4AJLA

Rat ldha in complex with 3-(ethylcarbamoylamino)-n-(2-methyl-1,3- benzothiazol-6-yl)propanamide
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
330
structure length
328
Chain Sequence
ALKDQLIVNLLKQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
total genus 119
structure length 328
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajlA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajlA02
1HL3A 1JN0A 4RVSA 3WLEA 1UP7A 3P19A 2YFQA 4OM8A 3Q1LA 3ZH2A 4AJHA 2EKPA 1UUFA 3C24A 2ZYDA 1U4SA 5JMPA 3WXBA 1IULA 2O7QA 1B3BA 4C4OA 4DYVA 5T6BA 2YHIB 2ZYAA 3GG9A 4BGIA 4ALJA 4OL9A 4E4YA 1LU9A 4WK6A 3NGLA 3KBOA 4RPHA 3KM0A 5U4QA 4IIUA 1C0KA 1I36A 1YOVB 4KDFA 2Q99A 4E2ZA 1NPDA 2P9EA 2PKRA 1MUUA 3PYXA 1HDXA 4DC1A 1CQIA 1LX6A 3OA0A 4JBIA 3CIFA 5DCYA 2HRBA 5L7WA 1GYPA 1XDWA 1DC3A 4BO7A 4CR6A 1HYEA 4H15A 4Y6SA 5KCZA 3AUAA 3ZWOA 1DBVO 5DDIP 3WSWA 4CUKA 4YR9A 1DRUA 5TT0A 2WTBA 4E30A 3FNFA 4R1UA 3NT2A 4U7WA 4MVJH 1OFGA 2B37A 4O1MA 5DBIA 3B1FA 3UVEA 1G0OA 3DBLA 4Q3NA 2ZTVA 4HWKA 5CPBA 1O95A 4JP3A 5JPIA 4NR0A 3SC4A 3F46A 3VAZA 1O5IA 2O3SA 5IDQA 2PV7A 3FCOA 2RH8A 4FGSA 3COSA 1E3LA 2BFOA 2FY8A 1EEHA 1U8FO 1GCUA 2YDYA 2JCYA 4ALKA 4BMSA 4BQPA 1VL6A 3IUSA 1NHWA 2PD4A 3L6DA 2O3TA 4J9UE 5K6AC 4KUHA 3QWHA 2JAHA 3FN4A 3H9UA 3JYQA 4BKPA 3FI9A 1S6YA 4E31A 2VYVD 1N7GA 1WVGA 3EZYA 4XDZA 3UFXA 1F12A 4LVCA 5TLSA 4CLRB 4UAGA 1TT7A 1U3WA 4R1NA 2D5AA 2X0JA 3I9KA 1ULSA 2ZJ0A 4FD3A 3ZNPA 1E6UA 4RDIA 4TKMA 1BDBA 4IDGA 3OIFA 5HTOA 4CV0A 1J4AA 3PIDA 2C07A 3QVWA 1T4BA 5C5IA 3TOXA 4GI2A 4MVJM 1V0JA 4B79A 3AFNA 2EJVA 3WNQA 4E2XA 4AJ4A 3RD5A 1S7CA 3WYBA 1QG6A 4A26A 3JD0A 3LDHA 5F1OA 2EGHA 1R12A 1GZ3A 3GGOA 2POQX 4LN1A 1BVRA 1DIRA 3IP3A 2BFPA 1OI7A 4Z3KA 3EMKA 2FOIA 3ADPA 4AJEA 2CF5A 3O03A 4DVJA 3IKTA 1YJQA 3L4BC 2IXBA 1Q2XA 5HBRA 4BNXA 4IMRA 3BMCB 4MKRA 1O9BA 4QFDA 4AJIA 4BO0A 1JKJA 2XPCA 4IPTA 4ZQBA 5AXDA 1CWUA 3G49A 3JQAD 1E1KA 3RU9A 4EGFA 3JQ6A 2G17A 3RAJA 3DL2A 2Y1CA 4YVFA 3ZWYA 2QRJA 3HDQA 3GEGA 4TRJA 4ILKA 1YXMA 4QSMA 3QWBA 4YRDA 1GUZA 1QSGA 4ESOA 4CV1A 2B4QA 3PGXA 2R6JA 3A9WA 3UOGA 4CQMB 2PGJA 5L3ZA 3K6JA 3DMTC 3HWRA 4E5PA 2BI8A 2OZPA 2RHRA 3BMOB 4R01A 4IXWA 2QHXA 1GUFA 3WGQA 3BHMA 4XD2A 3QY9A 4XCVA 3IP1A 2GASA 4CLEA 2P9GA 3E9MA 2Y68A 2FZWA 4B4OA 2BGLA 5CDGA 3AM3A 2XAAA 1NFFA 3EAGA 2V6BA 4BNIA 3NDJA 3DAPA 4P4NA 2D1YA 3HJAA 5DNAA 4YAKA 2JD1A 3N74A 3S2GA 4YT5A 3MWDB 3PIIA 5IJZA 2I67A 5F5NA 4QO7A 1VJ1A 2VN8A 3WGZA 2QYTA 4IQ8A 4Q39A 3ZHZA 1T25A 4PCVA 4BKUA 3FTNA 3ORFA 5FEUA 3A28A 3OEWA 1D3AA 2HK9A 3T7CA 4GKBA 3C7DB 1KEWA 3OH8A 1V3UA 2VZ8A 2C59A 4QO8A 1MX3A 3PHHA 4UEOA 4BVAA 4ID9A 1E6EA 1U28A 3E1KA 3GVPA 1Q7GA 3MEQA 5TIIA 1ZEJA 1U7HA 3KHUA 4U0KA 4EITA 5JAQA 4GX2A 5HS4A 1WZEA 4U8GA 3LU1A 2TMDA 2Y1EA 3MJ4A 3CMMA 1NR7A 4RQUA 2LDBA 2NQ8A 1I3MA 1E5LA 3OQ1A 1ENZA 3VDRA 4GVLA 4R9RA 1LDNA 1DHTA 1UZNA 2CDAA 3P7MA 2AG5A 3JYNA 3QWFA 3IKVA 5DULA 1WDKA 4GL4A 4M89A 2DUUA 3DMTA 2YDXA 3V1UA 5I7EA 4CMGA 3OHSX 1ZMTA 4Z3DA 4DL9A 1EFLA 3JQCA 3S55A 3VH4A 3WMXA 4EBFA 3QLJA 4CM8B 4ND1A 3RFVA 4LSMA 4BNMA 1MLDA 3AOEA 1DFIA 4ZICA 1PGQA 1PWZA 1Y81A 1E7SA 1LTHR 4EI2A 5JO9A 1R0KA 4HADA 4CMCA 1E7QA 4CPDA 4L74A 5H81A 5IZCC 5IAAA 4I9NA 3PQEA 2WM3A 3GK3A 3HDYA 3PYMA 3RBZA 4PZEA 1RYDA 4OQYA 2Z1NA 4OGWA 3RUAA 1HZJA 1DSSG 3JD1A 2W2KB 3WFIA 3P5SA 1WXDA 1XIVA 2D4AA 2ZB3A 4OH1A 6LDHA 3HQ4O 5B12A 3JYOA 5C7IO 3GHYA 1PJSA 1P1HA 1X13A 3OECA 3E9QA 1IPFA 3NJ8A 4GPD1 4YRAA 3H5NA 1ONPA 1YO6A 1F8GA 3H7AA 4P8RA 1BVUA 4CR8A 1RYEA 3ETEA 2FP4A 4PLHA 3H8VA 3L6EA 3BMNB 1WW8A 3NYWA 4LW8A 5BNFA 2ZKLA 3NT5A 1B8VA 1I30A 3WBFA 4R4JA 4KQWA 1V9LA 4GGPA 4FJ1A 3WGGA 3K73O 4F46A 2C2YA 1KBZA 3PJGA 4UVIA 2Q45A 5L7TA 4LRTB 1ISFA 3VDQA 1GCOA 4CM4A 3SLKA 4R51A 4P38A 4A10A 3WGOA 4G5HA 2EGGA 1QLHA 4DQVA 1GV0A 4YQYA 3E82A 4I08A 4QFCA 2BLLA 4XQ9A 2AQIA 1DRWA 2PR2A 3QVTA 3MJTA 3T7EA 5CG2A 2GN9A 3LT2A 4YJFB 3PPIA 2ZCUA 2GN6A 4EUHA 3K2BA 3R0IA 2QW8A 1JVSA 3WYEA 4ZHSA 1UZMA 4FFMA 3FBGA 3MJCA 5TT1A 1DIBA 4BIIA 2D0IA 4IDDA 1M6WA 4M1QA 3OJLA 4MVJI 4UREA 1PJ3A 3G3EA 5IN4A 2Q1UA 3E03A 1BSVA 1ZXLA 4WNCA 4Z9XA 3HFSA 4Q3DA 1LRJA 1N7HA 1Z6ZA 3JQ9C 3HB5X 5TJHA 5TQVA 2QZ9A 3IQDB 2D3TA 5C37A 1H9AA 1HDZA 1NR1A 1YBAA 2XF8A 3TZKA 1PQWA 1HXHA 1PJ2A 2PWZA 4WOKA 5COAA 1C1DB 2IZ1A 3RU7A 4PLPA 4W99A 1A7KA 1JTVA 2EW8A 2OUIA 4BO3A 3C1TA 1V8BA 4E12A 5G0WA 2HMUA 3WICA 1X1EA 4TVBA 2CD9A 3H9QA 4CM3A 3R3JA 5JY1A 1NASA 4N5MA 3TZHA 4IMPA 2DBVO 4NPCA 1O0SA 1E6WA 5GZ1A 2E6UX 2NACA 1H9BA 1N9GB 1P1JA 1DAOA 2WYUA 1LRLA 4OMUA 3RUEA 1PL6A 2AA3A 3ZWBA 2EF1A 4N18A 3VPSA 4E6PA 4UVEA 3RUHA 4BO8A 1ZK0A 4KTVE 1XLTA 1XU7A 2EG9A 4FDAA 3I5MA 3QWIA 1VSUA 4P4LA 2BELA 1KERA 1Q1NA 2UDPA 4IXTA 1LRKA 3C85A 4KP7A 2VZ0A 1R37A 4CUJA 3TZCA 3EC7A 1CEQA 4NJMA 3N7UA 4MVJA 2DU8A 5IDYA 2GDZA 1DO8A 3ZW9A 1SEVA 3DEYX 1EK6A 3SLGA 4L4SA 1ENOA 2W98A 3KLPX 4B8ZA 1PX0A 1LSJA 1GZ4A 1K6XA 4NBVA 1NBOA 3KUXA 2ZIZA 3O8QB 5IXSA 2CMDA 2VWPA 4NFSA 1JA9A 3VC7A 2WE7A 1UP4A 1E7MA 3WS7A 3TDKA 4O6VA 5GY7A 4JLWA 4PLCA 4JGBA 3DZBA 1CERA 4HXYA 4NK5A 3TFQA 4DLBA 4D46A 4EJ0A 1NFQA 5AVOA 1CRWG 4A27A 1UXJA 4IJKA 4U5QA 4KTTE 5J23A 4O63O 4IBOA 1A5ZA 4IJVA 4IGFA 3RIHA 3WG9A 2CVOA 3DBRA 1T2CA 3TL3A 3GAFA 2VRCD 3ON5A 2HMTA 3Q2KA 3B1JA 4NH4A 2HAEA 3L4BA 5JAZA 4TZKA 4JX8A 1UAYA 3QWAA 2HUNA 4KUEA 2Y05A 1OAAA 1QLJA 1KC3A 5BSFA 5CEJA 1KVSA 3CZRA 5JMWA 2VOJA 1RM3A 1E1NA 1TT5B 3D0OA 4RO0A 3DAFA 4UUMA 1DHRA 5C7LO 1ONOA 1KY4A 4JXKA 3DBHB 1ZK4A 1ORRA 4QEDA 4M55A 3HZZA 2B4RO 1DIHA 2Y0CA 3QHAA 1R6DA 3ROQA 4OYRA 2FPPA 1F06A 3GDFA 4GGOA 5A04A 3SEFA 5TRTA 1A4UA 4W6ZA 1PJQA 2E82A 2F1KA 2F00A 3Q11A 5ADHA 2W2KA 2JKVA 1M66A 3I3OA 1HSZA 1NXQA 4QTZA 5I7FA 1VKNA 4NU6A 3WFJA 1J5PA 4N5NA 2JD2A 5AOVA 3GUYA 1A7AA 2C82A 4FOOA 1VM6A 2GD1O 1IY8A 2NUAA 3MJEA 1R66A 1RPNA 1NQAO 4RPGA 3EW7A 4FJ2A 1PZEA 3AU9A 5A3JA 3CTMA 1E0DA 3QRWA 1MA0A 4BNFA 5B4TA 3VPGA 4B3HA 3LLSA 3MOGA 4RORA 4WECA 1Y5MA 2VWQA 4J4BA 3ZWNA 3JQDA 2YQ5A 5IXYA 4R68A 4B7XA 5EQFA 1T4DA 4BOYA 5DZSA 5HWSA 1ID1A 4GX1A 3I9MA 4TWRA 8ADHA 3WIEA 5DCUA 3X2EA 2BFMA 3U49A 1HYGA 5JDCC 3WMWA 4PRKA 1VRWA 3O26A 1IZ9A 1Y8RA 1LDYA 1U3UA 3PRJA 3EHEA 2V6MA 4B8WA 4EUEA 1I8TA 4OKNA 4HFJA 4J2OA 1E7WA 1M6HA 1T2FA 3JQBA 5I8ZA 5A3VA 2D5CA 3UHAA 4CLDA 3UICA 5FYDA 1U2DA 4H7PA 2PH3A 4YRBA 2G0TA 2VNAA 4RPLA 2X0NA 3UUWA 4DPMA 1LQTA 2NTVA 3LLVA 2DPGA 3TZQA 5KKCA 4BS9A 5A9SB 1GY8A 1B7GO 4E0BA 1DLIA 1EZ4A 3PDUA 1GU7A 1IB6A 3HE3A 3LSYA 1D4FA 5HS6A 4CMAA 1O94A 1ZKMA 4GWKA 4MIOA 4I9HA 2ZQYA 1ZJYA 3AI2A 2OBYA 4GBJA 4E2WA 1F14A 1PGNA 4EYEA 3SJ7A 4YAGA 1E3EA 1B8UA 2Y93A 5K6AA 2GUGA 3AK4A 1LUAA 3FNEA 4XYLA 3W4JA 2OBNA 4CLOB 2IYOA 2RHCA 4XRRA 1H6CA 3H65A 3IIEA 4OSOA 4PVDA 1EQ2A 4ALLA 4UUPA 4BGEA 4BUCA 5BSEA 2FHSA 2O3RA 4PLZA 5G0TA 1HDCA 1UH5A 2DBRA 4R9SA 5FWNA 4LRSB 1FDTA 5H83A 1TLTA 3DZGA 2VZ9A 4DYDA 1FXSA 1ZW1A 2FR1A 3VKVA 1M67A 1NTOA 4WLUA 2YYYA 4YJHB 3LT1A 2NQTA 3HFGA 2PKQO 3PEFA 1PEDA 4WASA 3KYDB 3ROPA 4MVJF 4IDAA 4RL6A 1UDAA 3EGOA 2J3KA 4KWIA 2HDHA 1JLLA 2PY6A 4XZ3A 2IZZA 3IS3A 1T2EA 2O3QA 4Y6RA 1P1KA 5JCJD 2PD6A 3TZ6A 3KEOA 4IGEA 1R16A 4LGVA 1ZZEA 1ZH8A 4J4HA 3SX2A 4XQEA 3PDJA 2W90A 1TEHA 4BHTA 3CEAA 4E13A 1N5DA 4RLHA 2C2XA 1LBEA 1VSVA 1YWGO 2G76A 4AFNA 4JP2A 3RUFA 1G0NA 3FRJA 2Y0DA 3V2GA 1KVTA 4YAIA 5TSDA 1QRRA 5KOIA 3PWKA 2J6IA 1ISIA 5IDXA 4XYEA 2C5EA 3WWYA 4YQZA 1R4MA 3U5TA 3S8MA 3RFTA 3ONFA 2QRKA 2OHXA 4IM7A 2Y1GA 5ES3A 2D59A 2HO5A 3WQRA 3AUSA 2IEDA 1ZXBA 2IODA 4JBHA 7ADHA 4R5MA 4QQRA 3ZU2A 2JHGA 1BXGB 4FFPA 2HRZA 3RC2A 2HKIA 2C5AA 2EEZA 4BNNA 5JYEA 3E5MA 1YB1A 1GQQA 1HTBA 1EBUA 1N1EA 1I3KA 3JQ8B 4RPJA 4EUFA 3VTZA 4K9DA 3F3SA 2X9GA 2RAFA 3CINA 4XB2A 5DP2A 1AE1A 4DMLA 2YHIA 1AXEA 3A1NA 1CETA 3KTDA 3B1KA 2VTDA 3BXXA 4FR5A 1V35A 2AG8A 2NU8A 3MTJA 2Q4EA 2PLAA 2Y1FA 1C0LA 1QV6A 4OSPA 2UYYA 4AICA 4XKJA 2VHVA 4ZRMA 4CV2A 5ITVA 4IQGA 4TVOA 4NBRA 2R2GA 3I9LA 3GEDA 4CQLA 2J8ZA 1Z7EA 4E32A 3VH2A 5L4NA 4NJOA 1KOLA 3K8ZA 1I2BA 2NM0A 3NTQA 4CL8A 1PGJA 5AQ1A 1V6AA 3TN7A 3GH3A 4R1SA 2H1SA 4Q3AA 4XIJA 2BH9A 4BV9A 4CMJA 5IZ4A 4Q3EA 4A73A 2GLXA 5G0UA 4CMIA 4Y9DA 4XGKA 4J7CA 4I5GA 4F3YA 3E48A 5JAMA 3PJEA 1PJCA 3OEYA 2ZB7A 1NAIA 5KVQA 2A94A 4N5LA 4OIMA 3GR6A 1X7HA 4J2HA 4ZN6A 3D5QA 5DCWA 1P0CA 2E48A 3KZVA 4HNGA 3AI1A 1ZSNA 4BKQA 2QZZA 1MXHA 1U9JA 3M6IA 4Z0HO 2NU6A 4WOJA 4MP8A 1R4NA 2Q3EA 2C0CA 3U62A 3D7LA 4CL3A 4OXNA 5JC8A 4TRMA 4FW8A 3PHLA 5BT9A 4L75A 1EUCA 1U7TA 3VVCA 5JSFA 2ILTA 2NNLD 3UCXA 5CFZA 5JW6A 5FF9A 2ZTLA 4IINA 5A03A 1PL8A 2AHRA 3ASVA 3CE6A 5AXAA 1L7DA 3TJRA 2Q1WA 4F6CA 5THKA 1X15A 1YQXA 4ND3A 3FWNA 4OOEA 3OBBA 1MG5A 4TRNA 4WLOA 3G17A 4UUOA 1L7EA 4W7IA 2J3HA 3UW3A 3FPLA 3OJFA 3FF4A 4QXMA 1PR3A 4GX5A 4U6QA 4CMHA 1N2SA 3P2YA 2O4UX 4CLXA 3FPCA 4BL5A 5KTKA 1C14A 2B4TO 4FFNA 4J43A 3DR3A 3ETDA 3PI7A 4J49A 1FK8A 1YL6A 4TRRA 1PGOA 2X5OA 1ZK3A 1HE3A 1MGOA 1BG6A 2FMUA 4GMGA 3B20A 3AWDA 1SOVA 2EXXA 3JV7A 3EK2A 2XXBA 1K0UA 1XQ6A 2AXQA 2G1UA 1TB4A 4Q9NA 4AVYA 8LDHA 3IC5A 3BMCA 1D8AA 1R15A 2WSBA 3GAZA 3RI3A 3VH3A 1KEUA 4DQXA 4PN3A 3TFOA 1Z45A 4B3IA 1B14A 1U1IA 5EN4A 5JE8A 1T26A 4EW6A 2J5KA 2PZKA 2EP7A 4JCOA 1Q7CA 4B7UA 3QJ5A 1XU9A 3V8BA 1HDOA 4RGBA 1H6BA 4RVFA 5IG2A 4B4WA 3VHRA 5KNLA 1XQ1A 2VHZA 3TL2A 2EJWA 1ZBQA 1U5CA 1QYXA 2OOSA 1ZNQO 3I9OA 3VZSA 2VT3A 1SEPA 1MC5A 2FR0A 5A9RA 5EESA 3U4HA 4E5MA 2GRAA 3MJVA 4O5OA 3I83A 4PLGA 3FSRA 3PJFA 4FIZA 1A4IA 3V1YA 1GEEA 3WQSB 1NQTA 3WQQA 4CQLB 4N7RA 3OQ6A 1K3TA 3STHA 1KY5A 1RJWA 3GLQA 3U4CA 5L53A 3DWFA 3INRA 4K1LA 4J7XA 1VL8A 4FSHA 7MDHA 3T4XA 1KC1A 5TJ9A 1YH3A 2Y99A 4URFA 4CLOA 3NTOA 4MIYA 2A4KA 4YJDA 4DLAA 4WEOA 5H82A 3AOGA 4D3SA 1WP4A 4RV9A 2YHUA 2VNSA 1AXGA 2Y1OA 3VZPA 2J5RA 4A0SA 3IUPA 4CLHA 1ML3A 4FOSA 4Q3CA 3AM5A 4DXHA 1DIGA 1UXHA 2VHYA 4KMSA 4MP6A 5EIOA 2YUTA 3CKYA 5HA5A 4PLFA 5U1PA 4CODB 4IS2A 4Z0TA 2VYVA 1JAYA 4DPLA 4M87A 5DT9A 3RJ9A 4DRYA 4RVGA 1I32A 2DFVA 2QYSA 4U6SA 4XJTA 3OA2A 3IL2A 1T2AA 4PZCA 2ZK7A 2Q46A 1XG5A 3G0OA 4LSWA 2FN7A 3L0DA 1ZUD1 3QW2A 3E9NA 4BGVA 2PH5A 2PGDA 1PL7A 4J1SA 4K6FA 2RH4A 1NFRA 4BMVA 4JROA 1RKXA 5JCXA 2JCXA 1ADGA 4J4TA 4BB5A 1B26A 3BTUA 1H94A 4FFOA 1LLQA 3ZHBA 3HB4X 2O48X 3KSUA 1GEGA 3WNVA 4D0SA 1A9ZA 2DM6A 4XYBA 3QSGA 1ENYA 4OXKA 5A5EA 1YBVA 4HNHA 4OHUA 1EDZA 5BSHA 2ZCVA 4KDEA 1E3WA 4J1TA 2X9VA 2IZ0A 3ETGA 1SZJG 1SAYA 3ZHXA 2AW5A 3DZHA 1PZFA 1EUZA 5IFLA 1EVJA 3W8FA 3DHEA 4WCFC 3QQPA 2B36A 4ALIA 5BNTA 3I9JA 4ONEA 2SCUA 4NIMA 3GEMA 2A35A 3SBOA 4BNLA 4YT4A 4AJPA 4UEJA 3IDSA 3CSDA 3BYZA 2VWHA 1QP8A 3L9XA 1QMGA 1I0ZA 4L76A 1BDMA 3DC2A 5KVCA 4EEXA 2HLPA 1FDUA 2HMWA 3KYBA 3DTYA 4IDBA 4D3DA 1GV1A 5B37A 4JIGA 3V2HA 1ISHA 1E3WB 3RBXA 4RJTA 4FGWA 3FR7A 3UXYA 4BB6A 2UUPA 4MKXA 2X7HA 3L6OO 5FI5A 2OGUA 3HN2A 1Y6JA 4JJGA 1ZK1A 5G4KB 5T64A 3RASA 3JQ7B 3M1AA 1QXSA 2W4QA 4N54A 4FC7A 5L7YA 3O9ZA 1WNTA 2HCTA 4RDHA 2FZEA 3GVHA 4B7CA 4E3ZA 5K9ZA 1XELA 3JTMA 3DBHA 4ZA2A 3DOCA 4GH5A 1BGVA 4J1QA 3ZV5A 1T1SA 2P2SA 1P33A 1SOWA 5KVSA 2BGMA 3GZNB 4HFMA 2GO1A 2NTNA 1K2WA 1ZMOA 4B4UA 1FF9A 1GYRA 1PZGA 4RZHA 1ISJA 3RBVA 1WAMA 4R1TA 1YOVA 1GADO 2YQ4A 3H4VA 1UXKA 2AQKA 3HUDA 3UCFA 3DZKA 3OMLA 3QIVA 4HV4A 4XGNA 3B6ZA 1GDHA 3CMCO 3MZ0A 2WD8A 3WIDA 5CDUA 1PJ4A 2Z95A 3PQFA 1R0SA 4BNKA 2JFHA 1PIWA 4LMRA 3F4BA 3JQGB 5I7VA 1PGPA 2AEFA 4OQZA 1QR6A 4PLTA 4WNIA 2P4HX 5ICMA 3TNLA 5L51A 4EJMA 1P77A 3EVTA 4GWGA 1Q0QA 2O3UA 3NKLA 5KJ1A 2I3AA 3MJSA 1PJTA 5JCJA 2CDCA 3L07A 5F1PA 4WGGA 1K5HA 3QE3A 4YT8A 3KSDO 2CSUA 4I5FA 3NDRA 4ZRNA 4UVDA 4UUNA 5HM8A 3K30A 2BHLA 3ROMA 1YE3A 5F1KA 2A92A 5DBFA 1NWHA 3ROKA 4J90A 1B16A 1PS9A 2FRDA 2YV1A 5DP1A 1NVTA 3FNGA 3EDMA 1Y9EA 3I1JA 5IDWA 5THQA 1B2LA 4JJFA 4HY3A 3E8XA 3FBTA 4GVXA 3GNSA 5JYDA 3OM9A 1QKIA 4R41A 4X54A 2P4QA 5K0ZA 2YY7A 2R00C 1HETA 1BXZA 5JDIA 4CUZA 4KZPA 1JKIA 4PFJA 2TMGA 4BNUA 4ITUA 5T8KA 2BFAA 4DPKA 3I4FA 1XWFA 1I24A 1R4MB 1KEPA 1ZFNA 2E49A 1I2ZA 1FJHA 3RROA 5ENDA 1IE3A 1X0XA 4INAA 3K2EA 1LDGA 1MP0A 1EDOA 3RC9A 4BO6A 3F1LA 1UZLA 4FN4A 2YV2A 4OJNA 2FSSA 3TWOA 4AJKA 2H6EA 3JSAA 4YB8A 1EE2A 4DBVO 1BW9B 1HDRA 1SO8A 3OJOA 1YDWA 4WLVA 2BGKA 1NPTO 1A71A 3VKUA 1NX6A 4LMPA 3TQHA 2O7SA 3HDHA 2CY0A 4XWYA 5A1TA 4JJIA 2HU2A 5LC1A 2YZ7A 1E3SA 2IYPA 2EWMA 4GKVA 2AE2A 1K89A 3ASUA 3EUWA 3GZ4A 4BO2A 4IQ0A 1Z75A 2B69A 2NWQA 5JO0A 1HF3A 3EZLA 3F6YA 5T5QA 3F1KA 4L8VA 4IS3A 1P9LA 1DPGA 4BNGA 5G0VA 4J9VA 4CM1A 4CMBA 1BXGA 3V2UA 2G5CA 3AJRA 1EUDA 1TXGA 3C1OA 1SPXA 3RSHA 1MXFA 1BW9A 4BNJA 1XYGA 2Q2QA 4J3FA 5I9LA 2W2LA 5KJ6A 3WWZA 1E77A 4D7AA 1ZO8A 2BF7A 4L9RA 2WYWA 4MIEA 1Y7TA 3S2EA 3DBRB 1GR0A 1P3DA 1QYWA 2C20A 2X9NA 4RF2A 2HJSA 2OL4A 3LZ6A 4AJJA 4MKZA 1QYCA 3RCBA 4I9UA 4CQMA 4MVJG 4W9NC 3QVOA 3ZV6A 3GRPA 3JYPA 5KIAA 1WDMA 3GOHA 1J49A 4NI5A 3V5NA 2IEBA 1YRLA 1GQ2A 2ZTUA 1ZK2A 4WKGA 1JVBA 2CNBA 4JQCA 1RWBA 4DIBA 4NG5A 3ZWWA 4K28A 4QX6A 5DF1A 1DC6A 1J6UA 1AHIA 3BMNA 4K6CA 4YBZA 1O6ZA 2WWRA 3W8EA 1NVMB 4II2A 3CUKA 6ADHA 1H93A 2O4CA 4FC6A 3S1LA 2CVZA 2AQHA 3H5RA 5COBA 3AY7A 4ZVVA 3INGA 1W6UA 4QECA 3NUGA 4CM9D 4D45A 4E21A 3C7CB 3M2PA 3G1UA 4CMEC 3HADA 3H2SA 1TI7A 1KVQA 3C1AA 1DJQA 4OXYA 1P45A 3BZUA 3PFFA 3CZMA 5AYVA 2NVUB 4Y98A 1U3TA 3JQBC 2H63A 3EYWA 1AHHA 2J3IA 4H3VA 3C8MA 2GSDA 2PZMA 3D3WA 4ND2A 3KRTA 4NU5A 5AXBA 2NADA 5DBGA 1CF2O 4YJGA 4FPXA 2UAGA 1LLCA 3OICA 3AU8A 4G65A 4YDRA 4L73A 4CM5A 1TVEA 5A9SA 5GZ3A 5HRUA 1NYTA 3AFMA 1ADCA 2X0IA 2C29D 3BMOA 1PTJA 2UVDA 3KYCA 5G4LA 5TNXA 4JBGA 5C7OO 3G1TA 2R00A 3ITKA 3KYDA 5A05A 1ZEMA 5EL0A 4C7KA 5ENVA 1HLPA 4Y6PA 5I9MA 4R5HA 2NVUA 3WTBA 2CVQA 4IDEA 1HDGO 4HFNA 1MB4A 3OIGA 2E37A 1LJ8A 1Q7BA 2BKAA 4CR7A 1OC4A 1WMAA 3HDJA 5CHEA 4TZTA 4BNHA 2HSDA 1T1RA 4MJLA 2OO5A 3ZU5A 5KKAA 3UAGA 4L4XA 4NK4A 4W9NA 3CPSA 3VZRA 3JCZA 3JQFC 3GPDG 4L0QA 2AMFA 3RKUA 3GVCA 1GPDG 3OIDA 5GZ6A 3WBBA 4PLWA 4A03A 2GCGA 1JWAB 3FNHA 1W4ZA 1ZCJA 1MFZA 1GYQA 4HFRA 1BWSA 1I10A 1O89A 3FTPA 3WDSA 4XR9A 5G0SA 4J0EA 3LF2A 5EJ2A 3NX4A 4OOFA 3BMQB 1ZVMA 3DB2A 3U0BA 2V6FA 1QV7A 3MWEB 3VPXA 1LQUA 2C54A 4P4GA 4RQTA 2VQ3A 4D42A 2DKNA 2I6TA 2PK3A 1A9YA 1B8PA 2OFPA 3GDOA 3WSVA 3NDIA 3KOUA 2X6TA 1WPQA 3OP4A 3D3EA 4J7UA 3Q9UA 4BQRA 4NJMB 4DBZA 1H5QA 1DLJA 3ONEA 4F45A 3GNQA 1N92A 1Q0LA 3JQAA 3D4PA 1JW9B 2W8ZA 1KETA 1NHGA 2GGSA 3RUDA 4BMNA 2OMEA 2PNFA 1Y8QB 1MG0A 4YACA 1Z74A 2Q4BA 1BXKA 4JNKA 3GFBA 4S1VA 4PLVA 4R3NA 5JAIA 2RCYA 4TQGA 2PZJA 3ANLA 3HSKA 4TMFA 4Z6KA 5TF4A 4ZGWA 5JY6A 3L77A 1GL3A 2P5UA 1WDLA 4FFLA 1KVUA 1E1LA 1RM4A 1T2DA 4Z0PA 5A4DA 4LCEA 1DJNA 1DC4A 3A14A 1PQPA 3ZWMA 2JCVA 1FDSA 1K6JA 2EKLA 3S2IA 3AUTA 2HK8A 3WGTA 3I6IA 4F6LA 4JN6B 3D4NA 1N9GA 2FPGA 2GN8A 2QIOA 1JAXA 4YJFA 2DQ4A 1M76A 2WD7B 2DBQA 2G82A 2I5PO 4RVHA 4AJ1A 4BNYA 3PJDA 4U0JA 4NBUA 4HBGA 1YB5A 2B83A 2X86A 5EPOA 1Y5RA 3JQ8A 2WDZA 1E92A 1Y8RB 3DZIA 2EERA 3I23A 3MTGA 3NRCA 1U3VA 1EK5A 1CJCA 3O38A 5JFOA 2X5KO 4WCFB 3Q0EA 1BRMA 1D7OA 2Q1SA 4IY1A 2AEJA 1E3JA 3K31A 1LSOA 1Q0HA 4ZU3A 5LCXA 3DXFA 3GN1A 1IYZA 4BO9A 4MO2A 4RF5A 4GSLA 4CLRA 1UJMA 1LEHA 4J6FA 3IJRA 1NVGA 4LCJA 4CM4B 4P22A 3IMFA 2EHDA 2VUSA 5KJEA 5BR7A 3NEPX 3N58A 2UUOA 3QVSA 5JXWA 1DC5A 1LC3A 5U9CA 4E5NA 3SXPA 3OF2A 2BRUA 3RKRA 4IJUA 3UGKA 1CIVA 3H6KA 3F5QA 3PHIA 3PWSA 2X8LA 2YV3A 3LK7A 4IDFA 2X23A 5IF3A 2NLOA 2O3JA 5DOZA 9LDBA 1ULUA 1GZ6A 5A9TA 1R4NB 3ZHYA 1ENPA 3F47A 1EE9A 3VH1A 3W4IA 3ZWAA 2ZB8A 4GAEA 4I1IA 4BKOA 4W82A 3JQ7A 3WOHA 1OC2A 4Q3BA 1YQDA 2C7VA 1Z82A 3IOYA 4CM9A 2Q2VA 2EW2A 4NHEA 4O0LA 1DOHA 4MPDA 3AW9A 3ZWCA 4YEDA 3WGIA 1UXGA 4D0RA 4EDFA 1VJTA 3DZJA 3LYLA 3JQFA 2B5VA 2AQ8A 1HDYA 4R69A 1PR9A 3RC1A 2WD7A 1FDWA 5JLAA 1VL0A 5TX7A 1YBMA 1IUKA 3BTSA 1IL0A 3BIOA 3LC1O 4PVCA 2XOXA 4XYGA 1X7DA 2H5LA 2PTGA 3M1LA 1EVYA 1L1FA 4A2CA 3KYCB 4JK3A 4DMMA 4ZQHA 1I01A 3TSCA 1V3VA 2GF2A 2WJPA 4XYMA 3E6AA 1PJLA 4ZD6A 4J0FA 2GERA 4OKIA 3H9JA 1HE5A 4Z9YA 1VI2A 4I8XA 4MVJE 3JD4A 5DOVA 4D44A 3QP9A 4XRGA 1UP6A 2PD3A 3JQ9A 2P5YA 3RUCA 3ZNQA 2RBEA 5IN5A 1X14A 3PWZA 1AUPA 5LDGA 1E7YA 5CEFA 1NWCA 4IJWA 2DAPA 3MOIA 1IHYA 1H6DA 4IZIA 2OXIA 5BNIA 2WMDA 1DFHA 4YJHA 3GNTA 1QORA 3HG7A 4KQXA 3INTA 2O2YA 4DUPA 1C3VA 4EJ6A 2FSVA 1O8CA 4EZBA 4KOAA 1H2HA 3GRKA 1DAPA 1EMDA 2VRBA 4NBWA 4OAQA 4YA6A 2P91A 2VUTA 4BO5A 2CZCA 5EERA 3T4EA 1LI4A 3W4KA 3W6ZA 5JS6A 5L4SA 3R6DA 1LC0A 3OJ0A 4DIFA 1ZIDA 3GFGA 4NMHA 4GMFA 1X1TA 2Y0EA 1UXIA 2IXAA 4NNJA 4I5EA 3PYLA 4RF3A 3DTTA 3VPFA 3WLFA 4FS3A 1HSOA 1DIAA 2DVMA 2I3GA 1NAHA 3LF1A 4XIYA 1RM5A 5TGDA 4RCVA 2PKQP 3ZDFA 3SVTA 2X0RA 4AJOA 1NM5A 3TF5A 3UCEA 4R54A 1WLYA 1LSSA 4RPKA 1XA0A 5EQDA 1YKFA 3WB9A 1IZ0A 3C3XA 3B70A 3PHGA 4RF4A 2JFGA 3WR5A 1X0VA 4FJ0A 3KSZO 3NJ4A 3U3XA 1OBFO 3R3SA 1GD1O 3X2FA 4FB5A 4WCDA 1XKQA 1I2CA 1AGNA 3PK0A 2AE1A 3FR8A 5EINA 2W2LD 1VPDA 2NU7A 4GLOA 1FDVA 3ANMA 3BTVA 4QT0A 5TS3A 5ILOA 4HX5A 5COQA 1KIFA 1G6KA 1U2GA 3NTRA 3RWBA 4CMEA 2I9PA 2X22A 3ADOA 2VCYA 3JD3A 2AEMA 3FHLA 3WJAA 1WWKA 3LT4A 3PVZA 3BMQA 2Q49A 1PJBA 2ZJ1A 1KYQA 1VC2A 3KXDA 5CP8A 3ZW8A 2PGLA 4CQMD 5MDHA 3GMDA 5F21A 3GN2A 5F5LA 4WJZA 2C7GA 2O23A 3VVBA 4E5YA 2V7PA 3GGGA 1C0PA 2YW9A 4AG3A 1M2WA 1OOEA 1ADFA 3FD8A 5G2OA 5T67A 3CH6A 4W7HA 5GMOA 1SCUA 3SJUA 3D64A 4MVJD 3QA9A 3KEQA 3GC6A 3KV3O 4WCFA 2GZ1A 2X5JO 2WEKA 2VWGA 2JHFA 1KVRA 3IAHA 4MVJP 5EMHA 3F4LA 1A72A 3DAGA 4BO4A 5T57A 1SBYA 5FI3A 2JFFA 5G4KA 4YWJA 4ZQGA 3H9GA 4MDHA 5JBIA 2B5WA 1HKUA 1IOLA 3WX0A 1DB3A 3GMSA 3DBVO 4LK3A 5L95A 3R1IA 1VKOA 3DDNA 3GA0A 1YL7A 3VZQA 3AOEC 2YFHA 2Y1DA 3D5TA 1YL5A 1C1XA 1E1MA 2HQ1A 3L9WA 4YAEA 3PZBA 2NVWA 4WUVA 2YJZA 2V6GA 2GZ2A 3JYLA 3DO5A 3G79A 3K9QO 4GSKA 4BGUA 2NU9A 2VRCA 4MOWA 1P44A 2DLDA 3DBLB 2DPHA 1N1GA 5JDCA 1R0LA 1WMBA 1W73A 3DOOA 3EY4A 4CM8A 4E5KA 1BHSA 4GX0A 1VJ0A 3NAQA 4E33A 5L45A 3PQDA 4FQ8A 1WZIA 4UEKA 3WTCA 3C7AA 1GQYA 2O2SA 3GF4A 1YGYA 4CMKA 3ZWPA 1DEHA 1RM0A 3IJPA 4XA8A 2JAPA 4DLLA 1MFPA 1DXYA 3OSUA 2DFDA 2P9CA 4NQZA 3LC2O 3W8DA 3GZNA 3I52A 3GG2A 4CM6A 1U5AA 2WYVA 1JDJA 3P2OA 2P68A 5B1YA 4PGFA 2J3JA 4TSKA 2CUKA 1GAEO 3ICPA 5A02A 3PFWO 3DFUA 4BNVA 3NGXA 2Y67A 1HZZA 3GT0A 4I5DA 2EIHA 1ZJZA 3K96A 4MINA 1T24A 1EBFA 4NBTA 3RVDA 3WGYA 4YTEA 4CM7A 3ONDA 3DZFA 1JKFA 1J0XO 3D1LA 1XGKA 2DTEA 4S3MA 3RJ5A 4D41A 3E5RA 1PZHA 5I7SA 5BQFA 3VPHA 1EQUA 3H9EO 2E4AA 2EP5A 3PLRA 4GQAA 1E5QA 3D4OA 3Q2IA 4Z9FA 1LDEA 5ER9A 3GQVA 4IZHA 1UDBA 2JJYA 4ROSA 1Y9AA 4WLEA 4DIOA 4W4TA 4XQCA 3W6UA 5TC4A 5F3RA 5KJFA 3I9NA 2PA3A 2ZATA 5CDYA 2OORA 4C7JA 1LLDA 2GYYA 4LISA 1LXCA 2DT5A 1SMKA 1ONNA 1XEAA 4DC0A 3DHNA 3DFZA 1BMDA 2UV8A 1F8FA 1W8DA 2D8AA 3PZRA 4O59O 2HMSA 4WLNA 2I99A 1PWXA 1OZAA 5CG1A 4BV8A 1IPEA 1XHLA 1FMCA 4ND5A 3NT4A 3VTFA 3RQSA 2BI7A 4NFYA 3H3FA 4D79A 3HNPA 5DN9A 3DQPA 3K5PA 4MP3A 4TROA 2VYND 1DDOA 4J1NA 1C0IA 3GUCA 1VLLA 5CPFA 3ZZNA 4RVDA 2BD0A 5T8KC 2H9IA 2NV6A 2OP1A 1SB9A 2ET6A 2ZB4A 3RFXA 3ZNOA 3ZWXA 3JQAB 1SB8A 2EKQA 2O50A 3AM4A 4XB1A 1ADBA 4M8SA 1KS9A 1Z73A 2X4GA 4XGIA 2I65A 1EVIA 1V3TA 1YJ8A 3ZGYA 1YONA 3O8QA 1A27A 3SC6A 2IDZA 1HE2A 1GFSA 2VUUA 4TKLA 3BHIA 3JD2A 3Q3CA 4XJSA 3ZU3A 3PP8A 1P1FA 1I3NA 1HRDA 3AI3A 4DQUA 1F17A 1YVEI 1HT0A 3OETA 1CDOA 1D1SA 4A7PA 5JC1A 1HYHA 3KETA 3PLNA 2Y66A 2I66A 1LSUA 4NFHA 3HN7A 3RUIA 3ANNA 1ZSYA 4DGSA 3RC7A 3GY0A 3ULKA 3FWZA 4ALNA 2JL1A 2NVBA 4EEZA 1HEUA 1JWBB 2GZ3A 3GDGA 3L4SO 4WPGA 2IRWA 1YB4A 3F9IA 3I6QA 4IUYA 4RVUA 1NPYA 4YCAA 5CAEA 4NZ9A 1MV8A 5MGBA 3QVXA 2NSDA 2X58A 2GN4A 4L4RA 4QUKA 3U4IA 3WGHA 4YAJA 1OMOA 4XX0A 5IZCA 3ZV4A 2XXJA 3H3JA 2I76A 3K92A 4DREA 3ICCA 4J16A 3ZI0A 3GPIA 2CDBA 3H5AA 3KLMX 2DTDA 4II3A 3PTZA 1B15A 3KVOA 3DONA 1NQOA 3DMYA 4H16A 2Q1TA 1H0KA 3EVNA 4B4VA 4PG8A 2LDXA 2Q2WA 1LLUA 1CQJA 4AJNA 4B3JA 1Y1PA 4RZIA 1MC4A 4YT2A 5ICSA 4IIVA 3AUUA 5KVVA 3BHJA 3JQEA 1YDEA 1TA4A 1XR3A 4J91A 1PSDA 2HMVA 3WYCA 5CDSA 5KWEA 2ZYGA 3PGJA 1H2BA 2HJRA 2DC1A 2GR9A 3I4CA 4FBGA 1XSEA 4R16A 4ZQEA 2GPTA 4BNZA 4PZDA 3GVXA 3TOZA 3BA1A 4CJXA 1HE4A 1JU9A 5AXCA 1ARZA 2EV9A 4M86A 1QYVA 1UR5A 1E7RA 1XCBA 3O4RA 1HWYA 2VTEA 3F5SA 4HKTA 4DTIA 4DWVA 9LDTA 1DFGA 3V1TC 3AY6A 5L4LA 4UVHA 4UULA 2QRLA 1LDBA 1QYDA 3UKOA 1UAGA 4PG5A 1N8KA 2BMAA 3QV1A 4YJGB 1U4OA 4WE3A 2HK7A 4BO1A 3BTOA 1YS4A 4KWHA 5ITWA 2CFCA 2PZLA 1TT5A 3NV9A 4AL4A 1ISMA 3LC7O 4DA9A 3Q6IA 3AY3A 1H6AA 1P1RA 1I33A 4XDYA 4NDNE 3M2TA 4HP8A 3OJEA 2V65A 3H2ZA 4PRLA 1P31A 1D1TA 2A9FA 3LT0A 4D3FA 5C3MA 3PHJA 4PG4A 4AJ2A 3D3WB 2VHWA 3S2FA 2RIRA 3GGPA 3ABIA 5ILGA 3Q9NA 1NP3A 5ER6A 4WEQA 1ISGA 5JNLA 5L9AA 3A06A 1G1AA 3UF0A 1IHXA 1LA2A 4BKRA 2ZQZA 1JQBA 2Z5LA 3ITDA 1KEVA 3LQFA 3DOJA 3PXXA 2PFGA 3KO8A 1DRVA 1NNUA 3JQGA 2D2IA 1GUYA 3A4VA 4D43A 3VOSA 3UN1A 1EFKA 1I5RA 4FFRA 1C1XB 3TRIA 2JD0A 1E3IA 1LNQA 4M49A 1PS0A 2VHXA 1SC6A 2Q50A 5B4VA 3ZV3A 4PG7A 5BSGA 4XR4A 1M75A 4R3WA 1PU2A 5JDIC 4BNTA 4ND4A 5A5FA 2OP0A 4K26A 3W1VA 1PS8A 1P0FA 3U4DA 1EVZA 3ZCXA 4FCCA 1X7GA 4BNWA 5A06A 1VE9A 4CMIB 2DUWA 3ST7A 3WJ7A 4M54A 2FR8A 2X1HA 1Z7BA 4ZQFA 4ALMA 3ZU4A 2B35A 4CV3A 4XQGA 4UVGA 2DBZA 4XEHA 5KJCA 3U9LA 2ZTMA 2QG4A 3KB6A 1W0CA 1CYDA 1F0YA 4AJLA 4Y67A 5I9NA 2J5QA 1LDMA 1AN9A 1C1DA 1I3LA 4ZJUA 2NTJA 2FWMX 2GNAA 5FFFA 2CF6A 5L40A 3DHYA 3TPCA 1K6IA 1YQGA 3GVIA 1GTMA 1BTOA 4WLFA 3U09A 4Y8VA 2VT2A 5CEEA 4KUGA 3OFSA 3ZN2A 3LVFO 3OQBA 4PLYA 4E2YA 1NQ5A 2DTXA 2VYNA 3BAZA 1HLDA 3ZWVA 4YPOA 1B3RA 3ENNA 2WE8A 3CXRA 5LDHA 2VOEA 1Y8QA 4G81A 2QQ5A 2IE0A 1U8XX 2FPIA 4RLSA 3MCVA 4GLLA 1B0AA 3HHPA 4A5OA 5I8WA 1ZSVA 3GHHA 4YYZA 1UDCA 3ENKA 3E18A 4G2NA 1GPJA 4HUJA 4LVUA 4IDCA 4YXFA 2QX7A 1PQUA 3ZNNA 5B4UA 1SNYA 4PIVA 4PG6A 3UH1A 1P1IA 1P74A 2Z1MA 2B0JA 4OO3A 5CDTA
chains in the Genus database with same CATH superfamily
1HL3A 1PWHA 3Q7EA 4RH1A 4RVSA 3WBJA 1UP7A 1KY2A 1BN7A 1J21A 5LB2A 2A2ZA 4K3VA 3C24A 2A0FA 4HDSA 3UB2A 4Y0AA 1AD2A 1U4SA 1DQSA 3WXBA 3KJHA 1K4MA 2VDJA 1I6KA 5EKTA 2QUIA 2IBTA 2AX4A 4IO0A 1ZWKA 4AYXA 4DYVA 3CLUC 5T6BA 1NVDA 4FQ7A 5IABA 2CKMA 2YRXA 3ADCA 3VGJA 1LU9A 1MQSA 4P86A 4QOEA 3ZPXA 3KM0A 1I36A 4KAAA 4HLDA 4OHBA 1XLTC 3JWPA 5ELMA 5EZQA 3SLRA 2V0NA 1NPDA 3C6XA 4RA6B 1MUUA 1Y6GA 1HDXA 2UYQA 3AT1A 3PFKA 1JEYB 3M3DA 3OA0A 2NSLA 4RCYA 1CUFA 3MTBA 1KK2A 1LVHA 4Y2PA 4NCJA 3UGTA 2HRBA 3HJGA 3OFJA 2WF6A 1DC3A 2BLNA 3UJ8A 1YR7A 3AKYA 4Y6SA 3OCJA 1QO0A 1OV4A 4K81B 4RHEA 3K94A 2WWVD 3RT9A 1DRUA 1LF0A 2AMLA 2BP7B 3AEYA 4F2WA 4JXZA 2JPDA 2WTBA 3ZBPA 3R5XA 3SEAA 4O2AF 5SYNA 1TYAE 1QHNA 3KKZA 4U7WA 3N6XA 4MVJH 1OFGA 2RHTA 2X4DA 2ZJ5A 4KB5A 3RQIA 1J8QA 1YQ9A 1SVUA 2LR0A 3UBMA 4Q3NA 2F1OA 2J3MA 2ZTVA 1O95A 1J00A 5K1ZA 3HJBA 2XVYA 4EA7A 4NR0A 1CC1S 3SC4A 5B2ZA 8AT1A 3GRAA 3KAKA 4NS4A 4OLBA 4HYYA 4J0IA 5AHRA 2RH8A 1EG7A 4RGQA 2OT3B 5T4EA 3I53A 3LG2A 3KUCA 5A71A 1U8FO 3E7FA 1N6KA 4HGPA 4FMDB 4GEKA 4C20A 1H65A 2IY7A 3JZIA 3RLFA 3WMEA 1VL6A 1FX1A 1XZCA 2EBWA 3IUSA 2O3TA 1LZKA 3M3PA 3SIWA 1Q22A 4KUHA 3QWHA 2GPSA 3STWA 5FOXA 3CM0A 4ARIA 2YWGA 4KBYA 4E31A 2CHGA 1ZX1A 3EZYA 3CURA 4J0HA 4JIMA 3UFXA 2A8YA 1G8FA 3IUNA 4LVCA 5E9QA 1HT3A 5TLSA 1Q74A 3IVRA 4X85A 4R1NA 1C8BA 2DETA 1R5OA 2JG3A 1GPLA 2X0JA 2R25B 3HACA 4GXNA 2RARA 5C32A 1SKMA 2GBCA 4FD3A 4WVFA 4AMVA 3HPRA 1RI3A 4RDIA 4IDGA 1ND5A 1SBNE 4Q34A 1ZN8A 1C8KA 1GKIA 2Q8QA 4JLSA 4NZPA 4B6JA 3H17A 3PIDA 1MB2A 1RE0A 2C07A 3FTEA 4KXFB 4EJSB 1RXUA 4OY3A 2IHJA 3AJDA 1V0JA 3BIXA 2D8MA 1BH2A 3AFNA 1XDSA 2WIJA 3FVRA 3NIWA 4RGVA 5AKZA 4FWBA 4MK4A 4Q7MB 3WNQA 4E2XA 4NFLA 3TKLA 2C96A 3MJDA 2VA9A 4KR7A 1ORWA 3A1CA 5JJKA 1V4BA 5KNCA 4LF7B 4RKWA 5EXPA 2H2WA 3NORA 5K0NA 3UC9A 3S5UA 1P7PA 2Q8NA 1GZ3A 4ZKDA 3L7AA 3ORSA 1IZYA 1RC0A 2POQX 2E0IA 4LN1A 3GPBA 5FQNA 1NM5C 2GAAA 2WAXA 3KQQA 1DIRA 1VSQA 2CMKA 3IP3A 5DXFA 5EXEA 1ZM7A 4ZV9A 1U28C 2C5FA 1UC9A 2PH7A 1Q0ZA 3RVOA 1T36A 1D7AA 1WPGA 4UZEA 2FPIB 1B0ZA 5BVGA 1RWOA 4QWWA 3YASA 1FU7A 4X3OA 4EYKA 2QUBA 4FZJA 5GONA 2G88A 4K2AA 3P9IA 3LLCA 4QWMA 1CZLA 1U80A 3VC1A 3WNCA 1X1BA 1RMTA 1YK1A 2QVGA 3BMCB 4AU1A 4BBJA 3BH0A 1WW2A 4QDJA 3ZD8A 4RTKA 4ZTZB 4P93A 2O2IA 2XPCA 4P3XA 2HK6A 3C6KA 3TNJA 1X7YB 4KQHA 4EFLA 3KQHA 1CWUA 1G8AA 3AHCA 2CUTA 3UMFA 5A4IS 2PRZA 4I8IA 1J1UA 2O0JA 4Q1EA 5BXYA 2GARA 2DPYA 1P4RA 3GLVA 1YZNA 2OBFA 1SC4A 2E1PA 2ZYVX 3MUOA 3X0DA 5DHQA 1SA0A 3CWCA 1CZHA 1OZGA 4TRJA 1B00A 2W83A 2HHLA 3ZQ6A 3QWBA 2RK4A 2EBFX 3TZEA 4ESOA 1Y4DE 2B4QA 3PGXA 3FNIA 1ODLA 3LW7A 4C4SA 2PRSA 1EHIA 3M6AA 5AVVA 4YUWA 5IP5A 5FNZA 4ZEXA 3ZBUA 4E5PA 3EIHA 3BL6A 4GVPA 2QB5A 2LBPA 2XMGA 4D74A 2SKDA 4N5HX 3WGQA 1HYBA 4F21A 3KLNA 1N32B 4JASB 4EDHA 2AN4A 1S3IA 2PQ6A 16PKA 1XZIA 5CLHA 5TGTA 1TAQA 1X1DA 4B4OA 3DQQA 2R8ZA 5JNUA 2X9QA 4I7EA 2QUJA 2XAAA 5CDHA 2GAOA 3MXOA 1MF7A 4D26A 3W1WA 4CKWB 1V47A 1PZXA 5K8CA 3AF3A 4I2VA 1G4UR 3DJYA 3FPSA 2Q3FA 4H08A 3X1MA 3S2GA 3CUUA 4OMFG 5KYVA 4ZK2A 2HZ7A 4QOHA 2I67A 3A05A 3QKTA 1CW2B 1VJ1A 1EPUA 1U2TA 4QPNA 1Z4MA 1OFIA 1E1CA 1HLFA 1V7CA 5J5VA 1MD9A 1P5HA 1PT9A 3RK0A 4A8HA 4BFVA 3A28A 3OEWA 5FEUA 1BWPA 2C57A 3TG8A 4PSUA 1Q95A 1JTEA 1NT2A 2C5SA 2HPZA 1EK1A 3C7DB 3ET4A 3SEQA 3M1YA 3CUTA 2VQEB 1A8HA 4GG1A 2BE9A 5I8PA 5ICGA 2PLFA 1WBDA 4JENA 2ONZA 2PWYA 4AIIA 1V8PA 1U8UA 2X2FA 3OJCA 4OHOA 4WXRA 5ALDA 4D8VA 4FDUA 4FHEA 4CYMA 1Q7GA 2XRMA 3ETCA 2EARA 4X9XA 4U0KA 1KDTA 2Q41A 3DP9A 1WMSA 3NFYA 4XWWA 1W49A 1QVVA 4DA4A 1WZEA 4AZWA 2WHQA 2MYUA 1OT5A 3K53A 4HBZA 4PZZA 4RIEA 1NR7A 2F8MA 1L4HA 5C8XA 2WU4A 3DM5A 3DVAA 5TPWB 4FBMA 1LWNA 1Q91A 2CL0X 2ID8A 2W6QA 2QT1A 2PVPA 2I7CA 4LDZA 4Q9AA 5HQTA 3LGXA 4D92A 3PEYA 3K8YA 1HE1C 4W8HA 4R1LA 2XMCA 3QWFA 2CDAA 3JYNA 4WIAA 5EVJA 1JIXA 1WDKA 1TU0A 4M89A 4HNVA 4GM1A 2F8TA 4DJTA 3GH1A 4OA5A 1ODKA 4KBFA 5D3MA 3BIFA 3OHSX 2IOYA 5BUSA 1ZMTA 4Z3DA 2I9KA 1TQ8A 1EFLA 4KWEA 3JQCA 4A6DA 3QOFA 1RRVA 4WKOA 5DYWA 1Q1AA 4EL0A 3QLJA 2Z3ZA 4IF6A 2QQFA 1M6VB 4IJ6A 3II6X 4QNNA 3RFVA 3UT5B 2AMYA 1DEKA 4BNMA 4BMOB 4GMXA 2Q9CA 3SYRA 3G2IA 3P0HA 1WKCA 5GINE 2KJQA 3TEJA 1H5UA 3KFVA 4A8PA 2ONKA 2Z2XA 1EJ6A 1LTHR 5DCLA 2IEGA 1PUXA 3WISA 2YIDA 3K6SB 4UQPA 3KAJA 4CNBA 5EJ8A 3EVFA 1D2AA 3RF7A 2EDAA 3B2QA 5C1OA 3VUFA 2FX3A 3PYMA 5KWVA 4MQFB 4OLFA 1KJWA 4PZEA 1WBJB 4F9FA 3W7VA 4QVGA 2QPLA 2HA7A 2QTVB 1BA2A 3ORQA 2D5BA 3SOPA 4OGWA 2W22A 2FN9A 1MQAA 3LP8A 4Y2VA 3RUAA 2PU5A 3V4OA 1AF7A 4M37A 4A0HA 4B45A 4V1CI 3N8HA 3BORA 1XC7A 4R1QA 1WXDA 4RA6A 6LDHA 2ZB3A 4OH1A 1CUHA 1USVA 1H69A 4ZJZA 2Q0XA 2R6R1 3JYOA 5C7IO 2AR9A 4CBVA 3GHYA 3OZ7A 1F20A 1SUWA 2WJ6A 5F9HA 1N6RA 4I1PA 1XZMA 2ZFUA 5K0SA 3Q7PA 3KSBC 1E6CA 5BYAA 2QJFA 2QTRA 2WTAA 3QXGA 2XWJI 5D84A 3GRRA 1KAGA 2I34A 4R1OA 4DQKA 4R7ZA 4HX9A 2FP4A 4Q3KA 4IXNA 3WXMA 3NYWA 1MGPA 3CXUA 3KZOA 2AVNA 3MB5A 4PZPA 2ZKLA 2PO5A 4YP5A 4LDRA 4TL8A 1E6MA 1NVBA 3FX2A 2PFSA 4KQWA 4R4JA 4C07A 2PX2A 4MHTA 4EAQA 4HH3C 3GX1A 4UASA 4F46A 4G26A 1PI3A 1WEKA 1KZ6A 1KBZA 1RPAA 2ZJAA 2H65A 3PJGA 4D1YA 3UHFA 4X93A 1X8LA 2H29A 2FN8A 2GKGA 1T9GS 4NPAA 2B3DA 3S3TA 1YR3A 3FTDA 3R9WA 3JTEA 4Y0NA 3AM1A 4OUKX 2OM2A 4GRDA 4DXAA 2Q5LA 4CM4A 5EWLB 5IUNC 3FWHA 1QHHA 4TLLB 1TVMA 3L84A 4A10A 3SHTA 4COOA 3TLJA 4ZI3A 2EGGA 3F6RA 1I1NA 4LY9A 2P2CA 5ALNA 3FOEC 1GV0A 4LGMA 3E82A 3NHSA 1JPJA 3UTCA 4FHGA 4XQ9A 3DF7A 1IIBA 3T7EA 1EWKA 3VTAA 2JLYA 1XZFA 2ZCUA 4EUHA 5AUOB 3R0IA 3WYEA 1JVSA 4JVMA 3QJGA 5FNVF 4XWOA 1PT6A 1ZUIA 4FFMA 3FBGA 1QTQA 2BTEA 4CWAA 3I8OA 3AFGA 4N0MA 4TMTA 3MMNA 3KTOA 2PU7A 4G9BA 4RYLA 2D0IA 3PC8C 1GXSA 2QXUA 3LKVA 4M1QA 4NOLA 4MVJI 1JR3D 3B9BA 3O91A 4NTZA 4BDSA 4KU4A 5LLTA 2OHOA 3ES9A 3OM1A 4MV8A 5HM6A 4KN5A 4GOJA 4W1SA 5DYIA 3W2GA 1WSBA 2QXYA 4B3SB 1L7XA 1LRJA 2XCUA 1GLVA 2I4TA 4JZYA 2QZ9A 5TQVA 3VX3A 3IQDB 3WL7A 2G9VA 2R6HA 5C37A 3P9CA 5E9WA 1SHUX 4LJSA 4YDSA 4CL2A 3FNBA 1DC8A 2ADOA 4AS1A 4A23A 4ZDWA 4R9VA 1OA1A 1NIPA 1BX1A 1NR1A 2Z98A 4WTOA 3KSAC 1PJ2A 3H6GA 3F2VA 2X0DA 3V3TA 3VR6H 2BHRA 1EIZA 3QIAA 2JLWA 1IG3A 5JV5A 3ZEAA 2EW8A 4CN8A 2J7KA 3GUVA 2JVIA 1V8BA 4R98A 2HMUA 4MKGA 2GJAA 4B85A 5E9JA 1ACLA 4Z4FA 2KB0A 2IHZA 3R3ZA 2JARA 3UJ6A 2GTPA 2OV6A 3R3JA 5F77A 2HXSA 3CA8A 1A95A 4GC5A 1J23A 2BUCA 3TZHA 4IMPA 1IQRA 3K2IA 4RV5A 1SD2A 4JWKA 4LBVA 2A9RA 1N5OX 1GDTA 1LRLA 1DP4A 3EIFA 5CJ2A 2PUDA 4Q01A 1PL6A 2AA3A 4N8SA 5EE0A 3P0RA 1QZTA 3IOCA 4HDNB 3S68A 3VKHA 4N18A 5AFSA 3VPSA 4TTSA 4AM8A 2BSQA 2CLIB 3IP6A 3QNWA 5K0EA 2XEDA 4EG1A 4Z8XA 4G0MA 4UVEA 3NATA 1JQKA 2HWUA 1PV1A 2O2HA 3RUHA 5BQ5A 2GM5A 1FUUA 2EG9A 4D99A 5A3RA 1Z6XA 1MPTA 4BMYA 3KCNA 2A9PA 3G8CA 4P4LA 4R8MA 1Q7TA 4OHVA 1CF4A 1S2GA 2ZBGA 3OAAD 1KI6B 1ULHA 1Y3CE 2CXXA 2GHTA 1JI0A 2QF7A 4KP7A 4NYJR 1CNMA 2FMIA 1W88B 4GP9A 3TZCA 1GG8A 2DU8A 2GDZA 1P19A 3CLRC 3EISA 2Q3MA 3WGNA 5DNWA 1AKVA 2QD1A 1VJRA 4WHMA 5H3LA 2FYTA 4CKBA 4Q9KA 5CDFE 1UKEA 1EINA 3NZEA 4M8LA 1NBOA 4DGQA 1YR6A 2BKXA 2P30A 2PMDA 4NFSA 1GA1A 1RVDA 2JGEA 4JMLA 1JXMA 2XRYA 3TDKA 4P36A 1BEZA 3KR0A 5BW5A 3N8NA 2JDIA 1OH7A 4DMHA 2ZPTX 1BXRB 3PNPA 4IG4A 1JL3A 4I3GA 5CVVA 3TFQA 5FTJA 4EJ0A 1QO9A 4RVCA 1P4SA 5EIBC 4IJKA 4QULA 2ARKA 1E2MA 2IU4A 4RHFA 1VGRA 3M6MD 4O63O 1EK0A 1DBQA 1Y9DA 5LP6C 4KYVA 1A5ZA 4AKSA 5MN4A 1FJGB 4IGFA 3WG9A 3EXFB 2VJDA 2VNJA 2HX1A 4JDUA 3AVPA 5AM2A 4BZZA 2X2PA 3SHOA 3SYNA 3ON5A 3MLEA 4JC0A 2A67A 5H68A 3RHZA 1P1CA 4NH4A 2Q8PA 2FUG1 3DFFA 3CHYA 4E08A 1V7ZA 3UJ3X 5ITZB 4U2BA 1ZD4A 2BKVA 2HUNA 3N1UA 2F9LA 2EKZA 4MW9A 5JWRA 5ALKA 3GLGA 3RRZA 2QIPA 4ILEA 5SZHB 3I34X 3UMRA 3SBDA 1OGYA 1BXRA 1E1CB 4JUIA 1IEWA 4PXSA 4X8HA 1U3DA 2ZZKA 2GEJA 1JR3E 2J4DA 4UUMA 4ESEA 1UBSB 3V2IA 2XF2A 4X24A 1ZK4A 1RAIA 2IE8A 1RJGA 3VJMA 4LXYA 1D2MA 1DIHA 3H4MA 3EWNA 5BNWA 1K7FB 3M0EA 4LQ4A 2FPPA 2EW1A 4GGOA 3DP7A 1CRPA 2GOYA 2CB9A 5FJIA 3UK6A 4W6ZA 1PJQA 2E82A 2VP6A 4U1RA 2F1KA 4DNFA 3Q11A 2JBWA 4X7MA 5ADHA 2X14A 2D54A 3GJ8A 1M66A 5ALOA 4Y6LA 5G02A 3I3OA 3NYRA 1HSZA 1RJDA 4B3CA 1VKNA 1C29B 3DULA 2DR2A 1H2AS 3Q3IA 1V4VA 1XN4A 3N76A 2LZ0A 4G4JA 2GZAA 2YH2A 1GKUB 3LFTA 3W5HA 4OV6B 3THYB 2GFQA 3V1KA 1R66A 3C3KA 3PG5A 4OHFA 1ZGCA 3EW7A 3R3VA 2H9YA 4M38A 5JAPA 3B1VA 2XHZA 4IKEA 3VPGA 3GJYA 2G09A 2RGYA 4HMOA 2QE7A 3FLEA 3MOGA 3TQFA 3ZCQA 821PA 2VWQA 2WP0A 4J4BA 5G1OA 4MRAA 4P7GA 2YQ5A 3EIQA 4CTJA 2AYYA 2HCRA 3ANYB 4U7HA 1T4DA 4UPDA 1HBJA 3KS9A 4NCNA 1UEIA 3F8TA 4GX1A 4TWRA 8ADHA 4W5TA 5LN1A 2BFMA 2GRJA 2PGIA 4DR3B 5JDCC 4PX5A 4K7JA 2VDRB 3KSMA 1JHDA 1VRWA 1IZ9A 1O2DA 1Y8RA 2H0RA 3FGOA 3O26A 3AEQA 3F5DA 3MYYA 4P34A 4G07A 1TTPB 4JEIA 3OO0A 4WY8A 1XO1A 5B3JA 4EUEA 1E7WA 5JLJA 1QZZA 3JQBA 3WL8A 4WY5A 5A3VA 3G2QA 4JB8A 4QYMA 4EUNA 3UICA 3OFKA 2W2XA 4FMPA 1U2DA 3LIPA 4RM2A 5BR4A 3FKJA 1NYRA 2IITA 1YCDA 4BP1A 1AGYA 4YP9A 3WRXC 1PR5A 4DM4A 1NJ1A 3AHDA 4MYUA 1SC1A 3U9SA 1JQJC 2VQ6A 2CHUA 3KLBA 3LLVA 3QTTA 5A9SB 3DEFA 1TC1A 1E32A 1V2HE 1ZITA 3EQ7A 3JQPA 4LYGA 4UCWA 4XXHA 2Z6AA 3KZMA 3W5JA 1YDHA 1CZKA 4RZ3A 2ZSUA 3OLZA 4NZNA 2VKQA 1GU7A 1IB6A 2R3SA 2QTLA 1D4FA 3H1PA 1T3LA 1ZPDA 1O94A 4KOEC 1NW6A 3C15C 1CTQA 2AOUB 2I4MA 3NIGB 2OAQ1 4FWIB 3RS3A 1NUHA 2IUTA 3LZCA 2GVZC 3AI2A 2C4UA 2P3QA 2FVYA 3OLWA 3SJ7A 1Z6PA 3OVMA 4QVIA 2Y93A 2DKFA 2GTIA 3AK4A 3ZI7A 1LUAA 6YASA 4LJAA 3OF5A 4Q4JA 3FOWA 1ZI8A 3IDAA 2C2BA 4RX1A 5AJWA 3RABA 2IYOA 3PS9A 3KPJA 2GESA 3MXTA 1EQ2A 4QXPA 3EPLA 1IMOA 3SQDA 2RHLA 3A10A 3HWWA 4PLZA 1W9MA 1UH5A 2EDCA 4R9SA 3ZYCA 5JZMA 2RDMA 1Q1BA 2XX3A 2YXLA 4R83A 1FDTA 1ZQ1A 2FTKE 2W6ID 1G42A 2VZ9A 2AD5A 2CWDA 1NJFA 3P32A 4NZMA 4DYDA 1KEEA 1I94B 1UJ2A 1SC3A 3DLIA 3FPHA 1LD3A 1A9RA 2YYYA 5EHIA 1ZESA 4RSHA 3HFGA 1T5BA 1PEDA 2ZU0C 4R40A 4KSCA 1KA9H 1XZJA 1TVCA 5BW4A 4PTZA 2FMKA 4M22A 1H4TA 2WILA 4Y6RA 5JCJD 4L50A 3ZJUA 2WA1A 4MR9A 3KVVA 4IGEA 3K4PA 1ZZEA 4MWZA 1ZH8A 2WWWA 4J4HA 5DHFA 3LVQE 2QG9A 3SX2A 5M29A 1BO6A 3PDJA 2QL6A 1QX3A 3NO4A 2W90A 2CHVA 3NTVA 4QAQA 2ZI5A 1TEHA 1F4LA 3ZIUA 4BHTA 1WB9A 1VMKA 1WX1A 3CEAA 4E13A 4RLHA 2C2XA 4H0FA 3HL4A 4WUTA 2H1HA 4PEVA 3TM5A 1Y4SA 3RUFA 2BW0A 3NONA 3V2GA 3QU7A 3R4CA 4YAIA 4FHFA 4OHKA 1W5AA 2YKGA 3C7TA 1C3JA 1J2JA 2A6PA 1KGDA 2I1VB 4F9EA 2CNWD 10MHA 1HGXA 1II0A 4MCJA 3ONFA 2CNLA 4HL6A 2QRKA 5JECA 5EUCA 4EQZA 3DL7A 5CFPA 3AVYA 2JJQA 3JRNA 1K7EB 2PV0A 3EZ2A 3WQRA 3AUSA 2GXSA 2CD7A 2IEDA 2IODA 3CWZA 4XX1A 4UBLA 3ZU2A 2QL7A 2F4NA 3SP1A 3HKCA 3MAJA 5CAEB 3G5UA 1CZOA 5EKXA 1CB0A 1U0SY 3KUDA 4ZU6X 1IZ7A 2C5AA 2HKIA 4QASA 1O4WA 2B2XA 3D3QA 1KSGA 3WIUA 2P6OA 3NXSA 4B87A 3E70C 4NJEA 1TTTA 1W1IA 1GQQA 1XEXB 2DSTA 3RV3A 1DJMA 1MJFA 2OVFA 2SCUB 3CR7A 3F7TA 3PX3A 4C7VA 5AVWA 4EUFA 5HQ3B 3ZGVA 1J2RA 4BCDA 4KI7A 4EMSA 1WUIS 2VDOB 3PEEA 4NV0A 2X9GA 4GLFA 3NG1A 1ZLYA 1OX6A 2RAFA 4KQGA 2H59A 4OFZA 4JJ8A 1K88A 4AD8A 3HBJA 4IZ6A 3K70B 1SZDA 1G8MA 3SOZA 5F7XA 1M8GA 1NRXA 3CJRA 3ET5A 1AXEA 4QE3A 4NU0A 4RNCA 1WD7A 4C6TB 3DE5X 3GBSA 2HO4A 3BXXA 4FR5A 3MWFA 3TCKA 1IB0A 2OD7A 4EWLA 3CNOA 5CB4F 2NU8A 1PG5A 2Q4EA 1J0DA 4O4LA 1C0LA 4A6EA 4XKJA 1L3IA 5JAUA 2VHVA 4X62B 1JMYA 3EXIB 3HI4A 4BJHB 4CV2A 5ITVA 5FTNA 4KRFA 1BJTA 4NBRA 5C1IA 4UNNA 3GMIA 1CLEA 1SXJA 1XL1A 2QLBA 3OX1A 3PXCX 3ZGOA 4U4AA 4CQLA 1CV2A 3FKSD 3RS2A 4AULA 2YX1A 4ZALA 4MMYB 4HUTA 4NJOA 1A97A 2BTOA 1FQWA 4LZOA 1FFSA 1R5NA 3GRZA 2XUZA 3EEIA 3HDTA 3N87A 4FYYA 4HEHA 4RNDB 5I51A 2Z8YA 2PCLA 1PGJA 2V1UA 2OMKA 3R20A 4R05A 4PCLA 1NNLA 4KQMA 3W5DA 3B60A 4BVFA 5DBOA 3BE4A 4X6UA 5F4ZA 1IM5A 4UM9B 2J5XA 5K0BA 4ZCLA 3UJBA 1RBZA 1ZVVA 3WLNA 1LK5A 1YD7A 4MUEA 3DZDA 2GLXA 5G0UA 1XTTA 2AJTA 4Y9DA 4XGKA 4QLAA 4J7CA 2V5UA 2AB0A 1V1RB 3P96A 2NZ2A 1X8KA 4ZAXA 2L18A 4BX8A 4F3YA 3E48A 3OE7D 3PJEA 3W3AA 1BEUB 1ZH6A 2O2DA 1TAUA 1V26A 3G85A 2RGAA 1NAIA 2UXDB 4N5LA 3LWBA 4I1RA 5ALEA 4OIMA 1SIWA 4GR9A 1WTCA 4G5FA 5DCWA 2PPLA 3QQ5A 3RT1A 3CTPA 2WRZA 1RPZA 1ZSNA 1PJ8A 3A1VA 4BKQA 4LXXA 2DT8A 1PJAA 2BFFA 4DTCA 4Z0HO 4HO1X 2NU6A 4WOJA 4MP8A 1LVGA 4G4SO 4XSVA 1WKBA 2LVBA 2A1TS 3LKZA 4DWOA 4FNAA 4B73A 5CT8A 1OT3A 3CLSC 3PDWA 4FEYA 4L75A 2COUA 5KWJA 4MCIA 2A5YB 1P81A 1O03A 5CVJA 1NUTA 4L8WB 1U8AA 2NG1A 3GJ4A 5A03A 4ANFA 3PKJA 1ZM9A 2O8BB 3MPUA 3LPLA 1NMEA 1X15A 4CKEA 1OV6A 4B2YA 4PHTA 5KQSA 2QP9X 3OBBA 1MG5A 1T5OA 1NJ6A 2ZJZA 1ZGAA 4JFRA 4QPZA 4TRNA 1S9DA 3SZGA 5TY0A 4UMFA 4D9MA 3MGKA 3MTAA 1A9XB 2HRCA 2JBAB 4W7IA 3FPLA 3OT1B 4HS9A 1XWIA 2D4HA 4LUCA 1N34B 4LF5B 1PR3A 3HBFA 1NXWA 2C61A 4U6QA 1ACMA 3IIJA 4MDEA 5LUAA 2D00A 2XDQB 4MB0A 2W71A 1T1EA 4L3WA 4YCBA 5EJ9A 1T10A 2B4TO 2F1JA 3IP9A 3NWPA 2X5NA 5KYYA 5JU6A 4LF4B 3CLTD 3PI7A 2O5CA 2PR7A 4LSZA 3FPKA 3L7DA 4TRRA 4BZXA 1ZK3A 1Q6ZA 2E87A 2RGCA 2PEYA 1L5RA 2Q4DA 5FA5A 4HRAA 1XJCA 4GMGA 3B20A 5U4XA 2JGFA 1KS2A 2EXXA 3EBPA 3JV7A 4CT5A 4CHGA 2G9ZA 2G1UA 2PMWB 4KQ1A 1M1YE 2HRDA 4V0ME 1FSSA 1D8AA 4FHDA 1ANKA 3AR6A 2WSBA 3W9YA 2AN3A 4FX2A 4RU1A 1KI1A 5CR9A 2IYSA 3M4NA 3BK7A 3E05A 3KELA 5CGZA 1B14A 2D06A 2QLJA 3PNQA 2PLRA 2OBXA 3EGDB 2VJOA 2X9LA 4QJIA 4YBRA 2REXB 1IPHA 3EVCA 1Q7CA 3N2ZB 3PQCA 1HDOA 4UJ5A 3AJAA 4WNAA 3ORHA 4RVFA 3JWGA 5HHTA 3VHRA 4HNSA 3ADDA 2M2IA 3RAEC 5REQA 3IMCA 3SM3A 3DQZA 1I5OA 3TO5A 2CVHA 3VZSA 3GP8A 2WYOA 3X1XA 1J70A 3I9OA 4R6XA 1ITZA 3AJ8A 1YR8A 5JVDB 5A9RA 1DXQA 4JOCA 2GRAA 3F3KA 4F86A 1TADA 4Q5IA 2N1MA 2ZSIA 5IT9A 3FSRA 3AHFA 3H2GA 4FIZA 4HG2A 4ARBA 3RIEA 4JSRA 2GFIA 1GEEA 4XB6B 3EIEA 1WPXA 4B7ZA 3LM8A 1K3TA 3OFVA 1KY5A 2H3HA 4NX2A 3ZHCA 3LP6A 3PT5A 1K92A 2X8JA 4K1LA 1B93A 1MBZA 1RWKA 2ZS8A 2OCBA 2HXYA 3JVEA 4J7XA 2NO5A 4R1PA 4WK2B 1FFHA 1KC1A 1I4WA 2F3RA 2Y99A 2VPYA 3NTOA 3O3CA 3ZG6A 1CIPA 1SIOA 5DK4A 1R0XA 4HTFB 3WK7A 4WEOA 2I3BA 3UAWA 4YUXA 1RXWA 1UJNA 4URZR 4ZVQA 5H82A 1JHOA 3ZLJA 4D3SA 2F3PA 4Q03A 2IPOA 4RV9A 3DEKA 1M33A 2Y1OA 1MENA 1BFKA 2FWPA 4H4EA 1U1FA 4CU2A 2P67A 5J2UF 3IUPA 3X1YA 2J3EA 3QMWA 4W1PA 3N0WA 4WZAA 2HCBA 4CLHA 3OQNA 4U7PB 1KZ1A 3ROXA 3HB7A 2VJMB 4LOAA 4KPYA 3LY5A 2DFNA 4C30A 2RE8A 1C9KA 1RJEA 5HA5A 3TG2A 2YUTA 3CKYA 3BBPA 4JYZA 3LUFA 3ZHSA 5HBGA 2FK8A 3V32A 1OU4A 2Q07A 5FUXA 4ASUD 1ORTA 1XDUA 4REQA 3ZLUA 5JALA 4WI1A 3C6ZA 4AF7A 2VYVA 1JAYA 4XCQA 2R0QC 4M87A 5DT9A 1Z13A 1YJAA 2W4IA 3AYXB 5EGNA 2G72A 1S8AA 1T4CB 2GKOA 1AV6A 4AO7A 1AUXA 4PZCA 5A3SA 3G0OA 1G6Q1 1WCV1 1XLVA 1P3JA 1S02A 1XTRA 2AHOA 1M6NA 2PGDA 2YXEA 1CKEA 4JR1A 4KWTA 5EHZA 4INJA 4BMVA 4JROA 2DHQA 2XUGA 3F7OA 2JCXA 2ZUVA 3HVJA 4M46A 4F4IA 4CIBA 4X8MA 3ANXA 5DYNA 4N6NA 3ZHBA 1SZCA 1OE0A 2OGSA 1CT9A 1V8OA 3BFVA 1W4BA 3TFWA 1GNPA 4WOBA 5EIXA 2LPMA 1G8PA 4TLEA 3T9BA 1M7GA 2WF5A 4XYBA 1W94A 9ATCA 4NBSA 5AW0A 2VPTA 1RC1A 1YBVA 2FQWA 3EXG2 4JL5A 4JAVC 1I13A 3IESA 3RU2A 2OCGA 3ESAA 2X9VA 5LQNA 1SZJG 4NZZA 5HRCA 2HIGA 4ZRDA 3R7AA 5DNUA 4UU1A 1EXWA 2AW5A 2HPHA 4FFDA 4G0OA 1PZFA 1LBHA 4I2NA 1EVJA 3X3HA 1YRWA 3DHEA 1Z38A 4FILA 3ZI4A 5F64A 2JLXA 3UMGA 3QQPA 2ZZMA 1TDJA 3C3PA 1PJZA 1MHPA 2JANA 2H16A 4CU5A 2SCUA 5HQ3A 4MYHA 4Y2JA 3U60B 3D6HA 5LZ5A 5ELXA 3GUHA 3QJYA 3MRTA 1RR6A 3E9DA 3UENA 2I1QA 1EB8A 4BNLA 4F60A 4UEJA 5HRAA 4GFDA 5EFOA 1YNSA 1YRYE 3AIMA 3KJGA 1GA6A 4KO3S 1WY7A 3RVMA 2H4XA 1P2DA 4G56A 1U2ZA 4JH0A 5H02A 4DV6B 2FPWA 2W6JA 1K68A 4U7GA 1QIJA 2HLPA 4ZTUB 3DTYA 1C41A 4IDBA 1GV1A 2Q5JA 3NEYA 4JIGA 4B6FA 4BXOA 3ENWA 1S2NA 2C8KA 4FGWA 3S1AA 3FR7A 4RJTA 5K51A 2QLMA 3CEMA 4E03A 2PA0A 4MKXA 5MFZA 2BFEB 2OGUA 1P2FA 2R1UA 1HTTA 3D6FA 5G4KB 1RMQA 1F8XA 3N2GB 3W2IA 4DW8A 1SG9A 2W0SA 2XIJA 5LYJF 3O9ZA 1WNTA 4UPVA 4RY2A 4ZAVA 3V1LA 1E3DA 3WGLA 4L15A 1IXYA 2V9PA 4ZA2A 3DTVB 2AR7A 2O5EA 1MA3A 3LQ1A 3N0RA 4ZC1A 2QM8A 1PK8A 1U11A 2AFIE 4FFBB 1KNQA 1K2VN 3TR0A 3WL6A 2IK8A 4KITB 3C87A 2FFHA 1OAKA 1CJSA 1K2WA 3R8XA 3I2GA 1ZMOA 1XX6A 4C0SA 1XVLA 3V3KA 1FF9A 2H1RA 1KO4A 5FPHA 1ZOLA 3H4VA 2LKCA 2A9JA 2QT9A 2ZOSA 3HB1A 2I2CA 3MT8A 2R7LA 1R8XA 3DT6A 3QFHA 2FETA 3HA2A 1AUQA 2HQRA 2P7IA 3LRPA 3U1TA 5HIKA 4DR5B 1GDHA 3MZ0A 2IH5A 1IN1A 5CDUA 4MUMA 2W6IA 4GOKA 4MCHA 3W2EA 4ENTA 4GE3A 4IH4A 5SYAA 4LMRA 3GJ5A 4DNQA 1SD5A 2WIDA 1PGPA 2AEFA 3GOQA 1QR6A 4PLTA 1RWVA 5CFLA 3G0DA 2B8WA 3VR0A 4C87A 2J3DA 1P77A 2OM6A 2Q6IA 3EVTA 2VP5A 3OZSA 2P1RA 5DN6A 4REOA 4IZOA 3O4FA 1Q0QA 5JH7B 3MJSA 1IN7A 1PJTA 2PZFA 5JCJA 4Z4HA 4NXNB 3G5LA 1CQZA 3ABRB 1CUYA 1NA5A 1FUKA 1Y5IA 2REQA 4ZRNA 5HM8A 2YN0A 3K9CA 1XMIA 1ZUWA 1YZLA 5GP1A 2C0QA 4TYQA 5F1KA 1FSZA 5DBFA 5DNEA 1EGMB 2YFKA 3L01A 1PS9A 3MG9A 1RYZA 4ZO4A 2YV1A 5LDDC 1SBIA 4KCGA 2PXAA 3I1JA 2A14A 1NNI1 5I47A 4G0UA 3V1MA 4HSEA 1ZM4A 6AT1A 3ER9A 5EJEA 1T5DX 3HCOA 3L8YA 3HR7A 1BYUA 2HF9A 2UYGA 3DDOA 1RQGA 3GLSA 13PKA 1DG1G 1DBPA 2G04A 2V5VA 3L1JA 3ZHUA 2QN3A 2MWMA 3CNLA 2SKCA 3OM9A 4CF4A 1H8HA 4EELA 5K0ZA 3DGFC 2ZJ7A 4MARA 2H7YA 4TN1A 3D0KA 1JIQA 1S2IA 1JKIA 4PFJA 4BNUA 2ZUDA 2HGSA 3VDNB 1ZYUA 2ACWA 1FMLA 3V7YA 4DPKA 2XWSA 2O8EB 3OP1A 4GD3Q 4PXAA 3QH4A 1ZFNA 4H3HB 3BC1A 4DUGA 3RROA 4AY6A 3VV3A 4FBLA 2DHRA 2OQ2A 3EFEA 3L49A 3AG6A 3T1NA 3VSDA 2WB2A 4OSEA 1QQBA 2ZUCA 4P81A 3KBBA 3QKRA 1GPAA 3UB4A 3WE7A 3FB1A 3GLKA 1GZSA 4FN4A 3VVLA 4LF6B 1IOVA 4OJNA 3T9FA 2BWJA 3JSAA 4DBVO 2P8JA 3ZVRA 1ECGA 1HDRA 2OCDA 3B9QA 4LX0A 4BBZA 1NPTO 1A71A 1Z5GA 2PGAA 1NX6A 1OLXB 1X9GA 1SCJA 2IKSA 1CSEE 4YJKA 2IU0A 4K6KA 2Q27A 4TVKA 1COZA 1UJ4A 5A1TA 1WBBA 5LC1A 4LY3A 2IYPA 2NYAA 4E15A 2A84A 1K89A 3ASUA 2FOXA 3EUWA 4KLNA 4GPAA 3V97A 4BLRA 4BO2A 5BMVB 2B69A 5BN5A 1NURA 3RGGA 1PR1A 2HU8A 3FKSA 3K5IA 1B42A 1RQPA 1T43A 1N1MA 2JGDA 3N6RA 2ANBA 2GJ8A 3VR5H 1P9LA 1DPGA 3NI2A 4R8KA 5EJ6A 4J9VA 5JNTA 1OH5A 4E46A 1K97A 1T5IA 3CSUA 4JL6A 3JY6A 3AJRA 3ESXA 3I0NA 3B36A 5C7YA 4YMLA 4HHEA 4M98A 3RSHA 1BW9A 5AHXA 1N9ZA 2Q2QA 1E2PA 1E9SA 4EHFA 4LJ5A 1QH1B 3AETA 1CUAA 3ZE0B 2W2LA 4DKXA 1VHWA 1BD4A 5B30A 1E77A 4D7AA 3IRVA 4BNDA 5I48A 3NALA 2IYXA 4IVQA 1TKCA 2PT5A 4L9RA 4MIEA 3S2EA 3DBRB 1GR0A 1U2GC 2UZ1B 3QUSA 3TMAA 3WLTA 2PGXA 3NOVA 1KJYA 3CX8A 4L0DA 3GROA 3LZ6A 4MVCA 5CH8A 2G67A 4IVRA 1NF9A 2Z5VA 5P8WA 3W3AD 4DA7A 2WHEA 2QTVA 3DMFA 1QYCA 5FKJA 2NYUA 3CKKA 3FFBA 4I9UA 4MVJG 1VBKA 1JA1A 4LHXA 4W9NC 3GLTA 2YXDA 2F1HA 2Y0PA 1SUCA 2OD9A 3JYPA 1PD1A 4MR7A 1JG7A 2KQUA 2VTVA 2WC1A 4K9NA 4ID3A 2M1XA 5A4KA 1CY1A 4EJ2A 3CNEA 1IXSB 2ZTUA 1RT9A 4UOQA 4JYBA 1BHQ1 1ISRA 2TMYA 4G36A 4US0R 2ZDQA 4WBNA 4JXXA 3ZCUA 3KK0A 1RMYA 3KXPA 4H4CA 3MWKA 1W48A 4Y1EA 2BDTA 4F8JA 4K6CA 3ESCA 3TB6A 2IZ6A 2BFNA 4S1TA 4E5SA 3RSQA 1N6LA 3DOIA 3PWTA 3O8CA 1L4BA 5ERGB 3S1LA 3OPVA 4TYMA 2C94A 3J80A 4RS4A 3H2YA 1N2JA 5FT9A 1CEYA 3L04A 1U7ZA 4OLJA 3AY7A 3GD5A 4ZVVA 3INGA 4FNGA 3QX9A 1HQDA 2PWBA 4MB2A 4CM9D 4Y9RA 4CEIB 1XXHE 3FPEA 1BEEA 3G1UA 1G5FA 4FGKA 5H4HA 1SFRA 5B64A 4Q15A 2EQAA 2REBA 1KRHA 3H11B 3RC3A 4TLCA 1EGAA 2EOAA 4ODIA 4LJRA 1K7XB 2BFWA 3BZUA 4WKPA 3CZMA 3C6BA 4AN0A 1U5BB 3JQBC 1TW3A 5M2QA 2VJBA 3EYWA 1Z6AA 2IV7A 1ZUHA 3C8MA 3JPYA 3D3WA 1TPZA 4WD3A 1L7VC 2QQEA 2ZQ5A 2G0NA 1F8UA 3P2IA 4IV5A 1CVIA 4LJ7A 5DBGA 5AXBA 4YJGA 4FPXA 1QANA 4HMQA 4NF2A 2IUYA 1YMUA 2YINC 1RHRA 4MV7A 1RW4A 4YDRA 5A9SA 4YRMA 5LQCA 4R2IA 3AFMA 2X0IA 2OFWA 2YYAA 1M8KA 2C29D 2FQ1A 2ZRAA 4BWYA 3OZVA 1PTJA 1GN9A 1TJ3A 2POCA 2Z2JA 4OHYA 4YGYA 5TNXA 1V1RA 3JZAA 1TCVA 1XK7A 2A3RA 4CCYA 4Q66C 1ZVJA 2R00A 5GIPE 4HSGA 3NKVA 3QITA 1KQFA 1XNGA 3QUCA 4FLEA 3WV5A 1F2DA 5EL0A 1M1XB 3EUAA 1XZ8A 4G63A 3VAAA 3E8MA 3LRXA 4QYXA 5CRIA 4US2R 2APJA 1CBUA 1ZIXA 1JEEA 2B3TA 4IIBA 1M2NA 2V7GA 3L8MA 1DTWA 1RRFA 3SN6A 4IOMA 5JARA 2YBEA 1LJ8A 2D1RA 4WY2A 5LP6B 2HZBA 2ZJ3A 1WMAA 3UJNA 3MW8A 2YZ2A 2HSDA 4GLJA 1AMNA 2XITA 4MS4A </