 4OREX 4PC7A 2EKDA 3NHMA 4RHEA 3RB8A 4EJFA 1H5UA 4CKZA 3W5CA 1RXVA 4N6NA 1X8KA 3LCRA 1QK4A 5IG2A 4WFQA 5JWHA 4J07A 2C96A 4R2XA 1E9AA 5ALKA 4ITUA 4J2OA 4ALIA 2VYVD 1RLUA 3GI1A 3OY7A 2F55A 4KLAA 2NMVA 1RU3A 2YHIB 2YIDA 4GT1A 4D8YA 1YJXA 1C7RA 5GV7A 3WL5A 4JBWA 2V45A 2J5KA 2VJYA 1HZJA 1ZIOA 3QX8A 4KYIB 1JU3A 1J0DA 4Z9YA 4DJDC 2D62A 4UHHA 3KS9A 5GJCA 4FHGA 1E9SA 3R20A 2Q49A 2JFFA 3LF2A 5BN3A 2A9PA 4GXNA 5H02A 4BB5A 3T7AA 1OXTA 1QV7A 4MR9A 3L1VA 5LWQA 4QQKA 1JDBC 3BRCA 4WBNB 5HZMA 3LDHA 1BX1A 2C1XA 3NV9A 5FEUA 2A5LA 4K7JA 3RODA 3E4DA 4H17A 4E5VA 1HWYA 2E87A 3AETB 2BKLA 5EJMA 4LFAB 2BEKA 3RC7A 2HR1A 2NO4A 3RVJA 1YR3A 5HG0A 2F3RA 3R40A 1Z68A 4KXUA 2WE7A 3U3XA 2X77A 3E15A 1SH7A 4LCBA 2Q5FA 2XRFA 3L18A 4LX0A 2GXUA 2VKQA 2XF2A 1LBSA 3AY3A 4ANFA 2GJKA 1Y9JA 1IUPA 1KQOA 2ZYTX 3A2LA 2XV1A 4ZCSA 4LVCA 2JJ1D 3ZE2B 2I67A 3P32A 2AJLI 3I62A 3E70C 1R18A 4QDKA 2XY4A 2O1XA 1FU7A 1ZOSA 2BONA 2P6NA 3RDPA 3LL7A 2FEPA 3H13A 2UVDA 2TMGA 3QU4A 4TV8B 1XDBA 1FVHA 1KPHA 3CLTC 4M54A 4W6QA 3X3HA 3H86A 4ASUA 1JFRA 1VMIA 1YQXA 4URYR 1HTWA 3PB3A 4B7XA 2VHCA 2NV6A 4DNOA 1E7SA 3Q8XB 3Q85A 1FLAA 4F3TA 1OUMA 2IEYA 5COBA 1XL0A 4F8JA 5HM6A 1GG9A 3NNDA 4LHVA 2QUIA 4GMDA 4CMHA 2OXCA 1SXJE 3UG6A 4O63O 4BNWA 3DDSA 4JOQA 2WB2A 2R11A 4PC6A 1E2JA 3VR1A 1XRMA 1CK4A 4ABYA 2HW8A 4FEGA 1XZCA 1QHIA 1ARZA 3IV9A 5PNTA 1VOTA 4LOAA 2R65A 3BIXA 3NM6B 2ANCA 1SQSA 4OU5A 1NPTO 2RHTA 4V0LA 2O8VA 2C4NA 2WZCA 3FN4A 3OF2A 4IRXA 3MGKA 4MQEA 1JDUA 4YCJA 1NW8A 5K0FA 1FRNA 2CLEB 1NBMD 1ZWKA 2DC1A 3ZTYA 1N32B 2E5FA 4D3SA 5CB6A 1E9DA 4NIMA 3IPCA 5CMLA 4PN3A 1OY1A 1Z26A 4PYQA 2OORA 4AS1A 3GOQA 2H4WA 1OJ7A 3MTAA 1ZESA 4M1KA 4Q9DA 5ALPA 2VZ8A 3DH0A 3TRJA 4AMBA 4F6RA 2RHMA 1E3WB 1I9GA 1NMSA 3UAOA 4EYGA 1TW2A 2AV6A 3I8XA 1XQVA 3BH6A 3OBIA 4I55B 1IBRA 2QXYA 1P5RA 3EW7A 4KQ2A 1PNTA 4HTFA 3GIDA 3M5DA 1AXRA 4UM5A 5IBRA 1EIZA 2ZBPA 2BHNA 4C7OA 2VNAA 3VH1A 3ND6A 1LBTA 2VH5R 4S1NA 4RJKA 2VT3A 1C4OA 2NU8B 2WF8A 2CV0A 3RIYA 3AEQA 1H1TA 4LPSA 2H92A 3EC1A 1R4MA 4JYBA 2ORED 2F00A 3UWMA 1E64A 1YK1A 3VKUA 3PUZA 1LPOA 1QE3A 3A4NA 2B0CA 2MYTA 3KYIB 3AMVA 3NT5A 4MS4B 1UQTA 2SICE 4AX4A 3P52A 1G9SA 2WRZA 3JALB 3P45A 4Q3NA