4AJEA

Rat ldha in complex with 2-(4-bromophenoxy)propanedioic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
330
structure length
327
Chain Sequence
ALKDQLIVNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
total genus 113
structure length 327
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajeA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajeA02
1U28A 1ONOA 1XU7A 2W8ZA 2UUOA 1ZMOA 2O48X 4JXKA 1LLDA 4TKMA 2JD0A 1DSSG 4O1MA 3ZI0A 4CM8B 5TJHA 1DC4A 1RM3A 3GMDA 3PHLA 2HMSA 4BKPA 3WYCA 3LT4A 3UFXA 2Q3EA 3V5NA 3V1YA 4C7KA 5HRUA 3AUAA 4JX8A 4KQWA 2GERA 2JAPA 3I9OA 4YBZA 2C2XA 4IJUA 1TVEA 1XKQA 1KY4A 4RVFA 2X0RA 5DULA 3PYLA 4FFRA 1SEVA 4DRYA 2IZ1A 1VL8A 1EUDA 2C7GA 3EC7A 2VZ0A 4GAEA 1YB4A 4GGOA 5A3VA 3O8QA 4ALMA 3GGGA 1F17A 2YYYA 4YDRA 4CMJA 2Q1WA 3AY7A 1VKOA 5G2OA 3RBZA 2O7SA 2DPHA 3OJOA 4BV8A 4A10A 8ADHA 4CJXA 2J3IA 3UCFA 3WBFA 2IZZA 4MKXA 5A3JA 4A26A 2EKLA 4PG5A 4XYBA 3NT5A 3DBHA 1XELA 4FFMA 5DP2A 3S1LA 4EYEA 3DMYA 1KVTA 2PD4A 2A4KA 2VNSA 2EJVA 3GN1A 4NDNE 2WM3A 2C20A 2BI8A 4UAGA 3AK4A 1HDZA 4R5MA 3SLKA 4AJ4A 4DTIA 3PDUA 4YJFA 1HSOA 1ZEJA 3GZ4A 2CVOA 5DCUA 4JROA 5EL0A 3TZCA 5GMOA 4S3MA 1NXQA 4CL8A 3FR7A 3DTTA 2DTEA 4E5MA 2W4QA 4GWGA 1E3WA 2NVUA 3GZNA 5JC1A 4QSMA 2JCYA 2FWMX 1TEHA 1H93A 5B4VA 1LEHA 4BNKA 1H0KA 1X0VA 4I08A 1SZJG 4FFOA 4GX2A 4ALIA 1AXGA 3IOYA 1H6CA 2ZIZA 4BMNA 5TJ9A 1D1SA 3GR6A 3L4BC 4IZIA 4EEXA 2EW8A 2ZTMA 2YQ4A 4P8RA 4R9RA 5JDIC 4BKOA 2GASA 3F4LA 3GPIA 3HUDA 5H81A 3H5RA 5T6BA 3ZU2A 1CWUA 4PG4A 2Q50A 1GZ6A 2GO1A 1PWZA 4RF5A 1DEHA 3G1TA 4RVGA 2J6IA 2YW9A 2Z5LA 4A5OA 4CMIA 1QRRA 3WGQA 1C0LA 3WTCA 3H2ZA 3RKUA 2GGSA 1T2EA 3QLJA 2EXXA 5DBFA 3VPXA 4GX0A 4OM8A 4WLNA 2PKQO 1WDKA 4BNVA 4CMEA 4ZGWA 2JHGA 3P2OA 1I2CA 3QWBA 1DIBA 1H6BA 2XXJA 2GZ2A 1HL3A 5A02A 5CAEA 3UCEA 1I01A 5TSDA 2J5KA 4J49A 2AQKA 5EPOA 2G5CA 5U4QA 1WMAA 4F6CA 2PZMA 2AE1A 2CF6A 3Q0EA 3H4VA 3WGGA 1QSGA 2JFGA 2E6UX 3KOUA 5DCWA 1PWXA 1LDNA 1R4NA 1ZBQA 4IIVA 2FR8A 1YBVA 3LF2A 4YYZA 5DN9A 5JDIA 1ZKMA 4L8VA 3NDJA 3E5RA 3G0OA 3ITDA 1PGPA 1NFQA 2YV1A 3JD1A 2O3RA 3OA0A 2G0TA 2GD1O 4D45A 2WWRA 3WX0A 3VZPA 2GN6A 3LU1A 3GK3A 3Q2IA 4E33A 2V65A 1EUCA 1F06A 3ZV4A 3GAZA 4R4JA 4LGVA 4TQGA 2OOSA 4PGFA 4PZDA 3ANNA 2NTNA 2HU2A 4J91A 4CQLB 2O3QA 3AU9A 3WDSA 4PLHA 1H9BA 1P44A 3ROPA 4DUPA 1PZGA 3MWEB 3INGA 2AEFA 2OHXA 1AN9A 1SPXA 3IAHA 1YDEA 3L77A 4RZIA 2HRBA 3H9JA 5T8KC 2VTDA 5IDYA 2W90A 1CYDA 2ZQZA 1YH3A 4CM4A 1X7GA 1V8BA 1N9GB 4L73A 1NP3A 3PZBA 1RYEA 1N2SA 1XG5A 4QECA 4CMGA 4YT8A 5CG2A 1OFGA 5JO0A 4P4NA 1GUZA 5JNLA 4E5PA 5L7WA 5KOIA 2AEJA 3ON5A 2B69A 4FD3A 1VRWA 1UR5A 3FNFA 3WMXA 4DWVA 1WNTA 4BO4A 5KWEA 3TZHA 1GV0A 2YHIB 1YB5A 3CUKA 2HUNA 2J5QA 1M75A 1WZEA 2OMEA 3JYNA 3GVHA 2FOIA 3FBGA 2EV9A 3LZ6A 3W6UA 2WE8A 3QHAA 4MP8A 1LSSA 2O4CA 3DZIA 4MKRA 5B37A 1FF9A 3DZHA 5L53A 5KNLA 3UKOA 4DIFA 4HV4A 3E9NA 3O4RA 4FIZA 3PGXA 4R68A 4EUHA 5TT1A 1RM4A 2PA3A 1GEEA 1D3AA 1P1FA 1NWHA 1UP6A 5T64A 5CEEA 9LDTA 1BVUA 3OECA 4YXFA 5JCXA 4MKZA 2BGMA 1KEPA 3OETA 4D79A 5AVOA 1HE3A 3PHJA 4J9VA 1N5DA 2NU9A 1UZNA 2YUTA 3WNQA 4BNIA 2P4QA 5G4KA 1UJMA 3GVIA 3S2GA 4RCVA 1EMDA 1B15A 4Z3KA 2NACA 1M6HA 4RZHA 4F3YA 1VE9A 3GUYA 4B79A 1CEQA 3I9MA 1E77A 4PLTA 3NYWA 1PGJA 1YBAA 2O7QA 1V3VA 3GDGA 1LTHR 4PLPA 3KSUA 2Y1DA 3PJGA 1P77A 4UUPA 4ND3A 5HBRA 2R00A 4GX1A 4HFMA 5F3RA 1P1HA 4HX5A 4YAEA 5G0VA 2DUUA 3KVOA 3W8FA 1KS9A 1I3KA 4OXKA 1U4SA 3DZFA 1MXFA 4XIJA 3WWYA 2PGJA 3IL2A 4MVJP 4BMVA 1I33A 4Z3DA 3TSCA 4IM7A 3NDIA 4NBWA 4EI2A 5DP1A 4ALLA 3TN7A 3RROA 3LVFO 1P1JA 1VJTA 1ISFA 3L0DA 4WNCA 3HDHA 1EDZA 3VH3A 1N8KA 2O50A 4QX6A 4CLHA 1AUPA 2RH8A 4IINA 4FFLA 1NPYA 1C3VA 1Y8QB 3E18A 2J8ZA 1ISHA 2D4AA 2DT5A 4BKUA 1E7QA 5EQDA 3ZWVA 3DB2A 2VHYA 1HSZA 3ZGYA 2JD2A 3KBOA 2OORA 1A9YA 2R6JA 4BKQA 4GBJA 4IQGA 1LLQA 4DLLA 2P5UA 1B7GO 3I9KA 3O8QB 1GYPA 1YQXA 2IODA 3GOHA 4RF3A 3NKLA 2D5AA 2GDZA 3JD4A 5K6AC 3GEDA 2BLLA 4B4VA 4AJLA 4W9NA 3GNQA 3RAJA 4RVSA 4J1SA 3W4KA 2QZZA 2VYVA 5HTOA 5K9ZA 5TQVA 3OM9A 3WNVA 3FSRA 3V8BA 4WNIA 3H3FA 1WP4A 2QQ5A 3PQEA 4N5MA 4FFPA 3PWSA 3ZWCA 1P3DA 4M87A 4R1SA 1SC6A 3D1LA 4JN6B 4BO9A 3SC6A 4M89A 3A9WA 4GQAA 3RSHA 1JLLA 4XQ9A 5ICSA 3S55A 4R3NA 4FGWA 1PX0A 1PS0A 4Y6SA 4FOSA 3PQDA 4ALNA 1U3VA 3S2IA 4CLEA 1M67A 2H1SA 2YDXA 4BNUA 4NK5A 4DMMA 2FHSA 2ZATA 1T2DA 1HT0A 1QKIA 3DO5A 4D42A 1AHIA 3NDRA 1D1TA 3WYBA 2JCVA 1HDXA 4IJVA 4IPTA 2EIHA 3WGOA 1NYTA 2W2KB 4CLXA 2BFOA 5AXCA 3RQSA 3OSUA 5U1PA 3VPFA 2E82A 1LSJA 4NFYA 3UOGA 1KBZA 2J5RA 4YA6A 2AHRA 3B6ZA 1K6JA 1KERA 3GEMA 1OI7A 2C29D 1BXKA 4A2CA 2I65A 3ONDA 3BTOA 5IAAA 1GZ4A 4BGUA 1P1IA 4E6PA 5FF9A 4HY3A 3OQ1A 3RKRA 3GY0A 1Z6ZA 2NVUB 1GAEO 2E49A 3PJDA 5AYVA 5TIIA 1DIAA 4HKTA 4XIYA 3OEYA 1IL0A 5I9MA 4J4TA 1DIGA 1WWKA 2ZKLA 1DAPA 3PPIA 5EJ2A 3ANMA 5KVCA 2A35A 4BQRA 1QMGA 1NAIA 1UP7A 5A04A 2X1HA 1PJ2A 3GHYA 3JD0A 1NQOA 3K9QO 3Q9UA 2DLDA 4WLFA 3RU9A 2Q2WA 4E2XA 4IMPA 5JCJD 2I9PA 4ND1A 5KJCA 1PGNA 4O63O 3RC2A 1O5IA 1ML3A 5F21A 3DC2A 4HUJA 1E5QA 4O59O 1O9BA 1GUYA 1EZ4A 3KHUA 2D0IA 4XWYA 5ENVA 3BHMA 1IZ9A 4IQ8A 3E9MA 4ZVVA 4XQEA 1U2DA 4WCFB 3FR8A 3DOCA 1GUFA 4RDIA 4WOKA 1HYEA 4RORA 1DHTA 1I30A 4CUZA 4RF4A 1GPJA 4M8SA 3K2BA 4R41A 1ENOA 5COBA 3VTZA 1GU7A 4ZQFA 4CMIB 2P5YA 3DAFA 1DRWA 1E3SA 1QYXA 3GVXA 5AOVA 2EEZA 1RWBA 4UREA 4CMBA 4K6CA 2GLXA 5G4KB 3C85A 3NJ4A 5IN4A 3B20A 3G3EA 1Y8RA 1I5RA 4R1TA 3FNHA 4CV1A 3EZLA 1G0NA 5G0UA 3RBXA 4L0QA 5CDSA 1R15A 5I7FA 1T25A 2JKVA 4DA9A 3ZW8A 5KVQA 2VHWA 1DFGA 2BF7A 3ADPA 4PZEA 4HFJA 4EJMA 3SX2A 1DC3A 1NVMB 4BMSA 4IQ0A 4AG3A 3F4BA 3BMQB 2DUWA 4BNXA 2FMUA 4CM9A 2DBZA 1GYQA 3MJ4A 4EW6A 4NFHA 3ANLA 3D3WA 1N1GA 3RJ9A 3K73O 3WFJA 4DIOA 1JAYA 1ORRA 3HE3A 2PLAA 2PH5A 3LK7A 4W7HA 2X23A 4ID9A 3JYOA 3PFFA 3HFGA 4KUGA 5A9TA 4J0FA 1NHGA 1QORA 4GWKA 1HEUA 1D8AA 1EE2A 3DBRA 3FCOA 2NU7A 3I6IA 5I7VA 4CLOB 4U7WA 2P9EA 5EMHA 2E4AA 4RPJA 5CHEA 4E4YA 4IDAA 1ADCA 1NM5A 2OXIA 1JVSA 4D41A 1GDHA 4J2HA 4EITA 1XGKA 2QYSA 3OIFA 4AJJA 4MVJM 4TRMA 1TT5B 5KJFA 3K30A 3RUFA 2I66A 5TF4A 4AICA 2NTJA 2DM6A 3F1KA 1Z82A 1MB4A 3AOGA 3KSDO 3DHYA 1DLJA 3DR3A 4Z6KA 4CM4B 1UXHA 4UVHA 4O6VA 1XLTA 3PHHA 4ZQHA 3F5QA 5JYEA 4TWRA 3DHNA 2VWQA 2EGGA 1UAYA 3C8MA 5HM8A 1EVIA 1YE3A 4IGFA 1OZAA 3EYWA 3GZNB 5I8ZA 1LLCA 1HE2A 1LDEA 4L4XA 2GUGA 2X58A 4OKNA 4ZQBA 2IXBA 4GX5A 4NHEA 1NX6A 1VJ0A 4YAKA 1JU9A 2AMFA 3WTBA 4RO0A 4UVGA 1GQYA 4KDFA 3IKVA 1YWGO 4NJMB 4PFJA 3B70A 2RCYA 3CTMA 2PFGA 1NQAO 3NV9A 3X2FA 2C7VA 1L1FA 1UUFA 1MUUA 4BS9A 1G0OA 2QYTA 1WDLA 3GEGA 4U5QA 3C7CB 2EKPA 2Q46A 3TL2A 4BOYA 2HRZA 3WGHA 5L4LA 3W4JA 5FEUA 4Q3EA 2Y1CA 5JAMA 1ZJYA 3WB9A 2DVMA 1PGOA 3IDSA 5DT9A 5IZCC 3TNLA 4ZRMA 2C2YA 4XD2A 2B5VA 5BSFA 5I7SA 2X6TA 3WQSB 3GG9A 3PYXA 1YVEI 4JJGA 4TKLA 2EG9A 2QHXA 4RQUA 3H9GA 4YJHB 2ZYAA 4ZN6A 5KJ6A 4IY1A 3GH3A 5COAA 5B4UA 1JTVA 4BO0A 3I1JA 2WD7A 4OIMA 1NAHA 5JDCC 4W82A 2WTBA 2P2SA 4DBZA 3C3XA 1E6WA 3EVNA 1IB6A 4BKRA 4J16A 1ZMTA 4J43A 1A72A 3QP9A 4P38A 3JSAA 4OKIA 1MX3A 2VYNA 4J3FA 2O23A 3FTPA 4YAJA 5IJZA 4CMAA 3E8XA 3FTNA 1PJSA 3K96A 2FRDA 2JCXA 4W7IA 4TRJA 2IYPA 1F8GA 3NEPX 2BELA 1F12A 2IE0A 1X7HA 3TWOA 5JBIA 4UVIA 1S7CA 4R69A 3EY4A 3ZHYA 4ND5A 1UH5A 1BRMA 2YQ5A 3P7MA 3WQRA 3AW9A 3BMOB 4TMFA 1VKNA 1LNQA 3OICA 4J90A 1QYWA 3GT0A 3WBBA 4BO5A 3Q2KA 3VDQA 1B2LA 1MC5A 2DAPA 2Q99A 4YQYA 4OOFA 2FPGA 4IDEA 1PQUA 4RJTA 4PIVA 2G82A 3WIEA 2GZ3A 3DQPA 3GC6A 3CPSA 4R51A 3PLRA 4BNHA 5C37A 3KLPX 3FI9A 1P74A 3OIGA 3K2EA 4L4RA 4DVJA 1N1EA 1U3WA 2NTVA 4WKGA 4BQPA 3QY9A 2DBVO 2GCGA 4B7XA 3DHEA 5BSEA 2Y05A 3F46A 4L76A 4EEZA 1BXZA 4YPOA 3LT0A 4FJ1A 1CETA 1HLPA 1P0CA 4RV9A 1T26A 3HDJA 2Q49A 5BSGA 1LC3A 1OC2A 2I99A 1ZFNA 4K28A 4MVJI 4OH1A 4AJOA 3KB6A 3RU7A 2BFMA 2EERA 4I8XA 3PQFA 3ASVA 1HETA 1R16A 1UZMA 2BD0A 1E1LA 1UXGA 3MZ0A 4D46A 3NUGA 1YXMA 5BNFA 1D4FA 1XYGA 1EVZA 3BMNA 2NV6A 3IC5A 3GUCA 2WYUA 1KETA 2ILTA 3DAPA 2JHFA 1Y5MA 5ADHA 3WLFA 4B7CA 3DAGA 1B14A 3CIFA 2JAHA 4BGEA 3RUHA 4M86A 3WJAA 3NRCA 2UYYA 1PEDA 5FWNA 3OJEA 2FPIA 3RFXA 3W4IA 1E7SA 4CR7A 4R16A 1Q7GA 2OP0A 1U2GA 2VWGA 3LLVA 2ZCUA 5A06A 1EEHA 6ADHA 1E1NA 3D4PA 4LVUA 4XJSA 5IZCA 1YO6A 4Y9DA 1XQ6A 4ZQEA 4AJ2A 3B1JA 3QWFA 1DBVO 4BNMA 5HWSA 4MJLA 2D8AA 1HLDA 2Z1NA 4XB1A 3B1FA 3PEFA 3WGIA 1KIFA 5F1PA 1EBFA 5L51A 3KO8A 1MXHA 2VZ9A 4HNGA 1C1XA 5EN4A 1ZZEA 2X0NA 2NLOA 3DBLB 1I2ZA 2Q1TA 1GL3A 1U8FO 3H65A 2QW8A 5KKCA 2O3UA 3KZVA 4PLVA 2XF8A 5THQA 3ETGA 1DJQA 1LDBA 3I4FA 2PK3A 2SCUA 2CF5A 1R0KA 3QIVA 4J6FA 2HDHA 1Y9EA 3VOSA 4B3HA 3QVWA 1GD1O 4L4SA 1YS4A 1I8TA 1VL0A 1NQ5A 2VQ3A 3W1VA 1K2WA 2CDAA 2VYVD 3GNTA 3MOGA 1LRJA 1T2CA 4TROA 4EGFA 5CDTA 4FOOA 3FNGA 4WPGA 2ZJ1A 1O8CA 5BSHA 1U7HA 4D43A 3ROKA 3TF5A 2F1KA 1Y1PA 1NVTA 3UCXA 5JAQA 1T4BA 1UXIA 2CVZA 2CD9A 4L9RA 3WICA 7MDHA 1X1TA 3AM5A 4AJ1A 3BYZA 4RLSA 1LX6A 1GQ2A 2Z1MA 4FC7A 4BVAA 1B26A 1R0LA 2BH9A 3A14A 2H9IA 3HB5X 2DU8A 3F6YA 4L75A 2HJRA 3ROQA 1EUZA 4TSKA 3ZU5A 2CMDA 3W6ZA 3V2GA 2JFFA 4WASA 3GVCA 4EDFA 2J3HA 3I9NA 4OXYA 4BO8A 2VHVA 4JQCA 2HMUA 5I9LA 1TB4A 2HSDA 2G76A 4GH5A 3SEFA 2VT2A 4F6LA 9LDBA 5JC8A 1DHRA 4K9DA 4J0EA 3U09A 3QVOA 2AXQA 4E5NA 4KUEA 5F5NA 1A9ZA 1I36A 5HS6A 1TT7A 1P9LA 2Y1FA 3ST7A 3A1NA 3R3JA 1VLLA 5JPIA 5TNXA 1FDWA 1R0SA 2Y0EA 3OF2A 4YT5A 4E2ZA 1HDCA 2H6EA 1XEAA 4CQMA 3JYLA 4IZHA 3UHAA 3JYPA 4GVLA 1LA2A 1CQJA 1HTBA 1V6AA 3ZWYA 1ZSNA 4ND4A 2RAFA 3L6EA 4Y6RA 4FPXA 4DQXA 3KETA 2B83A 1YKFA 2ZB7A 3GFBA 3EUWA 1B0AA 1PJ3A 4MINA 2P9GA 5ER9A 2DFDA 2EF1A 3X2EA 1GTMA 3CMCO 2BHLA 2ZTLA 3WMWA 4B7UA 1X7DA 5A9SB 1T4DA 2WE7A 3PI7A 3HZZA 1BG6A 2X9VA 4NJMA 2V6GA 4QXMA 3EW7A 4JJIA 2PGLA 4P4LA 4FFNA 4YWJA 3WSVA 3B1KA 3NGXA 4LW8A 4WECA 3DOOA 4AJKA 2Y0DA 2W98A 1A4IA 3DMTA 3CKYA 5JY1A 1V9LA 3DOJA 1EQ2A 4U8GA 3TOXA 5C7OO 4YCAA 3H6KA 4XX0A 3SJUA 4HXYA 1KEWA 1N7GA 1KVQA 2ZJ0A 5ITVA 3ZU4A 1ZH8A 3QRWA 4RLHA 4IDFA 3UN1A 1L7DA 1VPDA 5HS4A 1SBYA 1UAGA 1E3JA 1Z45A 1IY8A 3O03A 4YAGA 2Y93A 4OQZA 1E0DA 2XOXA 1GV1A 1Z7EA 2JFHA 4ONEA 3JQBA 3QSGA 4TZKA 2DPGA 3OJFA 1PL6A 1VC2A 4ZD6A 2BFAA 2EWMA 4IDDA 3BZUA 3Q9NA 3BAZA 3ICPA 2VWHA 1XA0A 3NT4A 4Q3NA 1KVSA 3ICCA 1MC4A 1JDJA 2X9GA 4Y6PA 1JKJA 1QLHA 5GZ1A 4CM3A 3AY3A 3ETEA 5A9RA 1CDOA 3OQBA 1I10A 3ZNNA 3WGZA 3IS3A 2NNLD 4DBVO 3T4EA 2A9FA 1GEGA 2EGHA 3ZNQA 3I9JA 1PJTA 5TX7A 2FZEA 4OQYA 3RASA 2P9CA 3JCZA 2X9NA 2RH4A 3S2EA 3UVEA 4Q39A 3H2SA 2A94A 3HNPA 3MJSA 3NTRA 1ENPA 2ZTUA 1ISMA 1PQPA 4HADA 1YDWA 3PWKA 5CEJA 4XZ3A 2ZB3A 4FJ0A 4NU5A 3ZHZA 2PY6A 2YJZA 5CP8A 4NBVA 1M66A 3U9LA 1BGVA 1XIVA 4OO3A 4MPDA 4WLUA 3W8EA 3VH1A 3INRA 4I5FA 2C54A 4WOJA 2V6MA 3PYMA 2XPCA 5F1OA 2X5KO 3AOEC 3C24A 4WGGA 2GN4A 1NPTO 1EK5A 4J4BA 1VSUA 1I32A 1EVYA 4LMPA 2CNBA 2HJSA 3KEQA 1UDAA 3D0OA 4H7PA 3TQHA 3A06A 2FPPA 4BNNA 1SO8A 1HDYA 1Q2XA 1DIHA 3JQ6A 1DJNA 4DPLA 5IDQA 2HQ1A 4BNWA 5EINA 2NSDA 1ADFA 2B5WA 4FR5A 4W9NC 4Z0PA 3H5NA 1JWBB 4DLAA 3G79A 4X54A 1YJQA 2EKQA 1LQTA 2O4UX 2EP5A 3JD2A 5H82A 1E1KA 3PK0A 4YEDA 1O89A 3RWBA 3U4HA 4ITUA 2IEDA 3ZHBA 2PR2A 3KYDA 3LC2O 1U4OA 3ZV5A 3RIHA 3TDKA 5C5IA 4L74A 3LT2A 1DC6A 4RDHA 2VT3A 1R6DA 2CDBA 4BNZA 4F45A 1PJLA 2RBEA 4XCVA 1BW9A 1O0SA 1C0IA 2D3TA 3BTVA 4O0LA 3L07A 4E30A 3HN7A 2QRJA 3TZ6A 1SMKA 5JY6A 1HZZA 1KYQA 1GZ3A 1GADO 1SB9A 3HN2A 2Y1GA 3IP3A 4O5OA 3KYDB 3VVCA 3S2FA 4LSWA 3KXDA 3HDYA 3NAQA 3LC1O 5DNAA 1PL8A 1SOWA 1JAXA 1NFRA 4WLOA 5J23A 1BWSA 2OP1A 3K6JA 3K31A 5KVSA 4CL3A 1WLYA 5A5EA 1T2FA 2ZTVA 4GPD1 4IXTA 3R0IA 4YJFB 1A27A 3MTGA 5MGBA 1RJWA 3LC7O 4WLEA 3KYCB 3QE3A 4J7UA 4C4OA 1NWCA 2BKAA 3IKTA 3OJLA 3PJEA 4KTTE 3MJCA 5IXYA 5TGDA 4AL4A 3ZWAA 4LN1A 2R00C 4DXHA 4BNLA 5KTKA 1PL7A 2D1YA 3ONFA 3HG7A 3Q1LA 1NPDA 2UUPA 1GFSA 2WYWA 4BO3A 4PN3A 1YGYA 5KVVA 2NVWA 2OBYA 1PJCA 4CMHA 3NX4A 4Z9XA 1Z75A 5CDUA 1H6AA 2GN9A 3EDMA 3Q6IA 2HCTA 4PLWA 4A7PA 2NQTA 5K6AA 3OJ0A 4YQZA 1LUAA 1XHLA 2HAEA 3GGOA 5FFFA 3WSWA 4B8WA 3PDJA 4HNHA 3BMOA 4CV3A 3IMFA 3EAGA 2VRBA 4WUVA 4D0SA 4M1QA 2ZCVA 4CMKA 2GNAA 4BGIA 3KLMX 3C1AA 1ZJZA 1J6UA 5G4LA 1GPDG 2BGLA 2DC1A 5LC1A 3JQ8B 3U3XA 4A0SA 3NT2A 1P45A 3NJ8A 2PH3A 4XKJA 5CDYA 2IZ0A 4OL9A 1E3IA 3QA9A 3EZYA 4IDCA 4XDZA 4JBIA 1VJ1A 1FXSA 5BT9A 1LJ8A 3D64A 1LSOA 3G17A 2O3SA 1SOVA 3JQGB 2B35A 4FDAA 5AXBA 3VH2A 8LDHA 5K0ZA 1A71A 2X86A 2VRCD 4FQ8A 1Q7CA 3EGOA 3RC7A 2VN8A 3KRTA 4QQRA 4AJIA 1PIWA 4CM5A 2I3GA 3M6IA 5LDGA 3OP4A 4U0JA 1SNYA 5JMWA 5KJEA 3JYQA 1KOLA 1ENZA 1W0CA 1X1EA 1BHSA 1JWAB 5HA5A 1AE1A 4I5EA 3JQ7A 4NR0A 2QZ9A 1QYDA 1DFIA 1Y6JA 4Q3CA 4YJDA 3F3SA 3IIEA 4JCOA 4BUCA 1U3TA 3JQFC 3PRJA 2I76A 2CVQA 4PG8A 4MDHA 2ET6A 1W6UA 1GYRA 2X7HA 2O2SA 3BHJA 4JJFA 2YHUA 4UULA 4YJGA 4DGSA 4E2WA 1FK8A 2YFQA 3ZWWA 2VTEA 5ILOA 3ZWMA 3DZBA 5JAIA 3MJVA 2PZKA 4N7RA 1YBMA 1ZIDA 3I23A 2V7PA 3QW2A 4CR8A 4DREA 1DAOA 4E2YA 1PJQA 3RFVA 4HFNA 3RVDA 4KZPA 1FDTA 3IQDB 1P1RA 4Z0HO 1Q1NA 2ZK7A 2UV8A 3BMCB 5L7TA 4GI2A 2WD8A 1PSDA 1UP4A 2VUTA 4J4HA 1EVJA 4IS2A 3UAGA 5MDHA 4Z0TA 4GGPA 3HFSA 1DB3A 1QLJA 4OXNA 1KVRA 1N9GA 1MV8A 3UICA 1I0ZA 4E0BA 3E82A 4I9HA 1CQIA 4OSOA 3AJRA 3WGTA 1ZW1A 4WE3A 5JW6A 3FD8A 3SXPA 3H7AA 3WYEA 5CPFA 4BHTA 4XGIA 1EQUA 1RM0A 4RQTA 2G17A 4W6ZA 1ISIA 4UUMA 2NUAA 5T67A 4NH4A 4DQVA 5CFZA 5AQ1A 4IJKA 4MP6A 4LK3A 1WZIA 2NU6A 3KM0A 2I3AA 3OBBA 2C5EA 5DZSA 2Q45A 3OH8A 3DBRB 3DTYA 2JD1A 3V2HA 4BB6A 3ABIA 3ULKA 3K5PA 1JN0A 4E32A 2OZPA 3CE6A 3O26A 2AA3A 4PG7A 4RVUA 4YAIA 3WR5A 5ENDA 1LRLA 1MG5A 2YZ7A 2FR0A 2X4GA 3KTDA 3MEQA 5H83A 1MGOA 3BA1A 4BB5A 5CEFA 3MWDB 3IUPA 1ZK2A 5GZ6A 2G1UA 1FDVA 4U0KA 2P68A 3HHPA 3MJTA 3QVXA 1DRUA 1A5ZA 1C1XB 4IS3A 2WJPA 4D3DA 3ZNPA 3FWZA 4JP3A 4R1UA 4IDGA 4TRNA 5JSFA 1HXHA 2UAGA 3VVBA 3L4SO 4NMHA 1LI4A 1PR9A 1HZJA 1KC3A 5KIAA 2LDBA 1LRKA 4CM6A 3JQFA 3I9LA 3UH1A 4I5DA 4XYEA 1ZK1A 3PJFA 3PGJA 3OA2A 3FF4A 3AI3A 1WPQA 1I2BA 1HYGA 1TLTA 4TRRA 3WWZA 1L7EA 5EQFA 3OEWA 4HWKA 3CXRA 3TFOA 1ZVMA 2DBRA 3GGPA 2HLPA 4J7CA 4RGBA 5TRTA 1ULSA 4DQUA 5JDCA 5C7LO 2BMAA 3D7LA 3DFZA 1R4NB 1LDGA 4Q3AA 4NQZA 4LVCA 4XEHA 4G5HA 3ASUA 2DKNA 2WSBA 3HWRA 1ID1A 4OMUA 1EFLA 2J3JA 3COSA 3GMSA 5JE8A 5ITWA 2X0JA 3IUSA 5ES3A 1BDBA 3GQVA 1G6KA 4J9UE 3Q3CA 2ZYGA 1PGQA 2QIOA 4IJWA 5IXSA 2RHCA 3E03A 4XGNA 4ILKA 4CMEC 4EJ6A 1E92A 1O6ZA 1SEPA 2NQ8A 2OBNA 3WJ7A 1N7HA 3DDNA 4M54A 4PRLA 5L4NA 1I24A 3LT1A 4Y67A 4GMGA 2Q1UA 4GSKA 1WXDA 4FCCA 4MVJF 4EUEA 4ZHSA 2FSVA 1NQTA 4ZRNA 1E6UA 2H5LA 4B4WA 3ZWBA 1MG0A 3CINA 2NWQA 3RUAA 1ULUA 1V3TA 2GR9A 5JLAA 3P19A 1R66A 1IHXA 5C7IO 1QV7A 1K3TA 4ZJUA 3DZKA 5IDWA 4JK3A 1K0UA 5B4TA 4YB8A 3SVTA 4OGWA 2NU8A 2VYND 3U0BA 3RC1A 2IRWA 3GFGA 3JQAA 3K92A 4N18A 5DDIP 1XCBA 2EHDA 5EESA 4TZTA 4AFNA 5IFLA 4CR6A 5IF3A 3N74A 4ZU3A 4WEQA 3AY6A 2C59A 1ZK4A 1RPNA 1NASA 4KMSA 4PLGA 4NNJA 3AUTA 1V35A 1DXYA 2AW5A 2FY8A 3I4CA 4J1QA 4KWIA 2C82A 1ZCJA 2V6BA 4INAA 1O95A 3GLQA 4KQXA 5T8KA 5CG1A 3IJPA 3ZW9A 3D4OA 3CSDA 3SLGA 1CF2O 3MOIA 4J1NA 3ENNA 3PTZA 4XRRA 1QYCA 1TXGA 1BDMA 3A28A 4KP7A 1U1IA 4YACA 4IMRA 3ZWOA 4CQMD 4GLLA 4YT2A 1FMCA 1B3BA 3JQBC 3C1OA 3JD3A 1WW8A 1UZLA 1KEUA 4N5NA 4PVCA 3GDOA 3EK2A 4H16A 4MO2A 1H2BA 1WAMA 3RCBA 1EDOA 3AWDA 4MOWA 1LBEA 3C7DB 4J1TA 3GRKA 3S8MA 3BIOA 1B8VA 2PTGA 2X5OA 5JAZA 1BVRA 3WGYA 4XQGA 3PLNA 3STHA 3QWHA 3TPCA 2YDYA 1PJBA 1DC5A 4Q3DA 2HMTA 1YONA 3GG2A 3JQAD 3NTOA 1ZK3A 4IDBA 2VWPA 3C1TA 3FRJA 1HWYA 3UUWA 1W4ZA 4JGBA 2QG4A 4QO7A 4XYMA 3G49A 1D7OA 4D3FA 3QWAA 4GKBA 3PXXA 2HO5A 4NG5A 1QXSA 3AFMA 3N58A 2HK9A 3AU8A 3PIIA 2D2IA 5F1KA 3QWIA 2VRCA 5G0TA 4AJHA 5KJ1A 2VOJA 3D4NA 5LDHA 1E5LA 4UUNA 2YV3A 1QYVA 1UDCA 3GPDG 1ISGA 4ZICA 5TLSA 3AI1A 4FN4A 3FHLA 3CMMA 4CUKA 3JQ9C 1DIRA 4D0RA 3OFSA 1PS9A 3VKVA 3W8DA 5L95A 3G1UA 1NBOA 4WCFC 3E6AA 5BR7A 4PZCA 4CLRA 5L3ZA 1X15A 3LDHA 1VSVA 1MA0A 4IXWA 5DCYA 1HF3A 3VZQA 1SCUA 3D5TA 4G65A 1G1AA 4DPMA 3N7UA 2XAAA 4NU6A 3JQAB 4XYGA 4LRSB 4FB5A 2GN8A 3JV7A 1E3EA 1SB8A 3IP1A 3NTQA 3RBVA 3DONA 2JL1A 4MIYA 4EUFA 3FN4A 3VHRA 1GY8A 4II2A 3TFQA 1U5CA 1T24A 1YL5A 3M2TA 4B3IA 4DL9A 1NHWA 3ZWPA 7ADHA 5ILGA 1TA4A 4YTEA 3ADOA 4UEJA 3RUEA 4DMLA 4Y8VA 5L9AA 1ONNA 2PWZA 1U3UA 1X0XA 4ROSA 4OJNA 3TZQA 3GA0A 4IBOA 1LXCA 3VC7A 1RYDA 3IJRA 1R4MA 4DYDA 1ENYA 3GF4A 1RKXA 4URFA 3NGLA 1X13A 1HDRA 1AGNA 1KEVA 1NR1A 2PGDA 2PZLA 4DYVA 1N92A 2YHIA 3BHIA 4YR9A 3T7EA 3ZWNA 3BMQA 4UEKA 1UXKA 2CUKA 4BO7A 3K8ZA 1HE4A 4PCVA 1S6YA 1PJ4A 4IUYA 1KC1A 1T1SA 3LLSA 4CM7A 1NVGA 3HB4X 1ISJA 4XR9A 4TVBA 3AM3A 1EK6A 4B3JA 3WXBA 3PHIA 3DMTC 1BW9B 3RFTA 1P0FA 4RVHA 2FR1A 4KWHA 3FBTA 1Y81A 3O9ZA 1ZNQO 4GL4A 2IXAA 2GSDA 1OC4A 4LMRA 5B12A 1C1DB 5DBIA 1RM5A 1HKUA 5TS3A 2YFHA 2VHZA 4FGSA 4BNFA 1P31A 1VM6A 4J2OA 2DQ4A 4S1VA 3OHSX 4UEOA 5IG2A 3PP8A 2YV2A 4JBGA 3EHEA 5L40A 1EE9A 2A92A 3ZV6A 5JFOA 3R3SA 1R37A 4MVJH 2I67A 4CPDA 2ZB4A 2B4QA 1B16A 2VCYA 1OOEA 1PR3A 2O3JA 3M1AA 1IPFA 3ONEA 2DFVA 1YRLA 3KYCA 1BMDA 2Q1SA 4QFDA 4N5LA 3P5SA 4UVEA 3KUXA 3ZU3A 2BRUA 1WDMA 2B4TO 3WIDA 2ZYDA 4KOAA 1XU9A 4CLRB 4E21A 3RI3A 1F8FA 4QTZA 3JQGA 5A1TA 2GYYA 1PZHA 4QEDA 3RD5A 1TI7A 1HDOA 1K6IA 1E6EA 2Q4EA 3D3EA 4Y98A 3LYLA 3BTSA 1FJHA 2Q2VA 1HRDA 2BFPA 5KCZA 1PU2A 3PHGA 2EP7A 1JQBA 2PV7A 4BNTA 2E48A 5IN5A 4A27A 4CMCA 4MVJA 4G81A 4LCJA 3TRIA 2VUSA 5BQFA 3LF1A 2GRAA 2Y1EA 1ZUD1 4OSPA 5L7YA 4P4GA 4AJPA 1Y5RA 1OMOA 4I1IA 1W73A 1KVUA 5A03A 3FNEA 2Y66A 3QVSA 4NI5A 2ZQYA 1UXJA 2B0JA 4JBHA 3WOHA 2TMGA 3I3OA 2R2GA 4BO6A 1C0PA 3H9EO 3MJEA 1J49A 3ENKA 4MIOA 4LCEA 3H3JA 3I5MA 3CZRA 4BO2A 2CFCA 3H9QA 5DOVA 4R9SA 5JXWA 3L6OO 1IOLA 2I5PO 3VH4A 3AOEA 4CM1A 4EJ0A 1J5PA 1JVBA 4YRDA 1GQQA 1E7YA 2QRLA 4NBTA 3I52A 2WYVA 2FZWA 4RPLA 3RJ5A 4D44A 1FDSA 4E3ZA 5BNTA 1C1DA 2POQX 4BO1A 3AFNA 3GDFA 2Z95A 4WJZA 1U7TA 3DXFA 2FN7A 1PTJA 4E12A 3U4DA 1P1KA 3MCVA 5CDGA 4QUKA 4LRTB 1ONPA 5L4SA 1YB1A 2OUIA 4GSLA 2UDPA 4YJHA 3AUSA 2AG8A 1XDWA 5T57A 5L45A 2F00A 2X0IA 3QQPA 4K6FA 1PZFA 1OBFO 1XWFA 3E5MA 1DDOA 5A05A 3BTUA 3AUUA 1ZXLA 2WMDA 5G0WA 2B36A 4RPHA 1H2HA 4NZ9A 4E5KA 2P4HX 3AM4A 1T1RA 1Z7BA 2IYOA 2WDZA 2CSUA 1EBUA 3VTFA 4KUHA 2GZ1A 3GRPA 5I9NA 1F0YA 2C5AA 1JKFA 4CLDA 2HK8A 1W8DA 1YL7A 2HMVA 4XJTA 4YJGB 2X22A 2AG5A 3O38A 5GY7A 4DLBA 3HSKA 5G0SA 3VPGA 5ER6A 4BGVA 3UW3A 3M2PA 1DRVA 5AXAA 4D3SA 5A5FA 1GCUA 4H3VA 4AJNA 4XA8A 3OIDA 3WFIA 1OAAA 1ZO8A 1MLDA 1C0KA 5CPBA 2OFPA 3GVPA 1C14A 2AEMA 2GPTA 3VZRA 3U4CA 1E1MA 3ZDFA 4D7AA 2EW2A 4BNYA 3RUDA 1Z74A 2AQIA 5JO9A 1HE5A 1Q0QA 5JCJA 2V6FA 2VOEA 3H5AA 3VDRA 3SC4A 3VPHA 3PFWO 5TC4A 2DTXA 2W2LD 2W2KA 3FPCA 4XR4A 2B4RO 1JKIA 4OOEA 1Q0LA 2PKQP 4MVJE 2CY0A 5FYDA 1KY5A 1B8UA 5GZ3A 1H9AA 3D3WB 2CZCA 3ZN2A 5JS6A 4Z9YA 3ZV3A 3I83A 3RC9A 3VKUA 1CIVA 1LU9A 2NVBA 3UGKA 4RPKA 4M55A 4E13A 3ZWXA 1YL6A 3EVTA 4ESOA 1SAYA 1QG6A 4XB2A 1Y8RB 4R5HA 5IZ4A 1GR0A 3H9UA 1Y7TA 2Y0CA 4J7XA 2LDXA 2WD7B 4XQCA 5FI3A 3WQQA 5DBGA 4FC6A 1HDGO 4UUOA 3GHHA 1ADGA 1IUKA 3JQDA 4NBRA 4P22A 5JYDA 4Q9NA 3VPSA 4R01A 4F46A 1YQGA 3F47A 3RUIA 4OAQA 3L9WA 1U8XX 4WEOA 3DBLA 3GAFA 1X14A 3OQ6A 4CQLA 4RPGA 1LSUA 1VL6A 1E3LA 4HFRA 4JP2A 4FBGA 5B1YA 4EZBA 3Q11A 2C0CA 4MVJD 3ROMA 1V0JA 3GN2A 4NJOA 3DZJA 5COQA 3TJRA 1JA9A 1Z73A 4K1LA 3SJ7A 3SBOA 4YRBA 4AJEA 1R4MB 4G2NA 1V3UA 2QX7A 3VAZA 4NBUA 1A7KA 4KDEA 4I9NA 2C07A 2B37A 4WK6A 5F5LA 4C7JA 1IE3A 1QR6A 2PD3A 1DO8A 3KV3O 3BXXA 1NR7A 2BI7A 3HADA 4GLOA 1NNUA 5T5QA 3T7CA 2IDZA 4QFCA 2Y68A 1I3LA 1WMBA 1K5HA 3DFUA 4NIMA 5DOZA 3KYBA 2Y99A 4XRGA 5I7EA 3M1LA 5TT0A 4AVYA 1H5QA 2GF2A 2JJYA 1ZK0A 3L9XA 3INTA 3JQ8A 1IYZA 3U49A 4BL5A 1JW9B 3L6DA 3KEOA 2TMDA 2H63A 4HP8A 1DLIA 3U62A 4E31A 5I8WA 3MTJA 1CERA 1HYHA 2EJWA 4I9UA 1IULA 4ALKA 4HBGA 3CH6A 3ORFA 2Q4BA 2E37A 2PKRA 4U6SA 4OHUA 2W2LA 1K6XA 1I3MA 4BNJA 3DBHB 1NFFA 3UF0A 4OYRA 1E7MA 4IGEA 2Q2QA 5EIOA 1H94A 4CLOA 4JLWA 3JTMA 3F1LA 3ITKA 4CM9D 2VNAA 1NTOA 5C3MA 1BXGB 4QO8A 4XDYA 5A4DA 2BGKA 1PS8A 4CODB 2VUUA 4EBFA 3F5SA 4PVDA 1T2AA 1LQUA 4B4UA 4GKVA 3ZCXA 4M49A 1E7RA 1YOVA 4CV0A 4JNKA 2IEBA 2Y1OA 3ZNOA 4LSMA 1A4UA 1LC0A 4MP3A 2D59A 1IPEA 1Q0HA 4PLCA 1UDBA 2PZJA 4K26A 3PVZA 1FDUA 4ND2A 4RF2A 4FSHA 4R3WA 3T4XA 2DBQA 2HMWA 2XXBA 2Y67A 2VZ8A 4R1NA 4IIUA 1IHYA 3DZGA 3U4IA 3R6DA 4LISA 3V2UA 3VZSA 1O94A 3DWFA 2NM0A 2NADA 4BNGA 1CRWG 1Y9AA 3QJ5A 1M6WA 1TT5A 4MVJG 3HJAA 5FI5A 5THKA 4W4TA 1QV6A 3P2YA 4CUJA 2AQ8A 2AQHA 3TL3A 4YRAA 1E3WB 1XR3A 3DL2A 5JMPA 2FP4A 4A73A 4H15A 1Y8QA 4DIBA 1QP8A 3WS7A 1YJ8A 1LDMA 2OO5A 4Z9FA 4RL6A 4A03A 4XYLA 1F14A 1IZ0A 3JQ9A 1DPGA 3PZRA 4CM8A 2RIRA 3LSYA 3QVTA 5AXDA 2X8LA 3RUCA 1MFPA 1ZSYA 1GCOA 1B8PA 3DBVO 4RVDA 5U9CA 2J3KA 2O2YA 3WLEA 1ARZA 4B4OA 5BNIA 4ZA2A 1EFKA 1LDYA 3I6QA 4WCDA 2VHXA 1M2WA 4DC0A 3C7AA 3U5TA 4XGKA 1WVGA 4FS3A 2X5JO 1H6DA 1ADBA 1K89A 3KSZO 1ZEMA 4JIGA 5DF1A 3LQFA 2YY7A 2PNFA 4WLVA 1MFZA 4PG6A 4GMFA 1BTOA 1J0XO 4N54A 4YVFA 3BMCA 2DTDA 4PLFA 3JQ7B 2I6TA 3PWZA 4R54A 3HDQA 3BMNB 4II3A 2OL4A 4NFSA 4I5GA 5LCXA 3V1TC 3UXYA 4WCFA 1AHHA 1DFHA 2OGUA 2PD6A 3EMKA 4CV2A 3TOZA 4Q3BA 5IDXA 4GVXA 3F9IA 4BV9A 3WG9A 1BXGA 3FPLA 4BIIA 4DC1A 1I3NA 1DOHA 1PZEA 2HKIA 2WEKA 3OMLA 4FW8A 3A4VA 3E9QA 2RHRA 4NPCA 3E1KA 3E48A 3HQ4O 4MIEA 1E7WA 1U9JA 3H8VA 4KTVE 3DEYX 1A7AA 1CJCA 1LLUA 3JQEA 1BSVA 3JQCA 1YOVB 4PLZA 4FJ2A 4PRKA 4TVOA 3ETDA 4W99A 5KKAA 3R1IA 1M76A 1B3RA 3ZH2A 3V1UA 3PIDA 3AI2A 4E5YA 2D5CA 1XSEA 4CQMB 3CEAA 4PLYA 6LDHA 2QRKA 1R12A 3D5QA 4UVDA 1XQ1A 2UVDA 3L4BA 4U6QA 3ZHXA 1P33A 4B8ZA 3FWNA 1PQWA 3GNSA 2P91A 1Q7BA 3TZKA 2O3TA 4YT4A 1YQDA 1MP0A 1U5AA 1VI2A 5EERA 4ALJA 2CDCA 3ZZNA 4ZQGA 5A9SA 3QV1A 2FSSA 1AXEA 1ZXBA 3CZMA 4DPKA 4NK4A 4QT0A 5ICMA 2AE2A 1ZSVA 1J4AA 2HK7A 2ZB8A
chains in the Genus database with same CATH superfamily
4QYTA 4S0ZA 1KYXA 5I7UA 5ED4A 1XU7A 4W1PA 5F23A 5DK6A 2W8ZA 2UUOA 3U9TA 2GAAA 5IS2A 4QPJC 3PF9A 2FWAA 2O48X 2COEA 4GOND 4NF2A 4TKMA 5F78A 2JIOA 3RFUA 3E8MA 2I1LA 3R6LA 5DLQC 3QVJA 3KELA 1V43A 3SEZA 5TJHA 3R0ZA 1DZ3A 2X0KA 3ESAA 4JGIA 1N8SA 4TLMB 4NYIQ 2HMSA 4ZVLA 4KPFC 1CZRA 1WSDA 3ISJA 1JA1A 3EFBA 5IF9A 3PNSA 1L7XA 4QGGA 3V5NA 4EY3A 3V1YA 5A4KA 2X8JB 5EGNA 3AUAA 3LM8A 3VVLA 2BSXA 4QFBA 4PYMA 3ZVKA 3R0XA 1WSBA 1WRBA 4AKEA 2Q7DA 2C2XA 1GFWA 1JDZA 2VJPA 1D4OA 1TVEA 1XKQA 1Z38A 3EOAI 4IJUA 3B7PA 3D4LA 3PYLA 2YWJA 1Y1TA 3PS9A 5DULA 2IHTA 1N3YA 4BMDA 1G2IA 1O8BA 1F2UA 1RKBA 3L6CA 4WK0B 4BQFA 3CEPB 5AH0A 1K7SN 1IZ8A 2VSFA 4JC8A 4ZOLA 5DWDA 1WHTB 3KR2A 4AO8A 2I29A 4JYZA 3EC7A 2GPYA 2VZ0A 4GAEA 1Z8NA 2BWJA 4DA7A 1TF2A 4H27A 5A3VA 3G8DA 3HDGA 2QQFA 4L3OA 3GGGA 1F17A 1P7WA 4YDRA 2VHUA 1WQ4A 4OBBA 3NP9A 3ZJYA 1Y5LA 3EDOA 1MOQA 4MUHA 1A2QA 1MJHA 2G1KA 2KHZA 3QY0A 4HDRB 2DPHA 3C3DA 4IX9A 5EP3A 2FN4A 4L0CA 2WZBA 4W8HA 2CL6X 8ADHA 3W5JA 4CJXA 1T8WA 1AJEA 1WW2A 4MKXA 3B2NA 2WAXA 2Z6QA 2EKLA 4PG5A 4LJRA 1KJJA 1RQ7A 3VOTA 3DBHA 5E9JA 3EZXA 3NDPA 5LXTA 4AX8A 2YXBA 5UKDA 3SGLA 4BX9A 5LIRA 2GLTA 1KVTA 4C1BA 4NDNE 4WGFA 4N48A 2ISSD 3PXBA 4OHZA 2WIKA 1U2QA 4RK0A 1P2DA 5A6VA 3I09A 5IDVA 1H4TA 1BE1A 1Y5NA 1XA4A 1TOAA 2G6TA 2PZEA 4R1OA 2KPOA 3K70B 3BS4A 1LVUA 4GUDA 1IN6A 5EL0A 2ZRFA 4ABTA 1OXKB 2VL7A 2QTLA 2Y27A 3QE2A 2AC7A 1XPRA 3UHFA 3ZYZA 4CL8A 5HW0A 3FR7A 3DTTA 3QEMA 3LUGA 1YKGA 1XVLA 3FUXA 3DDUA 2XCLA 2B8WA 2GX6A 2XQIA 1GHTA 3A6JA 3UWKA 2ZSDA 5JC1A 2JCYA 1TEZA 2FWMX 4Q01A 2ZJ5A 5IHXA 4MRSA 2B4KA 3DD5A 4PQGA 5B4VA 2ZSHA 2C95A 4BYGA 3F2VA 1M2KA 4ZWNA 1SZJG 1DCFA 4ALIA 3RS8A 3T1QA 3IOYA 1H6CA 2A0XA 2PWYA 3LGSA 4QEKA 4B2LA 2C1XA 4M0CA 3UAVA 2BP7A 4BMNA 4FLEA 3N2GB 4PHCA 3UMGA 4EEKA 4HHEA 5FV4A 4P8RA 4R9RA 3EXHA 3ANYB 2ZT7A 3H1EA 1GU1A 2GASA 2P3SA 2GETA 3KLBA 1GZVA 5H81A 4DLYA 2HYIC 3LPAA 3CLSD 1XKXA 2GO1A 2EZ8A 3ND5A 2JJ2A 4H1VA 3IKMB 3RYFA 5K8TA 3B9BA 3GCGA 4CTNA 1DEHA 4RVGA 4ZQIA 3JATB 2JA1A 3FNIA 2J6IA 4V03A 1U2DC 8OHMA 2COKA 4WX2B 2H92A 4N7MA 2Z5LA 2HSWA 1CLEA 3NPAA 3QUAA 4CMIA 3G23A 3LUAA 2YL2A 4MHTA 2CNOA 3K20A 3WTCA 5EGSA 4WSOA 1Q84A 3IAFA 4Y30A 3RKUA 3W2GA 1THZA 4QJ3A 3ZWQA 2WV9A 4UBLA 1E5VA 4M9ZA 4PPGA 1IVYA 4M99A 1G19A 5EMLA 3ECCA 4GX0A 1BNCA 2Q62A 3VPXA 3OLXA 2VXCA 1M6NA 1Q7EA 3CRVA 2D2EA 1I7LA 2F62A 1C9DB 3SZRA 4Q7QA 4DCMA 3L5KA 4ZMRA 2MOKA 2OUKA 2E0IA 5CAEA 4GOXA 3ACCA 2Y8EA 5EPOA 2G5CA 5U4QA 4RXMA 1SUDA 1KOFA 1E59A 2JGIA 1ZRNA 2WJWA 1QSGA 4U9IS 2RK6A 3RJZA 3WGGA 2Z2YA 2QR3A 3EWAA 2VRWA 2AFIB 1RQNA 3PNLA 3IFSA 5DCWA 2H4WA 1R4NA 1ZX1A 2WKQA 3VR6A 1SWVA 2W00A 2FR8A 4MH0R 5D1NA 5ALYA 4EI8A 1FTNA 3QOWA 1N2JA 1M2NA 1SC1A 4JLBA 4K03A 5JDIA 3WQHA 4L8VA 1J9GA 1NUAA 1C50A 2Z57A 2AEEA 3KWFA 4MWGA 5FLYA 1GILA 1EVKA 1V11B 2YX1A 3CHYA 2EOAA 4QJIA 3W6NA 2G0TA 2H1OA 1E0AA 1S1CA 1TLLA 2G63A 2GFHA 2ODQA 3Q0TA 2HDNB 3ZIDA 1YC2A 4XM0A 1VLQA 1X6VA 2GS9A 2JGNA 2JGDB 5F7ZA 2V65A 3USES 1WP9A 2C99A 3FWKA 1F06A 2JGFA 4L9AA 2OOSA 4FNAA 3PUKA 4DRXA 4HWOA 3ANNA 1F8UA 4M1WA 1JQKA 2NUAB 4CRWB 2ZBVA 5KDDA 1NV8A 1LW6E 3GLGE 5CB4B 1XJWA 1B0PA 3ROPA 1Z07A 1SKBA 3F4KA 2AEFA 5BMVB 3D6FA 1E4EB 3HYTA 1R00A 4RZIA 3H9JA 1KH3A 4HQOA 3H7IA 1ZNXA 1ND5A 1RYZA 4QOGA 3VYSB 4RJLA 3E9ZA 1OXBB 1Q0ZA 5EIBD 4KHPB 3NHFA 3T7AA 1G5FA 4CIYA 2PSJA 2VF8A 5CHEA 2A78A 2VDPB 2VEOA 1V8BA 2A1UB 3A4TA 3BIXA 2ERCA 1INLA 3ZXSA 3BWBA 4AO7A 3KTAA 4YT8A 1IXSB 5CG2A 3EIHA 1XZIA 5JT1A 1OYOA 1MJ5A 5EZYB 1VA5A 2P6OA 4NV1A 4HSEA 4UFOA 2FH5B 4HYYA 3H2KA 3GNLA 4PX2A 2AUTA 1TEVA 3VGJA 3AO0B 5BPHA 2YXLA 3AW8A 3JALA 1AHNA 2B69A 3G5LA 4Z1OA 1XTZA 1UR5A 2QOEA 5KOIA 1ULAA 3WMXA 2FZKA 4ILEA 3U44B 1D2AA 3BRQA 3HWX1 3QXHA 1E9VA 1BHJA 1TQ4A 2CB0A 3NG1A 4RDXA 1E64A 2AD5A 2EYUA 4QJ5A 3SQOA 2FSVC 1O57A 1YB5A 2I71A 5ULLA 3CUKA 3AR6A 4BFLA 1T8RA 1U3FA 2ZWIA 3AYXB 3NYIA 1VJCA 4RK6A 3V1NA 1EFAA 1HDEA 1O3YA 4JCCA 4CCYB 2FU5C 2MWMA 3EF1A 3TG2A 3LZ6A 5F7XA 4G86A 2EDAA 3DZIA 4MKRA 5AOAA 2J0VA 1LW7A 1FF9A 4O2LA 5EJ9A 1YZGA 4DIFA 5DNCA 4HV4A 3O4RA 2I4OA 1U7XA 3H9CA 3M6UA 1RWQA 1XQYA 1BVHA 1NWHA 1UP6A 2YXPX 1Z08A 2A14A 1FMLA 4PICA 3N05A 3OECA 4NOJA 4COKA 3I58A 5JCXA 2J6HA 1XZGA 5B57C 1NNLA 3EQ9A 5MGNA 1MRNA 3OETA 1JLLB 1QVAA 1ZGCA 2GHRA 3ME5A 4XFJA 3RRYA 1XPJA 2XLBA 3B2EA 3FA2A 3FNRA 2P4QA 5JNTA 1ZU5A 5CNIA 1EMDA 3D8UA 4UHDA 1FIUA 4IIYA 5ALUA 1SCIA 3VSBA 5CIQA 3K09A 5T7BA 5KMGA 3H5TA 1E77A 1J39A 1DGQA 3ZD9A 4HDMB 1YBAA 5FBWB 4EB0A 4YMHA 1XRMA 4D9FA 2PPVA 3EBLA 1DQRA 1LTHR 3M4JA 3QNWA 4PLPA 1E9RA 3KSUA 3KQVA 4LMBA 2Y1DA 2NP7A 1Y4ZA 4GXNA 4GX1A 3VR6D 2I7CA 4HX5A 2OHIA 2FF7A 5KQGA 3DM9B 2RHMA 1C29B 1HFWA 4IO1A 1HPLA 3A1EA 2GJ9A 3VYWA 5JQWA 3MILA 1KQGA 4ZHQB 2PUCA 1I33A 4P7GA 2OO7A 3L84A 4Z3DA 4EI2A 1ABFA 4X7RA 3PUZA 3VAAA 1N5JA 1Z5WA 4MHOA 3AEQA 3F5MA 1CUIA 5AHRA 3LVFO 2R2AA 3RROA 1VJTA 3DTNA 5H3CA 4ZEXA 3L0DA 2F8SA 4EQ6A 2DKFA 3HDHA 4JASB 1N8KA 4MQ4A 1N2BA 1AUPA 1TPYA 4OAOA 1PT9A 3OOWA 3ZCUA 4EO4A 1A96A 4DZZA 3V4SA 4F92B 4D6XA 1O97D 4C43A 2FEMA 3OTGA 2D4AA 2CLLB 2H18A 2IYSA 3GJSA 1SD5A 1D8TA 1OYWA 1K5PA 4DV6B 1T6NA 2FOXA 3I9V6 2ZIWB 1EXDA 3NZEA 1A9YA 2H7XA 1I0IA 1TJNA 2L2QA 2Q8PA 3O94A 3VR0A 1ODKA 4FNGA 1LLQA 1LTKA 4BKQA 2YNMC 2F3UA 2BISA 1IEVA 2P5UA 2W6ID 3O8QB 4QULA 5GV7A 4D97A 3ABSB 4Q3OA 1XLUA 1Z5ZA 2CYBA 1WLSA 4OIFA 3IIIA 3WK8A 4AN4A 1JRLA 2EX4A 4JNCA 3HYNA 2GJKA 1GDDA 2BLLA 1XQVA 2CC2A 2BZSA 3FMIA 4RVCA 4X1YA 3HNOA 4BJHB 2MYUA 1RC0A 3VR2A 2A5DA 3GNQA 4W9NA 3ZOZA 3P20A 1NJGA 1D6JA 3B6EA 5E6SA 2PSFA 5A0FA 3GLTA 5EOVA 1R88A 2XMRA 2YYZA 5AHXA 1V8FA 2QGZA 3OM9A 2VT6A 3OPVA 3WNVA 3ANSA 1Z0AA 3LRPA 4WNIA 3N2YA 4B34A 4RZSA 1WP4A 4P3KA 1R0WA 2R1UA 1W4BA 4FFPA 1FU7A 2ZBQA 3RJTA 2BBSA 1KRXA 3W9SA 3ZWCA 4G0ZA 4LDAA 4LDPA 3OCYA 4R1SA 1SC6A 4JOBA 1OASA 4DMHA 2A9PA 4BO9A 2ZXUA 5B55A 1UDRA 2ZUVA 5FWDA 4C4TA 5F35A 3RSHA 4XQ9A 5ICSA 3F6RA 2H07A 4XTCS 4RAOA 2REQA 2ANCA 4P4TA 2QTGA 4Y6SA 1M1XB 1M67A 2Y1LA 2Y3IA 4NK5A 2XQFA 4QPNA 5CIYA 2P5SA 1G9XA 1KI9A 4HJRA 5CH3A 1TVKB 1V8ZA 3SN6A 4KV9A 4OPMA 1BS1A 1T2VA 4KO3S 4KPUB 1HT1E 3NDRA 1YRBA 3MVEA 3O2SB 4JX9A 4Y1RA 5AT1A 1SVOA 5FB3A 3WLNA 1X87A 2HRRA 4XIIA 2OE2A 2EIHA 4ENSA 3RARA 1TTQB 3L6RA 2W2KB 2XX3A 1M9NA 3DF7A 4CLXA 4ED9A 3COJA 5U1PA 4L0MA 2E82A 1LSJA 5CB6A 1KPGA 5LQCA 3DUFB 2YVAA 2PO7A 3ENZA 2ECFA 4NFYA 4NU0A 4G5OA 3KSRA 3UOGA 3HDTA 1AKYA 2AHRA 2HXSA 3AUJB 2OV2A 1KERA 1BDHA 1PG2A 4HL6A 4K9SA 2C29D 3BILA 2I4MA 3G82C 4ZK6A 3BTOA 2GWHA 1VL2A 1FLVA 1VECA 3CG4A 3MMSA 3NAGA 2GJSA 4HCJA 5JS1A 4MWDA 2DR2A 2B94A 2X2PA 4LC0A 4M9UA 4WXMA 2FZLA 4HY3A 5GONB 2EAUA 2H4HA 3WK4A 5KSOA 3H75A 4XFKA 4O4HB 3RKRA 5EJAA 1JEYB 1TRKA 4AP5A 3GEBA 1GAEO 1DTWA 1DIAA 1X7XA 4Z9AA 1IL0A 3KZMA 1FS4A 2XTJA 2JFUA 3L46A 1YS7A 2ZKLA 2FVXA 1PWEA 4MR7A 4AROA 2E3JA 1YACA 3ANMA 3WBJA 3U3DA 3OU7A 5KVCA 2FK8A 3NASA 4F4HA 1NAIA 1O0CA 2CLMB 2X1HA 4Q47A 5A6SA 2VSXA 1PJ2A 3MBIA 3GHYA 3JD0A 1FTWA 3Q9UA 4Q0MA 2FEOA 1SC3A 5JCJD 4IMPA 3B48A 4RMHA 2I9PA 2CLCX 1O58A 2P9BA 1PGNA 4Q66C 5F21A 2WIAA 1O9BA 2EATA 3HMKA 5FI1B 4BUZA 3ESRA 3WNBA 1MD9A 2QRPA 2JBAA 3BHMA 4IQ8A 5ENVA 1SBQA 4AN0A 1CZKA 2RGBA 1BFKA 4MWTA 1U2DA 4QWWA 2D7DA 4KIWA 2J0SA 1GUFA 4RDIA 5JIBA 5ALJA 3NOOA 2O8EB 4RJJA 1NE7A 3N1UA 4KLNA 1D1QA 1F2TB 2ORWA 1SCAA 1ZOLA 2P5YA 3DAFA 1E89A 1DRWA 5AOVA 2Y4OA 3CR7A 3DXYA 1FNMA 3RHZA 4CMBA 4UREA 1FUKA 2APJA 2JBAB 1XZHA 4I5IA 2P2NA 2C4TA 2YWDA 3C85A 4HSGA 4P31A 1V4VA 4A2PA 3B20A 1V5EA 4QYIB 1Y8RA 2ZVDA 1XVAA 1JXOA 4R1TA 5F77A 3FNHA 2MYNA 2C00A 2H8GA 4GXRA 4IHAA 1HE1C 5CLFA 5KNCH 4HDNB 3E2MA 1YS6A 4MR8A 1F5SA 2P7HA 3W9YA 4W5TA 4DA9A 1DFGA 3UB3A 2PRJA 4Q4DA 1T8YA 3V8VA 3ZHUA 1N3LA 2BFEB 4KYUA 2BM0A 1E96A 1IY1A 1NVMB 2JAUA 3ANTA 3HFRA 3PFCA 4IQ0A 5EJGA 4AG3A 1BQ4A 1YB6A 2DUWA 2JGEA 4GNKA 1IRXA 4KNWA 2WTEA 2WB2A 3IUYA 4EUEA 2JASA 3B78A 3W78A 4HUQB 5GINE 3D3WA 4MDYA 1N1GA 3RJ9A 1RYNA 1H2YA 3WFJA 2PLAA 1Y5IA 3HU5A 3MRSA 2FFRA 2I4RA 4AUEA 1Z6AA 2Z2XA 1IK4A 3PFFA 1U3GA 4HUTA 5HPYB 1FSZA 1NXSA 1HEUA 1D8AA 1PR4A 3I6IA 3K15A 4U2GA 3I9V1 5FLKA 4XWKA 5THXA 2DY1A 1M6YA 1RXUA 2I91A 1T8PA 1XZDA 2GBLA 4E4YA 3AHJA 4P2GA 4EHKA 1YAHA 2ZANA 4JQOA 2OAEA 1NM5A 5IHPA 1N0VC 3K32A 3NM5A 2E7ZA 3G2IA 3UMSA 4BTEA 4C30A 2GHTA 2G9NA 2BMEA 1WU7A 3JVIA 4IUCS 4O4JA 1E6KA 2IL1A 3AF3A 2ZUTA 4PV7A 1KY2A 5HGJA 3V8RA 3ND6A 1KK1A 2DM6A 4OQNA 5BQ5A 1MB4A 4CI9A 3CA8A 2V7VA 3DR3A 3EB9A 3I72A 2ZAIA 2WJZB 5FPPA 3FZEA 3UFBA 4Z6KA 3FHTA 1UXHA 4URXR 3Q8XB 1UT5A 4KREA 3IT0A 4DF3A 2CV0A 2G9UA 2Z4SA 3CWCA 3IJ5A 4ZQHA 1TCCA 1RZUA 3VXKA 5JI3E 3UZUA 3PCXA 4C9BA 2VWQA 2XUPA 2C03A 1UAYA 4LOHA 5C8DA 5HM8A 3WIOA 4Z3OA 5E0KB 1C9KA 4QYMA 3ZLTA 4XPIA 3KQNA 3B5EA 3IDFA 1ZP6A 3GZNB 2V55B 3CNEA 3GLKA 3KVNA 4HB0A 5AUNB 2WA1A 4CKEA 2GRJA 4I9FA 3U7EB 3ZQ6A 1LPAB 3O9MA 3OZXA 4NYIR 5ALHA 3IP9A 2DKOA 4UHCA 2FWPA 2QSZA 1VJ0A 4XXHA 4W5QA 4EGAA 2CK3D 1IUOA 2NYVA 2ZRHA 1DAGA 1WE2A 4UVGA 5CT9A 3WTBA 3IKVA 1DOAA 3MK31 4NJMB 1T3LA 1U02A 3SYMA 4HH4A 1SURA 3B70A 3BXGA 4UPDA 2PFGA 3RE1A 4ZXFA 1RLOA 3TLAA 1DBPA 1OFIA 3R75A 1FUIA 1UF9A 4ER3A 5KWIA 1XZEA 2QYTA 3GEGA 3ZEAA 2YY6A 3A4IA 4U5QA 2YQZA 2B9VA 3HL0A 4KDRA 5LDGA 3TL2A 5IJ0A 3OUZA 3WGHA 1UC4B 2PMKA 4HXEB 2WWFA 1NYRA 5JAMA 1ZJYA 3WB9A 1GPAA 3KJZA 2RK3A 1P0IA 5IZCC 1Z63A 3U7HB 3H05A 4EHLA 5BSFA 5ICGA 1HE8B 2ADOA 3FYSA 3WQSB 4LF7B 3PYXA 1UK6A 4JJGA 3RHFA 3DFKA 5DT2A 3B1VA 5LSAA 2BFCA 3O73A 1UKAA 4N0DA 2ZYAA 3D43A 1O9GA 2X4IA 3PNKA 1D6NA 3GH3A 1D04A 4HC4A 5LLSA 1OSNA 3D31A 3I1JA 1VZ2A 3UV3A 2O19A 3IMGA 1VIYA 4MKHA 4ZGGA 1E6WA 3EVNA 1PK9A 3CGWA 4P3YA 4J16A 3NR2A 4J43A 4OEHA 2Q3HA 1CEYA 1W75A 3OAAD 1SRQA 4JLJA 1VLMA 1JHMA 4J3FA 3FTPA 3WL8A 2Z08A 4CU2A 4CMAA 3I28A 2J07A 1PJSA 2FWBA 3CYFA 2BLNA 3K96A 4TRJA 3FPKA 4YS6A 2IYPA 5FL3A 5REQB 3VO2A 4E03A 4CKWA 5DK4A 3UJ8A 1GOTA 2IE0A 3TWOA 2BJWA 3BDIA 3A6EA 3C3WA 4Y2GA 3WGNA 1S7CA 4A6XA 1CJBA 2YASA 3EY4A 4ZZ2A 1BRMA 3FMVA 4FP9A 1E8NA 1RIFA 1Y3DE 4TMFA 2PKEA 5EUBA 1OLSB 1LNQA 2EQ5A 4IIHA 2AMVA 3WBBA 5REQA 3Q2KA 3VDQA 4BO5A 4BMZA 1B0ZA 2Q99A 1Y33E 4YRCA 4NESA 1Z2OX 3BRWD 1ZC4A 4IDEA 4MICA 1L4UA 2V4ZA 1EFVB 3ANXA 2O0LA 2VNJA 4RJTA 4PIVA 1IAVA 2G82A 3V46A 3C4JA 3OE7D 4LF9B 2GZ3A 4OI2A 1NBMD 4BNHA 3SQMA 2WAMA 2NGRA 3EDYA 3KYIB 2O07A 4TT8A 1Z35A 4L4RA 2WPDA 1O6BA 3IA2A 1N1EA 4R2WA 1L5SA 3AVQA 4WKGA 2IT1A 5E8RA 1BD3A 3BDVA 5J2TB 3QY9A 1VJRA 2NW6A 4B7XA 4D57A 3K6SB 1TD1A 3B5JA 2IHJA 4DY6A 2CV1A 3OUTA 1GGMA 1H22A 3F46A 4JUAA 3VSEA 2QRNA 4L76A 4EEZA 4HWPA 2QPLA 3PKIA 4G89A 1B6RA 4EFDA 1EHYA 4RV9A 2F8TA 4KMOA 4IFIA 1P0PA 2WNHA 1T26A 1GTRA 1LC3A 1F6DA 1ZFNA 4K28A 4RZ3A 4RTSA 3GLHB 2X13A 4RPCA 2VP6A 2EERA 1M10A 4D0NA 3FYDA 2QYHA 1HETA 2WC1A 5KYTA 3QHPA 4J76A 1UEJA 3MZ0A 5BOSB 2ZIXB 2AFIE 3PGLA 5K3DA 1NSFA 2G5GX 4O08A 3IVRA 1YXMA 2ODAA 5BNFA 3RRJA 1ORIA 5B58T 8ABPA 5EWLA 4M0LA 4JI5B 3BEDA 4A23A 2FQWA 4CG2A 3LECA 4F9TA 3N6XA 4JI7B 5A3SA 1JU4A 3LL4A 3ABQB 3O2NA 3B9PA 4DLNA 1L5ZA 2JHFA 2QU7A 4RHFA 3DAGA 4HDSA 5B5SA 3KCNA 5AKIA 5CUQA 3CIFA 4C5AA 2JAHA 4FSDA 4BGEA 5KYXB 3KQUA 4M86A 1ZINA 4YALA 3MGCA 4DMCA 4YNBA 2OBBA 1PEDA 1M7HA 5FWNA 1E4VA 3G68A 1RZRD 3MB8A 3DLHA 2HO4A 3A10A 2ATCA 3K9WA 3T9FA 3F8TA 2I0FA 3U1VA 4C03A 2C2KA 1P80A 4N6GA 4S1PA 3A8TA 2IC5A 2OP0A 1B42A 2WJHA 5JSUA 4ZPJA 2A9JA 3D8BA 4DMGA 2KQUA 4KXMA 3R7DA 3CLKA 4BFZA 5CB4F 1J09A 5K6RA 3GFFA 2IIBA 1J2JA 1GNVA 2QU8A 4XJSA 3WWPA 2Q1YA 4Q7KA 1FUYB 1FEZA 2IYYA 2LV8A 4Y9DA 2KMLA 4ZQEA 1PFVA 5KINB 4AJ2A 2OCLA 4YMTA 1RVV1 5IAOA 1DBVO 4PM4A 5J4VA 1A4RA 2CL0X 2OENG 1UODA 3B53X 1B2RA 4MJLA 2D8AA 3B1FA 4G1FA 3WGIA 1GN9A 3SEQA 3OCWA 1EBFA 3ABRB 2OB1A 3MAGA 1TMGE 3NBFA 3SJBA 3M1IA 3N0XA 3UKDA 1JSZA 1ZVKA 5HFNA 3VR5H 4BJ6A 1ZZEA 3X43A 3IV9A 4DC9A 1IHPA 3H65A 3Q40A 4KIJA 4Q9JA 1Q50A 2D7JA 3HKDB 4LRWA 5E1OA 2G80A 2VDQB 4V2IA 3AJ8A 1XMSA 3ETGA 1DJQA 2GNOA 3SDZA 3I4FA 2PK3A 4I1UA 4I1YA 1WUIS 3PF8A 4TQ9A 2XGSA 3SWWA 4N8EA 3A3YA 2JIZA 3NONA 3QVWA 2V3CC 1YS4A 3ZHSA 1W76A 2IJGX 2TYSB 3QPAA 1GXSA 3GNTA 5ALRA 1UKVY 4IV0A 3A6ZA 3JS5A 1HT2E 3QXXA 4MSUA 4HWGA 1ULZA 3O4GA 3Q41A 4FOOA 4C21A 1AGYA 4WPGA 3QBDA 1O7JA 1OT3A 4ZKDA 1ZD4A 2IVFA 4OQLA 1WA5A 2GAOA 4D43A 5KKNB 3QUTA 4KO8A 4LVNA 4HX9A 5JAQA 1JNXX 3DW3X 3GEIA 4DSUA 1YDMA 3AM5A 2QD2A 1LX6A 1EFRA 3U3KA 2X2FA 2Z1MA 3BXEA 3P2MA 4FC7A 1B26A 5KWVA 5DYWA 1UM9A 2QPOA 3STWA 1IZ7A 4A8HA 3EJ6A 2XOKA 2PBFA 5DU2A 4B17A 1EUZA 5JH7B 3DS8A 2QDKA 5LYYA 3ZU5A 2HN9A 4ZHSA 3DYBA 3ZVLA 5LKAA 4YCCA 3BFXA 5IFKA 1K4MA 3QEOA 4MQFB 3IR5A 1VLJA 3RSGA 4OV6B 3GBVA 1UJ6A 4AS1A 2GA9A 5BOSA 3K8QA 4GT1A 2J1LA 4OXYA 2ZAYA 5JBNA 1PT5A 4JQCA 3QVMA 4KRGA 2DSNA 2ODNA 1L5QA 2HMUA 1TB4A 2HSDA 3W8RA 3L4EA 1SVSA 3PD7A 4I8IA 3D81A 3SEFA 4I66A 3MIIA 3RTGA 2MSKA 9LDBA 2OV3A 3LQQA 1DUSA 5FKJA 4E08A 3H1TA 1I51A 3P9RA 4HDSB 4KUEA 2TMKA 2Z09A 1A9ZA 1Y6RA 2X77A 2EDCA 2Y0BA 3GJTA 4KQIA 1I4DD 5JZSA 3KEFA 4DMUB 3QSYA 1FDWA 4L4ZA 3PNBA 3MJDA 1CUVA 3Q8KA 3UV7A 2XD9A 5SYMA 3I92A 4OLBA 1Y8CA 4CQMA 2O2EA 3JYLA 4IZHA 1YHYA 3PQ3A 3Q5GA 1E0KA 5KNDH 3JYPA 3AB8A 1PDWA 1HTBA 1N5RA 1U8CB 2XVZA 2JAXA 4PGMA 2IYAA 3PXUA 2RAFA 1O96A 1ZH2A 2H3HA 1QHEA 1RJEA 1Q1QA 1B8NA 1SBCA 1T8TA 2TRSB 3GFBA 4I55B 4MGIR 4WN9A 3WO1A 2J08A 3GAAA 1JFLA 2EF1A 5LQNA 4N49A 3WMWA 3CMCO 1A8QA 1QHHA 1ZUWA 2V1XA 1XOIA 4JT8A 1T4DA 3CUVA 1A04A 1ORHA 2IYXA 5GONF 3B12A 3HZZA 1HUQA 1SC4A 1FP6A 3MGGA 1V1MA 1UBUS 3BF7A 5IYZB 5DX1A 4JJIA 3UAWA 2QXYA 2ABWA 3KPUA 4Y2TA 4BTLA 3B1KA 1ZCAA 4WECA 4R8KA 3BERA 5I7RA 5EIEA 2ZYHA 4AJKA 2Y0DA 3UBTA 2IE8A 3CKYA 1NLUA 1V9LA 5FA6A 3DOJA 5JY1A 1EQ2A 4U8GA 2G40A 4YCAA 2PL1A 5AUPB 1KEWA 3WADA 5I48A 3NHBA 1UK7A 1V4BA 2XWQA 1TGVA 3UN1A 2VBGA 3GUUA 4QNMA 4R0NA 1L7DA 1AGRA 3BQMB 3GPCA 4G1VA 1SBYA 3RWMB 4ASUA 5HS4A 1Z45A 3O03A 1XMJA 3H5LA 5BUCA 4OATA 4CKCB 2JFHA 4HQRA 4DMKA 1MGPA 4TZKA 1S2OA 2DPGA 3OJFA 1PL6A 1POXA 4MUBA 4ZCSA 5JEEA 1EG7A 2AJDA 2BFAA 4E22A 2CEKA 1QHFA 3Q9NA 3BAZA 4Q4AA 3RS0A 3T1NA 2OQRA 5AICA 2FF5A 2L18A 1JQLB 1VMAA 3O3OB 1BS2A 1RLMA 3EVEA 4X6LA 4FDLA 1JDJA 1SHLA 4X9XA 2X9GA 2ERYA 5GZ1A 4N76A 1KXJA 5K3CA 5M2QA 5HIJA 3ASYA 5A9RA 4CCSA 1II9A 1CS4C 1KO8A 5KOHA 3C3BA 4WXPA 3WGZA 3ZNNA 5BN3A 2NNLD 4FMCF 3T4EA 1IBCA 3FCEA 2J4DA 3I9JA 1E1CA 4NBNA 2FQQA 4OQYA 2P9CA 1VJGA 3AL3A 1QJ4A 3JCZA 2RH4A 3NETA 5T4BA 3UEOA 3WLPA 4ACBA 2BEJA 3ZHTA 3NTRA 3AIOA 3RT7A 4YMUA 4R7GA 1PQPA 2I1QA 3EVZA 3PWKA 2GCNA 4MQMA 3AR8A 2GA8A 1UPXA 4CYMA 2W9XA 3ZHZA 1YB7A 3LI2A 3BWCA 4NU5A 5LVAA 1NDUA 5CP8A 2NO1A 1T9AA 5IK2D 1M66A 3T5CA 1NUSA 3NIFB 4I46A 4MLCA 4DVGA 2F1OA 5JPCA 4I5FA 1GQFA 1G9TA 2RGNA 3DPIA 3IODA 2GM4A 5F1OA 3BZBA 2XNHA 3SHOA 5K0CA 1DJLA 4TWJA 1NI3A 3IUBA 3LBHA 3OURA 4J4BA 1KMIY 1XMVA 4FILA 4TYQA 1K63A 4LRYA 3DKRA 1EVYA 3ZHOA 4D92A 2VP5A 2ZJ8A 3N2ZB 1RRMA 3ZY2A 5ICCA 1CYEA 4Q18A 2ZRBA 3FPAA 4QARA 3EGDB 2QRUA 1TAGA 2HJSA 4FCWA 2NT4A 4LBVA 4M9SA 1FW6A 3D0OA 2PX0A 3TQHA 2Q2NA 3DT9A 4HR7A 4JKOA 1SO8A 1YT5A 2C1ZA 1Q2XA 4QDKA 1JFVA 4DPLA 5D3KA 2Q7XA 2JF0A 5HRCA 4YPFA 2GD6A 2B5WA 4FR5A 3NIWA 1Z18A 3IHTA 3PC7A 2R97A 4DWOA 2P3LA 3G79A 1OE0A 4MX8A 4NXNB 4J0KA 2O4UX 5H82A 3PDIA 1XWWA 2X3UA 3FOBA 1CVLA 1ZR4A 4EB3A 3B5IA 3PK0A 4YEDA 3ZD6A 1CBUA 2ZWVA 3U4HA 4P83A 5LUAA 2CN1A 4TX1A 2GN2A 3ZHBA 3GWGA 3I8SA 5KNCA 3CX7A 3CFYA 4Y7DA 3GJ4A 1DZIA 3MTEA 3RVJA 3GT4A 1C30A 2OORC 3DV0B 3EEQA 3LT2A 2Z83A 3HJCA 1YB2A 3L02A 3HBLA 4BNZA 4B3GA 3TIGA 3KKKA 4QODA 3A70A 4XCVA 1O0SA 4WNAB 1Y8ZA 5HRAA 4E30A 5EUQB 5GWXA 1SBTA 1T0JB 1U98A 2J9RA 4L6CA 5AVJA 2KJQA 3HN2A 3EEOA 1MW8X 1NU6A 3ZBQA 1PFQA 3NV7A 1HORA 4HUQA 4O5OA 5DLPA 3B51X 5FRDA 1QRTA 1G41A 3ZCPA 2VFAA 4LSWA 3WP1B 1UQRA 4C88A 2WY2D 3KXDA 2H4FA 3N76A 3NAQA 1TC2A 5AJVB 1KFJB 2YMPA 2CXOA 1BJKA 3ZE2B 4ZCMA 1UCFA 4QD3A 3DMHA 4KB5A 1DMSA 3UUGA 5BV8A 4N0QA 2VNIA 4WLOA 3QI2A 1DCTA 5AW3A 1QVWA 2XIJA 5J23A 4L4YA 3K31A 1R8YA 1GJRA 1ZA1A 1WLYA 1YA4A 1GGHA 5LA6A 2Q7OE 5BVHA 2IEAA 2ZTVA 5K8LA 1TD9A 3R0IA 1XZAA 1H85A 1XZMA 4Q9KA 1VBKA 3MTGA 4YRMA 4I4LA 2F64A 2F2TA 2IHVA 3LC7O 4PAQA 3E61A 3KYCB 4WLEA 1JIKA 1VA4A 3BIWA 4Y1GA 4LE2A 4ZVKA 4W5WA 4ZDWA 2BTQA 4OGGA 1UBSB 4C4RA 5J4KA 3IKTA 4KR6A 4OVKA 4P34A 4C87A 2YVUA 5TGDA 1CF4A 5AW7A 2R00C 1Z0DA 3PUXA 2GK4A 4DXHA 1HY3A 4RA9B 4PFQA 2UUPA 2WYWA 4WZAA 3AUXA 2HTFA 4DNQA 5DASA 3VR4A 5ECDA 1ES9A 5B1IA 5GVSA 1UBOS 5EP4A 1C41A 1UJ2A 4BYMA 2FFHA 2W4MA 1SUEA 4ZPXA 1H6AA 2GN9A 5CDUA 4A7PA 2NQTA 5ESRA 4LSZA 1LUAA 5IBRA 4EAQA 3GRUA 1IXKA 2ZUFA 4CN8A 4DV4B 4P82A 3WSWA 4RYLA 4B8WA 4HNHA 3IMFA 1ZDMA 4IEIA 5TPZD 4D0SA 4M1QA 1UKZA 3K7EA 1L8XA 1R0XA 3KLMX 4J0DA 3CCFA 1IMJA 1J6UA 1GPDG 2BGLA 2FTKE 4MR7B 1V8DA 3KKEA 1NXOA 1J1IA 4UCQA 2OQIA 3U3XA 3WGKA 2GCIA 2R85A 5FQNA 3LFHA 3NJ8A 3J81k 4XKJA 5CDYA 3CURA 4UBIA 4MK4A 3T7KA 5ESWA 5K3FB 2FSHA 4XDZA 4EHIA 3JR7A 1KFKB 4KHZA 4TOIA 5DX0A 1LJ8A 3HJBA 4MGHA 1Z8HA 3FHJA 1NF8A 4KQ6A 3UAXA 1SOVA 2B35A 4F5DA 3KZCA 4MCIA 4G3XA 2BDUA 1L4HA 1NMQA 5GOZA 2VN8A 3OCCA 3KOYA 4WWHA 4AJIA 1N6KA 3KKMA 1QLWA 2O2JA 1FE8A 2PPLA 5TMDA 1NKSA 3RAEC 1FRVA 1N5LA 3HDVA 3OP4A 1SNYA 4BX8A 4DMRA 4K05A 2PUWA 3TE6A 5DM60 2B3TA 1KP9A 2HL6A 3BULA 4MGKR 5HA5A 5MN6A 2DLNA 3SIWA 4B09A 3FG9A 2FP4B 1ZIPA 4J0JA 3TQTA 1B6GA 4PG8A 1E61A 3IBYA 2PRYA 5T41A 4PNEA 1Z5VA 2EFHB 4JJFA 2O2SA 5DWVA 1CIJA 2AD1A 4G4GA 5B53A 2A5GA 2YHUA 3FIJA 4O4JF 4UW9A 3TGWA 2QSUA 3UXHA 4BX3A 2BYTA 2CXNA 2YFQA 5AKEA 3SQDA 4M1SA 3TKLA 2VTEA 1FNSA 4NJEA 4YUVA 1YA6A 1VYVA 1B6TA 3AF5A 1NW5A 5ABPA 3G9TA 4WESB 5JAIA 1JAZA 1W4AA 2PZKA 4AUNA 5ELXA 1VBNA 1YBMA 1PLJA 3AHEA 1OX4B 2XITA 2G9ZA 4OK6A 1G2PA 3FLEA 3PPXA 3W7AA 4P7JA 1FQOA 2VDJA 3M9XA 1TA9A 1WX1A 3T3GA 4HFNA 1U7DA 3MAJA 2B2CA 3PBKA 4JR0A 1PO7A 4KZPA 5CBPB 2C97A 3EX7C 1Q1NA 2E4UA 1XROA 2UV8A 5HSGA 4GI2A 4LPKA 1FYDA 5C1DA 2Z43A 2NZWA 1UP4A 1ZMXA 4A0FA 2J6BA 1E99A 1KA9H 3KFXA 4DWJA 4ZDIA 3ID6C 1ZIXA 2WLSA 5DW3A 4W8GA 3UGQA 4MQ6A 4KC0A 1NSTA 4RXTA 2B8NA 2HNBA 3LUCA 4FTWA 1ZGGA 2VP3A 1L7RA 3DEZA 3HFSA 1Z0JA 3QA3E 2LIPA 4NSNA 4OXNA 3THXA 2FCAA 3P2KA 4EWLA 2PLRA 3UICA 1I0ZA 4L07A 5CLIA 3U80A 3O95A 3TLKA 5G53C 3F6BX 1IUNA 1E8DA 1KI7A 3OF5A 3WGTA 3ZWKA 2HEGA 4FZRA 1ZW1A 2JRLA 3MNFA 5HXAA 1J8VA 3D1JA 5B6JA 5JW6A 4WRRA 3NHUA 3JVVA 1P8AA 3WYEA 4EQZA 4NOLA 4BLUA 4BLOA 4XGIA 3HI6A 3HP7A 3UNXA 2ZROA 1NNEA 3UK1A 2CD7A 2VJBA 1EVQA 3AERB 5HF9A 3V8MA 3OQNA 3M3PA 4RQTA 2WU8A 3RC3A 4W6ZA 1MVNA 4G56A 1ISIA 2ZRKA 1G291 3RVMA 4FZ5A 4NFLA 5AQ1A 1DG1G 2FRXA 3AF2A 2PGIA 4LK3A 5E6RB 2ID4A 5TDHA 4X1OA 2NU6A 1OFTA 2I3AA 3E3AA 2C5EA 1JIXA 3OBBA 5DZSA 1H1LA 2SKEA 4KXQA 2FE4A 4DSOA 2V5UA 4L5YA 4BB6A 1GZSA 4K88A 2QUJA 4Y3UA 4E32A 3O26A 2AA3A 4D9CA 3FGZA 4YAIA 1NMSA 3HYSA 1M5TA 2OV8A 1MG5A 2P9JA 2YZ7A 3MEQA 1U5BA 2X4GA 3Q9LA 4H08A 1MGOA 4ZT6A 5CBKA 1XQXA 1Z6XA 4F9FA 5K5EA 4M53A 5CEFA 2PUTA 1C7IA 3ITNA 4B6OA 4AY5A 1G3RA 3IPRA 2WWWA 3DVAB 4ZU1X 5EIWA 1CB7A 4D9KA 1G3MA 1DRUA 2OM2A 4H4EA 4Q93A 2Z8XA 4N3GA 3OD5A 3B1YA 3PE6A 4JUCA 3FWZA 1XNGA 2BEWB 2QAGA 4D2IA 3HXMA 3L79A 1PR9A 1DL5A 1DKQA 2WJAA 1LF0A 2XB9A 3FUVA 4LEIA 4D74A 1KTIA 1E2KA 3LT5A 4WBSA 3HCEA 1Y1SA 1CY4A 4XYEA 2VNKA 1JFSA 4YMSA 3L5OA 4FFVA 3FF4A 1PLLA 3AI3A 4KNVA 3ZDYB 2KX7A 1GXSB 1N5KA 2OXRA 4RCZA 3VC1A 4BQIA 2W2XA 3R6TA 1IBKB 4OCZA 4TRRA 3NVDA 5BW4A 4LY6A 2RAUA 1CSEE 1K7EB 1M2VB 4Q1DA 2JLBA 1ZRSA 1N36B 1UIRA 1T5HX 3D7LA 3AP2A 1LDGA 2DPXA 1OVGA 1H5UA 4Q3AA 3U3ZA 4G5HA 4B9AA 4EYSA 1ID1A 3JQPA 1JEQB 3GMSA 3COSA 1REQB 5IASA 1L7MA 2X0JA 3IUSA 3QIAA 2CUNA 3PT5A 3O74A 4C7VA 3KXKA 3L0YA