4AJ4A

Rat ldha in complex with 4-((2-allylsulfanyl-1,3-benzothizol-6-yl) amino)-4-oxo-butanoic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
330
structure length
330
Chain Sequence
b'ALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
molecule tags Oxidoreductase/inhibitor
source organism Rattus norvegicus
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
total genus 113
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4aj4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4aj4A02
1M6WA 1MA0A 4CV0A 3GQVA 2ET6A 1B8PA 4A2CA 1I01A 4O6VA 1HDOA 4YB8A 3VTFA 3KUXA 2X58A 3DZIA 5IZCC 1PZHA 4ROSA 3I4CA 4CPDA 3ANMA 3QVXA 4U5QA 2PH3A 4CM5A 3I52A 1B3RA 3CZRA 1TI7A 5L4NA 1I2ZA 2C5EA 1VC2A 4FFNA 3WTBA 4B3HA 2BELA 4WLVA 1DSSG 2WE8A 5L7TA 1GR0A 1T1SA 4CQMB 3JYOA 2WTBA 3CINA 3O03A 4O59O 3PHLA 4RF2A 5JAZA 1H5QA 1ZZEA 1HE4A 1X1EA 1PL8A 5T8KC 3DB2A 5EESA 1K2WA 1UUFA 2G82A 3HN7A 4NBUA 3UFXA 5BSHA 4DYDA 1X7DA 3GG9A 1Q0HA 3NAQA 5HS4A 2FPIA 3I9MA 2J3HA 2X0RA 3Q2IA 1OC2A 4ZQGA 3JCZA 4BNUA 1HE3A 3SLGA 4Y98A 4PRLA 4NK5A 4RQTA 3RWBA 1N2SA 4MP3A 1BVUA 2BRUA 2YZ7A 5TT0A 4CQLA 1ARZA 1ULUA 1I2CA 1WMBA 3JQAD 5ILGA 4B4WA 3GGGA 1GQYA 5FFFA 1WMAA 2NACA 4AJKA 1HETA 1Y7TA 2QYSA 3OHSX 2GO1A 2Z1NA 4LISA 1I24A 2VHWA 2P5UA 3PIDA 3PHJA 4WLEA 4GLOA 4EUHA 4IQGA 2E82A 3E48A 4U6QA 2PLAA 2DUWA 3G0OA 4YEDA 4URFA 1HSZA 2W2LD 2WJPA 4PLVA 2TMDA 4PZCA 3JYPA 4UEOA 4U0JA 3GGPA 1ZMOA 3MOIA 4FSHA 2BMAA 3TWOA 4NBVA 2ZYAA 1VJ0A 4Q9NA 4G5HA 1HRDA 2BLLA 4O5OA 4KP7A 3DHNA 5L9AA 4PRKA 4IIUA 4DXHA 4GWKA 3MJSA 1H9BA 4TKMA 4Y9DA 2H1SA 4RZHA 1ISIA 2GDZA 4HFMA 3W4KA 4XGNA 3BMCA 1EFKA 1ZXLA 2PNFA 4EGFA 1QV6A 3WICA 3EW7A 4QTZA 3FNGA 1P1JA 4OO3A 4BKPA 5TF4A 2EEZA 3PXXA 5CP8A 3TF5A 1E7YA 2AG5A 1OC4A 2EKQA 1EE9A 5F21A 4BV8A 2FPPA 1CDOA 4NFYA 4P8RA 3PGXA 4EI2A 1Z73A 2OO5A 3HG7A 2YV1A 5A06A 4TRMA 2HJSA 3DOCA 4U8GA 3W4IA 2Q49A 3UXYA 4ZN6A 4YAGA 2V6GA 1T24A 3DZJA 2HQ1A 3I9JA 4L73A 2FSSA 1ISGA 2JJYA 1AUPA 4IZHA 2Q2WA 1R0KA 2ZJ1A 3X2FA 4IS2A 5GZ1A 4BO9A 2CVQA 4C7JA 3E6AA 3ZU5A 3FWNA 3VZSA 4D3DA 3GC6A 2A4KA 4E2WA 2F00A 4XIYA 1C1DA 2ZKLA 1RKXA 4NDNE 4UVIA 3SXPA 1DRUA 1LTHR 2W8ZA 3TZHA 4FB5A 3Q11A 4Q39A 3TPCA 3LYLA 4HBGA 3RAJA 3TZ6A 3K6JA 4KTVE 4ALNA 4E0BA 4FGWA 4YA6A 1EVIA 4A73A 4A7PA 4RORA 5JYDA 2GN6A 1K5HA 2YY7A 3DBLB 4PG5A 5BSGA 4I5DA 1KETA 1LLUA 4DA9A 1MFZA 2B37A 3DBHA 4DC1A 1HEUA 3GHHA 2DPGA 2EKLA 4LRSB 1K6JA 2FP4A 5LCXA 4Q3CA 2PR2A 3N58A 4E5NA 5A4DA 4I08A 1IZ0A 1CERA 1P45A 2XAAA 3B20A 1WXDA 1JAXA 5JXWA 3HN2A 4CLXA 4RDIA 2JCXA 5C5IA 3RFVA 1E6WA 3WOHA 2AHRA 5T67A 4BNKA 1LSOA 4AJPA 4J16A 1R4NA 2H63A 3E8XA 2VTDA 4CUKA 1ZXBA 2PKQP 5KVCA 3F1KA 1BSVA 1J5PA 2QZZA 3RQSA 3ZZNA 4E32A 4QQRA 4UVEA 4BO5A 2JFFA 4UVHA 1AGNA 3H65A 1VI2A 4HX5A 3NX4A 1U7HA 5CPBA 1DDOA 1SPXA 4KUGA 4XA8A 5IFLA 5JDIC 3KV3O 2VYVD 2X1HA 2C07A 4QXMA 1VRWA 3PGJA 3AUAA 1GQ2A 4D46A 5L4LA 2VUSA 2QZ9A 4WCFB 2O4CA 4MVJH 4XWYA 3RC7A 3H7AA 5KIAA 3MTJA 5EJ2A 3LDHA 4CJXA 1DC5A 4EZBA 4FGSA 5ICMA 2A94A 4UUMA 4FIZA 3AUUA 5AYVA 2VCYA 1O5IA 3ZI0A 4M8SA 4HP8A 4YR9A 3AI3A 4MVJM 2C5AA 3WJ7A 1P9LA 4NFSA 5DBFA 1IY8A 3H2SA 1ZEJA 4D42A 3BMNB 4OAQA 3W8FA 1Y9EA 1XLTA 2BI8A 3TNLA 1UXIA 5CDTA 5TJHA 1XELA 3LLVA 4J90A 2QW8A 4BOYA 2GZ2A 3GPIA 4AJIA 3ROKA 4HWKA 1AE1A 1RPNA 4EYEA 3QA9A 2ZQZA 2WEKA 5AXAA 4TZKA 1LBEA 4E5YA 3ZGYA 4J7XA 5JBIA 3FD8A 1XSEA 3GH3A 1VM6A 1JA9A 5EL0A 4GVLA 4BNNA 1PGOA 1ZVMA 5HTOA 1JVBA 1SAYA 2YW9A 4F45A 1T1RA 1HDYA 4CUJA 5TJ9A 1IZ9A 1GQQA 3AY6A 3GDFA 3K73O 1WAMA 4AG3A 5I8WA 1Y1PA 3D4NA 3WDSA 5BSFA 3P5SA 4FFRA 4PN3A 5T5QA 3CUKA 4WLOA 2E48A 4QO7A 4RF5A 3PI7A 1U4OA 4OXYA 4B79A 2OP0A 2D3TA 3WB9A 1FDUA 3ZWCA 1FF9A 3AOEA 4BMVA 1PGJA 4XJSA 1CF2O 1O94A 1UZLA 2EXXA 1R0LA 1SC6A 1N5DA 4RJTA 2W2KA 3TZCA 3UUWA 4WK6A 1YKFA 5CPFA 4D7AA 5T8KA 2H5LA 2NQTA 3NGLA 1KEPA 2DC1A 4NBTA 4WJZA 4PGFA 1ZO8A 1WNTA 3LT4A 3VHRA 3ZHYA 4S1VA 3LU1A 4D0SA 4FS3A 5JE8A 3ZWMA 3FWZA 2JD0A 1JW9B 2O7QA 4QUKA 3WGOA 2BF7A 3SJUA 1DFHA 1ENOA 3N7UA 1ENPA 4II2A 2DTEA 3VPHA 4LN1A 3AFNA 1H0KA 1FDTA 1ZK3A 1E7MA 4BMSA 3JV7A 1CRWG 5JC8A 3U5TA 4FN4A 2W2LA 1XHLA 3VTZA 1G0NA 3I9NA 1EMDA 1JVSA 2IZZA 3JQCA 4CM9D 4IS3A 2IEDA 2NV6A 2VOJA 3WYEA 3JQGB 5F1OA 1YGYA 3AW9A 2HRBA 4DUPA 1ONNA 4I5FA 1GZ6A 4YXFA 1MB4A 2X6TA 2JFHA 3QWFA 4YRDA 1YH3A 4J0FA 2O3SA 1D4FA 2OUIA 2AQHA 3H2ZA 1ZUD1 1LRLA 3I3OA 4H3VA 2FPGA 1EBFA 2C59A 2Q45A 5CEEA 3PQDA 4J6FA 4CMEC 4YAIA 4ZQFA 3VPGA 4M49A 5DULA 4BNGA 2AQ8A 2DU8A 4XKJA 1YB4A 4H15A 4GPD1 2VHVA 2BD0A 3LT0A 4BKUA 3AM3A 3GY0A 1GCOA 1LDGA 5C37A 2QQ5A 2X9GA 1E7QA 1RYEA 3H5AA 2CZCA 3FTNA 2FWMX 1N9GB 2NUAA 3NTRA 1U3WA 4RF4A 5G4KB 4M1QA 2ZYGA 1Y9AA 4Q3BA 3B1JA 2HMSA 1DO8A 1KVUA 1WWKA 2YYYA 2HUNA 3HFGA 1Q1NA 4ZGWA 1U28A 2BKAA 1E0DA 4DRYA 4D41A 3AUTA 1L7DA 4OL9A 5GMOA 2NVWA 4KOAA 4B7XA 4QEDA 1G0OA 4Z0TA 3QQPA 4YCAA 4HY3A 2X4GA 2OL4A 1D3AA 4MPDA 4GX0A 3BMQB 3GEMA 4AJ2A 3H9JA 1Y5MA 4D3FA 3IQDB 5I7VA 1GUYA 2DT5A 3ANNA 3FNHA 1GEGA 3IS3A 4D0RA 1SEVA 4IJUA 3SEFA 3WQRA 4HNHA 1XKQA 4TVBA 3E03A 3FI9A 1PEDA 5A3VA 3UN1A 1HYGA 2WD7B 4OQZA 3RU7A 4NH4A 4IXWA 2IE0A 3TL3A 1A9ZA 2X22A 1N9GA 5G4KA 1BXZA 2JCVA 2GYYA 3OA2A 1IB6A 3GEDA 4KQXA 3IP3A 2AE1A 1EVZA 2PKRA 2PFGA 1QP8A 1IPEA 2Q4BA 3LVFO 1Z75A 1ADBA 2ZJ0A 3DL2A 4R16A 4BGUA 4DREA 3PHHA 3PTZA 1SO8A 2W4QA 4Z6KA 2PY6A 3INGA 3FF4A 4WCDA 2GN4A 1U5AA 1R6DA 4NJMA 1K6IA 4AJLA 5DNAA 5EINA 2VWPA 3K2BA 2VTEA 5K9ZA 4PFJA 3ZWWA 2Q1TA 3OEWA 3ZU2A 3DBRA 3RKUA 1YQDA 1PJSA 3UAGA 5I8ZA 1T2FA 3D1LA 4DQXA 1M6HA 3JQBA 3IDSA 4IQ8A 3DZBA 4DPMA 1PGNA 4XGIA 2SCUA 1EDZA 4CMAA 3VZPA 1LC0A 3IL2A 3KRTA 1LXCA 4FJ1A 2VWGA 3KVOA 4LMRA 4J43A 9LDBA 4BO3A 4R01A 4R69A 3R3SA 3GOHA 4DQVA 4BKOA 8ADHA 4IUYA 4OIMA 1U3UA 2NTJA 1X0XA 2JAPA 3VKVA 3LK7A 2PGDA 2FZEA 4L8VA 1LDMA 4L75A 4Z9XA 4WEOA 4WCFA 3S2IA 3RUAA 4BVAA 2GR9A 5TRTA 4CM8A 1BXGA 1H9AA 4R3NA 1I3LA 5LDGA 4W9NC 4ZVVA 1PQWA 3WQSB 3DMTC 3EHEA 1OMOA 3IOYA 4JP3A 4TZTA 2O4UX 3GN1A 5C3MA 3AUSA 1EK6A 2JD2A 1AN9A 4IM7A 4AFNA 1QSGA 1N7HA 2C2YA 3KEOA 5TNXA 4BO7A 2PH5A 1MX3A 5KJEA 1K89A 1MFPA 6LDHA 1YVEI 2AW5A 4J0EA 4L4SA 4AL4A 2VHYA 1UP6A 1HDGO 4ITUA 1IPFA 1I3MA 3RSHA 2CF6A 1BVRA 2RIRA 3OQ1A 4XYGA 5KJ1A 2Q50A 1FDWA 4CMEA 1O95A 2FHSA 2Y1OA 2AEMA 3HJAA 4E5KA 1MG5A 3ZW8A 3ZWAA 3HDQA 1M76A 4QT0A 2JCYA 4CR6A 5F1PA 1AHHA 1U2GA 3KM0A 5CEFA 3ZHBA 2FZWA 1IOLA 1E3EA 4UVDA 4CV1A 1PJCA 2Q1SA 1JU9A 4N5LA 3IKTA 1GFSA 3LC1O 1DIAA 3GVHA 4RVDA 3ZV5A 1CWUA 4AJJA 1LDBA 4IPTA 4TRRA 9LDTA 2X0JA 3Q3CA 3STHA 4CMCA 3UF0A 3CKYA 1JN0A 4BQPA 1VL6A 3FPCA 3WBFA 3E82A 4JNKA 2I6TA 3WIDA 5A03A 5JNLA 3OA0A 4I9NA 4D43A 5J23A 4B4VA 1KY4A 4FJ2A 1ZK4A 2CMDA 4NBRA 1ZIDA 3P2OA 1LRJA 1B15A 4W6ZA 3ICCA 4PLFA 2Q2VA 3KYDA 1ZBQA 4RLHA 3SC6A 4RPKA 5CEJA 2BGLA 4KDEA 1SMKA 4O0LA 1JKFA 5ENDA 3BHIA 3JQ9A 2HKIA 5KVQA 4YYZA 4MOWA 1IHXA 4XYMA 1IULA 2YUTA 2CVOA 4NZ9A 1N7GA 5COQA 4QSMA 5BNIA 3TN7A 4EEZA 3H9EO 4E21A 4BIIA 1K0UA 2IXBA 1T2DA 1M2WA 1E92A 1ZSNA 1J0XO 1NHWA 3GVPA 3QWIA 4OSOA 3ETDA 4FQ8A 3V1YA 1K6XA 4J1NA 2WD8A 4NU5A 5AXCA 3PJDA 1H6DA 2VNSA 3BMCB 5DCWA 5JC1A 2VWQA 3C85A 5CDGA 2P4QA 1P1KA 2DBZA 3H6KA 3RFXA 1DC3A 3GHYA 1GDHA 2WM3A 4FJ0A 4CM9A 4YT5A 2ZCUA 3PP8A 5LC1A 4GQAA 4GAEA 1HLPA 1LLQA 4GX5A 2GF2A 3VC7A 3FBTA 5AXBA 3FPLA 3BMNA 3OBBA 1C0PA 2YQ5A 3OSUA 3QVOA 3R6DA 1DLJA 4ESOA 1TT5A 4BNZA 2F1KA 3BTUA 3L4BC 4GX1A 3R0IA 2HMUA 1NTOA 4Z3DA 3KB6A 4ZQBA 1AHIA 1PWZA 4CMIA 5ENVA 1GD1O 3NEPX 5ITVA 5TSDA 3QE3A 4BNJA 2GZ1A 2OGUA 1DJNA 3ZHXA 4K28A 1PJTA 3F6YA 4QFCA 1KS9A 3ZV4A 4MVJA 4PLCA 1B8UA 2FSVA 4J1SA 3QLJA 2Y66A 4C4OA 5L7WA 2X9NA 4NJMB 3RC9A 2O3JA 4CM3A 4UUOA 4A10A 1PS9A 2DPHA 1JKJA 1XQ6A 1Z6ZA 3SBOA 4IDBA 2V6BA 5JFOA 1LDEA 3RI3A 5MDHA 3D3EA 4LK3A 5BR7A 4YWJA 1F0YA 4O63O 3JD1A 2Q2QA 3BHJA 4LRTB 1E6EA 4MVJD 1KERA 1YJQA 2EW8A 2X8LA 3LZ6A 4MVJG 3VZRA 4FCCA 1YBMA 3W8DA 3NT2A 1JWAB 2AE2A 5TT1A 1HSOA 3DMTA 2CUKA 3I9OA 2ZCVA 3U4IA 1U8FO 2DTXA 3I4FA 4WCFC 3FSRA 3W6UA 2EERA 2R00C 2Q4EA 3DZKA 2RH8A 4LSWA 4CODB 3TJRA 3F9IA 5G0UA 2O3RA 1YOVB 3KTDA 2LDXA 1MGOA 5JDCC 1HLDA 3ITKA 4BGIA 4R5MA 4A5OA 3GAFA 1DRVA 5JSFA 3ZNPA 1Y5RA 2HAEA 4RZIA 1DB3A 1GTMA 4UULA 5LDHA 5B4VA 3UGKA 1NBOA 2QRJA 4RVGA 4XYLA 3C1AA 4BO2A 3E9MA 3JQBC 3D4PA 5K6AC 2GD1O 1NHGA 5JO9A 3EVTA 4GBJA 1U5CA 3DZFA 3C7AA 4B4OA 3Q9NA 3H9UA 1DIRA 4D44A 3F4LA 4BUCA 1KVRA 1D1TA 1A5ZA 1VKNA 4HKTA 1M66A 3JSAA 1JDJA 3L77A 4BNIA 4BKRA 3UCEA 2ZB4A 1A7AA 4D45A 1D8AA 3GMDA 3L0DA 5T64A 2X5JO 3Q9UA 1BW9B 4JIGA 4XDZA 3RFTA 4E30A 2VNAA 4YBZA 1XYGA 3KLPX 4INAA 1WW8A 1ZJZA 4R1NA 5TGDA 2WSBA 1P31A 1NVGA 2YHIB 3VH1A 5ITWA 4IGFA 2WE7A 5G0WA 2NU9A 1QR6A 2JD1A 3ZU3A 2DFVA 3M2TA 3ZHZA 5DBIA 3LSYA 4N5MA 4XYEA 1LUAA 2J8ZA 5KTKA 4NR0A 1R37A 3HADA 2CFCA 4XB2A 4DWVA 3LQFA 3BXXA 4R51A 1VLLA 1Z82A 1KIFA 4IZIA 4XIJA 2GRAA 1NR1A 3JD2A 1EUCA 3JQ8A 3NRCA 2JL1A 2JKVA 5G2OA 4KTTE 4BV9A 1XCBA 2AG8A 1K3TA 2DQ4A 5U1PA 5L51A 4KUEA 1DEHA 2GPTA 4MIEA 4OKIA 4WASA 1MG0A 2Y0EA 3LF1A 1NASA 3NKLA 3RVDA 3ZWYA 4CUZA 4I9UA 1T2CA 5DCYA 1DBVO 5B4TA 1RJWA 1KVTA 4BNTA 1PU2A 2W90A 3I9LA 3JQ7A 3CPSA 1KY5A 3KOUA 4NHEA 3OJFA 4R4JA 5GY7A 3OQBA 1JAYA 4XJTA 1N8KA 3D0OA 3JYNA 3PFFA 3NGXA 4J91A 1YRLA 1YQXA 1TLTA 5ICSA 1X7HA 1TEHA 1I3NA 2RCYA 3FBGA 5IDYA 3GAZA 3ONDA 3PFWO 5DOZA 5I7EA 1NYTA 4U0KA 1A4IA 4EJ6A 4PVCA 1NM5A 4W9NA 1KBZA 1TA4A 1GV1A 2V6FA 2WD7A 4XQEA 3ULKA 3HDYA 1NQ5A 3RUIA 3QWHA 5G4LA 1NFQA 3MJTA 4GGPA 3KYBA 5DDIP 3JQEA 4TRNA 4XCVA 2CNBA 4E12A 1ID1A 4M55A 1XGKA 4E5PA 4WNIA 1C14A 5TLSA 1N92A 2QIOA 2O2YA 2B4QA 2O2SA 5THKA 3V2GA 3ZWBA 5DBGA 1WDLA 5JY1A 4JJFA 3GEGA 2OZPA 3AOGA 2G17A 3GZ4A 3HSKA 3PYLA 1SB8A 3VPFA 3TOZA 3IIEA 3OMLA 1H6BA 4J9UE 3EUWA 4JBIA 4NI5A 5KKCA 3ZWOA 4CM1A 2C0CA 5F1KA 2EG9A 3GNTA 3WSWA 4MKZA 4DMMA 1EQ2A 3HQ4O 2D8AA 3RJ9A 2ILTA 3ITDA 2HK7A 2FRDA 1GEEA 1XG5A 2OP1A 3U4DA 3A28A 2Y93A 2GASA 1SZJG 1E7RA 4ND5A 4OGWA 1B3BA 4H7PA 2OBNA 3QVTA 3GUCA 4K1LA 2DKNA 4EJMA 4HNGA 2C82A 4R68A 3RUFA 1Y8RA 5T57A 3A14A 1LDNA 3JD0A 2WYWA 2JHGA 3PDJA 3O9ZA 4E3ZA 2GN8A 2HCTA 2ZTMA 4EITA 2AMFA 3D4OA 3WFJA 3HUDA 3ON5A 1ONPA 2AA3A 5TQVA 3RC2A 3OP4A 1C0IA 1IE3A 4YJFB 3VPXA 4WLFA 2EJWA 3OIFA 3O38A 2ZB7A 3U09A 2Y0CA 2H9IA 3KSUA 3DBLA 1R16A 4ZA2A 1O89A 3OIGA 2NQ8A 2HSDA 2B83A 1EQUA 3O26A 3TFQA 2W98A 2VUUA 4MINA 4ZQEA 2VOEA 3OF2A 3T4EA 1H2HA 1UP4A 4KZPA 4PIVA 3PPIA 1DOHA 4JROA 4PZEA 1UDBA 5HBRA 4GH5A 3QY9A 4EUFA 3JQFA 4RO0A 4W82A 3RUDA 2UVDA 1O9BA 3DFUA 3L07A 4G65A 4EBFA 3GDOA 1LQTA 1SOWA 4M54A 3WNVA 2IDZA 4N54A 3W4JA 1WLYA 3G1UA 2RHCA 2VWHA 1LU9A 1QYVA 1RM4A 1IHYA 3G17A 4K26A 3KSZO 3VOSA 1YB5A 4B3JA 3D7LA 4BNWA 3ROMA 3PLRA 5DZSA 3GUYA 3GVCA 3KO8A 3WGZA 3OM9A 3IUSA 4RPJA 2B4RO 4B8ZA 3BIOA 2XXBA 4HFNA 3JQDA 2PGJA 1S6YA 5FI5A 1NVMB 3G3EA 3ONFA 4Q3DA 1Z74A 4ALMA 2X7HA 3S55A 2PZKA 1ADFA 1E5QA 5KCZA 1SBYA 4OXNA 3BMOA 4WEQA 1UXGA 4Z3KA 2BH9A 3JD4A 4MKRA 5I9NA 1I2BA 1OAAA 3C7DB 4CMJA 3TL2A 1XWFA 2YV2A 1E3SA 4WLNA 3TZQA 2E49A 3VDQA 1V3VA 3ZNOA 3QJ5A 4YRAA 4TMFA 3L6DA 3OJEA 1B14A 5CFZA 1LRKA 5JW6A 2E4AA 4IDCA 3ROPA 4DVJA 3JTMA 3L4BA 5ER6A 1EK5A 4KUHA 3DC2A 3QVWA 3ROQA 1E1KA 3V8BA 3CH6A 3H3FA 1QG6A 4JP2A 3RJ5A 1YDEA 4NJOA 5B37A 1KVQA 2CVZA 2Y68A 4J3FA 3WNQA 4RGBA 2Y1DA 2IODA 1UDCA 3GN2A 5ILOA 3A1NA 3E1KA 3BTOA 2B4TO 1T2AA 2Q1WA 4JGBA 3RUHA 4CM4A 4QECA 1FXSA 4DLBA 1XU9A 1ORRA 2G1UA 4HFJA 3ZNNA 2VT2A 1MXFA 4IINA 3RUCA 3WMXA 4FFPA 1YB1A 3OECA 1KOLA 4CLHA 4NPCA 1P1IA 3AOEC 3QV1A 4CMHA 3WR5A 3WIEA 1MUUA 2VZ0A 1GAEO 1ML3A 4GX2A 2OBYA 4NNJA 3VAZA 1KYQA 4KDFA 5DOVA 2GNAA 4MVJP 4RVSA 4DIFA 2PWZA 1QMGA 1YXMA 1GV0A 3OH8A 1PX0A 3C7CB 3IUPA 5KJFA 3FRJA 3BHMA 2UV8A 4PG7A 5IXYA 1RYDA 5AXDA 5JCXA 2X9VA 3UCXA 1N1GA 3M2PA 1C1XA 2VHXA 4FFOA 5K6AA 1B16A 1PJ4A 3DBHB 4JN6B 1ISFA 4L4RA 3C8MA 3F5QA 3PIIA 1JLLA 5KVSA 1PTJA 1SOVA 2VRBA 3Q2KA 5BNFA 3WTCA 2WDZA 1T2EA 1FJHA 4GGOA 2EKPA 4FPXA 1H2BA 4IIVA 1EUDA 1FK8A 4N7RA 4M89A 2AXQA 1H6AA 1VE9A 2EGHA 3PZRA 1B2LA 3DAPA 3WQQA 1HXHA 3DZGA 3LT1A 4DBZA 5A04A 1BMDA 2V65A 2OOSA 3QHAA 4FC7A 4WE3A 5AQ1A 4ZRNA 1CQJA 3DAFA 1R15A 3A9WA 1ZKMA 3GF4A 4R5HA 4Y6SA 2GGSA 5CG1A 3GZNB 4RVUA 1XDWA 1PZFA 3INTA 2PKQO 1DLIA 1U8XX 3UOGA 1BWSA 3GNQA 3WWYA 2XPCA 3AU9A 2FN7A 4BNLA 4ALLA 5GZ3A 3PQFA 3W6ZA 2IEBA 5CG2A 4J1QA 5IN5A 5JDIA 6ADHA 2CD9A 2GN9A 1WZIA 4MP6A 4CL3A 1R4MB 2OFPA 3ASVA 4NFHA 3I23A 1W6UA 1FMCA 4DLAA 2Y0DA 4XGKA 3WJAA 5C7IO 2HK8A 2I9PA 1Q0LA 3AJRA 2YHUA 1PZGA 1RM3A 2D0IA 4CR7A 1Y8QB 1YE3A 3FR8A 3MJCA 3IC5A 2B36A 4PG6A 4BNMA 4RVFA 3BAZA 3MWEB 3L6EA 1QRRA 3ETEA 5KKAA 2B69A 4WUVA 3KYDB 5EMHA 4OH1A 1RM5A 2D5AA 1X7GA 2BGMA 2HLPA 4GSLA 4HXYA 1FDSA 3WYCA 2FMUA 5EQFA 3S2GA 3VZQA 2DBQA 3AI1A 3PJFA 1L1FA 4Y67A 5A3JA 4CMIB 2V6MA 1NWHA 2NVUB 3WGHA 5CDUA 1LSSA 4AICA 4BO8A 4OKNA 2E6UX 2O7SA 5JO0A 4K6CA 2I66A 3HB5X 1WDKA 4DLLA 1ISHA 3GK3A 2P9EA 4YQYA 3NTQA 4PLHA 1XR3A 4MKXA 3K96A 3MZ0A 2EV9A 1Z45A 5IZCA 3NJ4A 3U4CA 1E7SA 2A9FA 3V2HA 5JYEA 1ZW1A 2PK3A 3V2UA 4FW8A 2VYNA 1MC5A 3AI2A 3B70A 3ENKA 2X0IA 3WGGA 1BDBA 4AJHA 1PSDA 2Y1EA 1I5RA 4Y8VA 2NTVA 3U0BA 5COAA 1AXGA 3D5TA 4R54A 1DC6A 2EIHA 3L9XA 3V1TC 2AEFA 1Q2XA 2VRCD 5JAQA 3S1LA 3TQHA 4J1TA 3SJ7A 4RVHA 3PJGA 4AJEA 3T7CA 4U7WA 3ZWNA 5BNTA 2HMWA 5L7YA 2X5KO 4F6CA 2A35A 4R9RA 4LGVA 4IDGA 2IYPA 3I6IA 2P9CA 2NADA 5JS6A 1EZ4A 1HTBA 3AWDA 7MDHA 3ASUA 4TRJA 2GSDA 3PHIA 2X23A 4E5MA 3KSDO 1NPTO 1PR3A 3IMFA 2VRCA 2BFMA 3NT5A 3O8QB 4R3WA 3F46A 5A1TA 2C7GA 3DHEA 1D7OA 4JX8A 4CMKA 1O8CA 5G0SA 2VQ3A 3CMCO 2PZJA 2AQKA 3TSCA 4MIOA 4CQMA 1E3WA 4GSKA 1DHRA 1ZMTA 1P1RA 1TVEA 2CDCA 3SC4A 4B3IA 4CM4B 4YAKA 1XU7A 2QRKA 3R3JA 4ILKA 3KHUA 1GYRA 5G0VA 1WDMA 1XQ1A 3BZUA 4Z0PA 1YS4A 3DOJA 2HK9A 1V3UA 5I7SA 3WFIA 2I76A 4XQ9A 4W7HA 4W7IA 3WWZA 3ZV3A 3PDUA 2O50A 1KC1A 1ZK2A 2IXAA 4YDRA 3IJRA 4XYBA 3O4RA 3V5NA 2FOIA 5A5EA 1NP3A 1X0VA 2C54A 1UZMA 5IDXA 1I32A 1E7WA 4CQMD 3ZCXA 1U3VA 5IXSA 1PJ3A 1HDRA 3Q6IA 1NPDA 3EZLA 1IUKA 5A05A 4AJ1A 4CMBA 3HDHA 5I9LA 3WGTA 1X14A 1LLCA 4E13A 2DBVO 3V1UA 1J6UA 4R41A 1V3TA 3BMOB 3UVEA 3M1LA 5EIOA 4FR5A 5JAMA 4PLYA 4GMGA 2A92A 5CDYA 3HFSA 3U3XA 4XR4A 2GERA 1PJLA 1UR5A 4FFMA 3P2YA 5TX7A 2ZB3A 4TROA 4KMSA 3JQAA 2UDPA 4CLOA 3MJVA 4MP8A 2G0TA 3DZHA 3DHYA 1DC4A 2G76A 4LCEA 4PLGA 3TRIA 1HE5A 4NMHA 3OJLA 3AU8A 1CETA 3LC2O 1BXKA 4ONEA 4DPKA 3IAHA 2E37A 1QYWA 2EGGA 1E3LA 3C1OA 4M86A 4IBOA 3C3XA 3H5RA 4MDHA 4B7CA 3E5MA 4I5GA 1PR9A 1A71A 3VH4A 1A27A 5CDSA 1IYZA 1S7CA 3JQ8B 4R1SA 3T4XA 3L6OO 3BMQA 4DC0A 3CEAA 2CDAA 1DAOA 3OETA 3N74A 2YQ4A 2EJVA 3L9WA 3NUGA 4ZU3A 1P44A 4WKGA 5KJCA 2TMGA 1Q7BA 1EEHA 2O3TA 3QSGA 3MEQA 1WP4A 4XDYA 5H82A 4BO1A 2R00A 2ZK7A 4WLUA 3QRWA 3I6QA 3VKUA 3TFOA 3LT2A 5BQFA 1GCUA 1VPDA 3E9QA 5KOIA 3GVXA 4E2YA 4J49A 4WOJA 3ZWVA 3ZH2A 2P2SA 4JJIA 2HRZA 2YHIA 1AXEA 2YDYA 3SVTA 4M87A 1X13A 3A4VA 5DF1A 4ZQHA 3T7EA 5DP1A 2PD4A 2ZTUA 3TZKA 4IMPA 1UAGA 2BFOA 3LLSA 4JXKA 4XZ3A 1F14A 1YBAA 3B1FA 4BQRA 3H5NA 1C0KA 1DXYA 5L45A 5L3ZA 1Y8RB 3RASA 1R4NB 1HDCA 4X54A 1CEQA 4ZRMA 2C29D 4ALKA 4E33A 2G5CA 3JQ6A 2I99A 3W8EA 4CLDA 4MO2A 3G49A 1QKIA 3ZWPA 4XR9A 3F47A 3E9NA 1PJ2A 2NNLD 4JCOA 5F3RA 1D1SA 1YBVA 4I1IA 1Y6JA 4Z9YA 1ZEMA 4BGEA 3PYMA 2JHFA 4LCJA 1B0AA 2HDHA 1A4UA 4A27A 3DBVO 2O3UA 1EFLA 1LC3A 4YPOA 3K5PA 3EK2A 1ENYA 2OORA 3B6ZA 2ZQYA 2D5CA 3HE3A 3MJEA 1HYEA 1PJBA 3GRKA 3ONEA 4DBVO 1YO6A 5B12A 3WG9A 5L95A 3WGIA 5IJZA 1VL0A 3VH2A 4RPHA 1ENZA 1DHTA 4E2ZA 4IJKA 3H3JA 3OJOA 3ABIA 4LVUA 1WPQA 1V0JA 3W1VA 4RL6A 1ZFNA 3ANLA 1KVSA 4YJDA 3GA0A 4ND1A 1DJQA 4J4BA 3MTGA 1NQOA 1QXSA 4NG5A 4L9RA 1Y8QA 5L53A 4A03A 5JCJD 1XA0A 1GY8A 1ZK0A 5CHEA 3GFBA 3B1KA 1I8TA 2J6IA 1R4MA 2O23A 3KYCB 1E1LA 1ZSYA 3AK4A 4YQZA 1P77A 3K8ZA 4MVJF 4LMPA 1UP7A 1LEHA 4CV2A 1LDYA 1C0LA 4O1MA 3QP9A 3G1TA 1YL5A 3ORFA 3I1JA 1YL6A 1O6ZA 4JQCA 1GADO 2Z5LA 4FOOA 1PIWA 1X1TA 3DO5A 3RBXA 1ZCJA 5FEUA 3HZZA 4BNVA 1P0CA 3AY3A 1H93A 1UXHA 2HMVA 4XB1A 4B8WA 3GGOA 5DT9A 5HWSA 1OFGA 3GNSA 3OEYA 5AOVA 2PA3A 3KBOA 4D79A 1PZEA 4NQZA 4J7CA 4NBWA 5IAAA 1HKUA 2Y1CA 1L7EA 5EPOA 2I65A 3K30A 4HADA 4RPGA 2OHXA 1B26A 4BKQA 3PQEA 1FDVA 3TDKA 5HM8A 3GFGA 3FNFA 5L40A 1CIVA 1E3WB 3DOOA 5B4UA 4K6FA 1CYDA 1PL6A 2PV7A 2XOXA 3CE6A 4PLZA 4Q3NA 5TS3A 1DFIA 3DBRB 1VJTA 3H9GA 1UXKA 3K92A 1E3IA 3PK0A 1TT7A 4IDAA 1NFRA 4LW8A 5K0ZA 1NFFA 2ZATA 1Q7GA 2J5QA 4YACA 2VYVA 3Q1LA 2Q1UA 4FFLA 1E5LA 4IXTA 4PZDA 4UREA 5GZ6A 3RBVA 2GLXA 2EP5A 1PS0A 2O48X 2ZTLA 3CTMA 3M1AA 1T4DA 4RQUA 4W99A 3D3WA 4CLEA 3WLEA 5IDQA 5JPIA 3HDJA 4GKBA 1ULSA 3NDJA 1BHSA 3RCBA 5DCUA 3DDNA 3E18A 4JJGA 1DFGA 1H6CA 4L0QA 3ADOA 2Y67A 1MLDA 4BB5A 2EW2A 2B5WA 4UUNA 5CAEA 5MGBA 3GLQA 2RH4A 4UEJA 3U49A 4YT4A 3M6IA 2DVMA 4KQWA 3JYQA 2J3KA 3CXRA 4TKLA 3UH1A 3UW3A 1W73A 3NDIA 1NQTA 3FTPA 4GL4A 1VSUA 1HZJA 1SNYA 4KWIA 4EDFA 4B4UA 3R1IA 1E77A 3PJEA 2AQIA 3I5MA 3PVZA 2CDBA 1PGPA 4FOSA 4XEHA 3WXBA 2VN8A 2WYUA 3IJPA 4C7KA 4CM7A 5IG2A 1I10A 1Y81A 3VDRA 3UICA 2GCGA 3BYZA 1EVJA 3DQPA 5KJ6A 2YFQA 3UCFA 1F8FA 1M75A 1YOVA 2P9GA 3E5RA 4Y6RA 4YT8A 4FDAA 1XEAA 3EGOA 4GWGA 4YJGA 1UXJA 1A9YA 2DUUA 1I30A 3F3SA 2BFAA 1LX6A 3ZV6A 4BGVA 2I5PO 4MVJE 4D3SA 3ZN2A 2Z1MA 3HWRA 4MJLA 3WX0A 1NVTA 4ALJA 5JY6A 4J7UA 1F12A 1B7GO 1W4ZA 3KETA 2PD3A 5ER9A 3ZWXA 4IDDA 1GYPA 3WBBA 1CJCA 3H8VA 4CLOB 1E3JA 4OHUA 4YTEA 1NAHA 5IF3A 1Q0QA 2EHDA 3OIDA 1TB4A 2QYTA 3KEQA 3NTOA 5A9TA 3GR6A 2FR0A 2P68A 3DXFA 4WGGA 5EERA 4OSPA 5B1YA 5JMPA 2RBEA 4OOEA 1QYCA 3D3WB 3RROA 2NWQA 1J4AA 1NXQA 1PL7A 1T26A 3QIVA 1DPGA 2BI7A 4FBGA 3PZBA 3K2EA 2R2GA 1OZAA 1CQIA 1YJ8A 2DBRA 4HFRA 4ND2A 1I3KA 4YJHB 4NU6A 4ZJUA 2R6JA 3GZNA 4A26A 1OBFO 4H16A 1I0ZA 3GVIA 3DTTA 4BNHA 2DFDA 2CSUA 1NNUA 2J5RA 4DPLA 3I83A 1P33A 2DLDA 2IZ0A 3D64A 3FHLA 4OM8A 1HZZA 3MCVA 1TT5B 4BL5A 5FYDA 3EVNA 5JDCA 3F4BA 3NV9A 3EAGA 2AEJA 4DL9A 4EEXA 4J4TA 1GPDG 1PGQA 2Q99A 1RWBA 4JBHA 4CR8A 1YONA 4E4YA 3O8QA 2GZ3A 3P7MA 5EQDA 4YJHA 4XRGA 1LNQA 4IQ0A 4DMLA 2W2KB 4GKVA 1PWXA 1V6AA 4L4XA 2Q3EA 2HU2A 3HNPA 4AVYA 1DAPA 2X86A 3GG2A 1KEVA 4R1UA 2DTDA 1IL0A 2NLOA 3I9KA 2QG4A 5U9CA 3VH3A 3AM4A 3EMKA 2V7PA 4R1TA 1BW9A 3CIFA 3PRJA 1W8DA 1OOEA 4Q3EA 3D5QA 1SB9A 3KYCA 1LA2A 2POQX 4TVOA 8LDHA 1SEPA 4JBGA 3ZW9A 2HMTA 1DRWA 3AM5A 1ZSVA 4OYRA 3FN4A 2P5YA 1EBUA 4P38A 4FD3A 3SX2A 2O3QA 4P4NA 2B5VA 5C7OO 3FR7A 5T6BA 3DMYA 2C2XA 5KWEA 4CL8A 5TIIA 2Y05A 1YDWA 4E31A 1V9LA 3RBZA 1TXGA 4G81A 4GMFA 2LDBA 1A7KA 1BG6A 2GUGA 5G0TA 4CLRB 4DIOA 3ZDFA 2D4AA 2VZ8A 4I5EA 1GL3A 3WMWA 1JTVA 2EWMA 1MV8A 2IZ1A 3COSA 2P4HX 4WOKA 2JFGA 4P22A 3UHAA 2D1YA 4J2HA 5C7LO 3RD5A 3BTSA 5ES3A 2QRLA 1V8BA 4Z9FA 3JYLA 4J9VA 1P3DA 3K31A 2ZYDA 4B7UA 1MC4A 1VSVA 1HE2A 5FWNA 2QHXA 4JLWA 3G79A 4IJVA 5COBA 3DTYA 1E1MA 4IDEA 3JD3A 4LSMA 4Y6PA 4YAEA 1MXHA 5I9MA 5IN4A 4AJ4A 3EC7A 2P91A 4CV3A 3DAGA 1HYHA 3MOGA 4BNYA 4GLLA 1LI4A 4RDHA 1BDMA 4TWRA 4QX6A 4DIBA 3KLMX 3DR3A 2PZLA 1NAIA 2CF5A 3IKVA 5IDWA 1F06A 4PLWA 3NYWA 5DN9A 4L76A 3F1LA 4UUPA 3OJ0A 1YL7A 4RCVA 4TSKA 3CZMA 1G1AA 1YWGO 3WSVA 4CQLB 3JQ7B 2ZTVA 4HV4A 5L4SA 1U3TA 5ADHA 4OXKA 3JQ9C 4K9DA 3JQGA 4II3A 3RC1A 1GPJA 4Q3AA 4YAJA 3ADPA 5AVOA 3VVCA 3OICA 5H81A 1E6UA 4BO0A 2Y99A 4OMUA 1PS8A 2VUTA 4HUJA 4XRRA 4RPLA 4WPGA 4CM8B 5JMWA 2WWRA 4XQGA 1M67A 2VYND 3RKRA 2YDXA 4G2NA 1QLHA 3HHPA 4BMNA 1LJ8A 1ZH8A 3FNEA 4UAGA 3C1TA 1DIBA 4DGSA 1OI7A 4PCVA 1GZ4A 4MVJI 1U7TA 2NVUA 3U9LA 4BNXA 3X2EA 1HF3A 1YQGA 3BA1A 3C24A 5BSEA 4DTIA 1F17A 4OJNA 2PZMA 2QX7A 2VT3A 4RLSA 2EP7A 4NK4A 5THQA 2RAFA 2OXIA 3BTVA 1HL3A 4J2OA 3EYWA 3VVBA 4EUEA 1ADCA 4BHTA 1ZK1A 2IYOA 1EVYA 3DEYX 4CM6A 1P74A 4F46A 3L4SO 2YFHA 2JAHA 3Q0EA 2X0NA 1LLDA 3JQAB 1A72A 2BFPA 2PD6A 4A0SA 2D59A 1QYDA 4Z0HO 5FI3A 5JLAA 1J49A 2J3JA 1WVGA 4KWHA 3EDMA 4YVFA 1HDXA 3UKOA 4AJNA 4PLTA 3S2EA 2XF8A 1GYQA 2YV3A 3INRA 3WYBA 4LVCA 1BRMA 1PQUA 5A9SA 1ADGA 3WGQA 1DIGA 1BTOA 4BNFA 5H83A 1VKOA 2ZIZA 5IZ4A 1GUZA 5U4QA 2B35A 1NWCA 3H4VA 3PWKA 1T25A 1LSJA 2FY8A 2VZ9A 4U6SA 1R0SA 3H9QA 4IMRA 1EUZA 1KEWA 4EW6A 3CMMA 1GU7A 5HS6A 4BS9A 1QV7A 2DM6A 3PEFA 1HWYA 3TOXA 2C20A 2C7VA 3FCOA 1X15A 3KZVA 3NT4A 1Z7BA 4YJGB 4IDFA 7ADHA 2Y1GA 2PTGA 2NTNA 3GRPA 5HA5A 3AY7A 2UAGA 2WYVA 4UVGA 1RM0A 3ZU4A 3DONA 2OMEA 3A06A 3NDRA 4IJWA 4DQUA 1QLJA 1NX6A 3MWDB 4CLRA 3PWZA 3KXDA 4N18A 5JAIA 2I67A 2HJRA 2I3AA 5HRUA 3EZYA 1G6KA 3ENNA 4GVXA 4TQGA 2EF1A 1ZNQO 2IRWA 4RV9A 5BT9A 2D2IA 3RUEA 4P4GA 1UAYA 2DAPA 2ZB8A 4UEKA 3WS7A 4I9HA 4N5NA 5A02A 3OQ6A 1HDZA 1PQPA 1C1XB 1ZJYA 3QWAA 1U2DA 1UJMA 1UZNA 1H94A 2NM0A 3CSDA 4I8XA 4ND3A 3K9QO 4ZD6A 3P19A 1ONOA 1VL8A 2UYYA 1N1EA 2CY0A 3GT0A 1ISMA 4PG8A 2Q46A 3DFZA 4FC6A 4ALIA 5F5NA 2NU8A 4WNCA 3ST7A 1UH5A 5I7FA 1QORA 1JWBB 4IGEA 4RF3A 1P0FA 5KNLA 1I33A 5FF9A 2Y1FA 1W0CA 5F5LA 2J3IA 4BB6A 3MJ4A 1NPYA 3LF2A 3ETGA 2BHLA 1ISJA 1VJ1A 4GI2A 1I36A 5JCJA 1BXGB 3S8MA 3QW2A 4YT2A 3EY4A 1DIHA 4JK3A 4F3YA 1V35A 3PYXA 3S2FA 1U9JA 4R9SA 4DYVA 3IP1A 1Q7CA 2NU7A 3WGYA 1BGVA 4EJ0A 1C3VA 1P1HA 3GDGA 4QFDA 2HO5A 4NIMA 1O0SA 2NVBA 1PJQA 3JQFC 5KVVA 3NJ8A 2VHZA 2NU6A 4XQCA 2WMDA 4WECA 3DWFA 1C1DB 1T4BA 1WZEA 3OFSA 4S3MA 4XD2A 1Z7EA 4J4HA 3QVSA 2BGKA 3PLNA 5DP2A 3RU9A 2XXJA 4ID9A 1MP0A 3ICPA 3LC7O 1EDOA 4CMGA 3PHGA 1NQAO 1KEUA 3SLKA 4XX0A 2H6EA 3GMSA 3ZNQA 3U4HA 2NSDA 4YJFA 2X5OA 1JKIA 3VPSA 1EE2A 4BO4A 1P1FA 2J5KA 1NR7A 1U1IA 4PLPA 4W4TA 1XIVA 2PGLA 5A9RA 5TC4A 2I3GA 3PWSA 2FR8A 4E2XA 5A5FA 1E1NA 3QWBA 1R66A 1B8VA 2UUPA 3RIHA 5EN4A 4P4LA 1JQBA 2YJZA 4BO6A 3AFMA 1R12A 5A9SB 2RHRA 2UUOA 4ND4A 3HB4X 4IY1A 2Z95A 2B0JA 2FR1A 4E6PA 3F5SA 4PVDA 1F8GA 1HT0A 4YRBA 4OQYA 1U4SA 1SCUA 1LQUA 1UDAA 3GPDG 1KC3A 4AJOA 4OOFA 4ZICA 4L74A 4PG4A 1QYXA 1GUFA 3U62A 1GZ3A 1LSUA 4F6LA 4QO8A 4MIYA 4ZHSA 3WLFA
chains in the Genus database with same CATH superfamily
1M6WA 2IY7A 1IU9A 2CHFA 2Q9AA 4MWEA 1B8PA 2Y1LA 3NAZA 3T06B 3SSMA 2HWYA 3E2PA 4O6VA 4F4IA 1OTXA 3NW9A 4CZ2A 1AMUA 3BCSA 2X58A 3OESA 4DJDC 5IZCC 1RVV1 5CVVA 1CCWA 4P6VF 2OCXA 3QVXA 3UAXA 3C8UA 3TRHA 2EAUA 4PFSA 5LQNA 2HREA 3R5SA 4L5BA 2FWAA 4KQ1A 1QUFA 3MPUA 1O0CA 4FWBA 3HSYA 3K9CA 2WFLB 2BF4A 4WA7A 4CEIB 2W2NA 3RHSA 4H7KA 4B3HA 4DSTA 4IEEA 4DW8A 1DSSG 1TCUA 5L7TA 1J0AA 3VBCA 1T1SA 4ZI7B 4PPQA 3VU1A 3QPVA 1PD0A 1VRCA 2IY9A 3A04A 3JYOA 4RF2A 2R25B 2CBXA 2O0LA 3IQIX 1HE4A 5KDOA 1HT2E 4CVNA 4UCFA 2B30A 1K2WA 2XNDA 2KPOA 1H8EA 1OCEA 3GLUA 3IUYA 3BSYA 3HV0A 4B1FA 5CAEB 2A57A 3L1UA 5HS4A 3I9MA 1JEYA 2QBYB 1O03A 2X0RA 1QQBA 1KWGA 1OC2A 1AVTA 3JCZA 4ZQGA 4YFVA 4AY4A 1KO8A 2VJYA 3SLGA 4LYDA 5HJEA 2A9JA 2Y9PB 5KYWB 1ZESA 2ALJA 2BEUB 2BRUA 4WJZA 5TT0A 3VAYA 1ULUA 1I2CA 1WMBA 1PVVA 4GZ3A 1HNXB 1TTTA 2FPUA 2R86A 3OE5A 3M34A 3FM9A 4LZAA 4B4WA 4KFCA 3W5DA 2B5OA 2WUFA 1TVMA 2PZGA 2QJRA 4XTCS 1HETA 1Y7TA 3TECE 4ZEXA 3OHSX 2QTFA 3EA4A 5ALHA 4A8HA 2H1IA 4JJEA 4RKFA 3PIDA 1XRLA 4EUHA 4IQGA 4N41A 3WZMA 2R6R1 3F8SA 2AFIE 3HWSA 2HF7A 2XJ9A 4YRGA 3N2KB 1JFVA 4U6QA 4UHEA 4Z99A 4Q7LA 3TLJA 5ARBA 1V1RB 2M9MA 4GYWA 5ALKA 5E8JA 1POXA 2JGNA 4MPRA 2G80A 3I45A 1ZH6A 3JYPA 2G4VA 1IN4A 1KPIA 1ZBDA 2OC4A 2F1OA 3CZQA 1ODLA 4TUYF 2PEZA 1SQSA 1QK3A 1EHYA 4K6OA 2C88A 2PRYA 4X94A 4FSHA 4X24A 3RSZA 2OCBA 3GO4A 3FUVA 1ZGAA 2ZYAA 1ZCFA 3GGSA 2G9VA 1B2RA 2PBFA 4MKIA 4Q9NA 1K7XB 4TTIA 2VF7A 2CLEB 1LVGA 5JADA 4JLKA 5L9AA 3UC9A 3AINA 4P4TA 3LQ1A 5DHPA 1OB2A 2JC3A 4KMRA 2J48A 4KQGA 3DF9A 2B1JA 4EATA 3MJSA 3W5SA 4TKMA 5GJWC 3N1UA 1NVVQ 4MRAA 2SECE 2GDZA 3W4KA 3EPJA 1OWLA 1G9TA 1L7AA 2HWKA 4FEAA 2ACEA 1EJBA 3BMCA 3LWDA 4LOAA 2Z0MA 3HU2A 4ER7A 2NV2B 4EGFA 3WYAA 2XAUA 1M6EX 2ZVPX 1FQKA 4RK4A 3FNGA 2FWPA 5T6MA 2RD2A 3CEPB 4HPWA 2EEZA 3PXXA 5CP8A 1FSSA 1EE9A 1M5UA 3L84A 2FPPA 3PR3A 4BV8A 5GV7A 2AD5A 1ZJ5A 2FSGA 4P8RA 4EI2A 1Z73A 2XV1A 4X6YA 4F3NA 1UM9B 3D9QX 3TKYA 4CQJA 5A06A 1TLLA 3ELBA 4GNKA 4YXWA 4EJSC 3C5VA 2OGZA 3AETA 3DOCA 3O8DA 2XGJA 1YI0A 1MVLA 1FFHA 2Q49A 3UXYA 5KYNA 4WL0A 1XXHB 3IOCA 3OWOA 4YAGA 3DVAB 1T24A 1YZFA 3N8IA 4XIGS 2G08A 2QSZA 1NRJB 2XRZA 3ER6A 1AUPA 2WU1A 1V1MA 2ZJ1A 3K32A 1OFVA 1DZ3A 1LPMA 1TKAA 3KS9A 4WERA 1OTYA 5AM1A 2ZZNA 3HABA 3KJFA 4RU1A 4WFIA 3ZU5A 4KKVA 4NCKA 4PSVA 4U7FA 1P3Y1 3O83A 4U7DA 4JLOA 2IL1A 3ZIUA 4GOOD 4UOEA 4OGKA 4ZI2A 4PC1A 4FSDA 2ZKLA 4NDNE 4UVIA 3OX4A 1AQUA 5IKMA 2O8DB 2W8ZA 1P2UA 2A30A 4Q39A 1YCGA 3VDMA 2G25A 4UDNA 2KWIA 4JU9A 4JEIA 4B3RB 2AJTA 2JH3A 2BFBA 4KTVE 4DYHA 1A7JA 1TC2A 3EFEA 1FFEA 4LDJA 5TPWA 1L8AA 4YP6A 3TCNA 3TW4A 3U7JA 3NTVA 3IH5A 5ALEA 4KXFB 3JATA 1FC0A 2IYAA 2GOYA 4FXPA 2O19A 3TIGA 1K5HA 4BN5A 5JJ5A 2X9QA 3LNCA 1KETA 5ECDA 3EB9A 1ZL2A 2CJWA 3TTYA 4DA9A 3S28A 1HEUA 3GHHA 4H1WA 4LRSB 3PCRB 2CLIB 1GZVA 3K1ZA 5J43A 4KQEA 4Q3CA 1E4EB 3CW8X 3N58A 3C6QA 3W9SA 1RRCA 4R83A 2WF9A 1CERA 1MEEA 3B20A 4ZCMA 4ZCSA 1JAXA 3C4JA 4JR1A 4JT8A 2PS9A 3FVVA 3VR2A 3JWIA 1S2LA 3DUFA 2PGAA 4BZPA 4ZTUB 4KV9A 4M3NA 1T3SA 4Y9SA 1LSOA 4J16A 2OQRA 1AG9A 2IUSA 3HKBA 4C0SA 1P29A 1WY5A 3O0TA 1RQNA 4HG2A 3UB3A 4QOEA 3ZZNA 5IANA 1UC5B 4BO5A 1U11A 4EHFA 4I9FA 3DV9A 1N0HA 4R31A 3NO4A 1ECLA 1VPVA 1QE0A 3BN3A 1X19A 3NBZC 4H17A 4Y30A 3TNFA 1RW4A 4UHHA 4ZDJA 2NO0A 2HMAA 4JJ4A 1XWWA 4KUGA 1XAJA 5CBPB 2IZ5A 1SC4A 3B1XA 1YRQA 2VYVD 3KOXA 3WQBA 4TM8A 2LVBA 4EFMA 1P18A 1U0TA 4QXMA 1ODCA 4NNPA 5IEJA 5JWRA 1XTUA 3FYUB 3TGPA 1J9GA 5L4LA 1H05A 2Y0BA 4WZBA 5KS2A 1VPLA 2O4CA 4MVJH 5EIBC 1C8BA 1YBHA 5EXSA 4C4PA 3A3YA 4BVFA 3LDHA 1JQKA 1DC5A 1S01A 1B6SA 3IEIA 3GARA 4KC0A 5HX7A 2CXXA 1MNAA 2XCIA 2A94A 2HJ9A 4UUMA 4FIZA 4WESA 3UA3A 5AYVA 1OJ7A 4R2LA 3JRXA 2V8BA 1TJ5A 3EVEA 3FFWA 3L6UA 4M8SA 2O2JA 4LDPA 4HK4A 2Q3MA 1PE0A 4YR9A 2CLDX 3D6FA 3HA7A 2C5AA 3CLRD 4GBMA 1GRRA 1PD1A 2QPLA 1FA9A 4R98A 2ZSDA 4Y2JA 2GN0A 1QAOA 4TTRA 3IAFA 3W90A 1RPTA 1VLZA 2GZ2A 2HYIC 4AJIA 3PNSA 1OU4A 5CU7A 1RPNA 4MAAA 3U6BA 4KNYA 4V0KA 3U7HB 3IEXA 4D9JA 1LBEA 2NXEA 4BFLA 1EKXA 3NHWA 1GLGA 1XSEA 2Q3HA 3A3KA 1JDTA 5EL0A 5IFKA 4GVLA 1PGOA 2QMEA 2P9TA 1I7LA 2CLKB 2JW5A 2N1BA 2ZSJA 3CPJB 4JJ6A 4K7JA 4L3VA 4NBSA 4BDSA 1UBHS 4F93B 4LJKA 1E64A 2RJOA 1E66A 5DYYA 5TJ9A 4CL2A 4ASUD 1NR5A 3AY6A 5I8WA 4AG3A 5BV8A 1T1JA 3NBFA 2GPBA 1TECE 3FPEA 4EQ6B 4FFRA 2I78A 5AHXA 2PUHA 3NYIA 4PN3A 3HBNA 4WXHA 5BP7A 1VMKA 3ESCA 5HEKA 3HYSA 3V8MA 3PI7A 1U4OA 4S04A 3G0GA 1J0DA 2IU6A 1U0NA 1XZFA 3EA5A 4LE2A 1DG9A 4YMSA 5EE9A 5LZ9A 3KCQA 1FDUA 5GJVC 1XJCA 3WB9A 4Z7QB 2H07A 2V9ZA 3AOEA 2CE7A 5ELLA 4BZXA 3KB2A 4P08A 2EXXA 4OQMA 1BX3A 1YZUA 2W48A 3F78A 3C14C 3IEVA 1N5DA 2A1IA 4H1HA 1N3IA 4RJTA 4WFQA 2WM9B 4RMGA 4RZ2A 1TQDA 4LBYA 2BEWB 2H5LA 4P0TA 4RAQA 5T8KA 5IT9A 3NGLA 3FAKA 1KEPA 2DC1A 3O8NA 2ZIFA 4KXLA 4L4ZA 4PGFA 1UBKS 3FMOB 3LT4A 5B7GA 1G64A 2AJCA 2X13A 4BVHA 2QL5A 3DXYA 4QTUB 3RSQA 5J5CA 3N8HA 1MQSA 4HH1A 4LGMA 2GBLA 5C53B 2YNMC 1GG5A 1PX2A 4M0CA 3WGOA 5IEBA 3UAWA 2BF7A 2JBHA 2OVFA 3Q7EA 1ENOA 2PQMA 2JJMA 4ME6A 1ENPA 4OHXA 5IVIA 1DKOA 5KB3A 2DTEA 3RLIA 4DT1B 4EARA 1RXVA 5B58C 721PA 4PXSA 1SBNE 2WJ3A 2CGEA 4H7DA 1D6MA 1WPXA 3LK6A 5A6SB 4BMSA 4ERNA 3KAJA 4KQ9A 5JC8A 3U5TA 1X6VA 1AGPA 2X6RA 2YYAA 3T9CA 1UMDB 3KQUA 2P3SA 1QX3A 2JGRA 1DRKA 4EBBA 5CCDA 1M5TA 4F9GA 3WYEA 1L9XA 3JQGB 3QEOA 3B78A 1YGYA 2WAYA 4FBLA 5KYVA 2W2XA 1XAHA 2WMYA 4I5FA 1MB4A 1TM5E 2W2QA 2KQUA 2X6TA 4J0FA 1GQFA 1SUFA 1W88B 2ZLBA 4NU0A 2W6IA 2AQHA 2QI9F 4H3VA 4M8NE 1WOYA 1Z33A 4TLCA 4TN1A 5C18A 3KQSA 4AS3A 5CEEA 4BQFA 1UJ2A 2P75A 3USES 3IVXA 4YAIA 1RRPA 5DGCA 5LD2B 4RMHA 4BNGA 1Y3BE 3Q8XB 1NVEA 2AQ8A 4JJZA 1C9MA 3CLTC 4PW0A 4XKJA 3TQTA 1W88A 3DEJA 4H15A 1TL7C 1TKRA 3DVQX 2BD0A 1AF7A 2ZRGA 3GY0A 1GCOA 1LDGA 3BA6A 3FPGA 4UM9B 5C37A 4QATA 1IK6A 3HKCB 2FWMX 3BXOA 1UWCA 1U3WA 4RF4A 4W5JA 1SOUA 1Y9AA 2FE4A 2WIJA 1H1TA 4GPZA 2L2QA 3B1JA 3KYJB 5K3OA 1SQ5A 5J40A 1CQZA 3LWZA 1VRVA 1IY0A 1P8AA 1PAUA 4PC7A 4EQZA 4Z1OA 1WWKA 4BLSA 5C0OE 1WTAA 2XCSB 1Q1NA 4ZGWA 4MQFB 5FLEX 4A2QA 1C41A 2TYSB 4DRYA 3AUTA 1L7DA 3JASB 4QQFA 5DB4A 4B7XA 2RGGA 4E11A 1G0OA 5I3ZA 4Z0TA 6REQB 3Q8KA 1WG8A 1P2VA 3QQPA 5AM3A 3NFYA 2DYKA 2WVHA 1FYWA 4KIFA 1OXXK 4B76A 1EVEA 2X4GA 2OL4A 1LBTA 1KO1A 3PXBA 5EJAA 3R7SA 4AJ2A 4WVFA 5T4EA 1P4RA 1U7XA 1H85A 1VG1A 1SXIA 3FNHA 2LD4A 1GEGA 3SF8B 3JWEA 3W3AA 5DI3B 2J0SA 5D87A 2Y77A 2WHQA 3RSSA 1JJIA 3WQRA 1F20A 3AC0A 5AW6A 1M34A 4UDYX 4TVBA 2HQOA 4YMIA 1R8SA 3E03A 3FI9A 3GLFB 1ZVKA 1J1ZA 2EFYA 5EUQB 2WD9A 5ALUA 3RU7A 6GPBA 5ISMA 1FP4A 3QVVA 4NH4A 4IXWA 4LAFA 5EHZA 5KNCH 1A9ZA 5FJIA 2C8KA 1M33A 1SKYB 3VR4H 3DM5A 4AO7A 1PK8A 4HEA1 1JKXA 2JCVA 5BR1A 2CCJA 3R5TA 1LCIA 2FH5B 3OA2A 1IB6A 1J8DA 1ES9A 4KQXA 2SBTA 2JJ2D 3HYCA 2Y1WA 1QQ6A 2IYLD 3LDAA 1IPEA 3DAHA 3G2KA 2CFIA 4PQRA 1ZM7A 3Q41A 1JIJA 3TSOA 4TV8A 4BGUA 1SVLA 4OV6B 2RH9B 4YV7A 2P7IA 2O2ZA 1DQZA 2WA1A 1G5IA 4FZ3A 4PICA 1RLJA 2H9AA 1M73E 2CW5A 1N6HA 2VXCA 5FPPA 1P72A 4PZLA 1NVDA 1D6SA 3FF4A 5IM4A 1U5AA 2ON6A 5AKJA 7MHTA 1R6DA 1E3MA 2VQEB 4AJLA 5DNAA 3UK0A 5ERGB 1MJ5A 4M0LA 1ADYA 4RENA 4PFJA 2IEZA 3DD5A 2DT8A 2Q1TA 2UZ1A 2VNIA 3RVSA 3GJ7A 7REQB 1GN9A 1GCIA 1HORA 1YQDA 1X42A 4HXEB 3P9ZA 5B6IA 3DL0A 3UAGA 4RM3A 2QAGC 5I8ZA 5GGYA 3D1LA 1RI5A 4LDRA 5BO5A 2E87A 4C07A 1CZOA 5JEEA 1G55A 3F74A 3IDSA 2GXQA 3FSGA 1WHTB 4IQ8A 4B43A 5KSOA 4TXLA 4JC4A 1YDMA 3UKDA 1BU5A 1BKDR 1LXCA 2BJVA 3KVOA 1CR1A 4J43A 1YZQA 2QSYA 3H1BA 3HGMA 4X8LA 1Y3FE 1OI4A 3LXMA 1EUDB 4EI9A 3BSSA 4L78A 4ZGGA 3OPXA 4PGAA 1VLVA 4KRYA 3KJZA 2E4UA 1TTPB 3AR9A 3IMKA 4DANA 5HIAA 3KXPA 1YUBA 2O0JA 1X0XA 1OZGA 4M9UA 4MUNA 3GZJA 3A2MA 4L8VA 1LDMA 4EZIA 1TMKA 3HVUA 1NVBA 2F1RA 3QBTA 1GQSA 2J0EA 5C81A 5FR2A 2QSJA 4R3NA 4DXAA 1TA9A 2QWXA 2XVXA 4W9NC 4RY0A 3P71T 3AB7A 4RV5A 3KJHA 5C3MA 3K9FC 1EK6A 1ILWA 2CK3D 1XZJA 3JALA 3CX4A 5LQMA 1H65A 3I1IA 4KH1A 3KEOA 1MOPA 5FOVA 4ZVNA 1WXWA 5TNXA 5HCNA 4BO7A 5AI4A 1K89A 1U8YA 2VJPA 3DDWA 3OU2A 3PT5A 4L4SA 4AL4A 2P0EA 2VHYA 1EA7A 1HDGO 3IJEB 3JQQA 2CF6A 3BUSA 2OECA 4YRTA 2Q50A 4CMEA 4CGZA 3W5HA 4RVOA 1J8FA 3DNFA 3OX2A 2DHRA 1L1EA 2A9KA 4PFQA 4E5KA 2D1QA 2IIBA 3ZW8A 3WGJA 4RTJA 3ETLA 3ZIAA 4JI2B 2JCYA 3IP7A 5E0OA 4U5XA 5E6SA 1XCPA 2PT7A 4GPIB 4K2AA 1H2ZA 3NHPA 3W7BA 4F4FA 1IOLA 3TQRA 2I8LA 1JR2A 4RBNA 3NHMA 2WHEA 2YW2A 4AN1A 1JU9A 1P9WA 1SHUX 2ZU6A 1CJMA 1LNSA 3HCDA 4N5LA 2PZFA 5LQRA 5ELXA 3ZS8A 3PPWA 1GAWA 3GVHA 3IURA 1RHMA 2HHCA 2XOEA 3U7QA 5IWCA 3AVQA 4DV4B 4L5YA 1EAMA 1LDBA 4TRRA 2GAIA 3JS5A 2FGJA 4MVYA 2X0JA 3STHA 4GRIA 1KL7A 1TTQB 4U9UA 5BNZA 1KZYC 4BQPA 3U4QA 5JNLA 2Z3ZA 4I9NA 4NYMR 4D43A 5B6PA 3BBLA 4JDPA 3V3KA 2YJ4A 3AHFA 3KLNA 2H54A 3CWCA 4H7JA 3JAWB 3TSAA 4DKJA 3WLRA 1Z5PA 1E58A 3P9CA 3EULA 3IULA 2ZRLA 2G72A 3FGPA 3VM6A 3RS2A 4XUDA 4ZYXA 2YWXA 3RS7A 3EH1A 3KYDA 1DQSA 3IR6A 4ZV9A 3V00A 2ZYWX 4M9XA 3D8BA 3OLQA 4FU0A 4MV6A 2BGLA 4FHFA 5E1OA 4ARAA 2IYNA 2RGXA 1JKFA 1RCUA 2NXNA 3JQ9A 5ENDA 1Z0JA 3L0PA 3L1HA 4MOWA 3OFNA 1IHXA 3LJKA 3NBYC 4QULA 3R5KA 1R27A 4ZVOA 3C6BA 3S68A 2DUNA 5B2EA 3W9BA 3EUAA 1N7GA 1R8YA 1ZUNB 3N70A 4IXNA 4OHMA 1DPFA 1Z12A 2IYSA 5IBQA 1T9KA 4QSHA 4OQXA 4EW3A 1OXTA 2Z09A 3H9EO 4H1UA 4HNQA 4BIIA 4FI3C 4QPCA 1H42A 1IHDA 2BFEA 1YZKA 2KBEA 2QVBA 3KJIA 1ZSNA 1V11B 3MD0A 4UNSA 4ZO6A 3V1YA 3C3KA 4FQ8A 4O33A 4RADA 2RCNA 3PJDA 3BMCB 4KSBA 5DCWA 2AYXA 4ZEVA 5FUMA 1FS4A 1O77A 3C85A 4C43A 2RH5A 2CBGA 4RLFA 4ZT7A 2P4QA 3H6KA 5EHGA 4AKSA 3GHYA 2YHAA 4AUNA 3NGMA 3HVKA 3WI7A 3AVOA 1KSHA 2VLIA 4HBZA 2V96A 1RBMA 3P9XA 2BM9A 2XUOA 4GAEA 4CIWA 3EXIA 1XQYA 2GF2A 3MK31 2YICA 1XTJA 5DVZA 3BMNA 3OBBA 4BJ6A 3ZD9A 1L3CA 2UXCB 1Z17A 4X20A 5I9BA 4MQEA 3WVNA 2ZWAA 4XVCA 3U44B 4HGRA 4ABTA 4C06A 1TT5A 1G20B 4XPZA 3CM0A 1SKQA 1TGVA 2W4MA 4IWNA 4I55B 3RTCA 3WWDA 3AESB 3KLOA 2Y27A 3KB6A 4HYQA 3R40A 4AYXA 3QE3A 1J7KA 4BNJA 2GZ1A 4EKNB 2VUHB 3CNEA 1SBHA 3N2LA 4QFCA 1KS9A 4LJ6A 4PLCA 1F7UA 1B8UA 2P4SA 4MYSA 3X1MA 2G6TA 2X9NA 4NJMB 1SZPA 3PICA 4XGRA 3WL5A 2O3JA 3CLTD 3O91A 5DPMA 1PS9A 1TZKA 1JKJA 3QMMA 4V0MA 1K86A 1XD2B 4H0FA 3SBOA 3TZBA 5CB4B 2G9UA 1QGUA 2HGZA 2RAUA 3DS8A 4KW7A 3TX6A 4W5WA 1T9CA 3D3EA 2C5LA 2C57A 2FPLA 1B42A 1LPPA 3G59A 5HDBB 3SIXA 5GVSA 1J06A 2O2XA 1G63A 2P7HA 3VR6A 5J3JA 2EW8A 2EBWA 2RI6A 3BCRA 1OSNA 2W83A 2HZ7A 1PI3A 1ZJWA 3RPEA 1JWAB 4JB2A 3IDQA 3NIFB 4DQLA 1Z5VA 3I9OA 4ZZ0A 3FUUA 2YHBA 4HVTA 3PL5A 5AESA 1U8FO 3NWPA 3L0OA 3PV0A 3FTDA 4FGUA 4I2VA 4YI3A 3NVMB 3V80A 5L3SB 3V32A 4DLUA 4EYQA 4F84A 3H1PA 3DZKA 1QUEA 4N8EA 4LSWA 1NKTA 4CODB 4ZU6X 2AC7A 3F9IA 4HYTA 5CK4A 1GU1A 3UATA 3UBMA 4DV6B 2XMQA 3KTDA 5IKXA 1MGOA 3C7KA 2JGMA 4N12A 2CXUA 4ER0A 1I4EB 3GAFA 1FX1A 2WZBA 4NE7A 4RWEA 4RDXA 1Y5RA 2CFOA 4JKIA 5IT0A 4HAIA 5LDHA 1OLSA 3TNYA 5L3SA 4UQLA 2P27A 3UGKA 4OLAA 2R5FA 2QRJA 4BO2A 1NVAA 1UBGA 2J6CA 2EF0A 3CRQA 3D4PA 1VLJA 5EUBA 1FFSA 1Z3IX 4MGKR 5K6AC 1V26A 4GHWA 2V0CA 1TKBA 4GBJA 4KR9A 1Y89A 4HQLA 3V1NA 5LR6A 2CXNA 1U5CA 1NUSA 5I4BA 3UK6A 1WL8A 1M2OB 1US8B 3P9QA 4KBFA 5DO9A 4BBJA 3PQ5A 5KX5A 4C7OA 5IJAA 3Q9NA 2GXSA 2YHSA 3HCRA 3VGPA 1P7WA 3F0TA 1RLOA 1OLUB 1B41A 1VKNA 2B7LA 2E4VA 3AEKA 3FOCA 3R0QA 3KHKA 2A9QA 4QNMA 1T3ZA 4BKRA 1XA3A 4LJRA 3CR7A 5J4HA 3D6MA 4PU0A 3ILHA 3PE6A 5FTLA 2Q1YA 3HJGA 5E9JA 3WWEA 4P98A 5JS7A 3V7WA 2Y8EA 2TRSB 1YU9A 2GJ8A 1NG9A 2IYWA 1WW8A 4ZTBA 5JPDA 2IW1A 2QTHA 2ORYA 3CZ9A 4KBYA 4FCWA 1Z35A 1ZI6A 2PAFA 3C3PA 2E5WA 4ENPA 4AY3A 2JAOA 1Z4MA 2W93A 5FWDA 3U17A 3VH1A 1DEKA 3HP4A 3LQRA 3O1HB 2JRLA 3LPMA 4PCUA 5BXQC 5ITWA 1HI9A 5J2UA 2M1ZA 1W19A 1M1ZA 2A9RA 2NU9A 3PI6A 3QMVA 1VL1A 4LQ4A 2JD1A 2REXB 3ZWDA 5D1HA 3RGGA 2DFVA 4INJA 3L79A 5EWMB 3W5AA 1Y37A 2FSFA 2DQKA 4N5MA 4DBLE 3AV0B 4XYEA 1IN1A 4NR0A 1VXOA 3H13A 4XB2A 3IKJA 3SE0A 2VHQA 4K88A 3BXXA 2W8BB 4GECA 4ZAFA 3U1TA 1C9YA 4R51A 2ZBVA 4EABA 2QE6A 4G36A 1WUIS 1Z82A 3A6GA 3DT8A 2J59A 4KGDA 1NR1A 4LDQA 1UBNA 3EZNA 5MN4A 4RIEA 3DAYA 3OCZA 2QJFA 5I4CA 3QIAA 3D1JA 2WTMA 2EX0A 2JCBA 4G0VA 5G2OA 1P0PA 1KJNA 2FUG6 2KB0A 2HPVA 5U1PA 2OCIA 3GLSA 1U65A 4QBTA 3QM1A 4LZJA 3I92A 4MXDA 5KYGA 3I4LA 3FSGD 1DEHA 2GPTA 2Q4RA 4OKIA 4WASA 5EMMA 4BFSA 1XTTA 2HI0A 5FNVA 3ZWYA 4CUZA 4EF6A 5KTYA 3FOAA 1JPNA 5DCYA 1JJFA 4IHQA 1L5NA 1UBMS 5HJ2A 4X62B 1RJWA 2XTZA 4UCXA 4EWLA 1PU2A 1KY5A 2Q6IA 4R4JA 4WI1A 5E4YA 2YWEA 1JAHA 1JAYA 1U0EA 2IH5A 3X43A 4DQ0A 2WMOB 3D0OA 4C0HA 2I2CA 1FFBA 4HR7A 1QS0A 4Y2PA 1SCDA 4H1VA 1FUIA 1XPUA 4IVNA 4DV0B 4LYGA 2Q9CA 3WYFA 3S29A 2BI4A 5FA6A 5LBTA 4REQB 1OFTA 1I3NA 4EOGA 2YFYA 1LZLA 4Q9KA 2KI5A 3AVUA 4EJ6A 1DMRA 2ECOA 3SEAA 3L8MA 2C92A 3W8NA 1NZJA 5ESWA 1KBZA 4WZBE 3DNMA 1WCWA 1GV1A 1YI1A 3G2OA 5IC6A 3WHPA 3ULKA 1FNCA 2WKRA 4JI0B 2I1LA 4Y7CA 3MJTA 5E1DA 3LCVB 4AYTA 3KYBA 5AJVB 2GPSA 3JQEA 5EZYA 1RR6A 4QAQA 5IBRA 3WGVA 2CNBA 2NZ8A 2PNJA 2WJ4A 1XZ8A 2XUIA 4P2BA 4MR7B 3R3XA 1L1RA 1XGKA 4WNIA 4H7EA 4F2DA 1N92A 2O2YA 4J94A 1PNTA 1Z68A 2I4TA 5KSPA 3F2IA 3R3HA 2F7SA 5D3QA 1HM5A 4DLRA 4PGGA 3U48A 1Y0BA 1ZMXA 4LV8B 3SC2A 4ETMA 5JY1A 4DA4A 2I9KA 2VXYA 1QYRA 3AB8A 3GZ4A 5DLPA 3TJZA 2AXEA 2RAPA 1OPRA 3EFHA 1SB8A 1TNDA 1WB4A 3BGIA 3PYLA 3MB5A 3QPAA 4G1BA 4J8PA 3IIEA 4OAOA 1H6BA 4OB6A 1SD5A 4NI5A 4JBIA 2WJAA 2B21A 2IKQA 2GPAA 3EIWA 3V42A 5CD1A 3ZWOA 4RULA 4BTLA 1Y6FA 5F1KA 3WSWA 4I50A 4MKZA 2BDTA 1KDZA 3OMXA 1RXIA 4DUGD 3RJ9A 3SS8A 1NW5A 4DMGA 2QQEA 3E8MA 3ITDA 3NBXX 4HAVA 4ARIA 1JDVA 3A28A 4DIEA 2QS9A 2BHSA 1SZJG 2XMPA 1C2TA 4ND5A 3LCCA 1H5UA 1CJSA 1B3BA 3IUNA 4OGWA 5DJ5A 3RRMA 4TOIA 3MA0A 1T1EA 3PQ6A 4EJMA 4GOMD 2DZDA 4HNGA 2X6QA 4GXRA 3BQNB 4R68A 1EHCA 3B5EA 3RUFA 1EWYA 3U7RA 4URVR 4YRMA 3A14A 1WSWA 3JD0A 1RSZA 3L7NA 2WYWA 2XZOA 2JHGA 3HFRA 5LZ2A 3MIIA 3L92A 3PDJA 3O9ZA 4G25A 3KZMA 1CZRA 2GN8A 3E8SA 3DG9A 3HXMA 3I42A 4O2AB 4S24A 4XI9A 4D5EA 2ZTMA 5ADWA 3FZQA 4EITA 2XGOA 3HKDA 3TLXA 4TWZA 1L8XA 1KYTA 3HUDA 5G53C 4DDHA 3IAEA 2FPWA 2AA3A 1RYHA 5TQVA 3DR5A 3RC2A 4YV2A 3CQ9A 5HYVA 3NIDB 4Q9IA 3LPNA 1Z8FA 4BAZA 4DCCA 5HQ3B 5LLSA 5SZJA 2Q5CA 4XX0B 1NGSA 1X1AA 2XADA 3CEHA 5DTRA 2QR5A 1RJGA 4OK5A 4FDTA 3MWJA 4M21A 2OKCA 1X2BA 2A4MA 1KDTA 3H11B 1UFQA 4JBYA 1ZOPA 4XASA 2W98A 4ZQEA 2VOEA 3T4EA 4OHKA 5FUVA 1UP4A 4I55F 4RMNA 2R8PA 3CKKA 4NESA 3CZ4A 3BIFA 1DOHA 4QPDA 4JROA 1JWLA 4PZEA 2AR9A 3B6KA 2FPOA 3MBKA 2OV8A 3MTDA 3QY9A 1KJQA 1DL5A 5LQCA 2XA1A 4QDTA 3TB6A 2Q4DA 3JQFA 5EZQA 3UAOA 3L7IA 5TARA 1KORA 5FO0A 1QGOA 2FEMA 1JV2B 1AV7A 2HU5A 2E7ZA 1F6BA 3GFQA 1SOWA 2YVLA 4IUCS 4D80A 2I7VA 4Z4IA 2HDOA 4GMXA 1WLYA 2R79A 3G1UA 2ZDHA 2ZTHA 1LU9A 1QYVA 1RM4A 1IHYA 2WI8A 4K26A 3BXZA 1G20E 3VOSA 1QV9A 4E88A 1JEAA 4H60A 3PLRA 5ED0A 3F9RA 2MTBA 4H27A 4HQ0A 3WGZA 1HO3A 1MC1A 3HKDB 3OM9A 3ICEA 1V96A 3BS4A 1A8PA 3IUSA 4M0PA 2DFNA 1RPAA 3BD7A 1NN5A 1Z5OA 3JQDA 1S6YA 1KP2A 1NVMB 4LBWA 4NCXA 4REQA 5FI5A 1K6MA 4Q3DA 2Z6QA 1Z74A 3EPKA 2X7HA 4TZ0A 1ADFA 3ENWA 1ADJA 5KCZA 1MMFB 2ZULA 3A3PA 4OXNA 5JYBA 2CEKA 3BMOA 5EXXA 1UXGA 4Z3KA 1YTLA 2BGJA 2YBDA 2PPVA 3WK4A 1VHDA 1G6HA 1W34A 3C7DB 3DOFA 3FFXA 4D25A 4K8OA 1G9XA 5JZ9A 4QUGA 2W37A 3BC1A 4H08A 1J0BA 1GGMA 3O47A 3TZQA 1IHOA 2YRXA 4TMWA 3ZNOA 3JZAA 3KPYA 1UIMA 4GD3Q 1C8LA 1V47A 4LECA 4B6JA 2XRFA 2HHAA 1Z62A 4AKTA 5C1BA 5KYKA 5CFZA 5ALYA 4TMKA 1IM5A 4DRXA 1QIDA 2YIJA 3D3NA 3JTMA 4DVJA 3K09A 1DCFA 3E5NA 3HC7A 2D74A 4HLCA 4DVGA 3QVWA 5KAPA 5KQMA 2YS7A 2A7QA 4B3SB 1Y63A 1A98A 3ROQA 3V8BA 1U2ZA 3H3FA 1OGIA 1QG6A 3RJ5A 1MC8A 5JI3E 1QG4A 5E2AA 4MYTA 3G9QA 3FLAA 1YKGA 4J3FA 3WNQA 3N0XA 5KQGA 4NDZA 3RRNA 1ZYUA 1QQAA 2OV6A 3ANTA 1O9GA 2UZ0A 3T38A 3GN2A 4EVIA 4O02B 3C6MA 1GWNA 1H1DA 1T2AA 1KK3A 2B4TO 3BTOA 3IVGA 1USWA 2LGJA 3CRRA 4PINA 1XU9A 1YULA 2J3LA 3FG9A 4G09A 1E69A 4ACAA 4RJLA 3HO6A 5EZ6B 1ORRA 3OWHA 5D5PA 5DEOA 5TMBA 3PQ7A 3O4GA 1M54A 1THZA 2VT2A 1T35A 4BZQA 5IUNC 5K4HA 1G2PA 4IINA 4V0OA 1Z0AA 1SXJA 2I1VB 3VHLB 4RCYA 1G1MA 4V0RA 1TUBB 2CNKA 5CJJA 3TVYA 3RAPR 1W9MA 4BB0A 3NH6A 2WT8A 3HXTA 3OECA 4M6WB 4CLHA 5JS8A 1UT5A 3OZIA 2I33A 2J85A 2ZE5A 1IVSA 3AOEC 1NW9B 5DWVA 1ODIA 4LE0A 1KRXA 2VZ0A 5T7BA 1M6VB 1ML3A 3RVRA 5LNK6 1BD4A 3ZZ0A 4FMCB 3Q9SA 4PX9A 4CCWA 1CNEA 4KDFA 2GEJA 3RKSA 3BJIC 4RVSA 1OREA 3RT9A 4XDHA 4RTRA 3RTAA 1R0WA 3AEKB 4INZA 3H5LA 5E3HA 4ZEWA 2UV8A 2YN4A 3QU2A 4KX5A 5AXDA 2C3MA 1MABB 1S3IA 1FPQA 2GFIA 1C1XA 1TO1E 2VH1A 2R1VA 2W43A 1FX0B 1OFUX 1KIMA 1PJ4A 3A9UA 2XGSA 3RV4A 4CGYA 3J80A 3DBHB 5FAXA 3HHEA 3DTVD 3O84A 4IKEA 1ISFA 2C77A 1H0HA 3OZVA 3C8MA 4IWXA 4M98A 1QCZA 3QG1A 4JYPA 5DRTA 1XTZA 5KVSA 3MGAA 2VRBA 3IDAA 3Q2KA 3T1QA 2NQ2C 3LUGA 2FLKA 1QONA 4DT1A 1NBMA 2XNKA 4FPXA 3WKCA 4HDOB 4LV6A 1FK8A 1FLVA 2KE5A 4MS3A 4M89A 3UJPA 1GDTA 1S9DA 1KDYA 5LJIA 3N3BC 3T7AA 1F2VA 3EGIA 1RWQA 3RS9A 4DBZA 2OTCA 3KXLA 3QHPA 1PFWA 1ETUA 5KYYA 2QX9A 4IZOA 2VJOA 2SCUB 2AOXA 1E2FA 3BDAA 1JFLA 2C8JA 2WJGA 3KE8A 1T5BA 1VDZA 4BEVA 4Y6SA 3LUHA 4HAUA 5EWMA 1NJ2A 3TIIA 2B0CA 2HA2A 1MN6A 3GZNB 1JFRA 1PZFA 3INTA 4MQLA 4U3JB 2P79A 1DLIA 1T3TA 4JUDX 3TYXA 2A1TR 2LW7A 4D9IA 3VYRB 1XE3A 1ZGBA 1E1CB 2XODA 3BF7A 1DUVG 4NOKA 3GNQA 5ALSA 3WWYA 4D98A 2UUCB 1AU9A 3D2CA 5D3MA 3AU9A 1Z7YA 5JCOA 2VPWA 4LXGA 3SDBA 1V5FA 5GZ3A 1M8PA 3OP1A 1Y6QA 2ZKIA 3LYHA 3W6ZA 3ZEAA 5B36A 4WKNA 2PCJA 4I4IA 2CD9A 2D5IA 1WZIA 3A6HA 2GVZC 4B6EA 1CVRA 4AULA 4DJTA 4DPKA 2Y92A 1E0SA 1SQGA 3FY4A 3KZOA 4M0MA 4YRQA 1W5TA 2OFPA 4NFHA 2GCOB 1FMCA 3KR0A 1VJDA 4ZVRA 1C9NA 1O6GA 4IDQA 4D26A 3QF4B 1BIFA 2YHUA 4LX8A 5SZKB 5AVTA 2IITA 4CR7A 3H8SA 4FOPA 4PG6A 1H5NA 3BAZA 5P8WA 1Y48E 3RBAA 5KKAA 3VTKA 4W5HA 5JS1A 3AI7A 4X64B 3QLVA 1N2BA 1X7XB 2GKSA 1T10A 4OH1A 4W8HA 5EWJA 3SYMA 3TR0A 2AMLA 4ER3A 5AKGA 1FDSA 1OBOA 1BEUB 2A9PA 2V6JA 3AEZA 3T6KA 1CRQA 2WKPA 2D4HA 4B5LA 5I7RA 4B2YA 2QM7A 4IHJF 3IP9A 1IBRA 1Z83A 2NVUB 1JIKA 4HQFA 1C80A 4BO8A 4OKNA 5CK5A 5IW8A 2E6UX 2JATA 1Q7TA 4S35A 3DULA 3T3MB 2Q41A 3HB5X 3TBKA 3WISA 1ISHA 2AJDA 1N1DA 1B0UA 3AR5A 3OFVA 3G9UA 4MKXA 1R0RE 1L1QA 2BE9A 3GDHA 1C3XA 1GPYA 5BSVA 2VJMB 2ORVA 1C4KA 1TVKA 2PUVA 3RC3A 4GG1A 5L6LB 1ECPA 1MC5A 2O52A 3L8EA 3AI2A 5HPYB 3RSLA 2VS1A 4HD8A 5DGXA 5FXMA 3ZTTA 3G8BA 3FYUA 1SM4A 1WDTA 3EDRA 4DQDA 4R54A 4YJ2A 2ZRBA 3EISA 1KY3A 3L9XA 3LQKA 1BKSB 3EASA 4UPDA 4DCSA 1JLKA 4PM4A 2RGYA 1U2PA 3HJBA 2XNSA 5EKUA 5BNTA 4MDFA 4QA9A 2BN4A 3TE7A 1DRJA 1SUWA 3TXXA 4C4TA 3IQGX 1SPBS 3NHLA 1KQ3A 4IDGA 4LGVA 2H1CA 2XMGA 5G1PA 1YHNA 1JKJB 2ZR7A 2P9HA 1JG4A 1RIIA 2NADA 1GNQA 1HTBA 2P9CA 4XLTA 1JTEA 2VHUA 3A4LA 4GPEA 4IIYA 1AKVA 1QE5A 3F3MA 3FNRA 4TS1A 1YACA 4EJSB 7MDHA 3ZHQA 1C9DB 1NJGA 3HUEA 3QKUA 4E5MA 2XSZA 1QOQB 2IZOA 1NPTO 4BO6A 4NZOA 4GE3A 2JLAA 2V3WA 1PR3A 2K87A 3IMFA 4UNIA 4DSUA 4EMTA 2WYHA 5KSZA 4AN0A 2GCEA 2V7QA 1J22A 1VL2A 3F46A 3OZ7A 3RQIA 4CMKA 2C5GA 2AQKA 2VAXA 3CLRC 3IIMA 4HGOA 4RZSA 1A9XB 4GSKA 1B00A 4Y2RA 4CM4B 4DR1B 2PGXA 2F8TA 2AK2A 4YAKA 5HF6A 1CIPA 4ENQA 1A9QA 3R3JA 1XN4A 1TAUA 1GYRA 4LY9A 3T34A 2C5BA 1M0TA 3M7IA 3BZUA 3DMGA 1OWNA 2ZYSA 3NONA 4FXOA 1XHFA 4H0NA 4HVLA 4Z0PA 3OZGA 1YS4A 3DE4X 3BGWA 1GGVA 3DZCA 4I50F 1ORHA 1FTWA 2HK9A 1V3UA 3LUAA 5I7SA 3IAM1 2OM2A 3TW6A 4W7HA 3W5JA 3ZIAD 2ZI5A 3ZV3A 2O50A 4QXOA 2C8VA 1KH3A 1ZK2A 3KDPA 4HH0A 3R7WA 3U7QB 4DN6A 1LPBB 3K8QA 4KDRA 3V9PA 5A5EA 4LKRA 4LY3A 1A4XA 1QKKA 3C15C 3N2GB 2UUAB 4IV5A 2IHUA 2I22A 4A5SA 2XHZA 2VQFB 4PPGA 2H5EA 3CBGA 2CFSA 4DCGA 2PWPA 1ZI8A 2XUDA 3Q12A 4RNCA 5LZ7A 4CQMD 4P84A 4D6XA 2CHQA 1AKRA 5IXSA 4N0MA 2I3DA 3IV7A 3M6AA 3DVAA 2DGDA 1NPDA 1ZOOA 1ZVQA 2ZRKA 3L8CA 2IJGX 1M7HA 1A76A 3E23A 1IHPA 3AETB 1LLCA 4E13A 5A4JA 5BUSA