4AJ4A

Rat ldha in complex with 4-((2-allylsulfanyl-1,3-benzothizol-6-yl) amino)-4-oxo-butanoic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
330
structure length
330
Chain Sequence
ALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
total genus 113
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4aj4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4aj4A02
3BTUA 1FDUA 4I08A 4PLZA 4HNGA 1ZBQA 3OQBA 5JMPA 3W8EA 4JLWA 3JQ8A 2YFQA 1O6ZA 2AG5A 4GI2A 4CPDA 4YXFA 3OETA 4FFLA 3RFTA 2BGLA 1U2DA 3KSDO 1IZ9A 1X1TA 1OC2A 5TJ9A 1A72A 1I36A 2ZJ0A 3RUIA 3OJOA 2C59A 2HK9A 3RIHA 1WP4A 2P5YA 4PVDA 5MDHA 1FDSA 4WLFA 5DN9A 1CDOA 9LDTA 1EVYA 3I1JA 3KYCA 3H3JA 3LT4A 3KYDA 2C7GA 1JTVA 3T4EA 3TDKA 2YDYA 3B70A 4NZ9A 1E7YA 4BO4A 4RVSA 1T2AA 5LDHA 1UZNA 2EG9A 1NFRA 1VKOA 2JFFA 5JO9A 3S2GA 1M75A 4ROSA 1JKIA 1E7MA 3F47A 4Q3BA 2PFGA 4ESOA 3AM3A 4XIJA 4X54A 4Z6KA 1C0LA 1CIVA 3LK7A 4BNTA 4E5YA 2B4RO 5I7SA 2PWZA 4CLRA 4LRSB 5DZSA 4LSWA 3MJVA 2I6TA 4RF3A 2ZTMA 4EITA 2V6BA 2Y68A 3PYLA 4K28A 4BUCA 4Y98A 5ADHA 1Z73A 3AUUA 3IUSA 4HNHA 2OL4A 1YL7A 1ZCJA 4IIUA 1WDKA 1TA4A 3Q2KA 4PLVA 1QYCA 1DAOA 4UREA 4B4WA 4CJXA 3PYMA 4YT4A 3MZ0A 1E3SA 4R3NA 2X0JA 4J43A 3RJ5A 1Z7EA 1BXGA 4YJFB 4EZBA 3BTOA 3SEFA 3UF0A 4XZ3A 4ZHSA 5HRUA 4BIIA 1E3IA 2GN6A 5L7YA 4RVFA 1WW8A 1V6AA 1MC5A 2EKPA 2VWQA 2O23A 1LJ8A 3ZV6A 1P9LA 3D7LA 3TN7A 1YJQA 3JQGA 2X6TA 4NFYA 2BHLA 4GVXA 4D41A 2Q4EA 3TOXA 3HUDA 3IS3A 4CR7A 2AW5A 7ADHA 1L7DA 1O89A 3CEAA 3K31A 3AY3A 3FNFA 4MVJH 4Y9DA 4U0KA 4CLDA 5C5IA 4RF2A 3RROA 2DC1A 4WGGA 3UICA 1B8PA 1U28A 4D0RA 2DBZA 4WLVA 4BKUA 2LDXA 1AHHA 3Q9UA 4FSHA 4CUZA 2YFHA 2Z1NA 3G17A 1G1AA 3IOYA 3JQCA 1DXYA 1DLJA 5KVVA 3QHAA 1PX0A 4ZRMA 1SMKA 2I3GA 4OAQA 1GYPA 4CM4B 1ULSA 4J7CA 3BHMA 4YA6A 3RBXA 3F6YA 5KVQA 1Q2XA 5G4KB 4E5MA 2Q1UA 3E18A 8LDHA 1Z74A 4FDAA 4XDYA 1UXKA 3DONA 3GNSA 4UEOA 4QUKA 1GPJA 1PZEA 1QV7A 1P1FA 3AUSA 3DWFA 4YVFA 2X7HA 4J49A 4IZHA 4NFHA 2O3SA 3R0IA 2ILTA 4J7UA 4FB5A 3GOHA 4YQYA 5B4TA 4QFDA 1ISGA 1DFIA 3NGXA 4KTVE 2I5PO 1EUZA 3ADOA 3LLSA 3CTMA 1H94A 4J3FA 3GG9A 1C0PA 3VZQA 3PQEA 3TZ6A 2XF8A 2AEFA 3DL2A 4U6SA 4XGKA 4ALIA 1HXHA 3H5NA 1HTBA 1DEHA 2E37A 3UVEA 1GUYA 1ML3A 2VHXA 4N5MA 1N7HA 4OSPA 3INRA 2B35A 1XQ1A 4NJMB 3ZHYA 1VC2A 1U7TA 1HE4A 1VE9A 3A14A 3LC7O 1UXGA 5CAEA 3INTA 4FOOA 3VTZA 4IXTA 5JAMA 3FBTA 4GWGA 5CEEA 1OOEA 1LQUA 4GX2A 4KOAA 5L9AA 4B4OA 2G5CA 5C7OO 1UDCA 3DBHA 4IJVA 3RU9A 1V3VA 3HSKA 3RWBA 4UEJA 4OO3A 4R4JA 4AICA 3B6ZA 2W4QA 1LX6A 3ZU4A 2X0IA 2CY0A 5G0WA 4ZICA 3U9LA 3CPSA 1OAAA 5F1KA 4WPGA 4DIFA 3KSZO 4KTTE 3GG2A 3RASA 1ZUD1 5ICMA 3COSA 3GEDA 3DTYA 1P3DA 2C2YA 2I76A 2NSDA 4YJFA 3SJUA 1J49A 4FQ8A 3V2HA 4DQUA 2W2LD 3O4RA 1X13A 1TB4A 2E48A 4KMSA 2D5AA 1ZO8A 3AUTA 4ZQBA 4RL6A 4Z3KA 4UVHA 1ZJZA 1TT5B 2ZB7A 2NU8A 4R1UA 2QHXA 4IDGA 2VHVA 3FWNA 2PD3A 1T26A 4YTEA 1LDGA 5EMHA 2YW9A 1BXKA 3PXXA 3VPSA 1Y8QB 2PH3A 4EEXA 4FN4A 2PA3A 3DOCA 4O1MA 4W9NA 4MIEA 3PHJA 1VSUA 3FF4A 4A27A 3DHEA 4KQXA 3SXPA 3CE6A 1SC6A 2ZTUA 4CM6A 1GL3A 3O03A 3QWIA 4GLLA 1DLIA 4CM4A 3LQFA 3ZNNA 3ZZNA 1GD1O 5G4KA 1YKFA 1GZ6A 4BGIA 2PY6A 2VYVA 2YV3A 4BMSA 3CIFA 3DMTC 3VHRA 4OOEA 1JAXA 2NWQA 1N1EA 2Q3EA 1T1RA 3DBLB 4JBHA 4CMEC 1DO8A 4MP6A 1GR0A 1BDMA 2W8ZA 3A1NA 1U8XX 3UKOA 4NPCA 4ALJA 1MB4A 2EWMA 1YB1A 5DBGA 1EVZA 2DT5A 1H5QA 1VL8A 3MTJA 4JIGA 1LDMA 1LSUA 3OSUA 3ZCXA 5JY6A 2A4KA 2ZJ1A 2AA3A 2YJZA 1P74A 3WGIA 1JVSA 3GPDG 4GX5A 1NBOA 3AI2A 2YHUA 3PLRA 4YAJA 2ET6A 5AXCA 4OL9A 4ITUA 3WGTA 1H9BA 1QYDA 4XR9A 4AFNA 4LVUA 4HFNA 3L07A 3IMFA 1G0NA 3OH8A 2AQHA 4D79A 5I7EA 2E6UX 1I2ZA 1RM3A 3EC7A 1I3LA 4R68A 5TT1A 3GT0A 1T25A 1ZXLA 3DFZA 3WYCA 4ZQHA 2IXAA 4NJMA 4WK6A 2DLDA 3JQDA 5DCWA 5B4VA 1D1SA 3D4NA 3HN2A 1OC4A 4MVJM 2QZZA 2BLLA 5HA5A 4DTIA 1Q7CA 5IJZA 3DBVO 5AXBA 3KEQA 4TKLA 1PWZA 3MJSA 4E2YA 4EEZA 3P2OA 1FDTA 2CVQA 2ZIZA 5BR7A 3U49A 1DSSG 3PJEA 3ITDA 4N18A 3HZZA 4XB1A 2O2YA 4NNJA 4NBUA 5L3ZA 3E6AA 4J91A 2FSVA 4WCFC 1PR9A 2OO5A 4IMPA 4ZQFA 4D3DA 3WIDA 4DIBA 1FF9A 3NTOA 4BO9A 5TC4A 1TT5A 5KVCA 2D59A 3CSDA 4DBZA 1PJ4A 3JQEA 1HDRA 4B8ZA 2AE2A 4G81A 5KKAA 4M49A 2WYVA 4MPDA 3GLQA 4B7UA 3OMLA 3GAFA 3UXYA 3HHPA 1CWUA 1Y8QA 2VCYA 4XDZA 1SB8A 4RV9A 1A4UA 4PLFA 1IHYA 2QW8A 3G49A 3EMKA 5T5QA 1FMCA 3WQSB 2ZQYA 1WZIA 2O4UX 3D4PA 2VNAA 2ZYDA 3OEYA 1QLHA 1R6DA 5JBIA 4U8GA 3D64A 4UULA 5JDIA 4J2HA 2WTBA 4R1TA 4XQEA 2Y93A 3OHSX 1NPTO 4PG7A 2DUUA 4AJEA 1E1NA 4FFPA 4PLGA 2PLAA 4QX6A 2D4AA 4IGFA 1U3TA 2X5KO 3DBLA 5EN4A 3WMXA 2OHXA 5A9RA 2TMGA 1X0XA 3JD1A 1C1DB 1LQTA 3WS7A 5TSDA 3DTTA 1O94A 4YPOA 4HKTA 1PJCA 4YAKA 4Q3CA 2IZ0A 1SPXA 2Q1SA 4CMCA 4WOJA 3GC6A 1OBFO 5AYVA 2J5KA 4KZPA 3GUCA 2Q2WA 1E3EA 3CZRA 3W4IA 1D7OA 4BO1A 1MGOA 3R1IA 1WDMA 3STHA 2VTDA 3H8VA 1X7HA 2RH4A 2AQKA 3ZV4A 4YBZA 2C82A 1RWBA 3S1LA 4GBJA 4J1TA 3LT1A 3UFXA 5GY7A 1PJ3A 4PLPA 1L1FA 4A0SA 1V9LA 3RSHA 3L4SO 3RUHA 3PHHA 2OXIA 3EY4A 4O0LA 4EYEA 4IDCA 4MKRA 4NR0A 3H9JA 1P0CA 1LLUA 3WOHA 5AXAA 3JQ6A 4AJLA 2D8AA 4OXKA 2CMDA 4MIYA 1G6KA 3BYZA 4J7XA 3UUWA 1YQDA 4TZTA 4K1LA 3EYWA 1Y5RA 1XQ6A 2WEKA 3TZHA 1WXDA 2IE0A 1M76A 4LISA 2FPGA 1XCBA 3FBGA 3DAPA 3GVHA 3Q11A 3A9WA 4P38A 4PLCA 3ZNPA 5G4LA 1KC1A 1PL8A 2HLPA 3QWFA 1HLPA 3JQ7B 1UP4A 3WTCA 3ZWMA 4KUHA 2UV8A 3G1TA 4GH5A 4J9VA 4BO3A 3PLNA 2QQ5A 1QG6A 1YL5A 1ENZA 4U5QA 1IYZA 3G79A 5T8KA 5ER6A 2IDZA 2CSUA 2LDBA 1HEUA 4MP8A 1BHSA 3JSAA 4LMRA 1GPDG 1KEUA 3ST7A 3C85A 2HDHA 3MWEB 3ZWXA 1CQIA 4A7PA 1YBAA 4CUJA 5CPBA 5JC8A 2O3JA 3DZGA 4GSLA 2Q4BA 4W99A 3ZWYA 3AY6A 2X0RA 4E0BA 4EJMA 1X0VA 5TIIA 1T2FA 3OEWA 4XRRA 1Y6JA 4ZA2A 1JKJA 5EQDA 1ZIDA 4CMHA 3GH3A 1UXJA 3RUEA 1DDOA 1XLTA 3NV9A 4HFMA 1I8TA 1YWGO 2YHIB 1LRJA 3GUYA 4QXMA 2G76A 1HE3A 4L8VA 3TNLA 1NXQA 1YDEA 4ONEA 2QG4A 3VAZA 2H9IA 4JROA 3NJ8A 3PJGA 3SX2A 3GK3A 3LC2O 4G2NA 4B4UA 1EK5A 1JKFA 1WLYA 1S6YA 4GVLA 1C1DA 3JYLA 4DXHA 1V8BA 5F1OA 3W4JA 3AFNA 4XIYA 1T24A 2GNAA 4E21A 4WNIA 1IHXA 3OA0A 2VTEA 3ANMA 3JD4A 3ROKA 3WGGA 4D43A 5C7LO 1K5HA 1DC6A 4F46A 1ENPA 4B3HA 2BFOA 5F21A 3ZHBA 1I2BA 4CM5A 1T2CA 3NRCA 1X7DA 1ZSNA 2R6JA 3AJRA 2GDZA 2V7PA 3PQFA 3U4IA 5JY1A 3DB2A 5U4QA 1L7EA 2X1HA 2X8LA 2I99A 3KB6A 4ID9A 4IQ8A 2FOIA 5GZ3A 1U3VA 1NR7A 4ND4A 4PCVA 4OXNA 1U5CA 4PG8A 2GF2A 2D0IA 1HE5A 2JHFA 3I9LA 4CL3A 4DMMA 3L9XA 2DPHA 3GN2A 2OORA 3K6JA 4FGSA 4GAEA 1EBFA 1UAGA 4E30A 5BNFA 3MOIA 3TZQA 3PIIA 1I3KA 1O8CA 1WDLA 4HX5A 2B4QA 1XU7A 4RPJA 3RFXA 4CV2A 1E3JA 4E2ZA 4EI2A 4LK3A 3ASUA 1OFGA 3RUDA 5A1TA 2PGJA 1J5PA 2NQTA 4XKJA 1DFHA 1DIAA 3JQ7A 4YACA 4GX0A 1ISJA 4KDEA 1P44A 2BH9A 4L76A 4F6CA 3C7CB 5CDSA 2HSDA 4TRJA 2WSBA 3GGGA 3RC9A 3ZWWA 1Y9AA 2HMSA 2IEBA 4MOWA 2DTEA 2ZTLA 3CH6A 3BIOA 1I30A 4WE3A 1Z45A 2FN7A 1NNUA 1PS0A 1RM0A 2OBYA 3IP1A 2CD9A 4QT0A 1DIRA 4CLRB 5KCZA 1PGNA 5BSHA 5JSFA 3OP4A 1PIWA 4PFJA 4E2WA 3L6OO 2CFCA 1EDZA 3M2PA 3PDUA 1LRKA 1PTJA 1P1IA 4IINA 2YHIA 2P4HX 1M6WA 2NVUA 1CQJA 4GLOA 4CV1A 5HS6A 1BTOA 3AWDA 3EGOA 4XD2A 5ICSA 2C0CA 3FTNA 3L9WA 1HYEA 1PQUA 3HG7A 4W9NC 1PEDA 3V8BA 1HSOA 1I33A 4Z9FA 4IDDA 4AJHA 4DC0A 3INGA 3QIVA 2Q49A 3BAZA 4UVGA 1ZZEA 1I3NA 2R00A 4E4YA 2OFPA 4BNLA 3UCXA 3NEPX 4OOFA 1YONA 2QYSA 4YDRA 1LU9A 3IDSA 1EVJA 2C7VA 4G65A 1W0CA 1WZEA 4R1NA 1HF3A 1BDBA 4DQVA 4MO2A 2IYPA 2JAHA 3T4XA 5COQA 2HMVA 3RQSA 3H5RA 3R3SA 1E5QA 4CQMB 5DP2A 5L45A 2YV2A 5HWSA 2UAGA 1GCOA 2PGLA 4NMHA 5HM8A 3GPIA 3WICA 1YGYA 1C0KA 5DOZA 3N74A 4NH4A 2B5VA 2PNFA 4J4HA 4PZCA 1PGPA 4XA8A 1ZSYA 1B26A 2W90A 1QXSA 2VYNA 3QWAA 1H6DA 2R2GA 4RF5A 3SLKA 4Q39A 1F17A 4URFA 2CUKA 3WQRA 3UHAA 2CF5A 1XDWA 2Y1FA 1RYEA 3DZIA 3S2FA 1P1RA 3BTVA 2C5EA 4Z9YA 1NP3A 3GF4A 3RC2A 2HAEA 2HRZA 4BGUA 3F4LA 4IDEA 1NTOA 1LUAA 3ZWNA 4XYLA 5IDQA 5FEUA 3HDYA 3JQAB 1GV1A 2NTJA 1FK8A 1E6WA 1GCUA 2FPIA 2DBQA 2VWHA 2Q45A 3ADPA 4PLHA 1YDWA 1Z82A 3VZRA 2A35A 4CL8A 2B0JA 4IPTA 3KUXA 1QRRA 3K2BA 2FY8A 2GUGA 3DZHA 4MVJG 4GX1A 4Y6SA 1SBYA 1M67A 2GZ2A 4Y8VA 1K3TA 4CODB 3NX4A 1I0ZA 4XB2A 1IOLA 4IJWA 1GUZA 4OIMA 4XQCA 4GMFA 4J4TA 2G0TA 2DTDA 2VZ0A 1A71A 1U4SA 2O48X 1QP8A 2VRBA 2V6GA 3GMDA 3ZI0A 2BELA 1X7GA 4GMGA 2Q46A 4FJ1A 4YWJA 1JWBB 3ENNA 3DBHB 3I6IA 2VRCA 2OGUA 3E9MA 5AQ1A 5K9ZA 2UUPA 4TWRA 3RAJA 4WLUA 1UZMA 1QSGA 3OIFA 4CQLB 1LDBA 1R15A 2B36A 3OICA 4UVEA 3U4DA 4BVAA 1DC3A 3ETEA 5G0TA 3AM4A 3K30A 4DLLA 4RPKA 1ISHA 4N54A 3RVDA 2YDXA 4Q3DA 1J4AA 3VH4A 2O3TA 2GCGA 4E5NA 3KVOA 3BMNA 3W4KA 3VPHA 3UN1A 1CYDA 5G0SA 5JDIC 2EV9A 4KQWA 5JMWA 3AUAA 1UUFA 3KHUA 3R3JA 1E1LA 1U8FO 6ADHA 2RIRA 4R1SA 2NU7A 1NR1A 3QE3A 2DBVO 2OP1A 5CG1A 4CQMA 2XXJA 1VL0A 4O5OA 2AXQA 5G0VA 2XXBA 3V1YA 4DRYA 3ETGA 5HTOA 4NK4A 4XGNA 4D3SA 2O3RA 2P5UA 3FTPA 4WEOA 4AJ2A 1GYQA 4L4XA 3IKTA 2J5QA 4GPD1 3UOGA 4J0FA 3GVPA 3SVTA 2P9CA 3RC7A 4BS9A 1Q0LA 2P9GA 2Y0EA 4NDNE 3X2FA 1JLLA 5THQA 1GV0A 3QWHA 4JN6B 3H3FA 5GZ6A 3Q0EA 2Y67A 3H9QA 4XEHA 4NG5A 1H2HA 2IODA 3HQ4O 1B15A 3JQAA 5JAQA 4L4SA 3RBVA 3U4HA 1N2SA 1H93A 2CF6A 4J1SA 3EUWA 5BSFA 5KJEA 3ONEA 5A04A 3GVIA 1GU7A 1PJTA 3AK4A 2BGKA 5FYDA 1TT7A 2P2SA 5I9NA 1NWHA 3WJ7A 1BMDA 1YOVB 2I65A 3NUGA 2HU2A 3GGOA 3BMQB 4R3WA 5DF1A 2HKIA 1MC4A 2PKQO 3DZFA 2ZYAA 3DEYX 1ISMA 2ZYGA 4CM1A 1Y9EA 1N7GA 4WOKA 1P31A 1NASA 4CLEA 4DL9A 5TNXA 2Z1MA 3ANNA 1A7AA 3JQFA 1ENYA 4XWYA 3NTQA 4CV0A 1O9BA 2VWGA 3FI9A 3GNTA 2WYUA 2GZ1A 1A5ZA 3W1VA 1LDYA 1ORRA 2X9GA 3PFFA 1PR3A 4IGEA 4AJNA 3Q3CA 1HSZA 2VNSA 4BKPA 4MP3A 1X15A 2EP5A 4IJKA 5T8KC 1E7QA 4FCCA 2D1YA 4O6VA 3UGKA 1GFSA 4FC7A 3LF2A 1NQTA 5DBFA 3DHYA 2O7QA 3DMYA 4KDFA 4Z0TA 4MVJA 5AOVA 3EZLA 4CQLA 4HFJA 1DJQA 3BZUA 4NQZA 1ISIA 3WSVA 3ZWCA 5L7TA 1N92A 1AUPA 2QRLA 4TRNA 4BO6A 5FWNA 2JCVA 1E0DA 2DTXA 2NM0A 3BMOB 4PIVA 1E5LA 4GKBA 4Q3AA 4A73A 4LN1A 4BNMA 4BL5A 1NVTA 2W2KB 2JHGA 2B83A 1DC5A 5DCYA 1UZLA 4JP2A 4UVDA 1UP6A 3ZU5A 2PR2A 3P7MA 3L6EA 2YZ7A 4LRTB 2Y1OA 3ABIA 1P77A 4AJ4A 3KETA 3DDNA 3O8QB 1QKIA 1JU9A 1KETA 3ZWAA 1DRUA 4BB6A 2WD8A 4QO8A 2J3KA 3QRWA 4IQ0A 1NFFA 1R4NB 3CUKA 4MJLA 5FF9A 2JD0A 5BSGA 3AU9A 4PLTA 1PS9A 4L74A 4BHTA 4YT5A 1B3RA 1C3VA 2WJPA 4JP3A 3GVCA 3ULKA 3KBOA 3DZKA 2DKNA 2GR9A 4GGOA 1J0XO 5TJHA 1ZH8A 3LU1A 3RU7A 4DWVA 4CM9A 3D5TA 4DPKA 2VUTA 1Z75A 1U3WA 1WPQA 5A03A 2D5CA 4R9RA 4RQTA 3U4CA 2RH8A 3ZNOA 1K89A 3ZDFA 1ADBA 2O7SA 1QYVA 3A28A 5LC1A 5TQVA 3TFQA 1ZEJA 2CDBA 2E82A 4OGWA 5KWEA 3GN1A 2I3AA 4OJNA 4RLSA 5CP8A 4BO5A 5JO0A 3PGJA 2DVMA 3HB4X 1VJ1A 3LSYA 5EERA 3VC7A 1TVEA 1VPDA 2C2XA 1A27A 2JL1A 1SNYA 4KWHA 3PIDA 1YOVA 1XGKA 2G82A 1DAPA 4I5FA 3BMQA 2EW8A 3JQ9A 4IS3A 5BNIA 3HE3A 3ICCA 1F06A 3PTZA 2WE8A 4XJSA 4BMNA 1XSEA 5F5LA 3I5MA 1EUDA 3AW9A 4U7WA 3ETDA 5DCUA 2BMAA 3AY7A 4OQZA 4YJDA 1NHWA 2UUOA 2J8ZA 5HBRA 4I1IA 3HADA 3OIDA 3I23A 4WNCA 4YYZA 1MFPA 3ZU2A 1LSOA 3E82A 4ZQGA 4YB8A 2NLOA 1IY8A 1BRMA 1KC3A 1ZXBA 2OMEA 2VWPA 2VYND 4DIOA 5JDCA 4IMRA 1E6EA 3VPFA 1BVUA 1PQWA 4PN3A 4I9UA 1MG0A 4K6FA 2FWMX 2WDZA 3FCOA 4EUEA 2Y66A 4FFRA 4HUJA 1PGJA 4BGEA 1KERA 3BMOA 3PJFA 3IQDB 2VT2A 2GRAA 4J4BA 1VRWA 4AJIA 1A9YA 1DOHA 2P68A 1ZMTA 4FW8A 2W2KA 1ZMOA 1P45A 4DVJA 2DU8A 2Q50A 4CLOB 3HNPA 1O0SA 5L51A 3QP9A 3WX0A 1HE2A 3QLJA 3O8QA 1HYGA 3ON5A 2EERA 1XR3A 3ROMA 2VUSA 1QV6A 2PK3A 1DBVO 2XAAA 3NT4A 4FIZA 1EQUA 1R4NA 3TQHA 4CMKA 3OM9A 3U5TA 4EUHA 4EW6A 2FR8A 4JX8A 2R00C 3KM0A 4KP7A 1A9ZA 1UAYA 5EJ2A 5A02A 1VM6A 5ITVA 1EE9A 5EESA 2RCYA 1U2GA 2BKAA 3DHNA 4M55A 1ENOA 4DBVO 3CZMA 1XKQA 3D5QA 3OQ6A 3S55A 3WNQA 1KVTA 3MOGA 3OECA 5EPOA 3PGXA 5B1YA 5KVSA 4TSKA 4PG5A 1NAIA 2VRCD 3I52A 1B8VA 2RHCA 3NGLA 4MDHA 4E13A 5A5FA 2EEZA 3G1UA 1VI2A 4IBOA 4UUPA 2P9EA 4YJHB 2PKRA 3WGQA 3K9QO 4CLHA 1NX6A 4Y6PA 5IXSA 2VZ9A 2OOSA 4RZIA 3HJAA 3RKUA 3WGYA 1KS9A 3A4VA 4E33A 1C1XA 1PJQA 1HDZA 1YB4A 1E7WA 3V2UA 3BHJA 3MJ4A 1KBZA 4FC6A 1PGOA 3QQPA 4BKQA 3GA0A 3AU8A 4QO7A 1SO8A 1XWFA 4IIVA 5H83A 1ONOA 3VOSA 2OBNA 2IZZA 1QR6A 4IDBA 3ZW9A 1GADO 1RM5A 3C1OA 1LLCA 4W7IA 5DOVA 5F1PA 3RUCA 4BMVA 1O95A 1Q1NA 4DPMA 3RJ9A 5JNLA 2V65A 1P33A 4ILKA 3LDHA 5JYDA 2X58A 3K92A 2FZWA 2YY7A 4NU5A 3ZV5A 4CQMD 1ONNA 4XYMA 5JS6A 3B1FA 4GQAA 3ZWBA 1NFQA 5AXDA 2NVWA 4WECA 4F3YA 1ZEMA 4WLNA 4CR6A 3ZWPA 1Y5MA 5LDGA 1HKUA 1ARZA 1I32A 4FFOA 4E3ZA 3GMSA 3OJ0A 2AEMA 1B3BA 4DGSA 2DQ4A 2JFGA 2HMTA 1UJMA 3AOEA 4H16A 3WR5A 1PJBA 1HDYA 4GKVA 1K6IA 2WMDA 2VHZA 3PQDA 4KUEA 2EXXA 5ER9A 3E1KA 3JQAD 4FD3A 5COBA 4E5PA 3KYBA 4GWKA 3NDIA 4DUPA 4OYRA 3OF2A 3PWZA 2Q2QA 5JPIA 3JQBA 4CUKA 4CM3A 4CLOA 3AI1A 2H1SA 2RBEA 4XJTA 4RO0A 4A5OA 3PFWO 4JJGA 4A2CA 4D45A 4DLBA 1NM5A 1YVEI 3EHEA 3Q1LA 4B4VA 1LNQA 1SB9A 1PL6A 1GY8A 5EL0A 5TRTA 2HK8A 4BO2A 3E03A 4MIOA 1ID1A 2O4CA 4F45A 5A5EA 2E4AA 1Q0QA 4QFCA 1IL0A 4YRBA 3PPIA 2FP4A 1PJLA 4C7KA 4K9DA 3U09A 2NVUB 3SC6A 2DM6A 1PZGA 3OA2A 5ILGA 1C0IA 2X5OA 3GDFA 2FSSA 1XG5A 2NU9A 4P8RA 5U9CA 1LLDA 4BNHA 2E49A 4C4OA 4J2OA 1GQYA 4EGFA 2PH5A 2Q99A 3R6DA 4ZQEA 1LI4A 4YRAA 1EMDA 3NYWA 3L6DA 3DAGA 1D4FA 3PEFA 3GGPA 1DHTA 3FD8A 4HP8A 4MVJD 4YJHA 1SCUA 3WGHA 3HWRA 3VTFA 4CM8B 3E8XA 3U3XA 3KLPX 3E48A 3JV7A 4Z0PA 3TSCA 5CDTA 2GGSA 5IZCA 3DZBA 4Z3DA 4L73A 4BOYA 1E7RA 3WXBA 4YT8A 3VDRA 1IUKA 2X0NA 4RZHA 3H9GA 2AG8A 3QVOA 1N1GA 5K6AA 5J23A 3VPXA 5I9LA 2BFMA 5THKA 3SLGA 1D1TA 3PZBA 3U62A 4RQUA 4NFSA 3F5QA 4PG6A 1IULA 4R01A 4XQ9A 5L95A 1WWKA 4XCVA 1KEWA 4EJ0A 3OFSA 4D42A 2XOXA 3UAGA 4NI5A 1A7KA 1T4BA 1H2BA 1NHGA 3JCZA 2JD1A 5H82A 3I9KA 4BNKA 2Y99A 3PP8A 5DNAA 3IIEA 3ZW8A 4XYEA 1NQOA 1ADCA 2HRBA 4CMJA 4ALKA 3VKUA 1SZJG 2VHWA 2NU6A 3M6IA 3JQFC 5GMOA 4CM9D 5JCJA 1X14A 4FJ0A 3MCVA 1YXMA 1R66A 3SC4A 2FHSA 5T67A 3TF5A 4OHUA 4NBVA 4YCAA 1KEPA 1HLDA 5HS4A 1EVIA 3FR8A 4RVHA 1OI7A 1EZ4A 4LCEA 3TZKA 3Q6IA 3E9QA 3TFOA 3K5PA 4MVJE 5KNLA 5C3MA 5JLAA 2VT3A 1AGNA 4AJKA 3KSUA 5TGDA 1UR5A 2HMUA 1AXGA 3OIGA 2POQX 1KEVA 3GY0A 3GDGA 1M6HA 3DOOA 3W8DA 1YJ8A 1ZKMA 3HFSA 5TX7A 1T2EA 5EQFA 1LC3A 3G3EA 5BSEA 3HFGA 1EE2A 1XIVA 2JJYA 1FDVA 4CM7A 3QVWA 1HL3A 1ZK0A 3VH1A 3TJRA 4XYBA 2GASA 3P5SA 1W8DA 3DBRB 8ADHA 3M1LA 4W6ZA 1PS8A 2GPTA 4OKNA 4YJGB 2GLXA 3F46A 2DAPA 1F8FA 2QRJA 1XHLA 3PYXA 4S1VA 4DPLA 2YYYA 3C3XA 1NQ5A 4BNYA 1B7GO 2PZLA 4XR4A 5ENVA 2QIOA 1LDEA 3WGOA 2GZ3A 3BMNB 3ZWVA 4CM8A 3WSWA 2RHRA 3GAZA 4FOSA 3FNEA 3PI7A 1PL7A 3GQVA 1I5RA 5KOIA 1B16A 4FJ2A 3WWZA 1MLDA 3QA9A 4WCDA 2DUWA 1HDOA 1U7HA 4WEQA 1BXZA 1ISFA 3LT0A 4P22A 3JD2A 3UCEA 5L4LA 1RKXA 3FWZA 2HJRA 1Y1PA 2GSDA 4FPXA 4BNFA 3EDMA 4A26A 2IZ1A 2PV7A 5KTKA 2CVOA 4HY3A 2IRWA 3D3WB 3FSRA 3M1AA 4J9UE 4E32A 3BMCB 1ZVMA 3H6KA 1K6JA 3D4OA 3JQ9C 4BV8A 2Z5LA 2J3HA 5T6BA 3IKVA 4D7AA 5A9TA 3E5MA 3FPCA 1R37A 4MKZA 4NHEA 1E1MA 2CNBA 5A3JA 1E7SA 3D0OA 5TLSA 2J3JA 2X23A 1JA9A 3OJLA 4E6PA 5CEJA 4JJIA 2D3TA 3PHGA 1T1SA 1KVSA 1GUFA 2H63A 1MX3A 4ZD6A 5A9SB 4WKGA 2IEDA 3AOGA 2QYTA 4FGWA 5JDCC 2IYOA 4UUMA 3H65A 1HZJA 3I9JA 4R69A 1YL6A 2RAFA 1LA2A 3MJEA 1IB6A 2BFAA 3GZNB 1J6UA 3TL3A 3RI3A 3HDJA 4XGIA 3JYPA 1BGVA 1GQ2A 1AXEA 3GRKA 1EFLA 4TMFA 4WASA 3C7DB 5KJCA 4I9NA 4IY1A 2F00A 3DR3A 1NAHA 1PZFA 1KVRA 5EIOA 2WWRA 1HDXA 4E31A 1B8UA 1CEQA 4AG3A 2Q1TA 3X2EA 3C8MA 1V3TA 3F1KA 3DBRA 5C37A 3FNHA 4PG4A 4DREA 1QYWA 4HV4A 4M86A 3MJCA 4YJGA 4ALLA 1NPYA 2O3UA 2PZMA 3IAHA 4LGVA 3L4BA 4YAIA 2AQIA 1JWAB 2AHRA 3E9NA 4OSOA 3ZN2A 1IPEA 3VH3A 4FS3A 1V3UA 2P91A 3G0OA 4AJJA 4N7RA 1KY4A 1XU9A 3WQQA 5B12A 1KIFA 2QZ9A 3DXFA 4IZIA 4ND2A 3HDQA 4P4LA 4PRLA 1A4IA 1Z6ZA 4M89A 4RDIA 1WAMA 5JAIA 3EW7A 4XYGA 4RGBA 5DDIP 3I4CA 1BG6A 2JKVA 2C5AA 2WYWA 1VKNA 1B0AA 4R16A 5F5NA 1CJCA 4J1NA 2X9NA 2CZCA 3LZ6A 4ZVVA 1MFZA 4R9SA 3WDSA 1N9GB 4BNJA 7MDHA 5GZ1A 4J6FA 3DFUA 3PWSA 4E5KA 3D3WA 2YQ4A 3AI3A 3H9EO 4EDFA 1LC0A 2G1UA 3BMCA 2GD1O 2C29D 3TPCA 3BHIA 4DC1A 4S3MA 5KKCA 1DC4A 4BQPA 4L9RA 2UDPA 4Z0HO 2J6IA 1U9JA 2ZK7A 1R4MB 4I8XA 3ENKA 4PLYA 4FBGA 5A3VA 1VJTA 3JD0A 1E6UA 3LF1A 4B7XA 5IN4A 4NJOA 3O26A 1IE3A 3WNVA 1BW9B 3H4VA 1EBUA 4Z9XA 5A05A 5DULA 1LTHR 2FZEA 5G2OA 2WE7A 2WM3A 4JXKA 1OMOA 3H9UA 5A9SA 1KOLA 2JD2A 4B3IA 2QX7A 1UDBA 2ZB8A 3K73O 4RVDA 4PRKA 3NT5A 4YAEA 1B2LA 4ND3A 4CMAA 2EKQA 3OJFA 2Y1GA 1YB5A 3JYQA 4TQGA 3AOEC 1F14A 3GZNA 5TT0A 2FMUA 3PDJA 9LDBA 2X9VA 4Q3EA 4L75A 3GDOA 1TEHA 5KIAA 3K8ZA 3ONDA 1N5DA 1M2WA 2PD6A 4J90A 3LC1O 1O5IA 1F12A 3JYOA 4EUFA 3WLEA 2HQ1A 3GNQA 5JC1A 2EW2A 4J1QA 5ES3A 3UCFA 1YH3A 1U3UA 3JQBC 4EBFA 4O59O 3NTRA 4QECA 3D1LA 4RVUA 2H5LA 1WMBA 3NAQA 3MJTA 3TRIA 1C14A 5JAZA 2JAPA 4BB5A 2CVZA 4TRRA 1DPGA 3KRTA 1HETA 3H2ZA 1Y7TA 4JQCA 4XQGA 5CHEA 1XELA 1CRWG 1TI7A 3QWBA 1W6UA 4BNVA 5JCJD 4MVJI 2QRKA 4K26A 4M54A 2ZKLA 3B20A 1JQBA 3GVXA 1DRWA 5C7IO 1K2WA 2WD7B 6LDHA 3F3SA 4INAA 3LVFO 4ZN6A 5I7FA 3JD3A 3WFIA 3IJRA 3TL2A 1H6AA 3NT2A 1R0SA 1X1EA 4ALNA 4EJ6A 5I7VA 4BKOA 1PSDA 4P4NA 4BGVA 1U5AA 2CDAA 1U1IA 4RF4A 1NVMB 1N9GA 5CDGA 4F6LA 5U1PA 1H0KA 5IZCC 4I5GA 4I5EA 3V1UA 1XEAA 3ASVA 4DYDA 5L40A 2O50A 1Q0HA 1YO6A 4LCJA 3OBBA 3KLMX 1HWYA 2F1KA 1LSSA 1H9AA 4H3VA 5K6AC 1I3MA 1YBVA 1LDNA 2ZB4A 3B1KA 1V35A 4WLEA 3LLVA 5FI5A 5H81A 3ZHZA 3PWKA 5CDYA 3ZNQA 4XRGA 5IDWA 1R4MA 3K96A 4TRMA 4PVCA 4U6QA 2EJVA 3T7CA 3WTBA 4ZGWA 3GFGA 3ZHXA 4DYVA 1P1HA 1ONPA 4D46A 1ADGA 1D3AA 2X5JO 3EVNA 3ITKA 1BW9A 4BO7A 1C1XB 2OZPA 1ZK4A 3P19A 2W98A 5DBIA 4WUVA 1YRLA 4B3JA 1SEVA 1XA0A 1LLQA 3O38A 4ND5A 3EK2A 3C24A 2D2IA 3Q2IA 4R41A 1UXIA 2J3IA 4RDHA 4XX0A 3RFVA 3M2TA 3ZWOA 4BQRA 4DA9A 3WG9A 1LRLA 1QLJA 2HJSA 2PTGA 1I24A 3NKLA 1YQGA 3QVXA 4FFMA 2BRUA 4M8SA 2BD0A 3A06A 1HRDA 4Q3NA 2DFVA 4BNGA 5BQFA 5KJ1A 1F0YA 4E12A 2GN8A 1AHIA 4DMLA 4HXYA 3JYNA 1SAYA 4IQGA 1GAEO 4YR9A 4JNKA 3F5SA 3T7EA 1Q7BA 4ZU3A 1WNTA 4ZJUA 1E1KA 2Y0CA 1GYRA 4JGBA 1TLTA 2BI7A 1B14A 2BFPA 2PGDA 3KTDA 2AQ8A 3BA1A 1LEHA 4OQYA 1DB3A 2A92A 5IZ4A 3VVBA 1U4OA 2JCXA 5FFFA 1FJHA 4KUGA 3MEQA 3WBBA 2NUAA 1UDAA 2AEJA 1LBEA 3L0DA 4HBGA 5T64A 3AFMA 3IP3A 1KVQA 4LVCA 1GZ4A 3VDQA 1R16A 2V6FA 4NBRA 4OMUA 4P4GA 4D0SA 3FRJA 3U0BA 4GL4A 4JCOA 1DRVA 3DZJA 4ZRNA 2WD7A 1NQAO 1YBMA 5DP1A 4IXWA 1KVUA 1MUUA 4IS2A 2B5WA 1Z7BA 3IJPA 4BO8A 4CV3A 5A06A 1Y81A 1G0OA 3VZSA 5LCXA 3IL2A 1NWCA 4R5HA 3I83A 3DQPA 3IC5A 5B4UA 4PGFA 2VOEA 2UYYA 4JJFA 5CEFA 1MV8A 4GSKA 3WBFA 3C1AA 1R0KA 3C1TA 1EEHA 2IXBA 1ZW1A 2VZ8A 4UUNA 3BTSA 4JK3A 5IF3A 2PKQP 1BWSA 4TZKA 4FR5A 3N58A 2JCYA 2NTNA 5I9MA 1VJ0A 3GR6A 3WB9A 2ZCVA 1I2CA 4I5DA 1JVBA 1QORA 3D3EA 5MGBA 2AMFA 4UVIA 4YAGA 3L77A 3CMCO 3F4BA 1PJ2A 3I6QA 5KJFA 3C7AA 1K6XA 5BNTA 4U0JA 2GYYA 4O63O 3F1LA 2NQ8A 4IM7A 2Y05A 5IDYA 2BF7A 3GEGA 4NU6A 3NJ4A 3PVZA 2EKLA 2GERA 2BGMA 2PZKA 5L53A 5L4NA 5A4DA 1F8GA 5B37A 4NIMA 1QYXA 4DQXA 4MINA 2J5RA 3H2SA 2FR1A 5ITWA 2HMWA 4II3A 3DO5A 2NADA 3QSGA 4WJZA 5F3RA 4RPHA 4UUOA 3JTMA 3RCBA 1HT0A 3HB5X 5CPFA 3VZPA 4I9HA 4FFNA 1QMGA 1AN9A 1MA0A 4YEDA 5ENDA 4AJ1A 3NDJA 4JBIA 1K0UA 2ZB3A 2H6EA 3GFBA 4L0QA 2V6MA 4K6CA 4QTZA 3ROPA 3V1TC 3EVTA 1SOVA 3KZVA 4RORA 4WLOA 4BNIA 1EK6A 1FXSA 1YE3A 4HWKA 4B79A 5JXWA 3KOUA 2Y1CA 2XPCA 3V5NA 3RD5A 2EF1A 4ALMA 5JCXA 3RUAA 5IN5A 4JBGA 3GHHA 4N5LA 1T2DA 3LYLA 4W7HA 5TF4A 1GZ3A 4BNXA 1T4DA 1DIHA 4RPGA 3VKVA 2O2SA 1TXGA 4CMBA 1GEGA 2ZQZA 3ZU3A 1HDGO 1FDWA 3FHLA 4J0EA 2ZCUA 1DFGA 3TWOA 3RKRA 1P0FA 2C07A 2ZTVA 5CDUA 3OJEA 1WVGA 4LMPA 4G5HA 4NBWA 3S8MA 3EAGA 2FR0A 3WWYA 2DFDA 3FNGA 4D3FA 4TVBA 3WFJA 2EJWA 1E92A 1GDHA 4RPLA 4YQZA 3ZGYA 5IDXA 4W4TA 4BNUA 3PRJA 2DBRA 2GN4A 4Y67A 2HK7A 3ZV3A 3QW2A 3I9NA 4CMIB 5I8ZA 3L4BC 2G17A 1E3WB 3VPGA 3KV3O 4MVJP 2B69A 4YT2A 2VN8A 5AVOA 1KYQA 1P1KA 2EHDA 1VLLA 3GEMA 1ZK1A 2YQ5A 1PZHA 4BKRA 2NACA 1I01A 2X86A 1JN0A 1PGQA 1D8AA 3WYEA 5DT9A 4HADA 3ROQA 1ZSVA 1IZ0A 3WIEA 1MG5A 3GHYA 3QY9A 4WCFB 1ADFA 2C54A 3OQ1A 3W8FA 1RJWA 3E5RA 3PHIA 4B8WA 4DLAA 1Y8RB 4BNWA 1RM4A 2A94A 3P2YA 5I8WA 3TZCA 2OUIA 5KJ6A 3MTGA 1R12A 3WMWA 1HDCA 1MXHA 3QJ5A 1LSJA 2NTVA 4L4RA 4B7CA 3DOJA 3N7UA 3BXXA 1JW9B 2A9FA 4A10A 1KY5A 2VUUA 3CXRA 3QVTA 5FI3A 3QVSA 4N5NA 3KO8A 3I3OA 4AL4A 5CFZA 4M1QA 4CMGA 2X22A 1GTMA 1GQQA 3ZH2A 2I67A 2NNLD 1SEPA 4GGPA 2TMDA 5JFOA 1V0JA 2FPPA 4LSMA 1MP0A 3CMMA 3S2EA 2EIHA 1BSVA 3ONFA 1JAYA 3SBOA 1CF2O 3AM5A 3CINA 4R5MA 4A03A 1EDOA 2Y1EA 5JW6A 4ND1A 3SJ7A 4RVGA 5CG2A 3DMTA 1NYTA 1MXFA 3PHLA 4J16A 5JE8A 4RCVA 1XYGA 4C7JA 4CMEA 2CDCA 3S2IA 1PU2A 2YUTA 5L7WA 2VQ3A 4IJUA 4TVOA 1H6CA 1N8KA 4H7PA 1CERA 3KEOA 5BT9A 2DPGA 1VSVA 3Q9NA 4AJOA 3PJDA 3JQ8B 1W4ZA 4CLXA 2AE1A 1DJNA 4HFRA 4II2A 4UAGA 4D44A 1RPNA 3FN4A 3RUFA 3EZYA 4CR8A 1EUCA 1ZJYA 5T57A 3PZRA 3QV1A 2I66A 4M87A 1JDJA 1RYDA 1YS4A 2W2LA 3WLFA 1PQPA 3H7AA 2I9PA 4OXYA 4MVJF 2Q1WA 3H5AA 1UH5A 2PZJA 2SCUA 2VHYA 1IPFA 1UXHA 2VYVD 1LXCA 3I9OA 4OM8A 3B1JA 5IFLA 3PK0A 4RJTA 2GN9A 2UVDA 4LW8A 3VVCA 4PZDA 1WMAA 4MKXA 3UH1A 3KYCB 2HUNA 3W6UA 2C20A 3RC1A 2EP7A 1HYHA 1M66A 1OZAA 1EFKA 4CMIA 2B37A 2Y1DA 5IG2A 1E3WA 3DAFA 3KYDB 4W82A 3V2GA 1BVRA 1UP7A 4PLWA 4UEKA 4TROA 1GEEA 2Z95A 4YRDA 3TOZA 3GZ4A 4IDFA 2O3QA 3WJAA 3DC2A 3F9IA 4R54A 1H6BA 2BI8A 1S7CA 5G0UA 3KXDA 5EINA 3HN7A 1ZFNA 3FR7A 1PJSA 2X4GA 2YV1A 2EGGA 3CKYA 2ZATA 4WCFA 1Q7GA 2P4QA 4E2XA 1Y8RA 1CETA 1ZK3A 5COAA 1AE1A 1NPDA 3WGZA 3UW3A 3VH2A 4AVYA 3O9ZA 4KWIA 4OH1A 1YQXA 3W6ZA 3ORFA 5JYEA 1SOWA 4BO0A 3ICPA 5IAAA 1E77A 3ANLA 4PZEA 2B4TO 2OP0A 4BV9A 5L4SA 1ULUA 4BNZA 3MWDB 1BXGB 5TS3A 3I4FA 4QSMA 4TKMA 4IUYA 4Q9NA 1DHRA 2VOJA 3WYBA 1I10A 3HDHA 5ILOA 3JQGB 4R51A 1R0LA 1PWXA 1VL6A 2GO1A 4QEDA 2HO5A 2JFHA 3LT2A 2FRDA 2Q2VA 2NVBA 3NDRA 1DIGA 4IDAA 4AJPA 5K0ZA 1ZNQO 4NBTA 3IUPA 2HCTA 4RLHA 3I9MA 4Y6RA 1W73A 3RBZA 2EGHA 5IXYA 1HZZA 4NK5A 1DIBA 1EQ2A 1NVGA 3K2EA 4OKIA 1P1JA 2NV6A 2Y0DA 4BNNA 1E3LA 3FPLA 4QQRA 2PD4A 3GRPA 4H15A 1ZK2A
chains in the Genus database with same CATH superfamily
2J3MA 2VBFA 1FDUA 3HRIA 4TKZA 1GZ7A 1AKEA 4PLZA 4LRWA 3C97A 3KU4A 2JF0A 1VHQA 4JLWA 5EZ5A 2HH9A 3BGSA 4GI2A 1OLUB 3OIYA 2PBFA 5AH0A 4CPDA 4RTSA 3JARA 2Q29A 1QE0A 3RFTA 2WPDA 2JJMA 1UIRA 1USWA 2GPWA 3I2KA 3ETNA 4ZWNA 3Q1KA 3T5AA 4G07A 4JI5B 1I4LD 5TJ9A 2AYZA 5REQB 4A0FA 2C59A 5DLYA 3RIHA 4DEVA 5A5VA 1CJTC 3IUMA 3C6ZA 1A7JA 1B76A 2P5YA 2WJGA 3O90A 1E4EA 1L1EA 1EQAA 2BISA 4EX7A 1VRCA 3HCPA 3HU2A 4YP6A 2H2FA 3IOEA 4RD2A 4WQMA 5KMGB 1UXOA 2MJLA 2QXYA 1EVYA 2R6R1 3SIXA 1EEXB 4YQEA 4G85A 3KYDA 3IDQA 1TFRA 3UKDA 1L5VA 2DRIA 3T4EA 5LWHA 2ZULA 3TDKA 2YDYA 4BO4A 1E7YA 4RVSA 4Q02A 1T8YA 5JO9A 2EG9A 1NFRA 1OU4A 3E3AA 1M75A 2RHDA 4MUBA 3ZHQA 4JI4B 3R8XA 2PFGA 4A0RA 3PFKA 4ESOA 4HQOA 3AM3A 3RSLA 4QRIA 2ZUSA 3L7MA 4FGUA 1TL7C 4E5YA 1V43A 2B4RO 4PHCA 3F8TA 3U7RA 3X1WA 5DZSA 1SQGA 4LSWA 3WNZA 2R60A 3QVVA 2XTJA 2ZRQA 3JRXA 3N05A 3HM9A 2Y68A 2GXUA 3PYLA 1GRRA 4Y98A 2J31A 4BUCA 1KU6A 2XECA 2G7ZA 2Z2ZA 4G5RA 3N7AA 4X1KB 1N0HA 5HTKA 4ERXA 4PLVA 3Q2KA 2GF0A 2RSLA 4RTMA 3LQYA 3FKQA 3GIWA 4UREA 3EIXA 3PYMA 1P2VA 4UTOA 4FUTA 5CB6A 2QUAA 4CN8A 1Z7EA 5C8YF 5AJHA 4LHYA 3L1HA 1PR5A 4ZHSA 2GN6A 4P4SA 1JG2A 1GRQA 5L7YA 1GN9A 4D74A 4PQFA 1GCGA 2C0PA 1NBMA 1IJEA 3I0MA 4RM3A 1H85A 2NIPA 2JGFA 1XCPA 3E15A 2XADA 2AOTA 2G04A 3TMYA 1E9CA 2BEUB 1G20E 2ZS9A 4Z2AA 4ON9A 4O3MA 1KXJA 1DKOA 2P5TB 2Q4EA 2JA2A 2P9TA 3TOXA 4E15A 2GESA 4FYWA 4KQ1A 1KDVA 3ZHOA 5ALVA 2PYZA 2DKFA 3ND5A 3EMVA 1Z07A 3HY6A 3K31A 4R2IA 3VQTA 3AY3A 3FNFA 1HNNA 2PQ6A 5C5IA 1QTRA 4G56A 4RF2A 4WGGA 2I6SA 3OJXA 4U2KA 2ZVDA 4WOBA 1B8PA 3VR4H 1U28A 4D0RA 1ECLA 4UQLA 3C4VA 4EY5A 1AHHA 4F2WA 4CUZA 4YLYA 2YFHA 3JQCA 2OAEA 3T3MB 4B2PA 5KEIA 1JXAA 3KJQA 2OQ2A 2GLTA 3NUQA 3GJSA 3GUVA 2F59A 2WWVD 3VR5A 2ZZMA 4KYIB 3QHAA 2VHUA 5KX5F 2P3OA 1SMKA 2I3GA 2AX4A 3BHMA 3HYLA 4PTZA 2D2XA 4BQQA 3QBVA 1R9JA 3E18A 3RS2A 4BFYA 4C5BA 4PZ9A 8LDHA 1GU0A 2ANCA 4U39A 3I04A 2ADFA 4ZAFA 1MEEA 1PWYE 3PL5A 4LEIA 1WY5A 3R23A 5ELXA 1OLUA 1TQHA 3IRVA 4UEOA 4CWAA 4YP0A 4G5YA 1GPJA 1PZEA 2YMQA 4GO1A 1U8ZA 3L92A 4DWOA 3RS3A 2WP8J 1CUSA 1P1FA 3Q3VA 1XI2A 2F8MA 2JKZA 2Q6TA 2X7HA 4J49A 3S0JA 4UJ5A 1I1HA 1MB2A 3DDZX 3DO8A 2VPTA 5REQA 1MB3A 1ORHA 5FWAA 1E9FA 3DBOB 3TDMA 3LG2A 3EEOA 2WT4A 4YQYA 3W2IA 4ZIRB 4G1CA 4QYSA 4EFLA 1T13A 2G67A 4KTVE 4L5CA 1BS9A 4E7OA 1U2RA 2ZDGA 5K99A 3CLUD 2VLBA 4BJ5A 3ADOA 2CXTA 5KMGA 3LLSA 1JJ7A 4PIPA 2JEZA 3JWPA 5BW6B 2BHNA 2AJBA 2NTEA 2JZCA 4PZYA 5F2NA 4KK3A 3AYXB 3TZ6A 3VBEA 1T5HX 3QXSA 1RWWA 2CCJA 2NYAA 2PFKA 4YJ3B 4NBSA 1OX4B 2PX0A 2YW2A 1BZYA 1EI9A 2YMLA 1DEHA 2JH3A 2MHCA 1MQAA 4M99A 4N5MA 3VYTB 3D6TB 4OSPA 1P80A 1KDYA 3GCGA 2B35A 2J08A 4RE5A 3RGWS 1VC2A 3G89A 1ZN9A 5M04A 3N8KA 1HE4A 3NFRA 3EXHB 3UJDA 1JBEA 2UZ1A 1UXGA 2WYIA 4FOOA 3FYCA 5IW8A 1Z36A 2ORIA 4FS8A 4UM9D 3QEJA 4L95C 1GUBA 4MI3A 1LQUA 5EQJB 3ZE1B 4KEAA 5CEEA 5FQNA 5H80A 3RU9A 4NS4A 1TEXA 1N6PA 3QEOA 4OO3A 4UEJA 4X1KA 2W4QA 2FZLA 1LX6A 1UFVA 2X0IA 3QXGA 2CY0A 3HCNA 4ZO6A 3SHQA 4GT1A 4TSFD 3U9LA 1GFWA 2RGAA 3ZDQA 1UKAA 1VE1A 2C94A 3T3PB 3ZW7A 1BN6A 3GG2A 2B7CA 4WZ6A 1RQGA 5ICMA 3COSA 1IQPA 2NAPA 1VYTA 3AONB 2Q4DA 3ADDA 1H2ZA 5FLYA 4O2AB 1F4LA 3IPRA 4PCUA 4EW2A 1A2BA 4KMSA 1KYIA 2D5AA 3AUTA 3NEYA 4F5EA 1I51A 5BNWA 1LBHA 1IK6A 2C9MA 2VH1A 4A16A 1YUNA 2AI1A 4R31A 2QHXA 4R1UA 2QX6A 5SZHB 5IKXA 2YWGA 2OCPA 1LD3A 3NJRA 3DCIA 4Y9UA 3M8KA 1T26A 4RH3A 2ATXA 4X71A 3A4LA 5LZ7A 1LDGA 5SZIA 4QDUA 1J1UA 5EMHA 3NAMA 1ZGZA 2B8EA 2JKYA 1M0SA 3PXXA 3VPSA 5J5AA 1DCKA 4DIEA 1Y8QB 3CLUC 3TQIA 3DOCA 2EZ8A 1BHQ1 1QANA 3IBCA 4W9NA 3A3YA 3T7RA 3PHJA 3F9CA 2PX6A 2UVQA 1JSRA 3GLHE 2E0IA 4A27A 3DHEA 4YR7A 3CE6A 3PIRA 3NHLA 4Q21A 1YB6A 2DSTA 1GL3A 3O03A 5F7JA 2R25B 3ND8A 5HFNA 1J2RA 5H4HA 4AG6A 5K0SA 5FUBA 4FHZA 3ZNNA 2PMFA 3M82A 1FW6A 1R0ZA 2ZR8A 1GD1O 1M1YB 1JI3A 2HM7A 3P0FA 4NULA 2JI4A 4RZXA 4S12A 1X38A 3P96A 2OT3B 4LDRA 3S81A 1A3CA 1FNCA 3CIFA 1SQFA 2BFCB 1A8UA 3VR0A 3VHRA 4EHAA 4EHBA 2LWIA 5FORA 3RAGA 2Q3EA 5DLEA 3RK1A 3DBLB 1ETUA 4NWIA 4DJAA 4EY4A 4DQ0A 1MQ9A 2C4TA 1YR1A 4MP6A 4J0KA 4GU5A 1BDMA 5BSTA 2B6NA 1PE0A 2HA6A 2M1XA 3VOTA 2AJDA 2I29A 3Q5EA 3SZRA 4ALJA 1B6SA 1ZGHA 3EQZA 5CT4A 1EVZA 1AKQA 2BFWA 3EUFA 4OQXA 4ZIRA 1H5QA 1UBGA 2VXBA 3MTJA 5K4HA 3O93A 2HU5A 4KE8A 1LSUA 2HJGA 4V0SA 1ADYA 1FU8A 3P32A 4XE5A 2ZJ1A 4Q7LA 2AN9A 5JARA 1JVSA 3K0EA 1RJEA 1GGVA 3K7EA 4AMVA 4B0PA 3MLBA 3K4QA 3EW9A 3OLXA 4LXTA 3ZLUA 5KI6A 4ECEA 5EPEA 5AXCA 4OL9A 1WXFA 4N8DA 1OD6A 4EZBA 4YJ3A 1P81A 1RXIA 1OX4A 2EFJA 2ZWAA 1XDZA 2VP9A 3P2JA 1FE8A 1G0NA 2QAGC 2QX8A 3OH8A 4LYDA 2IV2X 1S9DA 3ACDA 1Q6YA 2Q9UA 1RM3A 4CRWB 5I7EA 2X42A 3OZTA 2WM9B 3GT0A 2XRYA 3NVMB 4MQBA 2AFIE 3AR8A 4NJEB 5KWJA 4K05A 1NT2A 5FEMA 4JLVA 3EXHA 4D4LA 1VQ1A 3CB2A 1OC4A 1GGKA 3HTXA 2FJPA 4KI0A 4XLTA 2D00A 5HA5A 2E4ZA 4GBED 4DTIA 2I2AA 3DB1A 4HYEA 4JD5A 2FFBA 4E7PA 3BXHA 3OQIB 5F9HA 1HMYA 1AK9A 4B3SB 3DNPA 5D2CA 4E2YA 3FTFA 3ONVA 5DWVA 1FDTA 2CVQA 4U2FA 2A30A 3KPWA 3S2YA 3NHPA 1DSSG 3PJEA 3EDRA 5BR7A 2OG1A 1Z28A 3GJZA 4ZVKA 3K15A 3SYNA 2FW1A 4NNJA 4YFYA 3QM1A 1SKYB 1ZONA 1MN6A 3NYIA 4OHCA 5E3HA 3SE0A 4KXWA 4D3DA 1U1EA 3WIDA 1FF9A 2PL1A 4FYKA 4U4AA 1Q14A 4IIHA 2OZEA 1U81A 2QRMA 3PQ5A 4O2AA 4BO9A 1Y33E 1NLUA 2D2FA 3HKCB 4YBRA 4FMCF 3E3LA 4WBXC 3H1FA 1QV9A 2D59A 4PINA 4ZDWA 4C43A 2B4KA 1T0HB 2UYQA 2IP1A 4JVOA 2RK4A 1GN8A 1SIWA 2DFLA 2ENUA 4BVGA 1NBAA 5JQGF 2DHRA 2AE2A 3IHWA 5KKAA 3CY6A 2V3CC 2WYVA 1RAHA 3BT7A 3VH3A 3EA4A 1AGPA 2QUBA 5AHWA 2VR1A 1PUIA 3GAFA 3UXYA 1Y8QA 3G8YA 2QI9F 1ULBA 3EF3A 1SB8A 4LJ5A 3HI6A 3ESDA 2QW8A 2IUFA 3SBEA 2MT9A 5T5QA 2F8LA 1ODTC 3QU5A 4HG2A 2CBZA 2MYTA 1P75A 4BEWA 3V7UA 4WVFA 1EFCA 1WZIA 3DEKA 4FM9A 1PV4A 1QAQA 4OU5A 5IAEA 1OT5A 4DQKA 2ZYDA 2GYVA 3OEYA 1QFYA 2QNRA 4HSGA 5BWMA 2HR1A 3D64A 1M1YA 2X6RA 2P5SA 1WCWA 3T52A 1WMEA 2IYTA 5FA6A 4INPA 3C5HA 3O6VA 5C4IA 1XMOB 3ICVA 3ZZ0A 4KAJA 3WXMA 4CTOA 3OHSX 1A4XA 2BFCA 4PG7A 2ACWA 4ZTUB 4AJEA 1WTAA 4N9WA 2AVDA 2PLAA 3WMXA 4IGFA 1U3TA 2NV0A 2X5KO 3DBLA 3SOZA 4EFDA 5A9RA 4P0PB 3CX6A 3K16A 1UWLA 3O3NB 4FFVA 4HB3A 2QMZA 2R7KA 2RHWA 1PNQA 3RLIA 3KP1A 3Q8WA 3WS7A 2O7RA 2VAMA 4YAKA 3ZCRA 5LNK6 3O5AA 3CM0A 2IZ0A 2WIDA 3AWIA 2OYCA 1VGRA 1JSLA 2OPBA 4LF7B 4UHFA 1OAKA 3PRHA 3TXXA 4KZPA 2A9RA 5CCDA 1QK3A 2Q2WA 5J4VA 2XQJA 2NXNA 1J9ZA 2P40A 3RSGA 5IT5A 3P9PA 1D7OA 3OT1B 3R3ZA 1U2DC 3CPHA 5AM0A 3MT0A 4QDXA 3AVOA 3N0RA 2PUVA 2PN1A 2VTDA 1ZUWA 4LI3X 4NPAA 1UBTS 2XV1A 2HBYA 2CJPA 2RH4A 4KAAA 4LMBA 4YBZA 2C82A 5CH5A 3RPEA 1RWBA 3BXOA 3S1LA 2QLNA 2WU3A 1CR2A 1DXOA 4GBJA 5BMVB 4HWTA 4EA7A 4YRRA 1R0RE 5F1YA 5TY0A 1MQSA 2WTMA 2H3HA 3L4SO 1TVCA 5FH9A 5DPMA 2NW6A 5JISA 3EY4A 4O0LA 3VZDA 5G53C 4NJEA 2C9YA 2MINB 1QQ5A 4JKYA 4NNPA 4NR0A 3H9JA 3U31A 3ZXYA 4AWXA 3OQHA 3ESAA 5D6NA 3KEMA 3Q88A 4I2VA 3WOHA 2GH1A 1SOUA 4AJLA 1HQKA 2VK4A 4I8DA 1FRVA 4LDNA 3ZXSA 4M4SA 1WY7A 1FNMA 4ZYXA 3OQIA 2UXBB 1L2TA 1SUEA 2I4NA 2W6QA 3ESXA 1WUKS 4GRDA 3EYWA 5D51S 3RYFB 1OXVA 3GI1A 5EIFA 3T0GA 2IH5A 2QVXX 4OSEA 4R1OA 2IE0A 1M76A 3FBGA 3PKZA 2WBLC 4RD1A 4CGZA 1QPGA 3IAM6 2AOWA 3WC4A 3ZNPA 1WXEA 3OC6A 3H2BA 2C88A 3IP5A 3D7NA 4WIAA 5LZ8A 3G1TA 1TZCA 3HKCA 1QG6A 3KBBA 3HGMA 4XX1A 2VF4X 4A6DA 1A69A 3G79A 5EJ4A 1T6XA 1IRIA 3LDUA 2IDZA 2CSUA 2HU8A 3NCTA 4KQGA 2GAAA 1UFOA 3ZCQA 5EGNA 3MXOA 1SHLA 1U8AA 1FFWA 1OH7A 1GPDG 3DT6A 2AR0A 4F4JA 1I2DA 1JDPA 3PGKA 3C85A 2HDHA 3IVXA 3K2IA 4Q03A 1CQIA 1KYVA 1BDHA 4UEQA 3IAEA 2QMYA 2I55A 3DZGA 3ZWYA 4GSLA 2GN0A 4W99A 3NBYC 3AY6A 2X0RA 4EJMA 2J3EA 5DIFA 3AZQA 2FLVA 1U7ZA 5K8VA 1VIAA 1N5MA 3B3FA 4X8LA 5EQDA 4F9FA 1ZIDA 1F6DA 2W6OA 2XDWA 3GH3A 3SICE 4GC5A 3TAHA 4HRAA 4NLLA 1O87A 4YWHA 1HNXB 1RDFA 5K3EA 1XT6A 3DLPX 1TAGA 2C2BA 4MW6A 5CVTA 3NIFB 3GUYA 4QXMA 4CIAA 3AERB 3MVEA 1GZDA 4DY4A 4U6NA 4L8VA 4O8CA 4PAWA 1YDEA 3T12A 2W43A 4QLAA 3D81A 4XXHA 2QTLA 2YVQA 3C43A 3TX2A 3W90A 2W6ID 5BUZA 2JLVA 2BBTA 4Z54A 3MRSA 3TVYA 3PJGA 1F3OA 3TAXA 4OP2A 3GK3A 3PV0A 4M38A 4URWR 5AKXA 4PR3A 3UMGA 4BLRA 2EFEB 4KR7A 2C5FA 4FBMA 1S6YA 3RHFA 4AKHA 3W2EA 4DXHA 1E2UA 1XZEA 5JCJD 3DPSA 2C98A 2P41A 3R7FA 2YL2A 2ZUCA 4XIYA 2GNAA 4H2DA 2BCJQ 4QM7A 1ZVQA 2RI0A 3OA0A 3JD4A 2D1RA 5C7LO 2JFUA 2O1WA 4F46A 3ZX4A 3AETB 1ZOLA 1LS6A 1Z2OX 2C2HA 4ISCA 3ZHBA 4Z4FA 1I2BA 5FL7A 3OT1A 4CM5A 3AHIA 1G4HA 3H5OA 3VR2A 1RE0A 1Z5UA 1T2CA 3VSBA 4EEKA 3UGJA 3NRCA 4RS4A 1X7DA 3SEAA 3TNDA 1VCNA 1RWOA 3PQFA 2KMLA 4K1XA 5JY1A 3EBOA 4JT4A 1B2RA 1XZBA 1JDNA 1IG3A 1ST2A 2AX3A 2WICA 2PZGA 5BMVA 2JAWA 2WABA 3FRIA 4OHXA 5GZ3A 1YZTA 1V26A 1BHJA 4ND4A 4PCVA 5I7UA 3D4LA 2Q4RA 2Q6IA 2ZRFA 2GF2A 3OAAD 3WO0A 1N1MA 2MINA 1W4AA 3I9LA 4JMLA 2J5BA 3L8EA 3GDHA 2OORA 1P6XA 3I32A 4GXQA 1QZUA 3M7IA 2H2WA 4EKNB 2ID8A 2YOHA 5BNZA 2MSEB 3QEMA 2ZBVA 3K0SA 1Z6YA 4F04A 1I3KA 2N47A 1Y7IA 4HX5A 4K2AA 4C21A 2OD2A 1XU7A 3TAUA 1ZOIA 2ZI7A 1X3SA 1SBNE 4LK3A 3UV7A 4TMYA 4WGFA 1L5NA 4RD3A 2H2IA 2RJNA 2IP2A 3C3PA 3RUDA 5EI5A 4YK7A 1Z8NA 4KR3A 5HFAA 4WXRA 1YB7A 4M7RA 1P7YA 3I1IA 4RVCA 1J5PA 1VIDA 4UBOA 4TM7A 5CX1B 4OTZA 1C3EA 1DFHA 1Y4AE 3UBTA 1UC8A 1IN5A 3GEBA 2QV0A 1DIAA 2A78A 2IEAA 4LXQA 1ISJA 1RQRA 4BFXA 4I3GA 3R8FA 2O2GA 4QQNA 3EXFB 4QL3A 2JI7A 1R0YA 3H2IA 4W1QA 5GONF 4N47A 1BE8A 3WWDA 4JJ4A 5CDSA 1VG0B 4NVRA 4C5AA 2QQ0A 1BS2A 1T5SA 1X1AA 4TRJA 4Z7QB 3GGGA 1GKKA 4GQBA 2VNIA 2OXCA 4XPIB 4YJKA 5KTMA 1EHCA 4PNZA 3LD9A 1Z08A 2VCEA 1Z45A 2FX5A 5A5GA 5IC6A 3RT7A 2CC2A 1Z62A 2IS6A 2IOHA 3C7TA 4IVPA 3EXEB 3IP1A 4H7IA 4DMRA 4Z4IA 5IVKA 4CEIB 4D9IA 4HH4A 1PNVA 3IQEA 5BSHA 2WJIA 2DPYA 2LR0A 4Y1GA 3LKBA 5JSFA 1NUSA 5FIUA 4CQNA 4UZFA 1GKLA 1B6TA 3I28A 3PDUA 4S24A 5G02A 1LRKA 3VTAA 1P1IA 3LLUA 3WLOA 5FPKA 3WV5A 2HFJA 4YP7A 2HA4A 1LH0A 1JIUA 3AERA 4DDMA 4E4RA 5IKMA 1YC5A 3FMIA 1SVUA 1VB3A 3NBUA 4P2GA 3BULA 4P32A 4XD2A 4C4RA 1RRCA 4DSNA 4WY8A 3AHHA 5AUNB 4QM6A 4LRXA 1HYEA 3ZDXB 1TD1A 5DSXA 1G9XA 3TNFA 4DC0A 1ZM3A 1FNBA 3GRZA 2YZ2A 1AHNA 1G5FA 4MUGA 1RMYA 3QOFA 3CVYA 3NH6A 3GCWA 1U7WA 1NVFA 4YIHA 4EIWA 3C6KA 4BNLA 6ABPA 3NEPX 1E69A 4HAXA 3IQIX 2QYSA 4F11A 4NBKA 4YDRA 2XHEA 5EKTA 1EVJA 1TUIA 3ILYA 4G65A 5EXSA 4BMDA 5CFNA 4I66A 4RHEA 3ZI7A 2PWPA 3AETA 3L0BA 4LTDA 5ESDA 1YF3A 2O8BA 1HF3A 5C0OE 2JAHA 2GPJA 3MJDA 4TS9A 4GF5A 5GINE 1G2QA 1N0WA 2FWPA 4UASA 5CGZA 1E5QA 3G0GA 3PC8C 5GJBA 2PGLA 1VKHA 2HIMA 2RONA 5H1YA 2I3DA 1EXNA 1YGYA 4Y30A 3WICA 4UCFA 2RAVA 4IDQA 4BDTA 4GKAA 3CRVA 4NH4A 3K70B 4PZCA 1W49A 2N1BA 3JU3A 3QK7A 4RTNA 2O5CA 1B26A 2Z8XA 1QXSA 4B3CA 5KQGA 3QWAA 4RF5A 4XD7D 1J8MF 3G5MA 2KE5A 1AUXA 4RDXA 2ZZNA 2C8KA 1F17A 2CJWB 2CUKA 2D5BA 2TYSB 4JJZA 2ODAA 2CF5A 4KXQA 2OHFA 4MXDA 4O08A 4REMA 2P0YA 4NV0A 5FP0A 3RTGA 3BTVA 4H27A 4F7DA 3HPQA 1NP3A 3HKEB 5G41A 5IF9A 1IBRA 2BEJA 2HRZA 1A77A 3USES 1BFKA 4ARUA 4E22A 2GDJA 1NIPA 2WQ6A 1MJ5A 4CEHB 3GFPA 3HDYA 4C76A 3I1YA 3LECA 4GI1A 2HCFA 3GPCA 1FNDA 4JBXA 3KCNA 5EHZA 4L0CA 4H4CA 3CVJA 4HR7A 2Q45A 4PBRA 1UMCB 4MPPA 4PNHA 4IV0A 2FZCA 3EQ2A 3L7NA 4JB2A 1YGPA 2GEUA 1A76A 4NFLA 2JCGA 2EAUA 3BSSA 3GUHA 5CX1A 1CV2A 3VZRA 5AJXA 2V7VA 4JBLA 1A9RA 2B0JA 1JP7A 1KMQA 4L9SA 3K2BA 4DJFC 4ENQA 3W5CA 3EXFA 2DYKA 1GNRA 1NYLA 1Z4QA 1QUFA 4J0JA 2WB2A 1FX0B 3FKSA 1AZSC 4Y6SA 1SBYA 2ZQ5A 2ACVA 1PF7E 4HL6A 3GJ4A 4EYGA 1I0ZA 1Z35A 3A8TA 2QD1A 1HNWB 4XPIA 2W00A 3OOWA 2FLWA 1ORIA 4ZHQA 4JSYA 5DYTA 5ECGC 3CSUA 1FTGA 4FZJA 3BB4A 4PR0A 4JP5A 3I0ZA 2OO5C 3EXEA 4TQUS 2J30A 3L02A 4TTSA 3C5CA 4WZAE 4CKZA 1I1OA 4CEIA 2IX3A 2Z4TA 3O47A 4QWMA 2VRBA 3HA5A 4N0PA 1CHDA 1GFIA 3ZI0A 1Q12A 4URXR 5LLDA 1NRXA 4FJ1A 2ZRKA 4H0NA 1CRLA 4G0OA 2C8VA 3AVXA 4ZOLF 3OQPA 1ID8A 1AKYA 1N6RA 1AH2A 2F3PA 1FC0A 1T5IA 3K2QA 4ZV7A 2OHJA 3E9MA 3WE7A 4B3FX 2JFBA 5FJJA 3U6BA 4OFZA 1L1QA 5HE9A 1KAEA 4HSEA 3DVQX 3I2GA 2QDKA 5BSVA 1GNSA 2R87A 2ZUDA 1THGA 3KR9A 4F1KA 4V1CB 4AF6A 1QUEA 3E7PA 2IWHA 3K30A 4MVXA 1NI5A 1ISHA 2C58A 3PDWA 3FTCA 2HO4A 4N54A 3X1JA 3BQNB 3VH4A 2ZS8A 1PFGA 3G5UA 3QPCA 1VP9A 2O3TA 2VPYA 4Y6QA 4FOTA 3VPHA 1F2DA 3ZHRA 1YFZA 3QX8A 1W581 4K03A 4M1ZA 3A0RB 4WN9B 5G0SA 2C03A 3C6YA 3E5NA 4KQWA 4LKRA 3TTWA 3UWOA 4H0FA 3NMUF 5CR9A 1M34B 1ZJ4A 3SZOA 2B5OA 1MF7A 3T7SA 2W2XA 2I3ZA 3IMCA 4L7VA 4B8YA 1H4SA 3Q0TA 2QLLA 3QE3A 4KE6A 5CG1A 4W5OA 3GDWA 1DJMA 2FQ1A 1IOZA 1SWVA 5G0VA 4DRYA 3QLEA 1MKYA 2HWXA 4RGVA 1EM8A 4FDLA 1PFVA 2FFRA 2O3RA 2P5UA 3FTPA 4WEOA 1MAHA 4IUDS 4RANA 3SYMA 4D0GA 5TGZA 3IKTA 3PC2A 4A6EA 3COYA 4J0FA 1Q22A 2IGTA 3OFVA 2CJWA 2FEOA 4NDNE 4QODA 3ZDCA 3C3BA 1K4KA 2QR5A 3BHNA 4IILA 1JR3D 4MAMA 4TWJA 4PZZA 3HKEA 5DCLA 3QWHA 5KYXA 4YONB 1RBYA 3H2YA 4WKOA 1FTYA 3PNVA 4H9GA 1SK8A 2E1RA 2Y67A 4WXHA 1X87A 4XEHA 4NG5A 4D02A 4XVCA 1KSGA 3BCSA 2IODA 3P4XA 4O4IB 4RQAA 2K7FA 3EZNA 3T3NA 1CNEA 2SKCA 4B80A 1ZITA 5I9IA 3T9BA 1G5HA 1GGFA 1H93A 4J1SA 2A5DA 4Y2HA 1UMCA 3GVIA 3AK4A 4M9RA 2ID4A 4X45A 4UQOA 3WJ7A 5M34A 1BMDA 4MB0A 3AESB 2I65A 2O0HA 3NUGA 4KQKA 3GGOA 3JZFA 2FDCA 4R3WA 5DF1A 4X1IB 5F2OA 1KL7A 1G8SA 5A4MS 2IXDA 2WFLB 1ISMA 3LHSA 1FQJA 1JNXX 4KSYA 2GM3A 1T36B 2G25A 4WXMA 4MW9A 3LBAA 4CLEA 2IT1A 1SVOA 2BZ0A 3Q7RA 2CVFA 2Z1MA 4IGIA 4XUCA 4ZVPA 2ZR7A 4E09A 1SA0A 3NTQA 3O1JC 3O84A 1O9BA 3FI9A 4ZEWA 4KPFC 3CCBA 1XQWA 1NLMA 1J9GA 1A5ZA 1TZBA 5MN6A 2ZM5A 1HNZB 3PHBE 4C30A 4Y9RA 5JMTA 3MT7A 3DQQA 1GSOA 1P9OA 3DDOA 3GJTA 3PUKA 1W36C 1YIAA 1NQWA 2OPHA 4AJNA 2I7XA 1M0EA 2VSFA 3HR4A 4HO1X 4UNIA 5DK4A 2OCYC 4HGYA 1SHZA 4FCCA 3IIMA 4G9GA 1Q57A 5G1NA 3UGKA 4O29A 5FPSA 4BU1A 4F5DA 2V7TA 3DTNA 2YFKA 3R9IA 5AK6A 1QRDA 4DR4B 2C7QA 4F60A 4O4LF 2CLCX 3C98A 3TIVA 4EA9A 3EZLA 5DN6D 2V0GA 2J85A 3R0VA 2BYTA 1RZRA 4ETIA 3RU2A 3UIEA 3WSVA 3X1YA 5L7TA 5DFAA 2C0QA 1K7XB 1JZQA 3HBMA 3IAS1 4KB5A 1EDDA 3B78A 1FVOA 1V6CA 4LGCA 3FNBA 1Q3HA 3BCUA 4QBHA 5FWNA 3G8CA 1XLTC 2XZTA 5E4YA 4GKBA 2OWEA 2V4MA 4BCBA 3UUGA 3ZIDA 2A58A 4LN1A 5F7ZA 1NVTA 5I7HA 2B83A 1DC5A 3NHAA 4LXIA 1UZLA 4KJZA 1JFLA 4H17A 4WN9A 5DCYA 5DTQA 4MUAA 3WVNA 4DJDC 2Y1OA 3BWBA 4AJ4A 4X8MA 1KQOA 1M34A 4RXUA 3CN7A 1EBBA 1DRUA 1CQPA 1QP0A 4BB6A 3C3DA 1WG8A 3G6KA 3OAAA 4IQ0A 1V7PC 5CA0F 3TK1A 3T7KA 4MJLA 1CS4C 4LRQA 2JD0A 4WK4B 5FF9A 5FUVA 5G3ZA 1Y6FA 3O75A 3ODGA 3GLTA 1A8HA 4M9ZA 1B3RA 4CLOA 2N9UA 2XMSA 4WXYB 1C3OA 2Z6AA 3KBOA 1N6OA 3QTLA 4PCLA 3PRKE 2IPLA 3ELBA 3RU3A 1J21A 4IKOA 1Z4LA 2ECKA 3NXKA 4P7BA 4EB8A 5JXGA 1AY0A 2P6UA 4DPKA 5L3SB 4JV5B 4QJ4A 3GRUA 3EBPA 1PI3A 3BJZA 3PEUA 5D00A 1U3WA 3MMZA 5EZQA 5CGQB 3HBAA 4XUGB 2RH8A 3WLTA 2HXGA 2ZITA 4OHRA 5LC1A 3QJYA 4UQPA 4LWZA 4O4IA 2I3AA 3N59A 1PDOA 2PFSA 4OJNA 4RLSA 2YHBA 4M0DA 5CP8A 1EINA 1SUIA 1FSFA 4BO5A 5AJTA 5JO0A 3PGJA 4ZZ3A 4GOMD 521PA 4AY3A 5LMZA 3LCRA 1TJNA 4OJMX 2GHRA 2OQRA 4LHVA 4MUNA 2IYRA 2C2XA 1E5DA 3PPWA 4ZXPA 3RYIB 3RVMA 1GG9A 1M8KA 2DWCA 3HCDA 2YRXA 1KJJA 1XGKA 4Z4CA 4YV1A 4KQ6A 1I5EA 4X1IA 1U04A 3KT0A 5BNIA 3HE3A 1RIFA 2H85A 3L6RA 2WFLA 4RUKA 2GT1A 2IIVA 4XJSA 5FD8A 3DJYA 3AG5A 1T36A 2E4VA 4DDVA 5F5LA 3AIMA 3AW9A 4G2TA 2O1EA 4XSVA 3S99A 4CI0B 2GZDA 5KTSA 2CHEA 5ALYA 4DYHA 2BH2A 1A97A 2XJ4A 5KTTA 2VAXA 2ZRLA 3BVPA 3EZGA 4Y1RB 3OCZA 2Q3HA 5HBRA 5JXJA 4JI7B 2ZU6A 4OMFG 3QLUA 3N2LA 4EH1A 1K7FB 4KXUA 5EEHA 1VLQA 4M8NE 1JQEA 1LSOA 1UBCA 4RIFA 3RVJA 1O9GA 3DLIA 3KDSE 2NZUG 4YUYA 1T9DA 1CQZA 2DKOA 1T9ZA 4QFBA 4JR2A 4XJXA 4D8YA 2OMEA 4DIOA 3KFVA 2CSXA 4IMRA 3T38A 3K71B 1S96A 3T4PA 4NL4H 1JLMA 2V96A 4PWZA 3TSWA 2GEBA 3PNKA 2WNHA 1HC7A 2GWRA 4U7DA 1YBFA 4FYHA 3BBPA 1LB1B 3R40A 2I2BA 1R64A 2FWMX 2WDZA 3FCOA 3RS0A 4LFBB 4FINA 1PO7A 3FPJA 4HUJA 1OQAA 1N25A 2YJ5A 5BSWA 1XMPA 3PQ4A 2B94A 3LKZA 5AD1A 1G5RA 1KERA 1Z38A 2W83A 4Q00A 2ZYRA 3IQDB 5MN5A 3THOA 2GRAA 4MUYA 2IH4A 3IXLA 2AMLA 4AJIA 2AN4A 1KYZA 4MV4A 4GR9A 1FYDA 3N3BC 2ABWA 5LBTA 1Q50A 4DVJA 3B1WA 4AKSA 5IS2A 2XUZA 5IBRA 4CLOB 5BN3B 1O0SA 5L51A 2QRGA 2YWXA 3LY5A 3V4RA 1HYGA 1P19A 3MBKA 1XR3A 3AF4A 2H51A 1N2BA 2HLNA 2PK3A 1DBVO 5F98A 1J24A 2XAAA 3OPVA 4IW3B 3UJBA 3PXBA 3O1LA 4OBBA 2YMPA 2B1GA 2Q5QA 4EUHA 1HYQA 2F67A 2FR8A 3EASA 1H0HA 1YR6A 2AC2A 3CKKA 4JX8A 3USZA 1W88B 5A02A 1DCTA 3AM1A 3KEFA 1PYGA 3BPSA 5EESA 2YWCA 1Y4ZA 3NVDA 2BKAA 1XP8A 3WLKX 5DVZA 2P11A 4X20B 2XCUA 1CUEA 2XIJA 1O5TA 4BLUA 1Z7WA 1SKMA 1CPYA 1WBBA 1E3MA 1O6FA 3KDPA 2HGZA 3OQ6A 4YGXB 4YNBA 4DA6A 5L3SA 3T5MA 1G21B 3OECA 1ZN8A 4DILA 1E0JA 3IRUA 4MRMA 1K8ZB 4MDYA 3A1SA 4MW7A 1UIMA 1FTNA 3OD5A 1NXPA 1VI2A 4QOJA 4RJLA 2ACEA 4LBVA 2JAUA 2QMEA 2ZRPA 2JC3A 4YJHB 2KQUA 3LPAA 4F38A 2W4MA 1T15A 1NX6A 2JIQA 1FQKA 4R6XA 5DYYA 5IXSA 1RI4A 2IYYA 2OOSA 2Y77A 5BRJA 4WRRA 4ZMBA 3RYIA 2OCKA 3NV7A 1E7WA 2QRVB 1XRLA 3BHJA 3K5IA 2ODWA 2AJTA 1PGOA 2ZAGA 4EJ2A 4YUWA 3IAFA 3PGA1 4MLZA 5H02A 1KMMA 1YR7A 1KHTA 1Y3BE 3B82A 3K09A 1OWNA 3SFVA 2IZZA 5EMJA 1AM4D 4GXNA 3N87A 4IDBA 1GADO 1B00A 1RM5A 5DOVA 1O95A 5DYNA 3C87A 3MUEA 3LDHA 2XUFA 1MX1A 4GZMA 4Y1RA 1IAQA 2FZWA 2D13A 3E2IA 1SCNE 1ONNA 1LNSA 2GS9A 1I9GA 1Z83A 2C1XA 2IF2A 1G41A 3FAZA 3ILSA 3VR2D 4FEEA 4F21A 3PSAA 2C7BA 5AXDA 5JT1A 1AJEA 1KTVA 3LJKA 4WECA 1ZEMA 1KK0A 5HG0A 4CR6A 4E1AA 2VI5A 1Y5MA 2IOQA 2H8KA 1DQSA 3O1HB 3G59A 3IEIA 4EVIA 1UJNA 2EDCA 3GELA 3DE5X 1GHTA 2DQ4A 1YKGA 3NHMA 2HMTA 3AOEA 3EVAA 4DCGA 4OAOA 1FLAA 5FOUA 4Q05A 2WMDA 4UNPA 1M6YA 1QGZA 1SXJE 1XOIA 2BKEA 2E85A 2VHZA 4H3HB 3RSZA 4AIRA 5ER9A 1PKXA 1CLUA 1O1YA 3JQAD 4PCAA 4DLNA 4GNRA 1ATZA 2P7IA 3DCNA 3H1GA 4IO0A 4P5DA 3KYBA 4XH9B 2XNDD 4UDXX 4LIPD 4OYRA 5FLEX 1VBFA 4EKEA 3SQXA 2Z1DA 4JY7A 3TLXA 2PE5A 1OJLA 4DKJA 1Z6AA 1ZDMA 2JGLA 3M4XA 3BN3A 4CUKA 3DDCA 3PUWA 4KQEA 5BN3A 3AI1A 2H1SA 3FPHA 2J3QA 1BFDA 2VDQB 5ALUA 4RO0A 3OZAA 4J3JA 3PFWO 4D45A 4UE2A 4HNUA 2P3SA 1S2MA 3KXPA 1DV2A 5HR5A 1C4XA 1YVEI 1ILEA 3L2OB 2FETA 1PLLA 3Q1LA 2IUUA 5BR4A 4DLZA 1GY8A 4KYTA 3N6XA 1Z6QA 5IDVA 3E03A 3SEZA 2V8OA 3LAWA 2YV5A 4OBEA 4F45A 2PMDA 3NNSA 4QFCA 3FJ1A 3NYQA 4B1FA 4MKIA 2H08A 3EH2A 1ZUIA 1W88A 3AB3A 3LYHA 4IV8A 1DJPA 1QHNA 4M98A 2JLZA 3WAJA 4X20A 1PZGA 3OA2A 1TTHA 2RHJA 3QY0A 5FTJA 3QKIA 4M83A 3LBNA 2H5EA 2YVKA 4P8RA 5K2OA 2YXPX 1KQGA 5GJVC 1DARA 3F90A 3WB2A 1LLDA 1G21A 4DR3B 2WF7A 2ZTHA 4QOFA 3HSYA 1LI4A 4YRAA 1DXQA 2JIZD 1EMDA 3KLOA 1U31A 3L6DA 1R7RA 3MAGA 5KU7A 3EPHA 1D4FA 4B85A 3OQNA 2I2XB 3OEEA 3QVLA 1X1QA 4HP8A 4MVJD 4YJHA 2PUHA 2ZG6A 1WV1A 4TTTS 2ZROA 2P3QA 4CM8B 2O05A 3U3XA 4Z0PA 2QKYA 5BSRA 2YCBA 4MV7A 2PUBA 3DGEC 5CDTA 4LXUA 1E5TA 2QNBA 3AEXA 2FEMA 3OZRA 3A1VA 2QRVA 2QTAA 4I4NA 1A9PA 4KO1S 2X0NA 2ZRGA 4DV7B 2I6FA 1L4MA 2VPXA 2AG1A 1ABEA 3QVOA 2O2IA 4DDUA 2C4HA 4X7BA 5K6AA 2FAXA 4ESHA 1L4HA 2VEOA 2ODEA 3W5JA 1NP6A 1PZXA 3AMVA 4F92B 2DR3A 2KLBA 1CUXA 2G28A 3LUAA 2AC7A 1NJ8A 1N2CB 4G5GA 4PG6A 2G1JA 4RQUA 2OV6A 3NVKI 5JNTA 2CV0A 2QUIA 1WXWA 2CCGA 3GB9A 1N6LA 4XCVA 2A9OA 3KOMA 1P2TA 1YZHA 4LOLA 2HPVA 5JYBA 1F8UA 2O2HA 2VJOA 3AYZB 2B8TA 4PC3A 4LOAA 2WT8A 5DHPA 1A7KA 1AU9A 3JCZA 5ECYA 3UA4A 4DNXA 1BROA 2HQOA 2J33A 1ZYUA 2R8RA 3I2JA 3UWSA 1SCQA 4JX9A 1YCFA 1NQOA 3G2QA 3ZW8A 3LE8A 4A1OA 4EOGA 1Z6XA 2XB4A 4CMJA 2IYXA 1EA5A 2HRQA 2OKGA 3CT4A 1NY5A 3JZMA 1SZJG 5HZMA 4QQ8A 2R1VB 5EE1A 3JQFC 5J40A 2BWJA 1W1WA 2ONKA 3OWXA 3RYTC 1R66A 5FWDA 1Y89A 3I73A 2IV7A 5FOSA 1T34A 2D4HA 3KUUA 2W6ZA 1UKEA 2X5XA 3G8AA 3U4MA 2OGZA 3FR8A 1TEVA 1EP1B 2PWYA 1LJUA 2NSYA 2X3UA 3QFHA 4WBSA 1JA0A 3Q7SA 3I6YA 4BMPB 1GSHA 1IG0A 5KNLA 2DWQA 2I8LA 4EY7A 4D3XA 2GZMA 5C3MA 2D0OB 1ESMA 5MF6A 2RGYA 2VT3A 5TGDA 4RMJA 4RCYA 1H66A 4CTKA 4ZXFA 5JBQA 1KHHA 1KEVA 1Q0PA 3GY0A 5AM4A 4AS1A 3GDGA 1P91A 2A9JA 3NHKA 5D1HA 3TZEA 5K8IA 3W8DA 5B55A 2LZ0A 3VPDA 2WUEA 4LZPA 3DULA 3SF0