4AJ7A

Crystallographic structure of thioredoxin from litopenaeus vannamei (oxidized form).
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
105
Chain Sequence
MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Expression, Purification, Crystallization and X-Ray Crystallographic Studies of Different Redox States of the Active Site of Thioredoxin 1 from the Whiteleg Shrimp Litopenaeus Vannamei
pubmed doi rcsb
source organism Litopenaeus vannamei
molecule tags Oxidoreductase
total genus 36
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4aj7A00
2JZTA 2YNXA 5DBQA 2VCWA 1MDJA 3QMXA 1YKAA 3VWWA 2OE0A 4MPGA 3U5RE 3P8WA 2L59A 3HJMA 4FYCA 2PMTA 1RK4A 2PPTA 1PKZA 1ERTA 3QCPA 1OC9B 2DMLA 2R5GA 2JADA 3PR8A 3IC4A 1TP9A 4DSQA 1ML6A 4IJ3A 2LUSA 2TRXA 4PNGA 4MCUA 1XVQA 1G7OA 3IPZA 5ELAA 4KUNA 4ECJA 1SD8A 2RUFA 2V41A 2H70A 4EL1A 3F3QA 3KZQA 5KN1A 1JZRA 4G10A 3K8NA 4K6XA 4ECBA 4TOPA 5JWOB 4GCIA 2CVBA 4X1UA 2OBIA 4QL7A 2C80A 4OFTA 4N0ZA 4EO3A 1K0NA 1O6JA 2BTOT 1BJXA 3C1SA 10GSA 2WZ9A 3VI5A 3WGEA 3RAZA 4EUYA 1O8WA 3EC3A 4MZBA 5HFKA 4JE1A 3F63A 3FHKA 4HS1A 1CQHA 5DQSA 2V1MA 2L6CA 3KTLA 2PGTA 1USBA 3HZ8A 1PD21 4NHZA 4GWRA 4F0BA 1YJ6A 3HDCA 5HR3A 4ECIA 5IQYA 3GTUA 1R4WA 1UN2A 4DSSA 6GSTA 3UIWA 2YPMA 5JCWA 4J56E 2X99A 1ILOA 3MSZA 3FZAA 1X0RA 1O73A 1ON4A 2YOIA 4OFNA 1THOA 5F0GA 1LBKA 1PGTA 3W6GA 2CAQA 2H6YA 2VCQA 3EE2A 2KLXA 4HZ4A 2E0QA 3H93A 3L4NA 3NIVA 2H8LA 1GSYA 1ZCPA 3N9JA 3F9UA 2CVKA 2ALBA 1SU9A 5DCGA 1PQNA 3HJOA 5KN3A 4JRRA 5IPGA 1A8YA 2PN8A 1ERWA 5CAXA 1O81A 4TN8A 3M3MA 4P3YB 3DXBA 4HU9A 4KA0A 6GSSA 3TDGA 1UA5A 1PL2A 2YWNA 3US3A 4N30A 5GAPD 1KEBA 2EIQA 4KCAA 2B1KA 4HJMA 1ABAA 2CZ2A 2OKAA 2LQQA 2L4QA 4MZWA 1X5EA 1WMJA 5IO2A 1MDIA 4YQUA 5GZZB 5ECLB 2CAIA 3FY7A 3TKSA 1SL2B 1GRXA 1AQXA 2CZ3A 2WCIA 4EDYA 5CNWA 1OC9A 3OR5A 1Z6MA 1FB6A 3IHQA 5ECHB 3ME8A 5IOXA 3F4TA 4QL9A 3LEFA 2M80A 3QDNA 5A4UA 4MJBA 2NDOA 2FY6A 2GLRA 3UL3A 5IMAA 2H0IA 2GQKA 14GSA 5IM9A 2LV3A 5D8IA 1XWGA 4O32A 2EIOA 1Z5YE 3E3EA 4LA1A 5CRGA 3APOA 1E6BA 2KHPA 2M46A 3LYPA 5HR2A 2C1YA 1A23A 2VCZA 3Q6OA 2GTUA 2MMZA 1G6YA 2GSQA 2ZUPA 5ABRA 2XBQA 5E4WA 1GSEA 1YF0A 3TUEA 4ZBDA 3GFKA 11GSA 1YKCA 4TR0A 4V1Ag 1MEKA 1YQ1A 1GTAA 3A2XA 4H86A 4WR5A 1J9BA 2FNOA 3F6FA 2OA7A 1SKRB 1JFUA 4F82A 2H1DA 3HVSA 2CVDA 3F4RA 2NBSA 5D9VA 2G0FA 5EPFA 1GLPA 2E7PA 1QFNA 5A5KA 4WBRD 3TOTA 3HVXA 1AUCA 2XPDA 3D4MA 2MMOA 4TXVA 3RPPA 1K0MA 4RQRA 5G1LA 17GSA 1SJ6A 1TI3A 2YJHA 2DJJA 3U6VA 4IBPA 2FGXA 5IMZA 1R5PA 5FHIA 2PU9C 3I9V2 4PQ1A 3VPQA 1X9SB 3TKSC 2CT6A 2NPBA 12GSA 1B4PA 1DUGA 2G2QA 4WR4A 1YEPA 3IK7A 5GSSA 5DVBA 1K0CA 2VO4A 4KW6A 2VCXA 4MZCA 1SD9A 1EP8A 3V1WA 3CRUA 2H19A 5GAND 1BG5A 3A2WA 2YZHA 1B9XC 1VRSD 1G6WA 4MJEA 3GKMA 1WOUA 2MZCA 2CX3A 3GKXA 4WXTA 4HEA2 5J4UA 4OWYA 1QGVA 2IMFA 4HJ2A 3TRQA 1EEJA 1HNAA 3TKRA 2F8FA 2HYXA 1B48A 3FRCA 1EEMA 4FIWA 5D93A 3WGDA 1BQ7A 3VLNA 5DALA 3GURA 2LNSA 3DKSA 2IN3A 3VI7A 4EDZA 2DJ2A 2LEGA 6GSUA 2HZEB 4HU7A 2F3MA 2D2ZA 5CREA 1QQ2A 5LNKe 2YV9A 1J08A 1XWCA 5ECRB 4EVMA 4KSMA 4AJ6A 3DD3A 3C1RA 4K7OA 1EZKA 3E9JB 3ME7A 4F9ZA 2L5OA 3VURA 4IP6A 4ZL7A 1EV4A 4V2NA 5ID2B 3G7JA 3UBKA 1GNEA 2JZRA 5ECSA 3FW2A 2JU5A 4AJ7A 3QAWA 3ISOA 2H71A 2VL9A 2LNTA 1OE8A 3VWVA 2WFCA 2H1BA 1Z7RA 4E8HA 2F9SA 3J7Yk 3G7YA 3TGZA 4XS1A 3I6AA 5FWGA 5J9CA 4IQAA 3UVTA 2IMDA 2FLSA 1GL8A 3UVHA 2LSTA 4J57E 2B5EA 2A4VA 2DC5A 2I81A 4KDUA 1M9BA 1AQVA 1T4YA 3RPNA 2C0FA 1TRUA 2C8UA 5H5RA 3GKNA 3UBLA 2I1UA 3ZIJA 1PA3A 2HNLA 5ECNB 5ECOB 1T4ZA 3ZITA 4F2IA 3TOUA 4AGSA 2VLUA 2E2MA 1LJRA 6GSWA 5HQPA 3CRTA 1NHOA 4IQ1A 2ON5A 5E59A 2YCDA 2H1GA 3HKRA 1SYXA 3VWXA 1ERUA 1QXHA 4WF4A 3I69A 4OO4A 1VF4A 3F4SA 1ZZYA 4NAXA 1FB0A 3UMAA 3IR4A 2ES7A 3I43A 2X64A 3KMOA 3M9KA 3SWLA 4Q5QA 2VAFA 3HYPA 1PMTA 4POMA 3FR6A 4J2FA 5ECMB 3TB2A 5DCHA 6GSVA 3A2VA 5B6NA 2MYGA 5ECIB 2ON7A 4MF7A 2XPEA 1JHBA 4YAVA 1RQMA 4JZQA 1K0AA 1NSWA 3LGCA 2TIRA 3FR9A 2KOKA 3H1NA 2R6KA 2HE3A 1LU4A 2OJLA 4WETA 5ELGA 3CYNA 2HZEA 4OO5A 4POKA 4JBBA 2O89A 4YAPA 3D5JA 1EP7A 4F03A 3M8NA 3IXRA 4HOJA 3WT2A 1Y25A 4MF5A 5IO0A 1Z7PA 2FA8A 3MWHA 3LSZA 3L0HA 4ZB9A 1V58A 4IS0A 4MJCA 5ID2A 2VD1A 3D21A 4ULXA 2PWJA 3CTFA 2VCTA 3UOMA 3FR3A 5ECPB 3ZREA 3ED3A 1U3AA 1EOGA 1R26A 2JSZA 1FW1A 4HUAA 3APSA 3G7IA 4WBJA 1RW1A 3TCOA 5HR0A 1AAZA 3HY2A 3P90A 3VWUA 3PH9A 4NMUA 1TDIA 2EC4A 4GRFA 4KH7A 1NW2A 1XFLA 1I5GA 2QGVA 5DDLA 3RHCA 2DSAA 2V6KA 4TRXA 2GSSA 3G9BA 1G0TA 1TK5B 3LORA 2LJRA 4MABA 1EGRA 1MTCA 4PNFA 3CSJA 1PL1A 1GSFA 5F05A 1OC8A 2V6OA 4ZBBA 1OE7A 2VL2A 3VFIA 1YY7A 2JACA 1SL0B 5AIVA 4Q5RA 2MBSA 5B8AA 2IFQB 1J0FA 2H74A 1YZXA 1A0FA 1PSQA 4RQXA 1F37A 2X8HA 1TRSA 5KN0A 2L4CA 1GUKA 1GTUA 1XW9A 1KBNA 3CTGA 4LL4B 1K3YA 3A3TA 3FZ9A 2HSHA 4TR1B 1VGLA 1WIKA 4XTSA 2CX4A 4POLA 1T00A 1K3OA 5G2ZA 4I5QA 3LWAA 2BJXA 16GSA 2RUEA 3EWLA 3LYKA 5IMVA 4KNDA 4IKHA 3F3RA 3GL5A 3TRXA 1FAAA 4XCSA 1SKWB 1Q4JA 5F06A 4GSSA 1K3LA 3IBHA 1GNWA 3UARA 2A2RA 2P5RA 3KEBA 4TXOB 1GH2A 1B9YC 4ZB8A 5DALB 4L5OA 1S3CA 2KUCA 5B8BA 1U87A 1OKTA 1HD2A 5D96A 2WB9A 1TK0B 2C4JA 3WD6A 4I2UA 5G30A 2DJKA 4DSRA 4MA9A 3ZLPA 8GSSA 1M2DA 5DAKB 4PURA 2YANA 4N0VA 4BPYA 1AW9A 4MDCA 2E2GA 2R2JA 4N10A 4KCEA 3MNGA 2H66A 3DRNA 1EV9A 1R5AA 4MLYA 3ZTLA 3FZ5A 1XPVA 1TU7A 3O76A 1A2MA 1SENA 1ZL9A 3ZZXA 2OBKA 2VL2C 3EU4A 2C0DA 4CW9A 2V32A 1MD3A 4MK3A 2PERA 3HCZA 2WULA 4KB3A 2H0GA 5J41A 3RBTA 3EMPA 5F8BA 3GNJA 1WE0A 2P5QA 3L9SA 1OVNA 1PN9A 2LTKA 1HNCA 3FZ4A 3BOAA 2LJAA 3UJ1A 4K9ZA 2EIRA 3D0ZA 2QC7A 3R2QA 6GSYA 1ZOFA 1TTZA 3QPMA 1AIUA 4EXJA 4L8EA 1ZGNA 2B3SA 2AAWA 4ZIJA 19GSA 3D22A 3TJGA 3ZL5A 4IW9A 2GT6A 3Q18A 4O5RA 3DEXA 1S3AA 5KN2A 2LRCA 1UC7A 1BEDA 4GQCA 2IFQA 5G1KA 4ZL8A 1GLQA 3CXGA 4ZL9A 1O7UA 1SJZA 3ZMKA 2B6MA 4D73B 2GQMA 4OCFA 2NTOA 1GUMA 2HI7A 2VM2A 4GQFA 5IMCA 1EWXA 2GZPA 1FG4A 4BWSA 1T8EB 4TR1A 3IE3A 4ZILA 1SK2A 2K8VA 2N5FA 2YWIA 4G19A 2J23A 2GDRA 2VL3A 1C72A 4IHUA 3LXTA 4FYUA 1U88A 4Q5NA 1U3IA 3GV1A 4MJAA 1SK1A 1XBSA 3NOFA 4O92A 4X43A 5CP1A 2DIZA 3DVXA 4OCEA 4TXOA 1XW5A 2VLVA 13GSA 3LXZA 5G5FA 4GSNA 2AHEA 5AGYA 1CQGA 1AQWA 3W8JA 4BL7A 5D9TA 2AJQB 1T3BA 3EMXA 4IN0A 4I6XA 5CRDA 3KD0A 1UVZA 2YWMA 1HNBA 4CDOA 4MH2A 5DAKA 3UAPA 3S9FA 3KP8A 2X8GA 2HSYA 1VF3A 2K8SA 5JCUA 1F2EA 1AXDA 5EY6A 2H72A 4OD7A 2CQ9A 22GSA 2YJ7A 1FVKA 1B4QA 4XRAA 18GSA 1W4VA 3L9UA 4K8MA 1JZWA 4G9HA 1A8LA 2GT5A 4OFMA 4WKWA 2K6VA 3CMIA 1R7HA 3ZYWA 3KM6A 2AB6A 5H5SA 4NXIA 3E0UA 1ACVA 5KEJA 3QAVA 1DSBA 5AN1A 1A2JA 3BJ5A 4Q5FA 5G5EA 4HI7A 2IMEA 3HHVA 1DE1A 5H5QA 3M0FA 4XRDA 3EU3A 5DJMA 2P0GA 2DMMA 1NM3A 3GYKA 2YWOA 3KH7A 3RDWA 4BVYA 1XOAA 2LRNA 1KNGA 2B7KA 3L78A 1TW9A 3KIJA 3GA4A 2MMAA 1IYIA 1QK8A 3BBYA 1OC3A 4I97A 4TR3A 3QOUA 3TKPA 1Z9HA 4ECCA 2KP1A 1URMA 3GHAA 4D73A 4WF5A 2HT9A 5A4WA 3IAS2 1X9MB 2YN1A 1WRYA 5LD0A 6GSXA 1TKDB 1HQOA 3GIXA 4HZ2A 3C8EA 1I9DA 1X5DA 3ZVJD 1OKDA 4YQMA 2OACA 4O7HA 3LG6A 1B8XA 3SBCA 4PGTA 1OYJA 3ERWA 1GTBA 2JSYA 2AYTA 2L57A 5INYA 1K0BA 1YEXA 3ZRDA 4ML1A 2K18A 1AC1A 4GSTA 3J7Yb 4K7IA 4XS4B 1F3BA 1THXA 3FK8A 4ID0A 4K2DA 2NVLA 1SYRA 4N11A 1NHYA 4ZBAA 3O6TA 4POBA 2V2GA 4FYBA 4V2LA 4V2MA 4BVXA 3ZMLA 3GN3A 3GRXA 5AIXA 3ZIVA 1OAZA 3QR6A 1ST9A 1V9WA 2RIIA 3F0IA 1JZDA 4MF6A 3QFAC 4JR4A 2L6DA 3N5OA 2O87A 1VF1A 2R3XA 3TJFA 4XS6A 2WS2A 3VPTA 3GL3A 1JLWA 2AUVA 3LFLA 2F51A 1W89A 3KP9A 1M2AA 3FKFA 2LS5A 3HD5A 2C3NA 1Y6EA 3GH6A 4JEDA 2OADA 3KXOA 4TVEA 1JLVA 5D9XA 7GSSA 5J3RA 1WPIA 1N2AA 4KDYA 4MPFA 1GSSA 2VOCA 3HJPA 1T1VA 3KH9A 5AISA 2B5XA 1V57A 3HVVA 1PRXA 2N5AA 2H1AA 1TI1A 3CSHA 2H0HA 3GUSA 2REMA 4I8BA 1XWKA 1S3DA 1TK8B 2GS3A 3IRAA 3DWVA 2C0EA 3L9VA 3M9JA 1O8XA 4ZXGA 4K0NA 2IJYA 2CA8A 3DGQA 4GXZA 3MDKA 2WRTA 1Z3EA 2IIYA 3FYGA 2I4AA 2F8AA 3TJJA 1A2LA 3ZFLA 4G2EA 3WGXA 4X0XA 1FO5A 2H73A 1M99A 2OE1A 5D9WA 2DBCA 4BA7A 2XHFA 1BX9A 2HFDA 4L0WA 2VM1A 3CSIA 3IDVA 4YQVA 3F6DA 4FO5A 3GH9A 3AY8A 4IJIA 2HRFA 2B7JA 4DVCA 2FWFA 1GWCA 5CO3A 1WWJA 3KCMA 2WJUA 1XZOA 2GVPA 4YH2A 2N5BA 3HA9A 5JWQB 1ZYEA 2RM6A 2YP6A 3ERGA 1H75A 3TKQA 1A24A 2I9HA 2GSTA 2TRCP 3TKSE 2XBIA 4HQZA 4HQSA 1O85A 1FHEA 1A0RP 2DJ1A 4L0UA 2WDUA 2O7KA 4WEYA 4XS4A 4PQHA 1H4OA 4NWYA 2ZNMA 2BMXA 4RI6A 2H6XA 1XW6A 1XOBA 1M0UA 2GZYA 1YDKA 1GSUA 3LJRA 2PVOC 2QSIA 3NZNA 1YF1A 2DJ0A 4ZB6A 2IMIA 3IAM2 5HFIA 5HR1A 2XC2A 3LQ7A 1GP1A 2FWGA 3TJKA 4I2TA 5IMDA 3IOSA 1SKSB 2H30A 2RM5A 9GSSA 2IWTA 4XHMA 2A2SA 4PX1A 2VCVA 2YZUA 2IMKA 1PKWA 2H76A 2QKEA 1XIYA 2B1LA 4EE0A 5B6MA 4FH8A 3BD2A 1BYEA 1WJKA 3APQA 2C0GA 3GSTA 4E8EA 5L71A 2VD0A 1PX6A 1U6TA 4ISDA 1EOHA 4DEJA 3GMFA 1MD4A 3EVIA 5J9BA 1Q98A 2IPAA 3GX8A 4NV2A 3UEMA 4IELA 1E2YA 3C73A 4PUAA 5A4VA 2FHEA 1HYUA 4TR4A 2FWHA 2ZCTA 2C3QA 2PBJA 1DE2A 2L5LA 3WT1A 3BCKA 3FEUA 2JL4A 2DJ3A 5COHA 1FOVA 3DYRA 4RI7A 2GGTA 4GTUA 4LMWA 2GZZA 5ECKB 3IV4A 5HFGA 1XXUA 4MH3A 5D73A 5CRHA 4ILFA 2R4VA 4PUFC 2J9HA 4KE3A 4V1Ap 4EKZA 1QUWA 4BWQA 4KDXA 2RLIA 4HDEA 5DQYA 3VK9A 1GUHA 3ZVJA 1GSQA 2HLSA 3DVWA 4TW5A 2O85A 3KJYA 2HXKA 2FD3A 2VLTA 3TRPA 5CRWA 2LQOA 3Q74A 4L5LA 3EURA 3TJBA 2C3TA 1M9AA 3C71A 2I3YA 2DLXA 4KAEA 4AJ8A 1M7TA 1F6MC 4MP4A 3KMNA 3GKKA 2LJKA 2OE3A 3O3TA 1K0DA 2JZSA 3JCML 1ZMAA 3QD9A 2IL3A 5IIZA 1XCCA 4GF0A 4JU5A 1KTEA 4Z7XA 1XVWA 4IP1A 2FCHA 1TU8A 4LL1B 4AF2A 4KSOA 3CBUA 3P2AA 3DIEA 4K1FA 4F0CA 4ML6A 1BAYA 3H79A 1T7PB 3D6IA 4QQ7A 1TOFA 4JR6A 4NPBA 3EINA 3IA1A 1QMVA 3ERFA 5G31A 5C00A 2HZFA 1M2BA 4MMMA 1ZYQB 1EGOA 4K7NA 1GULA 4ACSA 3A5WA 1GTIA 1TRWA 3HZ4A 4KX4A 5LCZA 5EVOA 2CV4A 5IOWA 1SL1B 2M72A 3IK9A 1X5CA 3ZFBA 5EL8A 5GSTA 1F3AA 1Z6NA 1XWBA 3PGTA 3KTBA 4RUVA 1MDKA 2H75A 2FA4A 5JCGA 1TXXA 2PUKC 2R37A 3QAGA 5C04A 3RHBA 3KGKA 2MMNA 5FT3A 1G7EA 3WYWA 4KGIA 5F07A 5DJLA 1V98A 3PINA 2Z9SA 5JWRB 3D4TA 1GSDA 1TRVA 2FWEA 2H6ZA 3MAKA 3EYTA 3BCIA 1TJDA 5CYYA 3H4KA 1JZOA 4CHSA 1DBYA 2GSRA 1V2AA 2LRTA 5B7CA 4EC0A 2H01A 3GX0A 1F9MA 2MBTA 5IMFA 4NHWA 3H8QA 5J5NA 1K0OA 1SK0A 1XWAA 2DIYA 2YV7A 4LMVA 2WGRA 2KP2A 3GSSA 3GTUB 4DSSB 20GSA 3C7MA 3QFBC 4OMVA 4EF0A 3M1GA 2VIMA 2VUPA 4PQIA 2K9FA 1SJIA 2LKUA 2GQLA 2AV4A 4PXOA 3P7XA 4XIHA 2HRNA 2B5YA 4NV5A 1IYHA 2P31A 3DMLA 4TKYA 4IVFA 1N8JA 1V40A 5ENUA 1X9WB 3W8SA 2O8VB 4IGJA 3F8UA 1FVJA 2FUG2 5ECQB 3Q19A 4LLRA 4GLTA 4K0GA 2X8CA 3HXSA 5IPHA 1ERVA 2PVQA 1VF2A 1WP0A 1PX7A
chains in the Genus database with same CATH superfamily
2JZTA 2YNXA 5DBQA 2VCWA 1MDJA 3QMXA 1YKAA 3VWWA 2OE0A 4MPGA 3U5RE 3P8WA 2L59A 3HJMA 4FYCA 2PMTA 1RK4A 2PPTA 1PKZA 1ERTA 3QCPA 1OC9B 2DMLA 2R5GA 2JADA 3PR8A 3IC4A 1TP9A 2QA1A 4DSQA 5KOXA 1ML6A 4IJ3A 2LUSA 2TRXA 4PNGA 4MCUA 1XVQA 1G7OA 3IPZA 4A5PA 5ELAA 4KUNA 4ECJA 1SD8A 2RUFA 4HSCX 2V41A 2H70A 4EL1A 3F3QA 3KZQA 5KN1A 1JZRA 4G10A 1PFOA 3K8NA 4K6XA 4ECBA 4TOPA 5JWOB 4GCIA 2CVBA 4X1UA 2OBIA 4QL7A 2C80A 4OFTA 4N0ZA 4EO3A 1K0NA 1O6JA 2BTOT 1BJXA 3C1SA 10GSA 2WZ9A 3VI5A 3WGEA 3RAZA 4EUYA 1O8WA 3EC3A 4MZBA 1ZYPA 5HFKA 4JE1A 3F63A 3FHKA 4HS1A 4EIPA 1CQHA 5DQSA 2V1MA 2L6CA 3KTLA 2PGTA 1USBA 3HZ8A 1PD21 4NHZA 4GWRA 4F0BA 1YJ6A 3HDCA 5HR3A 4ECIA 5IQYA 3GTUA 1R4WA 1UN2A 4DSSA 6GSTA 3UIWA 2YPMA 5JCWA 4J56E 2X99A 1ILOA 3MSZA 3FZAA 1X0RA 1O73A 1ON4A 2YOIA 4OFNA 2UZ8A 1THOA 5F0GA 1LBKA 1PGTA 3W6GA 2CAQA 2H6YA 2VCQA 3EE2A 2KLXA 4HZ4A 2E0QA 3H93A 3L4NA 3NIVA 2H8LA 1GSYA 1ZCPA 3N9JA 3F9UA 2CVKA 2ALBA 1SU9A 1FOHA 5DCGA 1PQNA 3HJOA 5KN3A 4JRRA 5IPGA 1A8YA 2PN8A 1ERWA 5CAXA 1O81A 4TN8A 3M3MA 4P3YB 3DXBA 4HU9A 4KA0A 6GSSA 2X4AA 3TDGA 1UA5A 1PL2A 2YWNA 3US3A 4N30A 5GAPD 1KEBA 2EIQA 4KCAA 2B1KA 4HJMA 1ABAA 2CZ2A 2OKAA 2LQQA 2L4QA 4MZWA 1X5EA 1WMJA 5IO2A 1MDIA 4YQUA 5GZZB 5ECLB 3HVNA 2CAIA 3FY7A 3TKSA 1SL2B 1GRXA 1AQXA 2CZ3A 2WCIA 4EDYA 5CNWA 1OC9A 3OR5A 1Z6MA 1FB6A 3IHQA 5ECHB 3ME8A 5IOXA 3F4TA 4QL9A 2QA2A 2M80A 3LEFA 3QDNA 5A4UA 4MJBA 2NDOA 2FY6A 2GLRA 3UL3A 5IMAA 2H0IA 2GQKA 14GSA 5IM9A 2LV3A 5D8IA 1XWGA 4O32A 2EIOA 1Z5YE 3E3EA 2R0GA 4LA1A 5CRGA 3APOA 1E6BA 2KHPA 2M46A 3LYPA 5HR2A 2C1YA 1A23A 2VCZA 3Q6OA 2GTUA 2MMZA 1G6YA 3IHGA 2GSQA 2ZUPA 5ABRA 2XBQA 5E4WA 3MIXA 1GSEA 1YF0A 3TUEA 4ZBDA 3GFKA 11GSA 1YKCA 4TR0A 4V1Ag 1MEKA 1YQ1A 1GTAA 3A2XA 4H86A 4WR5A 1J9BA 2FNOA 3F6FA 2OA7A 1SKRB 1JFUA 4F82A 2H1DA 3HVSA 2CVDA 3F4RA 2NBSA 5D9VA 2G0FA 5EPFA 1GLPA 2E7PA 1QFNA 5A5KA 4WBRD 3TOTA 3HVXA 1AUCA 2XPDA 3D4MA 2MMOA 4TXVA 3RPPA 1K0MA 4RQRA 5G1LA 17GSA 1SJ6A 1TI3A 2YJHA 2A2PA 2DJJA 3U6VA 4IBPA 2FGXA 5IMZA 1R5PA 5FHIA 2PU9C 3I9V2 4PQ1A 3VPQA 1X9SB 2R0CA 3TKSC 2CT6A 2DKHA 2NPBA 12GSA 1B4PA 1DUGA 2G2QA 4WR4A 1YEPA 3IK7A 5GSSA 5DVBA 1K0CA 2VO4A 4KW6A 2VCXA 4MZCA 1SD9A 1EP8A 3V1WA 3CRUA 2H19A 5GAND 1BG5A 3A2WA 2YZHA 1B9XC 1VRSD 1G6WA 4MJEA 3GKMA 1WOUA 2MZCA 2CX3A 3GKXA 4WXTA 4HEA2 4G0LA 5J4UA 4OWYA 1QGVA 2IMFA 4HJ2A 3TRQA 1EEJA 1HNAA 3TKRA 2F8FA 2HYXA 1B48A 3FRCA 1EEMA 4FIWA 5D93A 3WGDA 1BQ7A 3VLNA 5DALA 3GURA 2LNSA 3DKSA 2IN3A 3VI7A 4EDZA 4K5SA 2DJ2A 2LEGA 6GSUA 2HZEB 4HU7A 2F3MA 2D2ZA 5CREA 1QQ2A 5LNKe 2YV9A 1J08A 1XWCA 5ECRB 4EVMA 4KSMA 4AJ6A 3DD3A 3C1RA 4K7OA 1EZKA 3E9JB 3ME7A 4F9ZA 2L5OA 3VURA 4IP6A 4ZL7A 1EV4A 4V2NA 5ID2B 3G7JA 3UBKA 1GNEA 2JZRA 5ECSA 3FW2A 2JU5A 4AJ7A 3QAWA 3ISOA 2A4HA 2H71A 2VL9A 2LNTA 1OE8A 3VWVA 2WFCA 2H1BA 1Z7RA 4E8HA 2F9SA 3J7Yk 3G7YA 3TGZA 4XS1A 3I6AA 5FWGA 4USSA 5J9CA 4IQAA 3UVTA 2IMDA 2FLSA 1GL8A 3UVHA 2LSTA 4J57E 2B5EA 2A4VA 2DC5A 2I81A 4KDUA 1M9BA 1AQVA 1T4YA 3RPNA 2C0FA 1TRUA 2C8UA 5H5RA 3GKNA 3UBLA 2I1UA 3ZIJA 1PA3A 2HNLA 5ECNB 5ECOB 1T4ZA 3ZITA 4F2IA 3TOUA 4AGSA 2VLUA 2E2MA 1LJRA 6GSWA 5HQPA 3CRTA 4Z2UA 1NHOA 4IQ1A 2ON5A 5E59A 2YCDA 2H1GA 3HKRA 1SYXA 3VWXA 1ERUA 1QXHA 4WF4A 3I69A 4OO4A 4ICYA 1VF4A 3F4SA 1ZZYA 4NAXA 1FB0A 3UMAA 3IR4A 2ES7A 3I43A 2X64A 3KMOA 3FMWA 3M9KA 3SWLA 4Q5QA 2VAFA 3HYPA 1PMTA 4POMA 3FR6A 4J2FA 5ECMB 3TB2A 5DCHA 6GSVA 3A2VA 5B6NA 2MYGA 5ECIB 2ON7A 4MF7A 2XPEA 1JHBA 4YAVA 1RQMA 4JZQA 1K0AA 1NSWA 3LGCA 2TIRA 3FR9A 1M3IA 2KOKA 3H1NA 2R6KA 2HE3A 1LU4A 2OJLA 4WETA 5ELGA 3CYNA 2HZEA 4OO5A 4POKA 4JBBA 2O89A 4YAPA 3D5JA 1EP7A 4F03A 3M8NA 3IXRA 4HOJA 3WT2A 1Y25A 4MF5A 5IO0A 1Z7PA 2FA8A 3MWHA 3LSZA 3L0HA 4ZB9A 1V58A 4IS0A 4MJCA 5ID2A 2VD1A 3D21A 4ULXA 2PWJA 3CTFA 2VCTA 3UOMA 4CY6A 3FR3A 5ECPB 3ZREA 3ED3A 1U3AA 1EOGA 1R26A 2JSZA 1FW1A 4HUAA 3APSA 3G7IA 4WBJA 1RW1A 3TCOA 5HR0A 1AAZA 3HY2A 3P90A 3VWUA 3PH9A 4NMUA 1TDIA 2EC4A 4GRFA 4KH7A 1NW2A 1XFLA 1I5GA 2QGVA 5DDLA 3RHCA 2DSAA 2V6KA 4TRXA 2GSSA 3G9BA 1G0TA 1TK5B 3LORA 2LJRA 4MABA 1EGRA 1MTCA 4PNFA 3CSJA 1PL1A 5BMUA 1GSFA 5F05A 1OC8A 2V6OA 4ZBBA 1OE7A 2VL2A 3VFIA 1YY7A 2JACA 1SL0B 5AIVA 4Q5RA 2MBSA 4G0KA 5B8AA 2IFQB 1J0FA 2H74A 1YZXA 1A0FA 1PSQA 4RQXA 1F37A 2X8HA 1TRSA 5KN0A 2L4CA 1GUKA 1GTUA 1XW9A 1KBNA 3CTGA 4LL4B 1K3YA 3A3TA 3FZ9A 2HSHA 4TR1B 1VGLA 1WIKA 4XTSA 2CX4A 4POLA 1T00A 1K3OA 5G2ZA 4I5QA 3LWAA 2BJXA 16GSA 2RUEA 3EWLA 3LYKA 5IMVA 4KNDA 4IKHA 3F3RA 3GL5A 3TRXA 1FAAA 4XCSA 1SKWB 3MYDA 1Q4JA 5F06A 4GSSA 1K3LA 3IBHA 1GNWA 3UARA 2A2RA 2P5RA 3KEBA 4TXOB 4X4JA 1GH2A 1B9YC 4ZB8A 5DALB 4L5OA 1S3CA 2KUCA 5B8BA 1U87A 4BL7B 1OKTA 1HD2A 5D96A 2WB9A 1TK0B 2C4JA 3WD6A 4I2UA 5G30A 2DJKA 4DSRA 4MA9A 3ZLPA 8GSSA 1M2DA 5DAKB 4PURA 2YANA 4N0VA 4BPYA 1AW9A 4MDCA 2E2GA 2R2JA 4N10A 4KCEA 3MNGA 2H66A 3DRNA 1EV9A 1R5AA 5BRTA 4MLYA 3ZTLA 3FZ5A 1XPVA 1TU7A 3O76A 1A2MA 1SENA 1ZL9A 3ZZXA 2OBKA 2VL2C 3EU4A 2C0DA 4CW9A 1XG8A 2V32A 1MD3A 4MK3A 2PERA 3HCZA 4FQUA 2WULA 4KB3A 2H0GA 2HRKA 5J41A 3RBTA 3EMPA 5F8BA 3GNJA 1WE0A 2P5QA 3L9SA 1OVNA 1PN9A 2LTKA 1HNCA 3FZ4A 3BOAA 2LJAA 3UJ1A 4K9ZA 2EIRA 3D0ZA 2QC7A 3R2QA 6GSYA 1ZOFA 1TTZA 3QPMA 1AIUA 2HSMA 4EXJA 4L8EA 1ZGNA 2B3SA 4O5QA 2AAWA 4ZIJA 19GSA 3D22A 3TJGA 3ZL5A 4IW9A 2GT6A 3Q18A 4O5RA 3DEXA 1S3AA 3CQFA 5KN2A 4BVYB 2LRCA 1UC7A 4Z2RA 1BEDA 4GQCA 2IFQA 5G1KA 4ZL8A 1GLQA 3CXGA 4ZL9A 1O7UA 1SJZA 3ZMKA 2B6MA 4D73B 2GQMA 4OCFA 2NTOA 1GUMA 1M3JA 2HI7A 2VM2A 4GQFA 5IMCA 1EWXA 2GZPA 1FG4A 4BWSA 1T8EB 4TR1A 3IE3A 4ZILA 1SK2A 2K8VA 2N5FA 2YWIA 4G19A 2J23A 2GDRA 2VL3A 1C72A 4IHUA 3LXTA 4FYUA 1U88A 4Q5NA 1U3IA 3GV1A 4MJAA 1SK1A 1XBSA 3NOFA 4O92A 4X43A 5CP1A 2DIZA 3DVXA 4OCEA 4TXOA 1XW5A 2VLVA 13GSA 3LXZA 5G5FA 4GSNA 2AHEA 5AGYA 1CQGA 1AQWA 4G0IA 3W8JA 4BL7A 5D9TA 2AJQB 1T3BA 3EMXA 4IN0A 4BVXB 4I6XA 5CRDA 3KD0A 1UVZA 2YWMA 1HNBA 4CDOA 4MH2A 4O5UA 5DAKA 3UAPA 3S9FA 3KP8A 2X8GA 2HSYA 3IC8A 1VF3A 2K8SA 5JCUA 1F2EA 1AXDA 5EY6A 2H72A 4OD7A 2CQ9A 22GSA 2YJ7A 1FVKA 1B4QA 4XRAA 18GSA 1W4VA 1PN0A 3L9UA 4MNNA 4K8MA 1JZWA 4G9HA 1A8LA 2GT5A 4OFMA 4WKWA 2K6VA 3CMIA 1R7HA 3ZYWA 3KM6A 2AB6A 5H5SA 4NXIA 3E0UA 1ACVA 5KEJA 3QAVA 1DSBA 4EIQA 5AN1A 1A2JA 3BJ5A 4Q5FA 5G5EA 4HI7A 2IMEA 3HHVA 1DE1A 5H5QA 3M0FA 4XRDA 3EU3A 5DJMA 2P0GA 2DMMA 1NM3A 3GYKA 2YWOA 3KH7A 3RDWA 4BVYA 1XOAA 2LRNA 1KNGA 2B7KA 3L78A 1TW9A 3KIJA 3GA4A 2MMAA 1IYIA 1QK8A 3BBYA 1OC3A 4I97A 4KF9A 4TR3A 3QOUA 3TKPA 1Z9HA 4ECCA 2KP1A 1URMA 3GHAA 4D73A 4WF5A 2HT9A 5A4WA 3IAS2 1X9MB 2YN1A 1WRYA 5LD0A 6GSXA 1TKDB 1HQOA 3GIXA 4HZ2A 3R3EA 3C8EA 1I9DA 1X5DA 3ZVJD 1OKDA 2OACA 4YQMA 4O7HA 3LG6A 1B8XA 3SBCA 4PGTA 1OYJA 3ERWA 1GTBA 2JSYA 2AYTA 2L57A 5INYA 1K0BA 1YEXA 3ZRDA 4ML1A 2K18A 1AC1A 4GSTA 3J7Yb 4K7IA 4XS4B 2HRAA 1F3BA 1THXA 3FK8A 4ID0A 4K2DA 2NVLA 1SYRA 4N11A 1NHYA 4ZBAA 3O6TA 4POBA 2V2GA 4FYBA 4V2LA 4V2MA 4BVXA 3ZMLA 3GN3A 3GRXA 5AIXA 3ZIVA 1OAZA 3QR6A 1ST9A 1V9WA 2RIIA 3F0IA 1JZDA 4MF6A 3QFAC 4JR4A 2L6DA 3N5OA 2O87A 1VF1A 2R3XA 3TJFA 4XS6A 2WS2A 3VPTA 4YKFA 3GL3A 1JLWA 2AUVA 3LFLA 2F51A 1W89A 3KP9A 1M2AA 3FKFA 2LS5A 3HD5A 2C3NA 1Y6EA 3GH6A 4JEDA 2OADA 3KXOA 4TVEA 1JLVA 5D9XA 7GSSA 5J3RA 1WPIA 1N2AA 4KDYA 4MPFA 1GSSA 2VOCA 3HJPA 1T1VA 3KH9A 5AISA 2B5XA 1V57A 3HVVA 1PRXA 2N5AA 2H1AA 1TI1A 3CSHA 2H0HA 3GUSA 2REMA 4I8BA 1XWKA 1S3DA 1TK8B 2GS3A 3IRAA 3DWVA 2C0EA 3L9VA 3M9JA 1O8XA 4ZXGA 4K0NA 2IJYA 2CA8A 3DGQA 4GXZA 5KOWA 3MDKA 2WRTA 1Z3EA 2IIYA 3FYGA 2I4AA 2F8AA 3TJJA 1A2LA 3ZFLA 4G2EA 3WGXA 4X0XA 1FO5A 2H73A 1M99A 2OE1A 5D9WA 2DBCA 4BA7A 2XHFA 1BX9A 2HFDA 4L0WA 2VM1A 3CSIA 3IDVA 4YQVA 3F6DA 4FO5A 3GH9A 3AY8A 2R0PA 4IJIA 2HRFA 2B7JA 4DVCA 2FWFA 1GWCA 5CO3A 1WWJA 3KCMA 2WJUA 1XZOA 4CY8A 2GVPA 4YH2A 2N5BA 3HA9A 5JWQB 1ZYEA 2RM6A 2YP6A 3ERGA 1H75A 3TKQA 1A24A 4K2XA 2I9HA 2GSTA 2TRCP 3TKSE 2XBIA 4HQZA 4HQSA 1O85A 1FHEA 1A0RP 2DJ1A 4L0UA 2WDUA 2O7KA 4WEYA 4XS4A 4PQHA 1H4OA 4NWYA 2ZNMA 2BMXA 4RI6A 2H6XA 1XW6A 1XOBA 1M0UA 2GZYA 1YDKA 1GSUA 3LJRA 2PVOC 2QSIA 3NZNA 1YF1A 2DJ0A 4ZB6A 2IMIA 4K5RA 3IAM2 5HFIA 5HR1A 2XC2A 3LQ7A 1GP1A 2FWGA 3TJKA 4I2TA 5IMDA 3IOSA 1SKSB 2H30A 2RM5A 9GSSA 2IWTA 4XHMA 2A2SA 4PX1A 2VCVA 2YZUA 2IMKA 1PKWA 2H76A 2QKEA 1XIYA 2B1LA 4EE0A 5B6MA 4FH8A 3BD2A 1BYEA 1WJKA 3APQA 2C0GA 3GSTA 4E8EA 5L71A 2VD0A 1PX6A 1U6TA 4ISDA 1EOHA 4DEJA 3GMFA 1MD4A 3EVIA 5J9BA 1Q98A 2IPAA 3GX8A 4NV2A 3UEMA 4IELA 1E2YA 3LW9A 3C73A 4PUAA 5A4VA 2FHEA 1HYUA 4TR4A 4BIKA 2FWHA 2ZCTA 2C3QA 2PBJA 4PTSA 1DE2A 2L5LA 3WT1A 3BCKA 3FEUA 2JL4A 2DJ3A 5COHA 1FOVA 3DYRA 4RI7A 2GGTA 4GTUA 4LMWA 2GZZA 5ECKB 3IV4A 2DKIA 5HFGA 1XXUA 4MH3A 5D73A 5CRHA 4ILFA 2R4VA 4PUFC 2J9HA 4KE3A 4V1Ap 4EKZA 1QUWA 4BWQA 4KDXA 2RLIA 4HDEA 5DQYA 3VK9A 1GUHA 3ZVJA 1GSQA 2HLSA 3DVWA 4TW5A 2O85A 3A5IA 3KJYA 2HXKA 2FD3A 2VLTA 3TRPA 5CRWA 2LQOA 3Q74A 4L5LA 3EURA 3TJBA 2C3TA 1M9AA 3C71A 2I3YA 2DLXA 4KAEA 4AJ8A 1M7TA 1F6MC 4MP4A 3KMNA 3GKKA 2LJKA 2OE3A 3O3TA 1K0DA 2JZSA 3JCML 1ZMAA 3QD9A 2IL3A 5IIZA 1XCCA 4GF0A 4JU5A 1KTEA 4Z7XA 1XVWA 4IP1A 2FCHA 1TU8A 4LL1B 4AF2A 4KSOA 3CBUA 3PPUA 3P2AA 3DIEA 4K1FA 4F0CA 4ML6A 1BAYA 3H79A 1T7PB 3D6IA 4QQ7A 1TOFA 4JR6A 4NPBA 3EINA 3IA1A 1QMVA 3ERFA 4YKGA 5G31A 5C00A 2HZFA 1M2BA 4MMMA 1ZYQB 1EGOA 4K7NA 1GULA 4ACSA 4Z2TA 3A5WA 1GTIA 1TRWA 3HZ4A 3EPTA 4KX4A 5LCZA 5EVOA 2CV4A 5IOWA 1SL1B 2M72A 3IK9A 1X5CA 3ZFBA 5EL8A 5GSTA 1F3AA 1Z6NA 1XWBA 3PGTA 3KTBA 4RUVA 1MDKA 2H75A 2FA4A 5JCGA 1TXXA 2PUKC 2R37A 3QAGA 5C04A 3RHBA 3KGKA 2MMNA 5FT3A 1G7EA 3WYWA 4KGIA 5F07A 5DJLA 1V98A 3PINA 2Z9SA 5JWRB 3D4TA 1GSDA 1TRVA 2FWEA 2H6ZA 3MAKA 3EYTA 3BCIA 1TJDA 5CYYA 3H4KA 1JZOA 4CHSA 1DBYA 2GSRA 1V2AA 2LRTA 5B7CA 4EC0A 2H01A 3GX0A 1F9MA 2MBTA 5IMFA 4NHWA 3H8QA 5J5NA 1K0OA 1SK0A 1XWAA 2DIYA 2YV7A 4LMVA 2WGRA 2KP2A 3GSSA 3GTUB 4DSSB 20GSA 2X49A 3C7MA 1ZYNA 3QFBC 4OMVA 4EF0A 3M1GA 2VIMA 2VUPA 4PQIA 2K9FA 1SJIA 2LKUA 2GQLA 2AV4A 4PXOA 3P7XA 4XIHA 2HRNA 2B5YA 4NV5A 1IYHA 2P31A 3DMLA 4TKYA 4IVFA 1N8JA 1S3RA 1V40A 5ENUA 1X9WB 3W8SA 2O8VB 4IGJA 3F8UA 1FVJA 2FUG2 5ECQB 3Q19A 4LLRA 4GLTA 4K0GA 2X8CA 3HXSA 5IPHA 1ERVA 2PVQA 1VF2A 1WP0A 1PX7A
chains in the Genus database with same CATH topology
2JZTA 2YNXA 5DBQA 2VCWA 1MDJA 3QMXA 1YKAA 3VWWA 2OE0A 4MPGA 3U5RE 3P8WA 2L59A 3HJMA 4FYCA 2PMTA 1RK4A 2PPTA 1PKZA 1ERTA 3QCPA 1OC9B 2DMLA 2R5GA 2JADA 3PR8A 3IC4A 1TP9A 2QA1A 4DSQA 5KOXA 1ML6A 4IJ3A 2LUSA 2TRXA 4PNGA 4MCUA 1XVQA 1G7OA 3IPZA 4A5PA 5ELAA 4KUNA 4ECJA 1SD8A 2RUFA 2V41A 2H70A 4EL1A 3F3QA 3KZQA 5KN1A 1JZRA 4G10A 3K8NA 4K6XA 4ECBA 4TOPA 5JWOB 4GCIA 2CVBA 4X1UA 2OBIA 4QL7A 2C80A 4OFTA 4N0ZA 4EO3A 1K0NA 1O6JA 2BTOT 1BJXA 3C1SA 10GSA 2WZ9A 3VI5A 3WGEA 3RAZA 4EUYA 1O8WA 3EC3A 4MZBA 1ZYPA 5HFKA 4JE1A 3F63A 3FHKA 4HS1A 4EIPA 1CQHA 5DQSA 2V1MA 2L6CA 3KTLA 2PGTA 1USBA 3HZ8A 1PD21 4NHZA 4GWRA 4F0BA 1YJ6A 3HDCA 5HR3A 4ECIA 5IQYA 3GTUA 1R4WA 1UN2A 4DSSA 6GSTA 3UIWA 2YPMA 5JCWA 4J56E 2X99A 1ILOA 3MSZA 3FZAA 1X0RA 1O73A 1ON4A 2YOIA 4OFNA 2UZ8A 1THOA 5F0GA 1LBKA 1PGTA 3W6GA 2CAQA 2H6YA 2VCQA 3EE2A 2KLXA 4HZ4A 2E0QA 3H93A 3L4NA 3NIVA 2H8LA 1GSYA 1ZCPA 3N9JA 3F9UA 2CVKA 2ALBA 1SU9A 1FOHA 5DCGA 1PQNA 3HJOA 5KN3A 4JRRA 5IPGA 1A8YA 2PN8A 1ERWA 5CAXA 1O81A 4TN8A 3M3MA 4P3YB 3DXBA 4HU9A 4KA0A 6GSSA 2X4AA 3TDGA 1UA5A 1PL2A 2YWNA 3US3A 4N30A 5GAPD 1KEBA 2EIQA 4KCAA 2B1KA 4HJMA 1ABAA 2CZ2A 2OKAA 2LQQA 2L4QA 4MZWA 1X5EA 1WMJA 5IO2A 1MDIA 4YQUA 5GZZB 5ECLB 2CAIA 3FY7A 3TKSA 1SL2B 1GRXA 1AQXA 2CZ3A 2WCIA 4EDYA 5CNWA 1OC9A 3OR5A 1Z6MA 1FB6A 3IHQA 5ECHB 3ME8A 5IOXA 3F4TA 4QL9A 2QA2A 2M80A 3LEFA 3QDNA 5A4UA 4MJBA 2NDOA 2FY6A 2GLRA 3UL3A 5IMAA 2H0IA 2GQKA 14GSA 5IM9A 2LV3A 5D8IA 1XWGA 4O32A 2EIOA 1Z5YE 3E3EA 2R0GA 4LA1A 5CRGA 3APOA 1E6BA 2KHPA 2M46A 3LYPA 5HR2A 2C1YA 1A23A 2VCZA 3Q6OA 2GTUA 2MMZA 1G6YA 3IHGA 2GSQA 2ZUPA 5ABRA 2XBQA 5E4WA 3MIXA 1GSEA 1YF0A 3TUEA 4ZBDA 3GFKA 11GSA 1YKCA 4TR0A 4V1Ag 1MEKA 1YQ1A 1GTAA 3A2XA 4H86A 4WR5A 1J9BA 2FNOA 3F6FA 2OA7A 1SKRB 1JFUA 4F82A 2H1DA 3HVSA 2CVDA 3F4RA 2NBSA 5D9VA 2G0FA 5EPFA 1GLPA 2E7PA 1QFNA 5A5KA 4WBRD 3TOTA 3HVXA 1AUCA 2XPDA 3D4MA 2MMOA 4TXVA 3RPPA 1K0MA 4RQRA 5G1LA 17GSA 1SJ6A 1TI3A 2YJHA 2A2PA 2DJJA 3U6VA 4IBPA 2FGXA 5IMZA 1R5PA 5FHIA 2PU9C 3I9V2 4PQ1A 3VPQA 1X9SB 2R0CA 3TKSC 2CT6A 2DKHA 2NPBA 12GSA 1B4PA 1DUGA 2G2QA 4WR4A 1YEPA 3IK7A 5GSSA 5DVBA 1K0CA 2VO4A 4KW6A 2VCXA 4MZCA 1SD9A 1EP8A 3V1WA 3CRUA 2H19A 5GAND 1BG5A 3A2WA 2YZHA 1B9XC 1VRSD 1G6WA 4MJEA 3GKMA 1WOUA 2MZCA 2CX3A 3GKXA 4WXTA 4HEA2 4G0LA 5J4UA 4OWYA 1QGVA 2IMFA 4HJ2A 3TRQA 1EEJA 1HNAA 3TKRA 2F8FA 2HYXA 1B48A 3FRCA 1EEMA 4FIWA 5D93A 3WGDA 1BQ7A 3VLNA 5DALA 3GURA 2LNSA 3DKSA 2IN3A 3VI7A 4EDZA 4K5SA 2DJ2A 2LEGA 6GSUA 2HZEB 4HU7A 2F3MA 2D2ZA 5CREA 1QQ2A 5LNKe 2YV9A 1J08A 1XWCA 5ECRB 4EVMA 4KSMA 4AJ6A 3DD3A 3C1RA 4K7OA 1EZKA 3E9JB 3ME7A 4F9ZA 2L5OA 3VURA 4IP6A 4ZL7A 1EV4A 4V2NA 5ID2B 3G7JA 3UBKA 1GNEA 2JZRA 5ECSA 3FW2A 2JU5A 4AJ7A 3QAWA 3ISOA 2A4HA 2H71A 2VL9A 2LNTA 1OE8A 3VWVA 2WFCA 2H1BA 1Z7RA 4E8HA 2F9SA 3J7Yk 3G7YA 3TGZA 4XS1A 3I6AA 5FWGA 4USSA 5J9CA 4IQAA 3UVTA 2IMDA 2FLSA 1GL8A 3UVHA 2LSTA 4J57E 2B5EA 2A4VA 2DC5A 2I81A 4KDUA 1M9BA 1AQVA 1T4YA 3RPNA 2C0FA 1TRUA 2C8UA 5H5RA 3GKNA 3UBLA 2I1UA 3ZIJA 1PA3A 2HNLA 5ECNB 5ECOB 1T4ZA 3ZITA 4F2IA 3TOUA 4AGSA 2VLUA 2E2MA 1LJRA 6GSWA 5HQPA 3CRTA 4Z2UA 1NHOA 4IQ1A 2ON5A 5E59A 2YCDA 2H1GA 3HKRA 1SYXA 3VWXA 1ERUA 1QXHA 4WF4A 3I69A 4OO4A 4ICYA 1VF4A 3F4SA 1ZZYA 4NAXA 1FB0A 3UMAA 3IR4A 2ES7A 3I43A 2X64A 3KMOA 3FMWA 3M9KA 3SWLA 4Q5QA 2VAFA 3HYPA 1PMTA 4POMA 3FR6A 4J2FA 5ECMB 3TB2A 5DCHA 6GSVA 3A2VA 5B6NA 2MYGA 5ECIB 2ON7A 4MF7A 2XPEA 1JHBA 4YAVA 1RQMA 4JZQA 1K0AA 1NSWA 3LGCA 2TIRA 3FR9A 2KOKA 3H1NA 2R6KA 2HE3A 1LU4A 2OJLA 4WETA 5ELGA 3CYNA 2HZEA 4OO5A 4POKA 4JBBA 2O89A 4YAPA 3D5JA 1EP7A 4F03A 3M8NA 3IXRA 4HOJA 3WT2A 1Y25A 4MF5A 5IO0A 1Z7PA 2FA8A 3MWHA 3LSZA 3L0HA 4ZB9A 1V58A 4IS0A 4MJCA 5ID2A 2VD1A 3D21A 4ULXA 2PWJA 3CTFA 2VCTA 3UOMA 4CY6A 3FR3A 5ECPB 3ZREA 3ED3A 1U3AA 1EOGA 1R26A 2JSZA 1FW1A 4HUAA 3APSA 3G7IA 4WBJA 1RW1A 3TCOA 5HR0A 1AAZA 3HY2A 3P90A 3VWUA 3PH9A 4NMUA 1TDIA 2EC4A 4GRFA 4KH7A 1NW2A 1XFLA 1I5GA 2QGVA 5DDLA 3RHCA 2DSAA 2V6KA 4TRXA 2GSSA 3G9BA 1G0TA 1TK5B 3LORA 2LJRA 4MABA 1EGRA 1MTCA 4PNFA 3CSJA 1PL1A 5BMUA 1GSFA 5F05A 1OC8A 2V6OA 4ZBBA 1OE7A 2VL2A 3VFIA 1YY7A 2JACA 1SL0B 5AIVA 4Q5RA 2MBSA 4G0KA 5B8AA 2IFQB 1J0FA 2H74A 1YZXA 1A0FA 1PSQA 4RQXA 1F37A 2X8HA 1TRSA 5KN0A 2L4CA 1GUKA 1GTUA 1XW9A 1KBNA 3CTGA 4LL4B 1K3YA 3A3TA 3FZ9A 2HSHA 4TR1B 1VGLA 1WIKA 4XTSA 2CX4A 4POLA 1T00A 1K3OA 5G2ZA 4I5QA 3LWAA 2BJXA 16GSA 2RUEA 3EWLA 3LYKA 5IMVA 4KNDA 4IKHA 3F3RA 3GL5A 3TRXA 1FAAA 4XCSA 1SKWB 3MYDA 1Q4JA 5F06A 4GSSA 1K3LA 3IBHA 1GNWA 3UARA 2A2RA 2P5RA 3KEBA 4TXOB 4X4JA 1GH2A 1B9YC 4ZB8A 5DALB 4L5OA 1S3CA 2KUCA 5B8BA 1U87A 4BL7B 1OKTA 1HD2A 5D96A 2WB9A 1TK0B 2C4JA 3WD6A 4I2UA 5G30A 2DJKA 4DSRA 4MA9A 3ZLPA 8GSSA 1M2DA 5DAKB 4PURA 2YANA 4N0VA 4BPYA 1AW9A 4MDCA 2E2GA 2R2JA 4N10A 4KCEA 3MNGA 2H66A 3DRNA 1EV9A 1R5AA 5BRTA 4MLYA 3ZTLA 3FZ5A 1XPVA 1TU7A 3O76A 1A2MA 1SENA 1ZL9A 3ZZXA 2OBKA 2VL2C 3EU4A 2C0DA 4CW9A 2V32A 1MD3A 4MK3A 2PERA 3HCZA 4FQUA 2WULA 4KB3A 2H0GA 2HRKA 5J41A 3RBTA 3EMPA 5F8BA 3GNJA 1WE0A 2P5QA 3L9SA 1OVNA 1PN9A 2LTKA 1HNCA 3FZ4A 3BOAA 2LJAA 3UJ1A 4K9ZA 2EIRA 3D0ZA 2QC7A 3R2QA 6GSYA 1ZOFA 1TTZA 3QPMA 1AIUA 2HSMA 4EXJA 4L8EA 1ZGNA 2B3SA 4O5QA 2AAWA 4ZIJA 19GSA 3D22A 3TJGA 3ZL5A 4IW9A 2GT6A 3Q18A 4O5RA 3DEXA 1S3AA 5KN2A 4BVYB 2LRCA 1UC7A 4Z2RA 1BEDA 4GQCA 2IFQA 5G1KA 4ZL8A 1GLQA 3CXGA 4ZL9A 1O7UA 1SJZA 3ZMKA 2B6MA 4D73B 2GQMA 4OCFA 2NTOA 1GUMA 2HI7A 2VM2A 4GQFA 5IMCA 1EWXA 2GZPA 1FG4A 4BWSA 1T8EB 4TR1A 3IE3A 4ZILA 1SK2A 2K8VA 2N5FA 2YWIA 4G19A 2J23A 2GDRA 2VL3A 1C72A 4IHUA 3LXTA 4FYUA 1U88A 4Q5NA 1U3IA 3GV1A 4MJAA 1SK1A 1XBSA 3NOFA 4O92A 4X43A 5CP1A 2DIZA 3DVXA 4OCEA 4TXOA 1XW5A 2VLVA 13GSA 3LXZA 5G5FA 4GSNA 2AHEA 5AGYA 1CQGA 1AQWA 4G0IA 3W8JA 4BL7A 5D9TA 2AJQB 1T3BA 3EMXA 4IN0A 4BVXB 4I6XA 5CRDA 3KD0A 1UVZA 2YWMA 1HNBA 4CDOA 4MH2A 4O5UA 5DAKA 3UAPA 3S9FA 3KP8A 2X8GA 2HSYA 3IC8A 1VF3A 2K8SA 5JCUA 1F2EA 1AXDA 5EY6A 2H72A 4OD7A 2CQ9A 22GSA 2YJ7A 1FVKA 1B4QA 4XRAA 18GSA 1W4VA 1PN0A 3L9UA 4MNNA 4K8MA 1JZWA 4G9HA 1A8LA 2GT5A 4OFMA 4WKWA 2K6VA 3CMIA 1R7HA 3ZYWA 3KM6A 2AB6A 5H5SA 4NXIA 3E0UA 1ACVA 5KEJA 3QAVA 1DSBA 4EIQA 5AN1A 1A2JA 3BJ5A 4Q5FA 5G5EA 4HI7A 2IMEA 3HHVA 1DE1A 5H5QA 3M0FA 4XRDA 3EU3A 5DJMA 2P0GA 2DMMA 1NM3A 3GYKA 2YWOA 3KH7A 3RDWA 4BVYA 1XOAA 2LRNA 1KNGA 2B7KA 3L78A 1TW9A 3KIJA 3GA4A 2MMAA 1IYIA 1QK8A 3BBYA 1OC3A 4I97A 4KF9A 4TR3A 3QOUA 3TKPA 1Z9HA 4ECCA 2KP1A 1URMA 3GHAA 4D73A 4WF5A 2HT9A 5A4WA 3IAS2 1X9MB 2YN1A 1WRYA 5LD0A 6GSXA 1TKDB 1HQOA 3GIXA 4HZ2A 3R3EA 3C8EA 1I9DA 1X5DA 3ZVJD 1OKDA 4YQMA 2OACA 4O7HA 3LG6A 1B8XA 3SBCA 4PGTA 1OYJA 3ERWA 1GTBA 2JSYA 2AYTA 2L57A 5INYA 1K0BA 1YEXA 3ZRDA 4ML1A 2K18A 1AC1A 4GSTA 3J7Yb 4K7IA 4XS4B 2HRAA 1F3BA 1THXA 3FK8A 4ID0A 4K2DA 2NVLA 1SYRA 4N11A 1NHYA 4ZBAA 3O6TA 4POBA 2V2GA 4FYBA 4V2LA 4V2MA 4BVXA 3ZMLA 3GN3A 3GRXA 5AIXA 3ZIVA 1OAZA 3QR6A 1ST9A 1V9WA 2RIIA 3F0IA 1JZDA 4MF6A 3QFAC 4JR4A 2L6DA 3N5OA 2O87A 1VF1A 2R3XA 3TJFA 4XS6A 2WS2A 3VPTA 4YKFA 3GL3A 1JLWA 2AUVA 3LFLA 2F51A 1W89A 3KP9A 1M2AA 3FKFA 2LS5A 3HD5A 2C3NA 1Y6EA 3GH6A 4JEDA 2OADA 3KXOA 4TVEA 1JLVA 5D9XA 7GSSA 5J3RA 1WPIA 1N2AA 4KDYA 4MPFA 1GSSA 2VOCA 3HJPA 1T1VA 3KH9A 5AISA 2B5XA 1V57A 3HVVA 1PRXA 2N5AA 2H1AA 1TI1A 3CSHA 2H0HA 3GUSA 2REMA 4I8BA 1XWKA 1S3DA 1TK8B 2GS3A 3IRAA 3DWVA 2C0EA 3L9VA 3M9JA 1O8XA 4ZXGA 4K0NA 2IJYA 2CA8A 3DGQA 4GXZA 5KOWA 3MDKA 2WRTA 1Z3EA 2IIYA 3FYGA 2I4AA 2F8AA 3TJJA 1A2LA 3ZFLA 4G2EA 3WGXA 4X0XA 1FO5A 2H73A 1M99A 2OE1A 5D9WA 2DBCA 4BA7A 2XHFA 1BX9A 2HFDA 4L0WA 2VM1A 3CSIA 3IDVA 4YQVA 3F6DA 4FO5A 3GH9A 3AY8A 2R0PA 4IJIA 2HRFA 2B7JA 4DVCA 2FWFA 1GWCA 5CO3A 1WWJA 3KCMA 2WJUA 1XZOA 4CY8A 2GVPA 4YH2A 2N5BA 3HA9A 5JWQB 1ZYEA 2RM6A 2YP6A 3ERGA 1H75A 3TKQA 1A24A 4K2XA 2I9HA 2GSTA 2TRCP 3TKSE 2XBIA 4HQZA 4HQSA 1O85A 1FHEA 1A0RP 2DJ1A 4L0UA 2WDUA 2O7KA 4WEYA 4XS4A 4PQHA 1H4OA 4NWYA 2ZNMA 2BMXA 4RI6A 2H6XA 1XW6A 1XOBA 1M0UA 2GZYA 1YDKA 1GSUA 3LJRA 2PVOC 2QSIA 3NZNA 1YF1A 2DJ0A 4ZB6A 2IMIA 4K5RA 3IAM2 5HFIA 5HR1A 2XC2A 3LQ7A 1GP1A 2FWGA 3TJKA 4I2TA 5IMDA 3IOSA 1SKSB 2H30A 2RM5A 9GSSA 2IWTA 4XHMA 2A2SA 4PX1A 2VCVA 2YZUA 2IMKA 1PKWA 2H76A 2QKEA 1XIYA 2B1LA 4EE0A 5B6MA 4FH8A 3BD2A 1BYEA 1WJKA 3APQA 2C0GA 3GSTA 4E8EA 5L71A 2VD0A 1PX6A 1U6TA 4ISDA 1EOHA 4DEJA 3GMFA 1MD4A 3EVIA 5J9BA 1Q98A 2IPAA 3GX8A 4NV2A 3UEMA 4IELA 1E2YA 3LW9A 3C73A 4PUAA 5A4VA 2FHEA 1HYUA 4TR4A 2FWHA 2ZCTA 2C3QA 2PBJA 4PTSA 1DE2A 2L5LA 3WT1A 3BCKA 3FEUA 2JL4A 2DJ3A 5COHA 1FOVA 3DYRA 4RI7A 2GGTA 4GTUA 4LMWA 2GZZA 5ECKB 3IV4A 2DKIA 5HFGA 1XXUA 4MH3A 5D73A 5CRHA 4ILFA 2R4VA 4PUFC 2J9HA 4KE3A 4V1Ap 4EKZA 1QUWA 4BWQA 4KDXA 2RLIA 4HDEA 5DQYA 3VK9A 1GUHA 3ZVJA 1GSQA 2HLSA 3DVWA 4TW5A 2O85A 3A5IA 3KJYA 2HXKA 2FD3A 2VLTA 3TRPA 5CRWA 2LQOA 3Q74A 4L5LA 3EURA 3TJBA 2C3TA 1M9AA 3C71A 2I3YA 2DLXA 4KAEA 4AJ8A 1M7TA 1F6MC 4MP4A 3KMNA 3GKKA 2LJKA 2OE3A 3O3TA 1K0DA 2JZSA 3JCML 1ZMAA 3QD9A 2IL3A 5IIZA 1XCCA 4GF0A 4JU5A 1KTEA 4Z7XA 1XVWA 4IP1A 2FCHA 1TU8A 4LL1B 4AF2A 4KSOA 3CBUA 3PPUA 3P2AA 3DIEA 4K1FA 4F0CA 4ML6A 1BAYA 3H79A 1T7PB 3D6IA 4QQ7A 1TOFA 4JR6A 4NPBA 3EINA 3IA1A 1QMVA 3ERFA 4YKGA 5G31A 5C00A 2HZFA 1M2BA 4MMMA 1ZYQB 1EGOA 4K7NA 1GULA 4ACSA 4Z2TA 3A5WA 1GTIA 1TRWA 3HZ4A 3EPTA 4KX4A 5LCZA 5EVOA 2CV4A 5IOWA 1SL1B 2M72A 3IK9A 1X5CA 3ZFBA 5EL8A 5GSTA 1F3AA 1Z6NA 1XWBA 3PGTA 3KTBA 4RUVA 1MDKA 2H75A 2FA4A 5JCGA 1TXXA 2PUKC 2R37A 3QAGA 5C04A 3RHBA 3KGKA 2MMNA 5FT3A 1G7EA 3WYWA 4KGIA 5F07A 5DJLA 1V98A 3PINA 2Z9SA 5JWRB 3D4TA 1GSDA 1TRVA 2FWEA 2H6ZA 3MAKA 3EYTA 3BCIA 1TJDA 5CYYA 3H4KA 1JZOA 4CHSA 1DBYA 2GSRA 1V2AA 2LRTA 5B7CA 4EC0A 2H01A 3GX0A 1F9MA 2MBTA 5IMFA 4NHWA 3H8QA 5J5NA 1K0OA 1SK0A 1XWAA 2DIYA 2YV7A 4LMVA 2WGRA 2KP2A 3GSSA 3GTUB 4DSSB 20GSA 2X49A 3C7MA 1ZYNA 3QFBC 4OMVA 4EF0A 3M1GA 2VIMA 2VUPA 4PQIA 2K9FA 1SJIA 2LKUA 2GQLA 2AV4A 4PXOA 3P7XA 4XIHA 2HRNA 2B5YA 4NV5A 1IYHA 2P31A 3DMLA 4TKYA 4IVFA 1N8JA 1V40A 5ENUA 1X9WB 3W8SA 2O8VB 4IGJA 3F8UA 1FVJA 2FUG2 5ECQB 3Q19A 4LLRA 4GLTA 4K0GA 2X8CA 3HXSA 5IPHA 1ERVA 2PVQA 1VF2A 1WP0A 1PX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZT A;  2YNX A;  5DBQ A;  2VCW A;  1MDJ A;  3QMX A;  1YKA A;  3VWW A;  2OE0 A;  4MPG A;  3U5R E;  3P8W A;  2L59 A;  3HJM A;  4FYC A;  2PMT A;  1RK4 A;  2PPT A;  1PKZ A;  1ERT A;  3QCP A;  1OC9 B;  2DML A;  2R5G A;  2JAD A;  3PR8 A;  3IC4 A;  1TP9 A;  4DSQ A;  1ML6 A;  4IJ3 A;  2LUS A;  2TRX A;  4PNG A;  4MCU A;  1XVQ A;  1G7O A;  3IPZ A;  5ELA A;  4KUN A;  4ECJ A;  1SD8 A;  2RUF A;  2V41 A;  2H70 A;  4EL1 A;  3F3Q A;  3KZQ A;  5KN1 A;  1JZR A;  4G10 A;  3K8N A;  4K6X A;  4ECB A;  4TOP A;  5JWO B;  4GCI A;  2CVB A;  4X1U A;  2OBI A;  4QL7 A;  2C80 A;  4OFT A;  4N0Z A;  4EO3 A;  1K0N A;  1O6J A;  2BTO T;  1BJX A;  3C1S A;  10GS A;  2WZ9 A;  3VI5 A;  3WGE A;  3RAZ A;  4EUY A;  1O8W A;  3EC3 A;  4MZB A;  5HFK A;  4JE1 A;  3F63 A;  3FHK A;  4HS1 A;  1CQH A;  5DQS A;  2V1M A;  2L6C A;  3KTL A;  2PGT A;  1USB A;  3HZ8 A;  1PD2 1;  4NHZ A;  4GWR A;  4F0B A;  1YJ6 A;  3HDC A;  5HR3 A;  4ECI A;  5IQY A;  3GTU A;  1R4W A;  1UN2 A;  4DSS A;  6GST A;  3UIW A;  2YPM A;  5JCW A;  4J56 E;  2X99 A;  1ILO A;  3MSZ A;  3FZA A;  1X0R A;  1O73 A;  1ON4 A;  2YOI A;  4OFN A;  1THO A;  5F0G A;  1LBK A;  1PGT A;  3W6G A;  2CAQ A;  2H6Y A;  2VCQ A;  3EE2 A;  2KLX A;  4HZ4 A;  2E0Q A;  3H93 A;  3L4N A;  3NIV A;  2H8L A;  1GSY A;  1ZCP A;  3N9J A;  3F9U A;  2CVK A;  2ALB A;  1SU9 A;  5DCG A;  1PQN A;  3HJO A;  5KN3 A;  4JRR A;  5IPG A;  1A8Y A;  2PN8 A;  1ERW A;  5CAX A;  1O81 A;  4TN8 A;  3M3M A;  4P3Y B;  3DXB A;  4HU9 A;  4KA0 A;  6GSS A;  3TDG A;  1UA5 A;  1PL2 A;  2YWN A;  3US3 A;  4N30 A;  5GAP D;  1KEB A;  2EIQ A;  4KCA A;  2B1K A;  4HJM A;  1ABA A;  2CZ2 A;  2OKA A;  2LQQ A;  2L4Q A;  4MZW A;  1X5E A;  1WMJ A;  5IO2 A;  1MDI A;  4YQU A;  5GZZ B;  5ECL B;  2CAI A;  3FY7 A;  3TKS A;  1SL2 B;  1GRX A;  1AQX A;  2CZ3 A;  2WCI A;  4EDY A;  5CNW A;  1OC9 A;  3OR5 A;  1Z6M A;  1FB6 A;  3IHQ A;  5ECH B;  3ME8 A;  5IOX A;  3F4T A;  4QL9 A;  3LEF A;  2M80 A;  3QDN A;  5A4U A;  4MJB A;  2NDO A;  2FY6 A;  2GLR A;  3UL3 A;  5IMA A;  2H0I A;  2GQK A;  14GS A;  5IM9 A;  2LV3 A;  5D8I A;  1XWG A;  4O32 A;  2EIO A;  1Z5Y E;  3E3E A;  4LA1 A;  5CRG A;  3APO A;  1E6B A;  2KHP A;  2M46 A;  3LYP A;  5HR2 A;  2C1Y A;  1A23 A;  2VCZ A;  3Q6O A;  2GTU A;  2MMZ A;  1G6Y A;  2GSQ A;  2ZUP A;  5ABR A;  2XBQ A;  5E4W A;  1GSE A;  1YF0 A;  3TUE A;  4ZBD A;  3GFK A;  11GS A;  1YKC A;  4TR0 A;  4V1A g;  1MEK A;  1YQ1 A;  1GTA A;  3A2X A;  4H86 A;  4WR5 A;  1J9B A;  2FNO A;  3F6F A;  2OA7 A;  1SKR B;  1JFU A;  4F82 A;  2H1D A;  3HVS A;  2CVD A;  3F4R A;  2NBS A;  5D9V A;  2G0F A;  5EPF A;  1GLP A;  2E7P A;  1QFN A;  5A5K A;  4WBR D;  3TOT A;  3HVX A;  1AUC A;  2XPD A;  3D4M A;  2MMO A;  4TXV A;  3RPP A;  1K0M A;  4RQR A;  5G1L A;  17GS A;  1SJ6 A;  1TI3 A;  2YJH A;  2DJJ A;  3U6V A;  4IBP A;  2FGX A;  5IMZ A;  1R5P A;  5FHI A;  2PU9 C;  3I9V 2;  4PQ1 A;  3VPQ A;  1X9S B;  3TKS C;  2CT6 A;  2NPB A;  12GS A;  1B4P A;  1DUG A;  2G2Q A;  4WR4 A;  1YEP A;  3IK7 A;  5GSS A;  5DVB A;  1K0C A;  2VO4 A;  4KW6 A;  2VCX A;  4MZC A;  1SD9 A;  1EP8 A;  3V1W A;  3CRU A;  2H19 A;  5GAN D;  1BG5 A;  3A2W A;  2YZH A;  1B9X C;  1VRS D;  1G6W A;  4MJE A;  3GKM A;  1WOU A;  2MZC A;  2CX3 A;  3GKX A;  4WXT A;  4HEA 2;  5J4U A;  4OWY A;  1QGV A;  2IMF A;  4HJ2 A;  3TRQ A;  1EEJ A;  1HNA A;  3TKR A;  2F8F A;  2HYX A;  1B48 A;  3FRC A;  1EEM A;  4FIW A;  5D93 A;  3WGD A;  1BQ7 A;  3VLN A;  5DAL A;  3GUR A;  2LNS A;  3DKS A;  2IN3 A;  3VI7 A;  4EDZ A;  2DJ2 A;  2LEG A;  6GSU A;  2HZE B;  4HU7 A;  2F3M A;  2D2Z A;  5CRE A;  1QQ2 A;  5LNK e;  2YV9 A;  1J08 A;  1XWC A;  5ECR B;  4EVM A;  4KSM A;  4AJ6 A;  3DD3 A;  3C1R A;  4K7O A;  1EZK A;  3E9J B;  3ME7 A;  4F9Z A;  2L5O A;  3VUR A;  4IP6 A;  4ZL7 A;  1EV4 A;  4V2N A;  5ID2 B;  3G7J A;  3UBK A;  1GNE A;  2JZR A;  5ECS A;  3FW2 A;  2JU5 A;  4AJ7 A;  3QAW A;  3ISO A;  2H71 A;  2VL9 A;  2LNT A;  1OE8 A;  3VWV A;  2WFC A;  2H1B A;  1Z7R A;  4E8H A;  2F9S A;  3J7Y k;  3G7Y A;  3TGZ A;  4XS1 A;  3I6A A;  5FWG A;  5J9C A;  4IQA A;  3UVT A;  2IMD A;  2FLS A;  1GL8 A;  3UVH A;  2LST A;  4J57 E;  2B5E A;  2A4V A;  2DC5 A;  2I81 A;  4KDU A;  1M9B A;  1AQV A;  1T4Y A;  3RPN A;  2C0F A;  1TRU A;  2C8U A;  5H5R A;  3GKN A;  3UBL A;  2I1U A;  3ZIJ A;  1PA3 A;  2HNL A;  5ECN B;  5ECO B;  1T4Z A;  3ZIT A;  4F2I A;  3TOU A;  4AGS A;  2VLU A;  2E2M A;  1LJR A;  6GSW A;  5HQP A;  3CRT A;  1NHO A;  4IQ1 A;  2ON5 A;  5E59 A;  2YCD A;  2H1G A;  3HKR A;  1SYX A;  3VWX A;  1ERU A;  1QXH A;  4WF4 A;  3I69 A;  4OO4 A;  1VF4 A;  3F4S A;  1ZZY A;  4NAX A;  1FB0 A;  3UMA A;  3IR4 A;  2ES7 A;  3I43 A;  2X64 A;  3KMO A;  3M9K A;  3SWL A;  4Q5Q A;  2VAF A;  3HYP A;  1PMT A;  4POM A;  3FR6 A;  4J2F A;  5ECM B;  3TB2 A;  5DCH A;  6GSV A;  3A2V A;  5B6N A;  2MYG A;  5ECI B;  2ON7 A;  4MF7 A;  2XPE A;  1JHB A;  4YAV A;  1RQM A;  4JZQ A;  1K0A A;  1NSW A;  3LGC A;  2TIR A;  3FR9 A;  2KOK A;  3H1N A;  2R6K A;  2HE3 A;  1LU4 A;  2OJL A;  4WET A;  5ELG A;  3CYN A;  2HZE A;  4OO5 A;  4POK A;  4JBB A;  2O89 A;  4YAP A;  3D5J A;  1EP7 A;  4F03 A;  3M8N A;  3IXR A;  4HOJ A;  3WT2 A;  1Y25 A;  4MF5 A;  5IO0 A;  1Z7P A;  2FA8 A;  3MWH A;  3LSZ A;  3L0H A;  4ZB9 A;  1V58 A;  4IS0 A;  4MJC A;  5ID2 A;  2VD1 A;  3D21 A;  4ULX A;  2PWJ A;  3CTF A;  2VCT A;  3UOM A;  3FR3 A;  5ECP B;  3ZRE A;  3ED3 A;  1U3A A;  1EOG A;  1R26 A;  2JSZ A;  1FW1 A;  4HUA A;  3APS A;  3G7I A;  4WBJ A;  1RW1 A;  3TCO A;  5HR0 A;  1AAZ A;  3HY2 A;  3P90 A;  3VWU A;  3PH9 A;  4NMU A;  1TDI A;  2EC4 A;  4GRF A;  4KH7 A;  1NW2 A;  1XFL A;  1I5G A;  2QGV A;  5DDL A;  3RHC A;  2DSA A;  2V6K A;  4TRX A;  2GSS A;  3G9B A;  1G0T A;  1TK5 B;  3LOR A;  2LJR A;  4MAB A;  1EGR A;  1MTC A;  4PNF A;  3CSJ A;  1PL1 A;  1GSF A;  5F05 A;  1OC8 A;  2V6O A;  4ZBB A;  1OE7 A;  2VL2 A;  3VFI A;  1YY7 A;  2JAC A;  1SL0 B;  5AIV A;  4Q5R A;  2MBS A;  5B8A A;  2IFQ B;  1J0F A;  2H74 A;  1YZX A;  1A0F A;  1PSQ A;  4RQX A;  1F37 A;  2X8H A;  1TRS A;  5KN0 A;  2L4C A;  1GUK A;  1GTU A;  1XW9 A;  1KBN A;  3CTG A;  4LL4 B;  1K3Y A;  3A3T A;  3FZ9 A;  2HSH A;  4TR1 B;  1VGL A;  1WIK A;  4XTS A;  2CX4 A;  4POL A;  1T00 A;  1K3O A;  5G2Z A;  4I5Q A;  3LWA A;  2BJX A;  16GS A;  2RUE A;  3EWL A;  3LYK A;  5IMV A;  4KND A;  4IKH A;  3F3R A;  3GL5 A;  3TRX A;  1FAA A;  4XCS A;  1SKW B;  1Q4J A;  5F06 A;  4GSS A;  1K3L A;  3IBH A;  1GNW A;  3UAR A;  2A2R A;  2P5R A;  3KEB A;  4TXO B;  1GH2 A;  1B9Y C;  4ZB8 A;  5DAL B;  4L5O A;  1S3C A;  2KUC A;  5B8B A;  1U87 A;  1OKT A;  1HD2 A;  5D96 A;  2WB9 A;  1TK0 B;  2C4J A;  3WD6 A;  4I2U A;  5G30 A;  2DJK A;  4DSR A;  4MA9 A;  3ZLP A;  8GSS A;  1M2D A;  5DAK B;  4PUR A;  2YAN A;  4N0V A;  4BPY A;  1AW9 A;  4MDC A;  2E2G A;  2R2J A;  4N10 A;  4KCE A;  3MNG A;  2H66 A;  3DRN A;  1EV9 A;  1R5A A;  4MLY A;  3ZTL A;  3FZ5 A;  1XPV A;  1TU7 A;  3O76 A;  1A2M A;  1SEN A;  1ZL9 A;  3ZZX A;  2OBK A;  2VL2 C;  3EU4 A;  2C0D A;  4CW9 A;  2V32 A;  1MD3 A;  4MK3 A;  2PER A;  3HCZ A;  2WUL A;  4KB3 A;  2H0G A;  5J41 A;  3RBT A;  3EMP A;  5F8B A;  3GNJ A;  1WE0 A;  2P5Q A;  3L9S A;  1OVN A;  1PN9 A;  2LTK A;  1HNC A;  3FZ4 A;  3BOA A;  2LJA A;  3UJ1 A;  4K9Z A;  2EIR A;  3D0Z A;  2QC7 A;  3R2Q A;  6GSY A;  1ZOF A;  1TTZ A;  3QPM A;  1AIU A;  4EXJ A;  4L8E A;  1ZGN A;  2B3S A;  2AAW A;  4ZIJ A;  19GS A;  3D22 A;  3TJG A;  3ZL5 A;  4IW9 A;  2GT6 A;  3Q18 A;  4O5R A;  3DEX A;  1S3A A;  5KN2 A;  2LRC A;  1UC7 A;  1BED A;  4GQC A;  2IFQ A;  5G1K A;  4ZL8 A;  1GLQ A;  3CXG A;  4ZL9 A;  1O7U A;  1SJZ A;  3ZMK A;  2B6M A;  4D73 B;  2GQM A;  4OCF A;  2NTO A;  1GUM A;  2HI7 A;  2VM2 A;  4GQF A;  5IMC A;  1EWX A;  2GZP A;  1FG4 A;  4BWS A;  1T8E B;  4TR1 A;  3IE3 A;  4ZIL A;  1SK2 A;  2K8V A;  2N5F A;  2YWI A;  4G19 A;  2J23 A;  2GDR A;  2VL3 A;  1C72 A;  4IHU A;  3LXT A;  4FYU A;  1U88 A;  4Q5N A;  1U3I A;  3GV1 A;  4MJA A;  1SK1 A;  1XBS A;  3NOF A;  4O92 A;  4X43 A;  5CP1 A;  2DIZ A;  3DVX A;  4OCE A;  4TXO A;  1XW5 A;  2VLV A;  13GS A;  3LXZ A;  5G5F A;  4GSN A;  2AHE A;  5AGY A;  1CQG A;  1AQW A;  3W8J A;  4BL7 A;  5D9T A;  2AJQ B;  1T3B A;  3EMX A;  4IN0 A;  4I6X A;  5CRD A;  3KD0 A;  1UVZ A;  2YWM A;  1HNB A;  4CDO A;  4MH2 A;  5DAK A;  3UAP A;  3S9F A;  3KP8 A;  2X8G A;  2HSY A;  1VF3 A;  2K8S A;  5JCU A;  1F2E A;  1AXD A;  5EY6 A;  2H72 A;  4OD7 A;  2CQ9 A;  22GS A;  2YJ7 A;  1FVK A;  1B4Q A;  4XRA A;  18GS A;  1W4V A;  3L9U A;  4K8M A;  1JZW A;  4G9H A;  1A8L A;  2GT5 A;  4OFM A;  4WKW A;  2K6V A;  3CMI A;  1R7H A;  3ZYW A;  3KM6 A;  2AB6 A;  5H5S A;  4NXI A;  3E0U A;  1ACV A;  5KEJ A;  3QAV A;  1DSB A;  5AN1 A;  1A2J A;  3BJ5 A;  4Q5F A;  5G5E A;  4HI7 A;  2IME A;  3HHV A;  1DE1 A;  5H5Q A;  3M0F A;  4XRD A;  3EU3 A;  5DJM A;  2P0G A;  2DMM A;  1NM3 A;  3GYK A;  2YWO A;  3KH7 A;  3RDW A;  4BVY A;  1XOA A;  2LRN A;  1KNG A;  2B7K A;  3L78 A;  1TW9 A;  3KIJ A;  3GA4 A;  2MMA A;  1IYI A;  1QK8 A;  3BBY A;  1OC3 A;  4I97 A;  4TR3 A;  3QOU A;  3TKP A;  1Z9H A;  4ECC A;  2KP1 A;  1URM A;  3GHA A;  4D73 A;  4WF5 A;  2HT9 A;  5A4W A;  3IAS 2;  1X9M B;  2YN1 A;  1WRY A;  5LD0 A;  6GSX A;  1TKD B;  1HQO A;  3GIX A;  4HZ2 A;  3C8E A;  1I9D A;  1X5D A;  3ZVJ D;  1OKD A;  4YQM A;  2OAC A;  4O7H A;  3LG6 A;  1B8X A;  3SBC A;  4PGT A;  1OYJ A;  3ERW A;  1GTB A;  2JSY A;  2AYT A;  2L57 A;  5INY A;  1K0B A;  1YEX A;  3ZRD A;  4ML1 A;  2K18 A;  1AC1 A;  4GST A;  3J7Y b;  4K7I A;  4XS4 B;  1F3B A;  1THX A;  3FK8 A;  4ID0 A;  4K2D A;  2NVL A;  1SYR A;  4N11 A;  1NHY A;  4ZBA A;  3O6T A;  4POB A;  2V2G A;  4FYB A;  4V2L A;  4V2M A;  4BVX A;  3ZML A;  3GN3 A;  3GRX A;  5AIX A;  3ZIV A;  1OAZ A;  3QR6 A;  1ST9 A;  1V9W A;  2RII A;  3F0I A;  1JZD A;  4MF6 A;  3QFA C;  4JR4 A;  2L6D A;  3N5O A;  2O87 A;  1VF1 A;  2R3X A;  3TJF A;  4XS6 A;  2WS2 A;  3VPT A;  3GL3 A;  1JLW A;  2AUV A;  3LFL A;  2F51 A;  1W89 A;  3KP9 A;  1M2A A;  3FKF A;  2LS5 A;  3HD5 A;  2C3N A;  1Y6E A;  3GH6 A;  4JED A;  2OAD A;  3KXO A;  4TVE A;  1JLV A;  5D9X A;  7GSS A;  5J3R A;  1WPI A;  1N2A A;  4KDY A;  4MPF A;  1GSS A;  2VOC A;  3HJP A;  1T1V A;  3KH9 A;  5AIS A;  2B5X A;  1V57 A;  3HVV A;  1PRX A;  2N5A A;  2H1A A;  1TI1 A;  3CSH A;  2H0H A;  3GUS A;  2REM A;  4I8B A;  1XWK A;  1S3D A;  1TK8 B;  2GS3 A;  3IRA A;  3DWV A;  2C0E A;  3L9V A;  3M9J A;  1O8X A;  4ZXG A;  4K0N A;  2IJY A;  2CA8 A;  3DGQ A;  4GXZ A;  3MDK A;  2WRT A;  1Z3E A;  2IIY A;  3FYG A;  2I4A A;  2F8A A;  3TJJ A;  1A2L A;  3ZFL A;  4G2E A;  3WGX A;  4X0X A;  1FO5 A;  2H73 A;  1M99 A;  2OE1 A;  5D9W A;  2DBC A;  4BA7 A;  2XHF A;  1BX9 A;  2HFD A;  4L0W A;  2VM1 A;  3CSI A;  3IDV A;  4YQV A;  3F6D A;  4FO5 A;  3GH9 A;  3AY8 A;  4IJI A;  2HRF A;  2B7J A;  4DVC A;  2FWF A;  1GWC A;  5CO3 A;  1WWJ A;  3KCM A;  2WJU A;  1XZO A;  2GVP A;  4YH2 A;  2N5B A;  3HA9 A;  5JWQ B;  1ZYE A;  2RM6 A;  2YP6 A;  3ERG A;  1H75 A;  3TKQ A;  1A24 A;  2I9H A;  2GST A;  2TRC P;  3TKS E;  2XBI A;  4HQZ A;  4HQS A;  1O85 A;  1FHE A;  1A0R P;  2DJ1 A;  4L0U A;  2WDU A;  2O7K A;  4WEY A;  4XS4 A;  4PQH A;  1H4O A;  4NWY A;  2ZNM A;  2BMX A;  4RI6 A;  2H6X A;  1XW6 A;  1XOB A;  1M0U A;  2GZY A;  1YDK A;  1GSU A;  3LJR A;  2PVO C;  2QSI A;  3NZN A;  1YF1 A;  2DJ0 A;  4ZB6 A;  2IMI A;  3IAM 2;  5HFI A;  5HR1 A;  2XC2 A;  3LQ7 A;  1GP1 A;  2FWG A;  3TJK A;  4I2T A;  5IMD A;  3IOS A;  1SKS B;  2H30 A;  2RM5 A;  9GSS A;  2IWT A;  4XHM A;  2A2S A;  4PX1 A;  2VCV A;  2YZU A;  2IMK A;  1PKW A;  2H76 A;  2QKE A;  1XIY A;  2B1L A;  4EE0 A;  5B6M A;  4FH8 A;  3BD2 A;  1BYE A;  1WJK A;  3APQ A;  2C0G A;  3GST A;  4E8E A;  5L71 A;  2VD0 A;  1PX6 A;  1U6T A;  4ISD A;  1EOH A;  4DEJ A;  3GMF A;  1MD4 A;  3EVI A;  5J9B A;  1Q98 A;  2IPA A;  3GX8 A;  4NV2 A;  3UEM A;  4IEL A;  1E2Y A;  3C73 A;  4PUA A;  5A4V A;  2FHE A;  1HYU A;  4TR4 A;  2FWH A;  2ZCT A;  2C3Q A;  2PBJ A;  1DE2 A;  2L5L A;  3WT1 A;  3BCK A;  3FEU A;  2JL4 A;  2DJ3 A;  5COH A;  1FOV A;  3DYR A;  4RI7 A;  2GGT A;  4GTU A;  4LMW A;  2GZZ A;  5ECK B;  3IV4 A;  5HFG A;  1XXU A;  4MH3 A;  5D73 A;  5CRH A;  4ILF A;  2R4V A;  4PUF C;  2J9H A;  4KE3 A;  4V1A p;  4EKZ A;  1QUW A;  4BWQ A;  4KDX A;  2RLI A;  4HDE A;  5DQY A;  3VK9 A;  1GUH A;  3ZVJ A;  1GSQ A;  2HLS A;  3DVW A;  4TW5 A;  2O85 A;  3KJY A;  2HXK A;  2FD3 A;  2VLT A;  3TRP A;  5CRW A;  2LQO A;  3Q74 A;  4L5L A;  3EUR A;  3TJB A;  2C3T A;  1M9A A;  3C71 A;  2I3Y A;  2DLX A;  4KAE A;  4AJ8 A;  1M7T A;  1F6M C;  4MP4 A;  3KMN A;  3GKK A;  2LJK A;  2OE3 A;  3O3T A;  1K0D A;  2JZS A;  3JCM L;  1ZMA A;  3QD9 A;  2IL3 A;  5IIZ A;  1XCC A;  4GF0 A;  4JU5 A;  1KTE A;  4Z7X A;  1XVW A;  4IP1 A;  2FCH A;  1TU8 A;  4LL1 B;  4AF2 A;  4KSO A;  3CBU A;  3P2A A;  3DIE A;  4K1F A;  4F0C A;  4ML6 A;  1BAY A;  3H79 A;  1T7P B;  3D6I A;  4QQ7 A;  1TOF A;  4JR6 A;  4NPB A;  3EIN A;  3IA1 A;  1QMV A;  3ERF A;  5G31 A;  5C00 A;  2HZF A;  1M2B A;  4MMM A;  1ZYQ B;  1EGO A;  4K7N A;  1GUL A;  4ACS A;  3A5W A;  1GTI A;  1TRW A;  3HZ4 A;  4KX4 A;  5LCZ A;  5EVO A;  2CV4 A;  5IOW A;  1SL1 B;  2M72 A;  3IK9 A;  1X5C A;  3ZFB A;  5EL8 A;  5GST A;  1F3A A;  1Z6N A;  1XWB A;  3PGT A;  3KTB A;  4RUV A;  1MDK A;  2H75 A;  2FA4 A;  5JCG A;  1TXX A;  2PUK C;  2R37 A;  3QAG A;  5C04 A;  3RHB A;  3KGK A;  2MMN A;  5FT3 A;  1G7E A;  3WYW A;  4KGI A;  5F07 A;  5DJL A;  1V98 A;  3PIN A;  2Z9S A;  5JWR B;  3D4T A;  1GSD A;  1TRV A;  2FWE A;  2H6Z A;  3MAK A;  3EYT A;  3BCI A;  1TJD A;  5CYY A;  3H4K A;  1JZO A;  4CHS A;  1DBY A;  2GSR A;  1V2A A;  2LRT A;  5B7C A;  4EC0 A;  2H01 A;  3GX0 A;  1F9M A;  2MBT A;  5IMF A;  4NHW A;  3H8Q A;  5J5N A;  1K0O A;  1SK0 A;  1XWA A;  2DIY A;  2YV7 A;  4LMV A;  2WGR A;  2KP2 A;  3GSS A;  3GTU B;  4DSS B;  20GS A;  3C7M A;  3QFB C;  4OMV A;  4EF0 A;  3M1G A;  2VIM A;  2VUP A;  4PQI A;  2K9F A;  1SJI A;  2LKU A;  2GQL A;  2AV4 A;  4PXO A;  3P7X A;  4XIH A;  2HRN A;  2B5Y A;  4NV5 A;  1IYH A;  2P31 A;  3DML A;  4TKY A;  4IVF A;  1N8J A;  1V40 A;  5ENU A;  1X9W B;  3W8S A;  2O8V B;  4IGJ A;  3F8U A;  1FVJ A;  2FUG 2;  5ECQ B;  3Q19 A;  4LLR A;  4GLT A;  4K0G A;  2X8C A;  3HXS A;  5IPH A;  1ERV A;  2PVQ A;  1VF2 A;  1WP0 A;  1PX7 A; 
#chains in the Genus database with same CATH topology
 2JZT A;  2YNX A;  5DBQ A;  2VCW A;  1MDJ A;  3QMX A;  1YKA A;  3VWW A;  2OE0 A;  4MPG A;  3U5R E;  3P8W A;  2L59 A;  3HJM A;  4FYC A;  2PMT A;  1RK4 A;  2PPT A;  1PKZ A;  1ERT A;  3QCP A;  1OC9 B;  2DML A;  2R5G A;  2JAD A;  3PR8 A;  3IC4 A;  1TP9 A;  2QA1 A;  4DSQ A;  5KOX A;  1ML6 A;  4IJ3 A;  2LUS A;  2TRX A;  4PNG A;  4MCU A;  1XVQ A;  1G7O A;  3IPZ A;  4A5P A;  5ELA A;  4KUN A;  4ECJ A;  1SD8 A;  2RUF A;  4HSC X;  2V41 A;  2H70 A;  4EL1 A;  3F3Q A;  3KZQ A;  5KN1 A;  1JZR A;  4G10 A;  1PFO A;  3K8N A;  4K6X A;  4ECB A;  4TOP A;  5JWO B;  4GCI A;  2CVB A;  4X1U A;  2OBI A;  4QL7 A;  2C80 A;  4OFT A;  4N0Z A;  4EO3 A;  1K0N A;  1O6J A;  2BTO T;  1BJX A;  3C1S A;  10GS A;  2WZ9 A;  3VI5 A;  3WGE A;  3RAZ A;  4EUY A;  1O8W A;  3EC3 A;  4MZB A;  1ZYP A;  5HFK A;  4JE1 A;  3F63 A;  3FHK A;  4HS1 A;  4EIP A;  1CQH A;  5DQS A;  2V1M A;  2L6C A;  3KTL A;  2PGT A;  1USB A;  3HZ8 A;  1PD2 1;  4NHZ A;  4GWR A;  4F0B A;  1YJ6 A;  3HDC A;  5HR3 A;  4ECI A;  5IQY A;  3GTU A;  1R4W A;  1UN2 A;  4DSS A;  6GST A;  3UIW A;  2YPM A;  5JCW A;  4J56 E;  2X99 A;  1ILO A;  3MSZ A;  3FZA A;  1X0R A;  1O73 A;  1ON4 A;  2YOI A;  4OFN A;  2UZ8 A;  1THO A;  5F0G A;  1LBK A;  1PGT A;  3W6G A;  2CAQ A;  2H6Y A;  2VCQ A;  3EE2 A;  2KLX A;  4HZ4 A;  2E0Q A;  3H93 A;  3L4N A;  3NIV A;  2H8L A;  1GSY A;  1ZCP A;  3N9J A;  3F9U A;  2CVK A;  2ALB A;  1SU9 A;  1FOH A;  5DCG A;  1PQN A;  3HJO A;  5KN3 A;  4JRR A;  5IPG A;  1A8Y A;  2PN8 A;  1ERW A;  5CAX A;  1O81 A;  4TN8 A;  3M3M A;  4P3Y B;  3DXB A;  4HU9 A;  4KA0 A;  6GSS A;  2X4A A;  3TDG A;  1UA5 A;  1PL2 A;  2YWN A;  3US3 A;  4N30 A;  5GAP D;  1KEB A;  2EIQ A;  4KCA A;  2B1K A;  4HJM A;  1ABA A;  2CZ2 A;  2OKA A;  2LQQ A;  2L4Q A;  4MZW A;  1X5E A;  1WMJ A;  5IO2 A;  1MDI A;  4YQU A;  5GZZ B;  5ECL B;  3HVN A;  2CAI A;  3FY7 A;  3TKS A;  1SL2 B;  1GRX A;  1AQX A;  2CZ3 A;  2WCI A;  4EDY A;  5CNW A;  1OC9 A;  3OR5 A;  1Z6M A;  1FB6 A;  3IHQ A;  5ECH B;  3ME8 A;  5IOX A;  3F4T A;  4QL9 A;  2QA2 A;  2M80 A;  3LEF A;  3QDN A;  5A4U A;  4MJB A;  2NDO A;  2FY6 A;  2GLR A;  3UL3 A;  5IMA A;  2H0I A;  2GQK A;  14GS A;  5IM9 A;  2LV3 A;  5D8I A;  1XWG A;  4O32 A;  2EIO A;  1Z5Y E;  3E3E A;  2R0G A;  4LA1 A;  5CRG A;  3APO A;  1E6B A;  2KHP A;  2M46 A;  3LYP A;  5HR2 A;  2C1Y A;  1A23 A;  2VCZ A;  3Q6O A;  2GTU A;  2MMZ A;  1G6Y A;  3IHG A;  2GSQ A;  2ZUP A;  5ABR A;  2XBQ A;  5E4W A;  3MIX A;  1GSE A;  1YF0 A;  3TUE A;  4ZBD A;  3GFK A;  11GS A;  1YKC A;  4TR0 A;  4V1A g;  1MEK A;  1YQ1 A;  1GTA A;  3A2X A;  4H86 A;  4WR5 A;  1J9B A;  2FNO A;  3F6F A;  2OA7 A;  1SKR B;  1JFU A;  4F82 A;  2H1D A;  3HVS A;  2CVD A;  3F4R A;  2NBS A;  5D9V A;  2G0F A;  5EPF A;  1GLP A;  2E7P A;  1QFN A;  5A5K A;  4WBR D;  3TOT A;  3HVX A;  1AUC A;  2XPD A;  3D4M A;  2MMO A;  4TXV A;  3RPP A;  1K0M A;  4RQR A;  5G1L A;  17GS A;  1SJ6 A;  1TI3 A;  2YJH A;  2A2P A;  2DJJ A;  3U6V A;  4IBP A;  2FGX A;  5IMZ A;  1R5P A;  5FHI A;  2PU9 C;  3I9V 2;  4PQ1 A;  3VPQ A;  1X9S B;  2R0C A;  3TKS C;  2CT6 A;  2DKH A;  2NPB A;  12GS A;  1B4P A;  1DUG A;  2G2Q A;  4WR4 A;  1YEP A;  3IK7 A;  5GSS A;  5DVB A;  1K0C A;  2VO4 A;  4KW6 A;  2VCX A;  4MZC A;  1SD9 A;  1EP8 A;  3V1W A;  3CRU A;  2H19 A;  5GAN D;  1BG5 A;  3A2W A;  2YZH A;  1B9X C;  1VRS D;  1G6W A;  4MJE A;  3GKM A;  1WOU A;  2MZC A;  2CX3 A;  3GKX A;  4WXT A;  4HEA 2;  4G0L A;  5J4U A;  4OWY A;  1QGV A;  2IMF A;  4HJ2 A;  3TRQ A;  1EEJ A;  1HNA A;  3TKR A;  2F8F A;  2HYX A;  1B48 A;  3FRC A;  1EEM A;  4FIW A;  5D93 A;  3WGD A;  1BQ7 A;  3VLN A;  5DAL A;  3GUR A;  2LNS A;  3DKS A;  2IN3 A;  3VI7 A;  4EDZ A;  4K5S A;  2DJ2 A;  2LEG A;  6GSU A;  2HZE B;  4HU7 A;  2F3M A;  2D2Z A;  5CRE A;  1QQ2 A;  5LNK e;  2YV9 A;  1J08 A;  1XWC A;  5ECR B;  4EVM A;  4KSM A;  4AJ6 A;  3DD3 A;  3C1R A;  4K7O A;  1EZK A;  3E9J B;  3ME7 A;  4F9Z A;  2L5O A;  3VUR A;  4IP6 A;  4ZL7 A;  1EV4 A;  4V2N A;  5ID2 B;  3G7J A;  3UBK A;  1GNE A;  2JZR A;  5ECS A;  3FW2 A;  2JU5 A;  4AJ7 A;  3QAW A;  3ISO A;  2A4H A;  2H71 A;  2VL9 A;  2LNT A;  1OE8 A;  3VWV A;  2WFC A;  2H1B A;  1Z7R A;  4E8H A;  2F9S A;  3J7Y k;  3G7Y A;  3TGZ A;  4XS1 A;  3I6A A;  5FWG A;  4USS A;  5J9C A;  4IQA A;  3UVT A;  2IMD A;  2FLS A;  1GL8 A;  3UVH A;  2LST A;  4J57 E;  2B5E A;  2A4V A;  2DC5 A;  2I81 A;  4KDU A;  1M9B A;  1AQV A;  1T4Y A;  3RPN A;  2C0F A;  1TRU A;  2C8U A;  5H5R A;  3GKN A;  3UBL A;  2I1U A;  3ZIJ A;  1PA3 A;  2HNL A;  5ECN B;  5ECO B;  1T4Z A;  3ZIT A;  4F2I A;  3TOU A;  4AGS A;  2VLU A;  2E2M A;  1LJR A;  6GSW A;  5HQP A;  3CRT A;  4Z2U A;  1NHO A;  4IQ1 A;  2ON5 A;  5E59 A;  2YCD A;  2H1G A;  3HKR A;  1SYX A;  3VWX A;  1ERU A;  1QXH A;  4WF4 A;  3I69 A;  4OO4 A;  4ICY A;  1VF4 A;  3F4S A;  1ZZY A;  4NAX A;  1FB0 A;  3UMA A;  3IR4 A;  2ES7 A;  3I43 A;  2X64 A;  3KMO A;  3FMW A;  3M9K A;  3SWL A;  4Q5Q A;  2VAF A;  3HYP A;  1PMT A;  4POM A;  3FR6 A;  4J2F A;  5ECM B;  3TB2 A;  5DCH A;  6GSV A;  3A2V A;  5B6N A;  2MYG A;  5ECI B;  2ON7 A;  4MF7 A;  2XPE A;  1JHB A;  4YAV A;  1RQM A;  4JZQ A;  1K0A A;  1NSW A;  3LGC A;  2TIR A;  3FR9 A;  1M3I A;  2KOK A;  3H1N A;  2R6K A;  2HE3 A;  1LU4 A;  2OJL A;  4WET A;  5ELG A;  3CYN A;  2HZE A;  4OO5 A;  4POK A;  4JBB A;  2O89 A;  4YAP A;  3D5J A;  1EP7 A;  4F03 A;  3M8N A;  3IXR A;  4HOJ A;  3WT2 A;  1Y25 A;  4MF5 A;  5IO0 A;  1Z7P A;  2FA8 A;  3MWH A;  3LSZ A;  3L0H A;  4ZB9 A;  1V58 A;  4IS0 A;  4MJC A;  5ID2 A;  2VD1 A;  3D21 A;  4ULX A;  2PWJ A;  3CTF A;  2VCT A;  3UOM A;  4CY6 A;  3FR3 A;  5ECP B;  3ZRE A;  3ED3 A;  1U3A A;  1EOG A;  1R26 A;  2JSZ A;  1FW1 A;  4HUA A;  3APS A;  3G7I A;  4WBJ A;  1RW1 A;  3TCO A;  5HR0 A;  1AAZ A;  3HY2 A;  3P90 A;  3VWU A;  3PH9 A;  4NMU A;  1TDI A;  2EC4 A;  4GRF A;  4KH7 A;  1NW2 A;  1XFL A;  1I5G A;  2QGV A;  5DDL A;  3RHC A;  2DSA A;  2V6K A;  4TRX A;  2GSS A;  3G9B A;  1G0T A;  1TK5 B;  3LOR A;  2LJR A;  4MAB A;  1EGR A;  1MTC A;  4PNF A;  3CSJ A;  1PL1 A;  5BMU A;  1GSF A;  5F05 A;  1OC8 A;  2V6O A;  4ZBB A;  1OE7 A;  2VL2 A;  3VFI A;  1YY7 A;  2JAC A;  1SL0 B;  5AIV A;  4Q5R A;  2MBS A;  4G0K A;  5B8A A;  2IFQ B;  1J0F A;  2H74 A;  1YZX A;  1A0F A;  1PSQ A;  4RQX A;  1F37 A;  2X8H A;  1TRS A;  5KN0 A;  2L4C A;  1GUK A;  1GTU A;  1XW9 A;  1KBN A;  3CTG A;  4LL4 B;  1K3Y A;  3A3T A;  3FZ9 A;  2HSH A;  4TR1 B;  1VGL A;  1WIK A;  4XTS A;  2CX4 A;  4POL A;  1T00 A;  1K3O A;  5G2Z A;  4I5Q A;  3LWA A;  2BJX A;  16GS A;  2RUE A;  3EWL A;  3LYK A;  5IMV A;  4KND A;  4IKH A;  3F3R A;  3GL5 A;  3TRX A;  1FAA A;  4XCS A;  1SKW B;  3MYD A;  1Q4J A;  5F06 A;  4GSS A;  1K3L A;  3IBH A;  1GNW A;  3UAR A;  2A2R A;  2P5R A;  3KEB A;  4TXO B;  4X4J A;  1GH2 A;  1B9Y C;  4ZB8 A;  5DAL B;  4L5O A;  1S3C A;  2KUC A;  5B8B A;  1U87 A;  4BL7 B;  1OKT A;  1HD2 A;  5D96 A;  2WB9 A;  1TK0 B;  2C4J A;  3WD6 A;  4I2U A;  5G30 A;  2DJK A;  4DSR A;  4MA9 A;  3ZLP A;  8GSS A;  1M2D A;  5DAK B;  4PUR A;  2YAN A;  4N0V A;  4BPY A;  1AW9 A;  4MDC A;  2E2G A;  2R2J A;  4N10 A;  4KCE A;  3MNG A;  2H66 A;  3DRN A;  1EV9 A;  1R5A A;  5BRT A;  4MLY A;  3ZTL A;  3FZ5 A;  1XPV A;  1TU7 A;  3O76 A;  1A2M A;  1SEN A;  1ZL9 A;  3ZZX A;  2OBK A;  2VL2 C;  3EU4 A;  2C0D A;  4CW9 A;  1XG8 A;  2V32 A;  1MD3 A;  4MK3 A;  2PER A;  3HCZ A;  4FQU A;  2WUL A;  4KB3 A;  2H0G A;  2HRK A;  5J41 A;  3RBT A;  3EMP A;  5F8B A;  3GNJ A;  1WE0 A;  2P5Q A;  3L9S A;  1OVN A;  1PN9 A;  2LTK A;  1HNC A;  3FZ4 A;  3BOA A;  2LJA A;  3UJ1 A;  4K9Z A;  2EIR A;  3D0Z A;  2QC7 A;  3R2Q A;  6GSY A;  1ZOF A;  1TTZ A;  3QPM A;  1AIU A;  2HSM A;  4EXJ A;  4L8E A;  1ZGN A;  2B3S A;  4O5Q A;  2AAW A;  4ZIJ A;  19GS A;  3D22 A;  3TJG A;  3ZL5 A;  4IW9 A;  2GT6 A;  3Q18 A;  4O5R A;  3DEX A;  1S3A A;  3CQF A;  5KN2 A;  4BVY B;  2LRC A;  1UC7 A;  4Z2R A;  1BED A;  4GQC A;  2IFQ A;  5G1K A;  4ZL8 A;  1GLQ A;  3CXG A;  4ZL9 A;  1O7U A;  1SJZ A;  3ZMK A;  2B6M A;  4D73 B;  2GQM A;  4OCF A;  2NTO A;  1GUM A;  1M3J A;  2HI7 A;  2VM2 A;  4GQF A;  5IMC A;  1EWX A;  2GZP A;  1FG4 A;  4BWS A;  1T8E B;  4TR1 A;  3IE3 A;  4ZIL A;  1SK2 A;  2K8V A;  2N5F A;  2YWI A;  4G19 A;  2J23 A;  2GDR A;  2VL3 A;  1C72 A;  4IHU A;  3LXT A;  4FYU A;  1U88 A;  4Q5N A;  1U3I A;  3GV1 A;  4MJA A;  1SK1 A;  1XBS A;  3NOF A;  4O92 A;  4X43 A;  5CP1 A;  2DIZ A;  3DVX A;  4OCE A;  4TXO A;  1XW5 A;  2VLV A;  13GS A;  3LXZ A;  5G5F A;  4GSN A;  2AHE A;  5AGY A;  1CQG A;  1AQW A;  4G0I A;  3W8J A;  4BL7 A;  5D9T A;  2AJQ B;  1T3B A;  3EMX A;  4IN0 A;  4BVX B;  4I6X A;  5CRD A;  3KD0 A;  1UVZ A;  2YWM A;  1HNB A;  4CDO A;  4MH2 A;  4O5U A;  5DAK A;  3UAP A;  3S9F A;  3KP8 A;  2X8G A;  2HSY A;  3IC8 A;  1VF3 A;  2K8S A;  5JCU A;  1F2E A;  1AXD A;  5EY6 A;  2H72 A;  4OD7 A;  2CQ9 A;  22GS A;  2YJ7 A;  1FVK A;  1B4Q A;  4XRA A;  18GS A;  1W4V A;  1PN0 A;  3L9U A;  4MNN A;  4K8M A;  1JZW A;  4G9H A;  1A8L A;  2GT5 A;  4OFM A;  4WKW A;  2K6V A;  3CMI A;  1R7H A;  3ZYW A;  3KM6 A;  2AB6 A;  5H5S A;  4NXI A;  3E0U A;  1ACV A;  5KEJ A;  3QAV A;  1DSB A;  4EIQ A;  5AN1 A;  1A2J A;  3BJ5 A;  4Q5F A;  5G5E A;  4HI7 A;  2IME A;  3HHV A;  1DE1 A;  5H5Q A;  3M0F A;  4XRD A;  3EU3 A;  5DJM A;  2P0G A;  2DMM A;  1NM3 A;  3GYK A;  2YWO A;  3KH7 A;  3RDW A;  4BVY A;  1XOA A;  2LRN A;  1KNG A;  2B7K A;  3L78 A;  1TW9 A;  3KIJ A;  3GA4 A;  2MMA A;  1IYI A;  1QK8 A;  3BBY A;  1OC3 A;  4I97 A;  4KF9 A;  4TR3 A;  3QOU A;  3TKP A;  1Z9H A;  4ECC A;  2KP1 A;  1URM A;  3GHA A;  4D73 A;  4WF5 A;  2HT9 A;  5A4W A;  3IAS 2;  1X9M B;  2YN1 A;  1WRY A;  5LD0 A;  6GSX A;  1TKD B;  1HQO A;  3GIX A;  4HZ2 A;  3R3E A;  3C8E A;  1I9D A;  1X5D A;  3ZVJ D;  1OKD A;  2OAC A;  4YQM A;  4O7H A;  3LG6 A;  1B8X A;  3SBC A;  4PGT A;  1OYJ A;  3ERW A;  1GTB A;  2JSY A;  2AYT A;  2L57 A;  5INY A;  1K0B A;  1YEX A;  3ZRD A;  4ML1 A;  2K18 A;  1AC1 A;  4GST A;  3J7Y b;  4K7I A;  4XS4 B;  2HRA A;  1F3B A;  1THX A;  3FK8 A;  4ID0 A;  4K2D A;  2NVL A;  1SYR A;  4N11 A;  1NHY A;  4ZBA A;  3O6T A;  4POB A;  2V2G A;  4FYB A;  4V2L A;  4V2M A;  4BVX A;  3ZML A;  3GN3 A;  3GRX A;  5AIX A;  3ZIV A;  1OAZ A;  3QR6 A;  1ST9 A;  1V9W A;  2RII A;  3F0I A;  1JZD A;  4MF6 A;  3QFA C;  4JR4 A;  2L6D A;  3N5O A;  2O87 A;  1VF1 A;  2R3X A;  3TJF A;  4XS6 A;  2WS2 A;  3VPT A;  4YKF A;  3GL3 A;  1JLW A;  2AUV A;  3LFL A;  2F51 A;  1W89 A;  3KP9 A;  1M2A A;  3FKF A;  2LS5 A;  3HD5 A;  2C3N A;  1Y6E A;  3GH6 A;  4JED A;  2OAD A;  3KXO A;  4TVE A;  1JLV A;  5D9X A;  7GSS A;  5J3R A;  1WPI A;  1N2A A;  4KDY A;  4MPF A;  1GSS A;  2VOC A;  3HJP A;  1T1V A;  3KH9 A;  5AIS A;  2B5X A;  1V57 A;  3HVV A;  1PRX A;  2N5A A;  2H1A A;  1TI1 A;  3CSH A;  2H0H A;  3GUS A;  2REM A;  4I8B A;  1XWK A;  1S3D A;  1TK8 B;  2GS3 A;  3IRA A;  3DWV A;  2C0E A;  3L9V A;  3M9J A;  1O8X A;  4ZXG A;  4K0N A;  2IJY A;  2CA8 A;  3DGQ A;  4GXZ A;  5KOW A;  3MDK A;  2WRT A;  1Z3E A;  2IIY A;  3FYG A;  2I4A A;  2F8A A;  3TJJ A;  1A2L A;  3ZFL A;  4G2E A;  3WGX A;  4X0X A;  1FO5 A;  2H73 A;  1M99 A;  2OE1 A;  5D9W A;  2DBC A;  4BA7 A;  2XHF A;  1BX9 A;  2HFD A;  4L0W A;  2VM1 A;  3CSI A;  3IDV A;  4YQV A;  3F6D A;  4FO5 A;  3GH9 A;  3AY8 A;  2R0P A;  4IJI A;  2HRF A;  2B7J A;  4DVC A;  2FWF A;  1GWC A;  5CO3 A;  1WWJ A;  3KCM A;  2WJU A;  1XZO A;  4CY8 A;  2GVP A;  4YH2 A;  2N5B A;  3HA9 A;  5JWQ B;  1ZYE A;  2RM6 A;  2YP6 A;  3ERG A;  1H75 A;  3TKQ A;  1A24 A;  4K2X A;  2I9H A;  2GST A;  2TRC P;  3TKS E;  2XBI A;  4HQZ A;  4HQS A;  1O85 A;  1FHE A;  1A0R P;  2DJ1 A;  4L0U A;  2WDU A;  2O7K A;  4WEY A;  4XS4 A;  4PQH A;  1H4O A;  4NWY A;  2ZNM A;  2BMX A;  4RI6 A;  2H6X A;  1XW6 A;  1XOB A;  1M0U A;  2GZY A;  1YDK A;  1GSU A;  3LJR A;  2PVO C;  2QSI A;  3NZN A;  1YF1 A;  2DJ0 A;  4ZB6 A;  2IMI A;  4K5R A;  3IAM 2;  5HFI A;  5HR1 A;  2XC2 A;  3LQ7 A;  1GP1 A;  2FWG A;  3TJK A;  4I2T A;  5IMD A;  3IOS A;  1SKS B;  2H30 A;  2RM5 A;  9GSS A;  2IWT A;  4XHM A;  2A2S A;  4PX1 A;  2VCV A;  2YZU A;  2IMK A;  1PKW A;  2H76 A;  2QKE A;  1XIY A;  2B1L A;  4EE0 A;  5B6M A;  4FH8 A;  3BD2 A;  1BYE A;  1WJK A;  3APQ A;  2C0G A;  3GST A;  4E8E A;  5L71 A;  2VD0 A;  1PX6 A;  1U6T A;  4ISD A;  1EOH A;  4DEJ A;  3GMF A;  1MD4 A;  3EVI A;  5J9B A;  1Q98 A;  2IPA A;  3GX8 A;  4NV2 A;  3UEM A;  4IEL A;  1E2Y A;  3LW9 A;  3C73 A;  4PUA A;  5A4V A;  2FHE A;  1HYU A;  4TR4 A;  4BIK A;  2FWH A;  2ZCT A;  2C3Q A;  2PBJ A;  4PTS A;  1DE2 A;  2L5L A;  3WT1 A;  3BCK A;  3FEU A;  2JL4 A;  2DJ3 A;  5COH A;  1FOV A;  3DYR A;  4RI7 A;  2GGT A;  4GTU A;  4LMW A;  2GZZ A;  5ECK B;  3IV4 A;  2DKI A;  5HFG A;  1XXU A;  4MH3 A;  5D73 A;  5CRH A;  4ILF A;  2R4V A;  4PUF C;  2J9H A;  4KE3 A;  4V1A p;  4EKZ A;  1QUW A;  4BWQ A;  4KDX A;  2RLI A;  4HDE A;  5DQY A;  3VK9 A;  1GUH A;  3ZVJ A;  1GSQ A;  2HLS A;  3DVW A;  4TW5 A;  2O85 A;  3A5I A;  3KJY A;  2HXK A;  2FD3 A;  2VLT A;  3TRP A;  5CRW A;  2LQO A;  3Q74 A;  4L5L A;  3EUR A;  3TJB A;  2C3T A;  1M9A A;  3C71 A;  2I3Y A;  2DLX A;  4KAE A;  4AJ8 A;  1M7T A;  1F6M C;  4MP4 A;  3KMN A;  3GKK A;  2LJK A;  2OE3 A;  3O3T A;  1K0D A;  2JZS A;  3JCM L;  1ZMA A;  3QD9 A;  2IL3 A;  5IIZ A;  1XCC A;  4GF0 A;  4JU5 A;  1KTE A;  4Z7X A;  1XVW A;  4IP1 A;  2FCH A;  1TU8 A;  4LL1 B;  4AF2 A;  4KSO A;  3CBU A;  3PPU A;  3P2A A;  3DIE A;  4K1F A;  4F0C A;  4ML6 A;  1BAY A;  3H79 A;  1T7P B;  3D6I A;  4QQ7 A;  1TOF A;  4JR6 A;  4NPB A;  3EIN A;  3IA1 A;  1QMV A;  3ERF A;  4YKG A;  5G31 A;  5C00 A;  2HZF A;  1M2B A;  4MMM A;  1ZYQ B;  1EGO A;  4K7N A;  1GUL A;  4ACS A;  4Z2T A;  3A5W A;  1GTI A;  1TRW A;  3HZ4 A;  3EPT A;  4KX4 A;  5LCZ A;  5EVO A;  2CV4 A;  5IOW A;  1SL1 B;  2M72 A;  3IK9 A;  1X5C A;  3ZFB A;  5EL8 A;  5GST A;  1F3A A;  1Z6N A;  1XWB A;  3PGT A;  3KTB A;  4RUV A;  1MDK A;  2H75 A;  2FA4 A;  5JCG A;  1TXX A;  2PUK C;  2R37 A;  3QAG A;  5C04 A;  3RHB A;  3KGK A;  2MMN A;  5FT3 A;  1G7E A;  3WYW A;  4KGI A;  5F07 A;  5DJL A;  1V98 A;  3PIN A;  2Z9S A;  5JWR B;  3D4T A;  1GSD A;  1TRV A;  2FWE A;  2H6Z A;  3MAK A;  3EYT A;  3BCI A;  1TJD A;  5CYY A;  3H4K A;  1JZO A;  4CHS A;  1DBY A;  2GSR A;  1V2A A;  2LRT A;  5B7C A;  4EC0 A;  2H01 A;  3GX0 A;  1F9M A;  2MBT A;  5IMF A;  4NHW A;  3H8Q A;  5J5N A;  1K0O A;  1SK0 A;  1XWA A;  2DIY A;  2YV7 A;  4LMV A;  2WGR A;  2KP2 A;  3GSS A;  3GTU B;  4DSS B;  20GS A;  2X49 A;  3C7M A;  1ZYN A;  3QFB C;  4OMV A;  4EF0 A;  3M1G A;  2VIM A;  2VUP A;  4PQI A;  2K9F A;  1SJI A;  2LKU A;  2GQL A;  2AV4 A;  4PXO A;  3P7X A;  4XIH A;  2HRN A;  2B5Y A;  4NV5 A;  1IYH A;  2P31 A;  3DML A;  4TKY A;  4IVF A;  1N8J A;  1S3R A;  1V40 A;  5ENU A;  1X9W B;  3W8S A;  2O8V B;  4IGJ A;  3F8U A;  1FVJ A;  2FUG 2;  5ECQ B;  3Q19 A;  4LLR A;  4GLT A;  4K0G A;  2X8C A;  3HXS A;  5IPH A;  1ERV A;  2PVQ A;  1VF2 A;  1WP0 A;  1PX7 A; 
#chains in the Genus database with same CATH homology
 2JZT A;  2YNX A;  5DBQ A;  2VCW A;  1MDJ A;  3QMX A;  1YKA A;  3VWW A;  2OE0 A;  4MPG A;  3U5R E;  3P8W A;  2L59 A;  3HJM A;  4FYC A;  2PMT A;  1RK4 A;  2PPT A;  1PKZ A;  1ERT A;  3QCP A;  1OC9 B;  2DML A;  2R5G A;  2JAD A;  3PR8 A;  3IC4 A;  1TP9 A;  2QA1 A;  4DSQ A;  5KOX A;  1ML6 A;  4IJ3 A;  2LUS A;  2TRX A;  4PNG A;  4MCU A;  1XVQ A;  1G7O A;  3IPZ A;  4A5P A;  5ELA A;  4KUN A;  4ECJ A;  1SD8 A;  2RUF A;  2V41 A;  2H70 A;  4EL1 A;  3F3Q A;  3KZQ A;  5KN1 A;  1JZR A;  4G10 A;  3K8N A;  4K6X A;  4ECB A;  4TOP A;  5JWO B;  4GCI A;  2CVB A;  4X1U A;  2OBI A;  4QL7 A;  2C80 A;  4OFT A;  4N0Z A;  4EO3 A;  1K0N A;  1O6J A;  2BTO T;  1BJX A;  3C1S A;  10GS A;  2WZ9 A;  3VI5 A;  3WGE A;  3RAZ A;  4EUY A;  1O8W A;  3EC3 A;  4MZB A;  1ZYP A;  5HFK A;  4JE1 A;  3F63 A;  3FHK A;  4HS1 A;  4EIP A;  1CQH A;  5DQS A;  2V1M A;  2L6C A;  3KTL A;  2PGT A;  1USB A;  3HZ8 A;  1PD2 1;  4NHZ A;  4GWR A;  4F0B A;  1YJ6 A;  3HDC A;  5HR3 A;  4ECI A;  5IQY A;  3GTU A;  1R4W A;  1UN2 A;  4DSS A;  6GST A;  3UIW A;  2YPM A;  5JCW A;  4J56 E;  2X99 A;  1ILO A;  3MSZ A;  3FZA A;  1X0R A;  1O73 A;  1ON4 A;  2YOI A;  4OFN A;  2UZ8 A;  1THO A;  5F0G A;  1LBK A;  1PGT A;  3W6G A;  2CAQ A;  2H6Y A;  2VCQ A;  3EE2 A;  2KLX A;  4HZ4 A;  2E0Q A;  3H93 A;  3L4N A;  3NIV A;  2H8L A;  1GSY A;  1ZCP A;  3N9J A;  3F9U A;  2CVK A;  2ALB A;  1SU9 A;  1FOH A;  5DCG A;  1PQN A;  3HJO A;  5KN3 A;  4JRR A;  5IPG A;  1A8Y A;  2PN8 A;  1ERW A;  5CAX A;  1O81 A;  4TN8 A;  3M3M A;  4P3Y B;  3DXB A;  4HU9 A;  4KA0 A;  6GSS A;  2X4A A;  3TDG A;  1UA5 A;  1PL2 A;  2YWN A;  3US3 A;  4N30 A;  5GAP D;  1KEB A;  2EIQ A;  4KCA A;  2B1K A;  4HJM A;  1ABA A;  2CZ2 A;  2OKA A;  2LQQ A;  2L4Q A;  4MZW A;  1X5E A;  1WMJ A;  5IO2 A;  1MDI A;  4YQU A;  5GZZ B;  5ECL B;  2CAI A;  3FY7 A;  3TKS A;  1SL2 B;  1GRX A;  1AQX A;  2CZ3 A;  2WCI A;  4EDY A;  5CNW A;  1OC9 A;  3OR5 A;  1Z6M A;  1FB6 A;  3IHQ A;  5ECH B;  3ME8 A;  5IOX A;  3F4T A;  4QL9 A;  2QA2 A;  2M80 A;  3LEF A;  3QDN A;  5A4U A;  4MJB A;  2NDO A;  2FY6 A;  2GLR A;  3UL3 A;  5IMA A;  2H0I A;  2GQK A;  14GS A;  5IM9 A;  2LV3 A;  5D8I A;  1XWG A;  4O32 A;  2EIO A;  1Z5Y E;  3E3E A;  2R0G A;  4LA1 A;  5CRG A;  3APO A;  1E6B A;  2KHP A;  2M46 A;  3LYP A;  5HR2 A;  2C1Y A;  1A23 A;  2VCZ A;  3Q6O A;  2GTU A;  2MMZ A;  1G6Y A;  3IHG A;  2GSQ A;  2ZUP A;  5ABR A;  2XBQ A;  5E4W A;  3MIX A;  1GSE A;  1YF0 A;  3TUE A;  4ZBD A;  3GFK A;  11GS A;  1YKC A;  4TR0 A;  4V1A g;  1MEK A;  1YQ1 A;  1GTA A;  3A2X A;  4H86 A;  4WR5 A;  1J9B A;  2FNO A;  3F6F A;  2OA7 A;  1SKR B;  1JFU A;  4F82 A;  2H1D A;  3HVS A;  2CVD A;  3F4R A;  2NBS A;  5D9V A;  2G0F A;  5EPF A;  1GLP A;  2E7P A;  1QFN A;  5A5K A;  4WBR D;  3TOT A;  3HVX A;  1AUC A;  2XPD A;  3D4M A;  2MMO A;  4TXV A;  3RPP A;  1K0M A;  4RQR A;  5G1L A;  17GS A;  1SJ6 A;  1TI3 A;  2YJH A;  2A2P A;  2DJJ A;  3U6V A;  4IBP A;  2FGX A;  5IMZ A;  1R5P A;  5FHI A;  2PU9 C;  3I9V 2;  4PQ1 A;  3VPQ A;  1X9S B;  2R0C A;  3TKS C;  2CT6 A;  2DKH A;  2NPB A;  12GS A;  1B4P A;  1DUG A;  2G2Q A;  4WR4 A;  1YEP A;  3IK7 A;  5GSS A;  5DVB A;  1K0C A;  2VO4 A;  4KW6 A;  2VCX A;  4MZC A;  1SD9 A;  1EP8 A;  3V1W A;  3CRU A;  2H19 A;  5GAN D;  1BG5 A;  3A2W A;  2YZH A;  1B9X C;  1VRS D;  1G6W A;  4MJE A;  3GKM A;  1WOU A;  2MZC A;  2CX3 A;  3GKX A;  4WXT A;  4HEA 2;  4G0L A;  5J4U A;  4OWY A;  1QGV A;  2IMF A;  4HJ2 A;  3TRQ A;  1EEJ A;  1HNA A;  3TKR A;  2F8F A;  2HYX A;  1B48 A;  3FRC A;  1EEM A;  4FIW A;  5D93 A;  3WGD A;  1BQ7 A;  3VLN A;  5DAL A;  3GUR A;  2LNS A;  3DKS A;  2IN3 A;  3VI7 A;  4EDZ A;  4K5S A;  2DJ2 A;  2LEG A;  6GSU A;  2HZE B;  4HU7 A;  2F3M A;  2D2Z A;  5CRE A;  1QQ2 A;  5LNK e;  2YV9 A;  1J08 A;  1XWC A;  5ECR B;  4EVM A;  4KSM A;  4AJ6 A;  3DD3 A;  3C1R A;  4K7O A;  1EZK A;  3E9J B;  3ME7 A;  4F9Z A;  2L5O A;  3VUR A;  4IP6 A;  4ZL7 A;  1EV4 A;  4V2N A;  5ID2 B;  3G7J A;  3UBK A;  1GNE A;  2JZR A;  5ECS A;  3FW2 A;  2JU5 A;  4AJ7 A;  3QAW A;  3ISO A;  2A4H A;  2H71 A;  2VL9 A;  2LNT A;  1OE8 A;  3VWV A;  2WFC A;  2H1B A;  1Z7R A;  4E8H A;  2F9S A;  3J7Y k;  3G7Y A;  3TGZ A;  4XS1 A;  3I6A A;  5FWG A;  4USS A;  5J9C A;  4IQA A;  3UVT A;  2IMD A;  2FLS A;  1GL8 A;  3UVH A;  2LST A;  4J57 E;  2B5E A;  2A4V A;  2DC5 A;  2I81 A;  4KDU A;  1M9B A;  1AQV A;  1T4Y A;  3RPN A;  2C0F A;  1TRU A;  2C8U A;  5H5R A;  3GKN A;  3UBL A;  2I1U A;  3ZIJ A;  1PA3 A;  2HNL A;  5ECN B;  5ECO B;  1T4Z A;  3ZIT A;  4F2I A;  3TOU A;  4AGS A;  2VLU A;  2E2M A;  1LJR A;  6GSW A;  5HQP A;  3CRT A;  4Z2U A;  1NHO A;  4IQ1 A;  2ON5 A;  5E59 A;  2YCD A;  2H1G A;  3HKR A;  1SYX A;  3VWX A;  1ERU A;  1QXH A;  4WF4 A;  3I69 A;  4OO4 A;  4ICY A;  1VF4 A;  3F4S A;  1ZZY A;  4NAX A;  1FB0 A;  3UMA A;  3IR4 A;  2ES7 A;  3I43 A;  2X64 A;  3KMO A;  3FMW A;  3M9K A;  3SWL A;  4Q5Q A;  2VAF A;  3HYP A;  1PMT A;  4POM A;  3FR6 A;  4J2F A;  5ECM B;  3TB2 A;  5DCH A;  6GSV A;  3A2V A;  5B6N A;  2MYG A;  5ECI B;  2ON7 A;  4MF7 A;  2XPE A;  1JHB A;  4YAV A;  1RQM A;  4JZQ A;  1K0A A;  1NSW A;  3LGC A;  2TIR A;  3FR9 A;  2KOK A;  3H1N A;  2R6K A;  2HE3 A;  1LU4 A;  2OJL A;  4WET A;  5ELG A;  3CYN A;  2HZE A;  4OO5 A;  4POK A;  4JBB A;  2O89 A;  4YAP A;  3D5J A;  1EP7 A;  4F03 A;  3M8N A;  3IXR A;  4HOJ A;  3WT2 A;  1Y25 A;  4MF5 A;  5IO0 A;  1Z7P A;  2FA8 A;  3MWH A;  3LSZ A;  3L0H A;  4ZB9 A;  1V58 A;  4IS0 A;  4MJC A;  5ID2 A;  2VD1 A;  3D21 A;  4ULX A;  2PWJ A;  3CTF A;  2VCT A;  3UOM A;  4CY6 A;  3FR3 A;  5ECP B;  3ZRE A;  3ED3 A;  1U3A A;  1EOG A;  1R26 A;  2JSZ A;  1FW1 A;  4HUA A;  3APS A;  3G7I A;  4WBJ A;  1RW1 A;  3TCO A;  5HR0 A;  1AAZ A;  3HY2 A;  3P90 A;  3VWU A;  3PH9 A;  4NMU A;  1TDI A;  2EC4 A;  4GRF A;  4KH7 A;  1NW2 A;  1XFL A;  1I5G A;  2QGV A;  5DDL A;  3RHC A;  2DSA A;  2V6K A;  4TRX A;  2GSS A;  3G9B A;  1G0T A;  1TK5 B;  3LOR A;  2LJR A;  4MAB A;  1EGR A;  1MTC A;  4PNF A;  3CSJ A;  1PL1 A;  5BMU A;  1GSF A;  5F05 A;  1OC8 A;  2V6O A;  4ZBB A;  1OE7 A;  2VL2 A;  3VFI A;  1YY7 A;  2JAC A;  1SL0 B;  5AIV A;  4Q5R A;  2MBS A;  4G0K A;  5B8A A;  2IFQ B;  1J0F A;  2H74 A;  1YZX A;  1A0F A;  1PSQ A;  4RQX A;  1F37 A;  2X8H A;  1TRS A;  5KN0 A;  2L4C A;  1GUK A;  1GTU A;  1XW9 A;  1KBN A;  3CTG A;  4LL4 B;  1K3Y A;  3A3T A;  3FZ9 A;  2HSH A;  4TR1 B;  1VGL A;  1WIK A;  4XTS A;  2CX4 A;  4POL A;  1T00 A;  1K3O A;  5G2Z A;  4I5Q A;  3LWA A;  2BJX A;  16GS A;  2RUE A;  3EWL A;  3LYK A;  5IMV A;  4KND A;  4IKH A;  3F3R A;  3GL5 A;  3TRX A;  1FAA A;  4XCS A;  1SKW B;  3MYD A;  1Q4J A;  5F06 A;  4GSS A;  1K3L A;  3IBH A;  1GNW A;  3UAR A;  2A2R A;  2P5R A;  3KEB A;  4TXO B;  4X4J A;  1GH2 A;  1B9Y C;  4ZB8 A;  5DAL B;  4L5O A;  1S3C A;  2KUC A;  5B8B A;  1U87 A;  4BL7 B;  1OKT A;  1HD2 A;  5D96 A;  2WB9 A;  1TK0 B;  2C4J A;  3WD6 A;  4I2U A;  5G30 A;  2DJK A;  4DSR A;  4MA9 A;  3ZLP A;  8GSS A;  1M2D A;  5DAK B;  4PUR A;  2YAN A;  4N0V A;  4BPY A;  1AW9 A;  4MDC A;  2E2G A;  2R2J A;  4N10 A;  4KCE A;  3MNG A;  2H66 A;  3DRN A;  1EV9 A;  1R5A A;  5BRT A;  4MLY A;  3ZTL A;  3FZ5 A;  1XPV A;  1TU7 A;  3O76 A;  1A2M A;  1SEN A;  1ZL9 A;  3ZZX A;  2OBK A;  2VL2 C;  3EU4 A;  2C0D A;  4CW9 A;  2V32 A;  1MD3 A;  4MK3 A;  2PER A;  3HCZ A;  4FQU A;  2WUL A;  4KB3 A;  2H0G A;  2HRK A;  5J41 A;  3RBT A;  3EMP A;  5F8B A;  3GNJ A;  1WE0 A;  2P5Q A;  3L9S A;  1OVN A;  1PN9 A;  2LTK A;  1HNC A;  3FZ4 A;  3BOA A;  2LJA A;  3UJ1 A;  4K9Z A;  2EIR A;  3D0Z A;  2QC7 A;  3R2Q A;  6GSY A;  1ZOF A;  1TTZ A;  3QPM A;  1AIU A;  2HSM A;  4EXJ A;  4L8E A;  1ZGN A;  2B3S A;  4O5Q A;  2AAW A;  4ZIJ A;  19GS A;  3D22 A;  3TJG A;  3ZL5 A;  4IW9 A;  2GT6 A;  3Q18 A;  4O5R A;  3DEX A;  1S3A A;  5KN2 A;  4BVY B;  2LRC A;  1UC7 A;  4Z2R A;  1BED A;  4GQC A;  2IFQ A;  5G1K A;  4ZL8 A;  1GLQ A;  3CXG A;  4ZL9 A;  1O7U A;  1SJZ A;  3ZMK A;  2B6M A;  4D73 B;  2GQM A;  4OCF A;  2NTO A;  1GUM A;  2HI7 A;  2VM2 A;  4GQF A;  5IMC A;  1EWX A;  2GZP A;  1FG4 A;  4BWS A;  1T8E B;  4TR1 A;  3IE3 A;  4ZIL A;  1SK2 A;  2K8V A;  2N5F A;  2YWI A;  4G19 A;  2J23 A;  2GDR A;  2VL3 A;  1C72 A;  4IHU A;  3LXT A;  4FYU A;  1U88 A;  4Q5N A;  1U3I A;  3GV1 A;  4MJA A;  1SK1 A;  1XBS A;  3NOF A;  4O92 A;  4X43 A;  5CP1 A;  2DIZ A;  3DVX A;  4OCE A;  4TXO A;  1XW5 A;  2VLV A;  13GS A;  3LXZ A;  5G5F A;  4GSN A;  2AHE A;  5AGY A;  1CQG A;  1AQW A;  4G0I A;  3W8J A;  4BL7 A;  5D9T A;  2AJQ B;  1T3B A;  3EMX A;  4IN0 A;  4BVX B;  4I6X A;  5CRD A;  3KD0 A;  1UVZ A;  2YWM A;  1HNB A;  4CDO A;  4MH2 A;  4O5U A;  5DAK A;  3UAP A;  3S9F A;  3KP8 A;  2X8G A;  2HSY A;  3IC8 A;  1VF3 A;  2K8S A;  5JCU A;  1F2E A;  1AXD A;  5EY6 A;  2H72 A;  4OD7 A;  2CQ9 A;  22GS A;  2YJ7 A;  1FVK A;  1B4Q A;  4XRA A;  18GS A;  1W4V A;  1PN0 A;  3L9U A;  4MNN A;  4K8M A;  1JZW A;  4G9H A;  1A8L A;  2GT5 A;  4OFM A;  4WKW A;  2K6V A;  3CMI A;  1R7H A;  3ZYW A;  3KM6 A;  2AB6 A;  5H5S A;  4NXI A;  3E0U A;  1ACV A;  5KEJ A;  3QAV A;  1DSB A;  4EIQ A;  5AN1 A;  1A2J A;  3BJ5 A;  4Q5F A;  5G5E A;  4HI7 A;  2IME A;  3HHV A;  1DE1 A;  5H5Q A;  3M0F A;  4XRD A;  3EU3 A;  5DJM A;  2P0G A;  2DMM A;  1NM3 A;  3GYK A;  2YWO A;  3KH7 A;  3RDW A;  4BVY A;  1XOA A;  2LRN A;  1KNG A;  2B7K A;  3L78 A;  1TW9 A;  3KIJ A;  3GA4 A;  2MMA A;  1IYI A;  1QK8 A;  3BBY A;  1OC3 A;  4I97 A;  4KF9 A;  4TR3 A;  3QOU A;  3TKP A;  1Z9H A;  4ECC A;  2KP1 A;  1URM A;  3GHA A;  4D73 A;  4WF5 A;  2HT9 A;  5A4W A;  3IAS 2;  1X9M B;  2YN1 A;  1WRY A;  5LD0 A;  6GSX A;  1TKD B;  1HQO A;  3GIX A;  4HZ2 A;  3R3E A;  3C8E A;  1I9D A;  1X5D A;  3ZVJ D;  1OKD A;  4YQM A;  2OAC A;  4O7H A;  3LG6 A;  1B8X A;  3SBC A;  4PGT A;  1OYJ A;  3ERW A;  1GTB A;  2JSY A;  2AYT A;  2L57 A;  5INY A;  1K0B A;  1YEX A;  3ZRD A;  4ML1 A;  2K18 A;  1AC1 A;  4GST A;  3J7Y b;  4K7I A;  4XS4 B;  2HRA A;  1F3B A;  1THX A;  3FK8 A;  4ID0 A;  4K2D A;  2NVL A;  1SYR A;  4N11 A;  1NHY A;  4ZBA A;  3O6T A;  4POB A;  2V2G A;  4FYB A;  4V2L A;  4V2M A;  4BVX A;  3ZML A;  3GN3 A;  3GRX A;  5AIX A;  3ZIV A;  1OAZ A;  3QR6 A;  1ST9 A;  1V9W A;  2RII A;  3F0I A;  1JZD A;  4MF6 A;  3QFA C;  4JR4 A;  2L6D A;  3N5O A;  2O87 A;  1VF1 A;  2R3X A;  3TJF A;  4XS6 A;  2WS2 A;  3VPT A;  4YKF A;  3GL3 A;  1JLW A;  2AUV A;  3LFL A;  2F51 A;  1W89 A;  3KP9 A;  1M2A A;  3FKF A;  2LS5 A;  3HD5 A;  2C3N A;  1Y6E A;  3GH6 A;  4JED A;  2OAD A;  3KXO A;  4TVE A;  1JLV A;  5D9X A;  7GSS A;  5J3R A;  1WPI A;  1N2A A;  4KDY A;  4MPF A;  1GSS A;  2VOC A;  3HJP A;  1T1V A;  3KH9 A;  5AIS A;  2B5X A;  1V57 A;  3HVV A;  1PRX A;  2N5A A;  2H1A A;  1TI1 A;  3CSH A;  2H0H A;  3GUS A;  2REM A;  4I8B A;  1XWK A;  1S3D A;  1TK8 B;  2GS3 A;  3IRA A;  3DWV A;  2C0E A;  3L9V A;  3M9J A;  1O8X A;  4ZXG A;  4K0N A;  2IJY A;  2CA8 A;  3DGQ A;  4GXZ A;  5KOW A;  3MDK A;  2WRT A;  1Z3E A;  2IIY A;  3FYG A;  2I4A A;  2F8A A;  3TJJ A;  1A2L A;  3ZFL A;  4G2E A;  3WGX A;  4X0X A;  1FO5 A;  2H73 A;  1M99 A;  2OE1 A;  5D9W A;  2DBC A;  4BA7 A;  2XHF A;  1BX9 A;  2HFD A;  4L0W A;  2VM1 A;  3CSI A;  3IDV A;  4YQV A;  3F6D A;  4FO5 A;  3GH9 A;  3AY8 A;  2R0P A;  4IJI A;  2HRF A;  2B7J A;  4DVC A;  2FWF A;  1GWC A;  5CO3 A;  1WWJ A;  3KCM A;  2WJU A;  1XZO A;  4CY8 A;  2GVP A;  4YH2 A;  2N5B A;  3HA9 A;  5JWQ B;  1ZYE A;  2RM6 A;  2YP6 A;  3ERG A;  1H75 A;  3TKQ A;  1A24 A;  4K2X A;  2I9H A;  2GST A;  2TRC P;  3TKS E;  2XBI A;  4HQZ A;  4HQS A;  1O85 A;  1FHE A;  1A0R P;  2DJ1 A;  4L0U A;  2WDU A;  2O7K A;  4WEY A;  4XS4 A;  4PQH A;  1H4O A;  4NWY A;  2ZNM A;  2BMX A;  4RI6 A;  2H6X A;  1XW6 A;  1XOB A;  1M0U A;  2GZY A;  1YDK A;  1GSU A;  3LJR A;  2PVO C;  2QSI A;  3NZN A;  1YF1 A;  2DJ0 A;  4ZB6 A;  2IMI A;  4K5R A;  3IAM 2;  5HFI A;  5HR1 A;  2XC2 A;  3LQ7 A;  1GP1 A;  2FWG A;  3TJK A;  4I2T A;  5IMD A;  3IOS A;  1SKS B;  2H30 A;  2RM5 A;  9GSS A;  2IWT A;  4XHM A;  2A2S A;  4PX1 A;  2VCV A;  2YZU A;  2IMK A;  1PKW A;  2H76 A;  2QKE A;  1XIY A;  2B1L A;  4EE0 A;  5B6M A;  4FH8 A;  3BD2 A;  1BYE A;  1WJK A;  3APQ A;  2C0G A;  3GST A;  4E8E A;  5L71 A;  2VD0 A;  1PX6 A;  1U6T A;  4ISD A;  1EOH A;  4DEJ A;  3GMF A;  1MD4 A;  3EVI A;  5J9B A;  1Q98 A;  2IPA A;  3GX8 A;  4NV2 A;  3UEM A;  4IEL A;  1E2Y A;  3LW9 A;  3C73 A;  4PUA A;  5A4V A;  2FHE A;  1HYU A;  4TR4 A;  2FWH A;  2ZCT A;  2C3Q A;  2PBJ A;  4PTS A;  1DE2 A;  2L5L A;  3WT1 A;  3BCK A;  3FEU A;  2JL4 A;  2DJ3 A;  5COH A;  1FOV A;  3DYR A;  4RI7 A;  2GGT A;  4GTU A;  4LMW A;  2GZZ A;  5ECK B;  3IV4 A;  2DKI A;  5HFG A;  1XXU A;  4MH3 A;  5D73 A;  5CRH A;  4ILF A;  2R4V A;  4PUF C;  2J9H A;  4KE3 A;  4V1A p;  4EKZ A;  1QUW A;  4BWQ A;  4KDX A;  2RLI A;  4HDE A;  5DQY A;  3VK9 A;  1GUH A;  3ZVJ A;  1GSQ A;  2HLS A;  3DVW A;  4TW5 A;  2O85 A;  3A5I A;  3KJY A;  2HXK A;  2FD3 A;  2VLT A;  3TRP A;  5CRW A;  2LQO A;  3Q74 A;  4L5L A;  3EUR A;  3TJB A;  2C3T A;  1M9A A;  3C71 A;  2I3Y A;  2DLX A;  4KAE A;  4AJ8 A;  1M7T A;  1F6M C;  4MP4 A;  3KMN A;  3GKK A;  2LJK A;  2OE3 A;  3O3T A;  1K0D A;  2JZS A;  3JCM L;  1ZMA A;  3QD9 A;  2IL3 A;  5IIZ A;  1XCC A;  4GF0 A;  4JU5 A;  1KTE A;  4Z7X A;  1XVW A;  4IP1 A;  2FCH A;  1TU8 A;  4LL1 B;  4AF2 A;  4KSO A;  3CBU A;  3PPU A;  3P2A A;  3DIE A;  4K1F A;  4F0C A;  4ML6 A;  1BAY A;  3H79 A;  1T7P B;  3D6I A;  4QQ7 A;  1TOF A;  4JR6 A;  4NPB A;  3EIN A;  3IA1 A;  1QMV A;  3ERF A;  4YKG A;  5G31 A;  5C00 A;  2HZF A;  1M2B A;  4MMM A;  1ZYQ B;  1EGO A;  4K7N A;  1GUL A;  4ACS A;  4Z2T A;  3A5W A;  1GTI A;  1TRW A;  3HZ4 A;  3EPT A;  4KX4 A;  5LCZ A;  5EVO A;  2CV4 A;  5IOW A;  1SL1 B;  2M72 A;  3IK9 A;  1X5C A;  3ZFB A;  5EL8 A;  5GST A;  1F3A A;  1Z6N A;  1XWB A;  3PGT A;  3KTB A;  4RUV A;  1MDK A;  2H75 A;  2FA4 A;  5JCG A;  1TXX A;  2PUK C;  2R37 A;  3QAG A;  5C04 A;  3RHB A;  3KGK A;  2MMN A;  5FT3 A;  1G7E A;  3WYW A;  4KGI A;  5F07 A;  5DJL A;  1V98 A;  3PIN A;  2Z9S A;  5JWR B;  3D4T A;  1GSD A;  1TRV A;  2FWE A;  2H6Z A;  3MAK A;  3EYT A;  3BCI A;  1TJD A;  5CYY A;  3H4K A;  1JZO A;  4CHS A;  1DBY A;  2GSR A;  1V2A A;  2LRT A;  5B7C A;  4EC0 A;  2H01 A;  3GX0 A;  1F9M A;  2MBT A;  5IMF A;  4NHW A;  3H8Q A;  5J5N A;  1K0O A;  1SK0 A;  1XWA A;  2DIY A;  2YV7 A;  4LMV A;  2WGR A;  2KP2 A;  3GSS A;  3GTU B;  4DSS B;  20GS A;  2X49 A;  3C7M A;  1ZYN A;  3QFB C;  4OMV A;  4EF0 A;  3M1G A;  2VIM A;  2VUP A;  4PQI A;  2K9F A;  1SJI A;  2LKU A;  2GQL A;  2AV4 A;  4PXO A;  3P7X A;  4XIH A;  2HRN A;  2B5Y A;  4NV5 A;  1IYH A;  2P31 A;  3DML A;  4TKY A;  4IVF A;  1N8J A;  1V40 A;  5ENU A;  1X9W B;  3W8S A;  2O8V B;  4IGJ A;  3F8U A;  1FVJ A;  2FUG 2;  5ECQ B;  3Q19 A;  4LLR A;  4GLT A;  4K0G A;  2X8C A;  3HXS A;  5IPH A;  1ERV A;  2PVQ A;  1VF2 A;  1WP0 A;  1PX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...