4AJNA

Rat ldha in complex with 2-((4-(2-((3-((2-methyl-1,3-benzothiazol-6- yl)amino)-3-oxo-propyl)carbamoylamino)ethyl)phenyl)methyl) propanedioic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
330
structure length
329
Chain Sequence
b'ALKDQLIVNLLKEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
total genus 115
structure length 329
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajnA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajnA02
1A27A 1UZMA 1ZSYA 4I5FA 4CMAA 4FDAA 2B4TO 3PRJA 3RU7A 4ESOA 3D5TA 1G0NA 3DAFA 3M1AA 4DPMA 4YAJA 2BMAA 1NTOA 2JFGA 1JU9A 1CJCA 3D4NA 2AQIA 5HS6A 5JDIA 3I9NA 4J4TA 3IMFA 4XB1A 1DBVO 2OMEA 3VZRA 1GV1A 4G65A 2SCUA 1ML3A 3NTOA 4R3WA 4BO6A 2WYVA 3ZV3A 3RROA 4DXHA 3AOEA 1DC4A 1KS9A 4TQGA 3JD1A 3NTRA 3EZYA 4GH5A 4O6VA 1CQIA 3NJ8A 1RKXA 4E12A 2ZYDA 2GZ2A 4U6SA 4JQCA 3I1JA 1NASA 2YDXA 3HG7A 2EP5A 1H2BA 1UZNA 3LC1O 1H94A 2CD9A 2W2KA 2ET6A 3M1LA 3VDRA 1KC1A 3ABIA 3RC1A 3NT2A 5FF9A 5F1PA 4XYMA 3F3SA 1P1FA 4JBHA 3K5PA 4FSHA 3C3XA 4J2OA 2FWMX 3LDHA 1GYRA 1MB4A 1O95A 3B6ZA 1VRWA 4OL9A 1TXGA 3ZWYA 2TMGA 4CM9A 1ZUD1 4WLVA 3RUAA 1ZKMA 3WQSB 5DOZA 4EZBA 5C7LO 3QWBA 4II3A 4W7HA 4D3DA 3AI2A 4M8SA 4NDNE 3A9WA 2OL4A 4J90A 5IZCC 1KVTA 5AXCA 3E8XA 1I3KA 3PHHA 2J5QA 4ZJUA 4K6CA 1E3LA 4ROSA 4YAEA 4BGEA 3TL2A 4D3FA 1GUZA 5FI3A 4NBUA 1Y81A 4W9NC 4DC0A 1N7GA 4I9NA 3WYEA 3ZU2A 5ICSA 1U3WA 1HE4A 1I3LA 2YHIB 2BI7A 3QE3A 4I5EA 1YO6A 4J16A 4HUJA 3ANLA 2YY7A 4AG3A 3AUUA 2YQ4A 4ZQFA 3DZFA 3WB9A 4FQ8A 2GN4A 4WECA 3NGLA 1GV0A 2CDCA 4IM7A 3PEFA 4CUJA 1DAOA 4NQZA 5B37A 4DREA 1T2DA 2C7VA 5HRUA 1PGNA 1NX6A 1VPDA 1X1TA 3ZW8A 2CVOA 3AM3A 3HWRA 1M67A 1O89A 1ZFNA 1HL3A 2GZ1A 1ZBQA 4N7RA 4EDFA 1VLLA 3LK7A 5T57A 4FC6A 4E13A 5H83A 1OC2A 1UUFA 4XA8A 3PJGA 4MPDA 1U7HA 2DPGA 5L9AA 3C7AA 4M87A 4P4NA 2RH8A 2GZ3A 3PK0A 2PGDA 3GHHA 4LCEA 4URFA 5G0TA 1U8FO 4E31A 4YXFA 2QRLA 1DB3A 2O3SA 4CLRB 5ENDA 5A9SA 2Y0CA 2JAPA 3JQGA 2DBVO 2EXXA 5HWSA 1ZO8A 3JV7A 2IYPA 3DHNA 1SNYA 4CM4A 2IZ1A 1VM6A 3R1IA 3H6KA 1J4AA 1L7EA 3ASVA 4FFOA 4NFSA 1VJTA 3ZHZA 1X7DA 1ZK1A 2BF7A 3KB6A 3BMQB 4RQTA 4BQRA 3D4PA 1XQ6A 1NWCA 1T4DA 4B8WA 3IC5A 2WYUA 2D8AA 1ZZEA 4E30A 1LC0A 3OIDA 3QJ5A 4BO8A 1RWBA 4XYEA 1NVMB 3E9QA 3L4BC 4YJFB 5DP2A 3GDOA 1F12A 5GZ3A 1JVSA 4GSKA 1V3VA 3K2BA 2XAAA 5JYDA 3ZHYA 4FW8A 4A7PA 2YYYA 3I23A 1PJ2A 4A03A 3UW3A 4BNNA 3Q9UA 1IUKA 1EMDA 3RBZA 2DQ4A 3M2PA 3OICA 2J8ZA 2QRJA 3STHA 1B8VA 1QV6A 5EJ2A 1JAXA 1BVRA 5IF3A 1P77A 3FNEA 4A2CA 4YPOA 2DC1A 1V35A 4UREA 2GF2A 1U5AA 1YQDA 1ZSVA 1GUFA 3D3EA 2CVQA 3GN1A 5KIAA 3PJDA 1MGOA 1UXKA 2ZJ1A 5A3VA 1H9BA 2IXAA 2AW5A 1QSGA 5CP8A 2DTXA 1ADBA 1OI7A 1YJ8A 5K0ZA 3GG2A 3OECA 4MO2A 1BW9B 1R37A 3H9QA 4J49A 4MIOA 3GC6A 4A10A 4BNGA 4Z0TA 5EIOA 4RJTA 1G1AA 2YDYA 2ZTUA 1PR9A 3MWDB 4NJMB 4K28A 1I0ZA 4Q3EA 3H9GA 5A9TA 5B12A 2PKQP 3BTOA 4G5HA 1JWBB 1HKUA 1ZK4A 1NFRA 4I9HA 3OJ0A 3FBTA 2EV9A 3QVOA 4OGWA 3K96A 4RLHA 3ULKA 1DRUA 5TJHA 5G0SA 3SVTA 2O3QA 1LC3A 3QWAA 4DQVA 1N7HA 3H5AA 4IZHA 3KYDB 2CZCA 4PZEA 3TZCA 4KDEA 3OM9A 4RVGA 1MA0A 1NPDA 1R4NA 5EN4A 4N54A 2GLXA 1LDGA 3L6OO 4FFRA 3VC7A 2YFQA 1H0KA 4Q3BA 1UXJA 4PLFA 2FR0A 1GDHA 2HK9A 1QYVA 1N2SA 3IP3A 2DU8A 3QWHA 3CMMA 5G4LA 3D7LA 4B4VA 4CQLA 4E2WA 4BO9A 1I10A 4QECA 3ZU3A 3FTPA 3O26A 4FJ1A 3G0OA 2NADA 4K26A 3ZNQA 4YJGA 1N1GA 2B4RO 1IPFA 4DRYA 4R9SA 4R41A 5BSEA 2D3TA 4YR9A 1R12A 2E6UX 1B3RA 1DFHA 4UVGA 4INAA 2HK7A 1GY8A 3OHSX 1QYXA 1EDZA 1M66A 4GBJA 8ADHA 2FRDA 1GCOA 4R54A 2BI8A 4LVCA 3EVNA 1WWKA 4B7UA 5B4TA 1ULSA 1NQTA 4NJOA 2PR2A 4BOYA 2JHGA 4XQEA 4ND1A 4NU5A 3EZLA 1E7YA 2E48A 2G0TA 1BXZA 1VKNA 2DFVA 1UZLA 3TN7A 4RVDA 4XQGA 4BKRA 1T2FA 2GDZA 4RVFA 5HA5A 2B5WA 1KEVA 1PQWA 3ZZNA 1HDRA 1A7KA 3PYMA 3B20A 4M54A 3AK4A 4XJSA 4BVAA 2WMDA 1DLJA 3HSKA 1GZ6A 5EESA 1B0AA 1HETA 1V8BA 3RCBA 4CM6A 3IP1A 5G0VA 3WLFA 4EGFA 1XG5A 4IGFA 1C1XB 4ZU3A 3JQFC 3FNGA 1B14A 3HDQA 3DTYA 4DQUA 1SAYA 5C7OO 2XPCA 1GL3A 3GGOA 3ZWNA 1UAGA 3AM5A 4YBZA 2EW2A 1HYEA 3DBVO 5CPBA 2ZTLA 4GI2A 1K3TA 3JQAA 4L4SA 1VJ0A 5EL0A 2PZMA 4J1NA 3GVHA 3RUIA 5JW6A 5TSDA 4RF5A 3VH2A 3F5SA 3FBGA 5IZCA 4NG5A 3I4CA 4YA6A 1HF3A 4UEOA 4MVJG 1YB4A 4S3MA 3GRKA 4PFJA 2BH9A 4W9NA 2C0CA 3DWFA 5DCWA 1E6WA 1Z45A 1YBVA 5DULA 2C7GA 3S55A 3A1NA 1FDUA 3AU9A 3UCEA 2QYSA 2DAPA 4GWGA 4U5QA 4UVIA 1BG6A 3AM4A 4RCVA 5L3ZA 3IIEA 1VSUA 2AEFA 1H93A 2IZ0A 1VL8A 4XYBA 4CMEC 3WMXA 2H9IA 2IZZA 3VH3A 2AHRA 1OAAA 2Y1DA 2VUSA 3G79A 4XR4A 3MJTA 3RFVA 4TSKA 3EMKA 2B83A 2O3JA 2EG9A 2Q1WA 5T67A 1TT5B 5JCJA 3RUEA 4CMIB 3G49A 5TF4A 1SCUA 2NTNA 2VZ0A 4CMJA 3EYWA 1H6BA 2ZB8A 3Q2KA 4DPLA 3BTVA 9LDBA 4FFNA 2Z1MA 4DA9A 3W6UA 4BMNA 3A28A 1DC5A 1XU9A 3L9WA 1ZMOA 1ZJZA 2CFCA 1SPXA 1D1TA 3U4HA 4ZA2A 1EQUA 1V0JA 3Q1LA 4MVJM 3ZU5A 3KM0A 3WGGA 4D3SA 2GSDA 4WNIA 4U0JA 3G1UA 3WNVA 1PJBA 4Y6RA 1P44A 3H3JA 1YXMA 4LRTB 2GGSA 5JCXA 3BTUA 3SLGA 3VH4A 1R66A 1JLLA 4GMFA 5B1YA 4BNWA 1DC6A 4MOWA 4OKIA 4WEOA 4PG5A 1MUUA 1R16A 3ZWBA 1C1DA 3UVEA 4EITA 5HM8A 1P45A 5ICMA 2GNAA 1W4ZA 3DBLA 3L4BA 4EJ6A 3HDYA 3TRIA 3KYCB 2PNFA 1XU7A 4GGOA 4IINA 1YS4A 5JBIA 4Y8VA 3CEAA 1EUDA 1I2ZA 4LN1A 3E9MA 4IJUA 2AA3A 4I8XA 4H7PA 4Z9XA 3TWOA 3INTA 5BNFA 4BO7A 4XDYA 4FFPA 1R6DA 3BHIA 1ISFA 2EP7A 3E18A 2EKLA 4OMUA 1HZJA 3V1UA 2AEMA 4HNGA 3NEPX 5IDXA 4L8VA 1MG0A 5A02A 3AI1A 1DIRA 4TKLA 1VE9A 4J7UA 9LDTA 5CEFA 3MCVA 2QZ9A 1WPQA 3JYQA 3KTDA 3DO5A 4H3VA 4OAQA 3HNPA 3CPSA 1LTHR 5FYDA 4WE3A 5KVCA 3CSDA 4MVJP 3PYLA 2WD7B 4D44A 1HXHA 1T4BA 2Y1FA 3WIEA 1CF2O 1C0IA 3KUXA 2I6TA 1LSSA 4NK4A 3TSCA 1TB4A 2DBQA 2CVZA 4M89A 2PH5A 3ICCA 5ENVA 1LEHA 4RDHA 4N5MA 4R16A 4F6CA 3DFZA 3W4IA 4GLOA 3PHJA 1RYEA 2J5KA 4K1LA 4XRGA 2VT3A 3U09A 2YHUA 1HDOA 1FF9A 4PIVA 5FWNA 2ZQYA 1VI2A 1CRWG 1LRJA 1E0DA 2PD6A 5L51A 1JA9A 2GCGA 1XELA 1P1RA 1SEVA 1LU9A 4XIYA 5DBIA 5CDGA 1ISIA 3IAHA 5GMOA 2B37A 1B8PA 1E5LA 3GNSA 1QYDA 2Q1UA 1Y1PA 2EGGA 3LT4A 1KVQA 1U4SA 4YVFA 3V2UA 1PR3A 3HUDA 2YV3A 3I9KA 5ER9A 4D7AA 3U4CA 1HYHA 4LVUA 3TZKA 1QG6A 4GVXA 5A4DA 3ZNOA 3KLPX 4DBZA 3PQFA 4BNIA 3CIFA 2Z95A 4GLLA 2B5VA 4IDGA 2BD0A 1C14A 4U7WA 5TC4A 3RKUA 3CXRA 3FI9A 4CLHA 3KV3O 4OKNA 1F14A 5AOVA 1PJCA 4QEDA 4Z3KA 1E6UA 1RJWA 5COBA 3D5QA 2DKNA 4PVCA 1E1NA 5ITWA 2W98A 1T1SA 2E82A 3IL2A 1XLTA 4R68A 1PJ4A 1HLDA 1DSSG 2JFFA 5HBRA 3JQDA 4RLSA 1E92A 5IZ4A 3PHLA 3E6AA 1YE3A 2VWHA 3GMDA 3TFOA 3ZDFA 1RM5A 4YAGA 1HT0A 1I24A 2HUNA 3KBOA 2ZATA 3DBRB 4HY3A 1SZJG 2CNBA 3MTJA 1H9AA 4KUHA 4TZTA 2C2YA 1K6XA 4B3HA 1Q0QA 2X9NA 2HMUA 3NT4A 3ZNPA 4CMCA 1CEQA 1EBFA 2W8ZA 1XSEA 5JY6A 3JQFA 2QW8A 5U9CA 4D0RA 2DT5A 4XJTA 4GSLA 1MG5A 1WDKA 4IDBA 5L95A 3OEWA 4IJVA 1XKQA 5K9ZA 2FZWA 1CQJA 1LJ8A 4B3IA 3ZWAA 1Y8QB 2V6GA 1P9LA 2POQX 3FWZA 4NIMA 1P0FA 5JO0A 4LW8A 2VRCA 3ZWPA 2VTDA 4KTTE 1XA0A 2O3TA 4EI2A 4KZPA 3T7EA 1GZ4A 2O4CA 4EW6A 2NTJA 2NVUB 1O9BA 1PJTA 3UGKA 4OXKA 1I30A 1UDBA 1G6KA 3IKVA 1LNQA 4QT0A 4JCOA 4WCFB 1IZ0A 2J6IA 3VPXA 4CMEA 1U3VA 3KSDO 4KTVE 3GVXA 4DWVA 1Y5RA 3LLVA 5H82A 3W8EA 2YHIA 1DIHA 1LXCA 3I9OA 1PSDA 4AJ4A 2FSSA 3P2YA 4N18A 1J6UA 1VKOA 2EEZA 1E7RA 5F1OA 3JYOA 3LC2O 3Q11A 2G5CA 2A35A 3GZ4A 1UR5A 4HFMA 4MKRA 1NR7A 5LDGA 1D3AA 3VPSA 2NTVA 1ONPA 4GWKA 1DFIA 1KVSA 1VC2A 4E0BA 1BVUA 2FMUA 3MOGA 5EPOA 4O5OA 2A92A 4H16A 1J49A 4NPCA 1CIVA 4FCCA 2O2SA 4FJ0A 1N5DA 2HQ1A 5A5EA 1LDYA 4YEDA 3PXXA 2NU7A 2RCYA 4DC1A 3PVZA 3ZWOA 1UXHA 3PFFA 4B79A 1ZMTA 3PLRA 4CLRA 3S2FA 3WSVA 4TWRA 1DIBA 1M6WA 4XCVA 4EYEA 3LQFA 3TZHA 4EUEA 2YUTA 1L1FA 1I5RA 4JIGA 2DUUA 4NH4A 1DAPA 4R4JA 1PZGA 4RV9A 4YWJA 3MWEB 1WMBA 2PWZA 4L4XA 3IUPA 5L4LA 3BMQA 2CMDA 1ZXLA 4AL4A 3W8DA 2R2GA 1C0KA 2Y05A 3MJVA 2PV7A 4QSMA 2X0RA 1HSOA 1WNTA 3X2EA 2G1UA 3HDHA 2FHSA 3GF4A 4OH1A 2JD2A 2R6JA 3G17A 4ID9A 4Q3CA 2I5PO 2QYTA 2DBZA 3BYZA 4UUOA 3AY3A 4YJFA 1K0UA 3I5MA 1KBZA 2HSDA 4CR8A 4P4LA 1H6AA 1FMCA 3H9EO 1PX0A 1ADFA 1YJQA 1GAEO 3FN4A 4BV8A 2VQ3A 2IE0A 4OXYA 5C7IO 3K92A 3UF0A 1BRMA 2JD1A 3QA9A 4QX6A 4BB6A 3DC2A 3M2TA 3SEFA 1SC6A 2P5YA 4IXTA 2FP4A 5JY1A 1QXSA 1Z75A 3INGA 1NPTO 1NWHA 1G0OA 3RFXA 3H4VA 1LSUA 1Y9AA 3NYWA 3RU9A 1HSZA 2B36A 2A94A 3F6YA 4GMGA 3K30A 1ZEJA 4R1TA 2FSVA 5AXBA 1RM0A 3FRJA 4E5YA 4KUGA 2I3GA 5EINA 3ETDA 2HMTA 2VCYA 4HNHA 3DTTA 4D79A 3WICA 3CMCO 5KWEA 3FNHA 3VVBA 1BW9A 3BHMA 4HX5A 2VUUA 5F21A 1A71A 2J3HA 3COSA 3DZGA 4OXNA 1TT7A 1TVEA 4JP3A 4NJMA 4RPJA 4RZHA 5BSFA 3TF5A 3DZHA 2O7QA 2UAGA 3U5TA 3RVDA 4BKPA 2VZ8A 3H2ZA 2E49A 3H3FA 4UVDA 4Y6SA 4BNTA 1LDEA 3KZVA 3JQCA 3AFNA 4CODB 1ZVMA 3U62A 5CEEA 3NDRA 3QP9A 4IPTA 1FK8A 3HN7A 3IS3A 3WR5A 1QLJA 3ITKA 5JMPA 5C37A 1L7DA 3GEMA 1EVJA 1LRKA 1Y7TA 3KYDA 4RPGA 2AXQA 5THKA 4KOAA 3OH8A 1EVIA 2Q99A 4Q9NA 1E7QA 2P91A 4IMPA 3L9XA 4J4BA 2I99A 3GEGA 3C7CB 1J5PA 2BFPA 4QO8A 3RWBA 3EAGA 2Q50A 1OMOA 4M49A 4YJDA 4RVUA 5DOVA 4F3YA 3BIOA 3NGXA 2Y68A 5TRTA 3UUWA 4AICA 3PTZA 4LSMA 1F8GA 1YDEA 5LC1A 4BNXA 1GD1O 1W73A 4DIFA 1YGYA 4MP3A 3Q6IA 5ILGA 1X7GA 2Z5LA 3AW9A 4QTZA 2D2IA 2AE2A 5JXWA 2ZTVA 3LVFO 3ONFA 3U0BA 5TJ9A 3F5QA 4UAGA 2XF8A 4LGVA 2VYND 2Q1SA 4IMRA 3E03A 1YH3A 3FWNA 5GZ1A 3OIGA 1A9YA 1X0VA 2X0NA 4IBOA 4CV2A 1YOVB 5AXAA 4BB5A 1BDMA 3KSUA 1PS9A 3GUYA 4HKTA 3G1TA 2IEDA 1EVYA 2PD4A 4HP8A 3PIDA 1ONOA 1U9JA 2NVBA 4JJFA 3QVXA 5DBGA 3WGTA 5U4QA 4PG4A 2PKQO 1AN9A 3P5SA 1MV8A 4LMPA 3LC7O 1LLCA 2AG5A 3RUDA 2RAFA 1X1EA 2V6MA 3JSAA 4LCJA 4MIEA 5JYEA 3RAJA 4CL8A 1EVZA 2BKAA 4R9RA 2Y67A 1XR3A 3JYLA 1C1XA 2VRCD 2C2XA 4GPD1 2X0IA 1UH5A 2X9GA 1Y6JA 2PK3A 2X6TA 5G0UA 1X0XA 1NP3A 3NT5A 4ALMA 3NDJA 2NQTA 4RPLA 2Y99A 1N1EA 5ILOA 1HEUA 1I32A 2D59A 3D0OA 4DBVO 4LRSB 2O2YA 3BA1A 4NNJA 2BGMA 1KY4A 1MFPA 2AE1A 1ZJYA 2IODA 1NQOA 2W2LD 5B4UA 3JYNA 2OORA 4BUCA 1K6IA 1ZK3A 3ZGYA 4YQZA 2P9CA 4FIZA 4E5NA 2G76A 4PLGA 3GRPA 2ZJ0A 1PIWA 4OQYA 4PLYA 3B1KA 4K9DA 1OFGA 4JK3A 4BO4A 1ULUA 1JWAB 3QVSA 4J6FA 4BO0A 1YDWA 4AJIA 5I8ZA 3UN1A 3GVCA 3ADPA 3GUCA 4NHEA 3ZWWA 1IL0A 4WCFC 3INRA 4IZIA 4WLUA 1ENOA 2EHDA 2HDHA 2WEKA 4OYRA 4PLCA 3ON5A 3R3JA 4JJIA 3UICA 3ROQA 1MFZA 1NPYA 2HMWA 4IS3A 5JE8A 4O1MA 3PWSA 4CL3A 1TT5A 4CMIA 4FJ2A 4HV4A 1PZHA 2ZCVA 4MKZA 3NRCA 4XD2A 3F4BA 1IHXA 3DBHB 4J43A 4BNUA 4EJMA 4HWKA 2H5LA 5F3RA 2C59A 1GYQA 4GKBA 4OQZA 1ARZA 5I9MA 3WTCA 5IAAA 2GERA 1PWXA 5KCZA 4MDHA 1T2CA 5TLSA 3ZCXA 1LX6A 4L75A 2GUGA 3ZN2A 1FDTA 2AG8A 4IQ0A 4OSPA 3I6IA 1DIAA 4YT5A 2BGLA 4MP6A 4XQCA 1BXKA 1YVEI 4Z6KA 1HYGA 3WTBA 1QR6A 4AJKA 4EBFA 1TA4A 5T64A 3WYCA 4M1QA 2EERA 4DPKA 3DQPA 3JQ9C 2DBRA 5DZSA 3O8QB 1KETA 2PZJA 3JCZA 4WLOA 2WJPA 2G82A 4BGVA 2Q2WA 3RASA 1NBOA 4DLBA 3AUAA 4J9VA 3PJFA 1T25A 3L07A 3KYCA 1PL7A 3OA2A 1I2BA 1I8TA 2PA3A 4CMBA 2HKIA 4R5HA 1FDVA 1B3BA 3OJLA 4ND3A 1P0CA 3LU1A 2AQHA 1WVGA 4RO0A 4TVOA 1PJQA 4UEKA 4I1IA 5KVQA 2ZIZA 3FD8A 5TS3A 3GK3A 4E21A 4BKUA 5A04A 4RORA 1UP4A 4CQMA 4PN3A 4ALIA 2RH4A 3KSZO 3MJ4A 3DONA 2HMVA 3RC7A 3GA0A 4A26A 3VTZA 1NNUA 3LYLA 1PL8A 4Z0PA 2JFHA 2VHXA 1EK5A 4G2NA 4AFNA 4YYZA 2OHXA 2NSDA 3SJ7A 3HFSA 3RFTA 1I2CA 4ZQGA 1KVUA 4JGBA 4ZQBA 4RGBA 1P33A 2NNLD 2PTGA 5BNTA 3TPCA 2OBNA 2WD7A 4GGPA 4C4OA 1XIVA 4E33A 1F17A 2YQ5A 3OA0A 4RL6A 2O3RA 3WS7A 2P68A 4M55A 3WSWA 5DNAA 2CUKA 2OUIA 4K6FA 1Y8RB 4KWIA 4PRLA 5MGBA 1JQBA 3QV1A 1Q7BA 3ICPA 5F5NA 5KOIA 1NVGA 1HDYA 4ZVVA 1YB1A 1PJSA 3FCOA 3UXYA 3Q2IA 3W6ZA 2P2SA 3VOSA 3DMTC 3GNQA 3ST7A 1PS8A 4L0QA 3LT2A 5F5LA 5U1PA 3V8BA 1S7CA 3IOYA 4HFJA 3V2GA 3AJRA 5CG2A 2PGLA 3HJAA 4R3NA 1PTJA 1LLUA 5DF1A 3OP4A 3DFUA 3WXBA 1PZEA 1O0SA 3NUGA 1R0SA 3GR6A 2BELA 3SBOA 4PRKA 1ENPA 3OIFA 4U6QA 3GN2A 2G17A 3BMNB 5I7FA 3VHRA 4TRNA 2FZEA 1UXIA 3S8MA 1LI4A 2EKPA 3U4IA 1SMKA 3DHYA 4DUPA 2OP1A 1DRVA 4XX0A 5JC1A 3GT0A 4AJLA 3FTNA 3HHPA 1VSVA 4ZGWA 1B2LA 1DLIA 4B4UA 2WSBA 4AJ1A 1EQ2A 1WDLA 3GLQA 1ZXBA 4M86A 2O4UX 3AY6A 4TZKA 3KOUA 3OF2A 2O48X 2I3AA 4BO1A 4IXWA 5CFZA 4PVDA 3F47A 3C1OA 2HMSA 2DTEA 1WAMA 3ORFA 4Y98A 5A3JA 3F46A 4D41A 5EQFA 1HDXA 4FGSA 4OJNA 4GKVA 5IJZA 5L40A 5KNLA 2UV8A 1BGVA 2QIOA 5BSGA 4FGWA 3MTGA 4WCDA 4B7XA 4BKQA 4CM5A 1QORA 3JQ7B 3RJ5A 1WXDA 1NHWA 4E6PA 1YL5A 4R1NA 3VKVA 3UFXA 5I9LA 1WDMA 3WG9A 2FR8A 3DBRA 4J9UE 4BNMA 1A4IA 3WLEA 4CQMB 1CYDA 4GAEA 3VKUA 2A4KA 3VPFA 1EBUA 3A4VA 4YTEA 3SX2A 3D1LA 1I3NA 4D45A 5IN4A 1M2WA 2DLDA 1Z82A 4YACA 1HE2A 2PKRA 3D3WB 3VPGA 2LDBA 1I01A 1I33A 3CTMA 1BDBA 2Q49A 4E5KA 4KP7A 5LCXA 3CZRA 1DRWA 3WGHA 5I7VA 5TT1A 1EK6A 4D42A 2NVWA 2C5EA 3BMOB 3DZIA 4XR9A 3RUHA 1Y8QA 3PQEA 2P5UA 2NLOA 3W1VA 1Z6ZA 3I3OA 4L73A 4F6LA 2C20A 3DXFA 4NBRA 4RQUA 3WGOA 4A27A 1TLTA 2WM3A 2NM0A 1PL6A 3C1TA 3L6EA 5CG1A 1E1KA 3F1LA 4UULA 2CDBA 4ZN6A 3PHGA 4MVJF 1LUAA 3MJCA 1OZAA 4RDIA 5JAQA 2C07A 3U3XA 2IRWA 7ADHA 3RSHA 3SC4A 4ALLA 2NVUA 2WE7A 1UDCA 4A5OA 3I83A 1XCBA 2V65A 1ZIDA 3EVTA 4GX1A 1NAIA 4NR0A 4DQXA 3BXXA 2I65A 3BAZA 3PHIA 1P1JA 4WCFA 3OMLA 4L9RA 3WGZA 1HE3A 3FPCA 4TROA 1EE9A 4NFYA 1AHHA 4DYVA 2GO1A 2Y1OA 3OFSA 4GX0A 4IDAA 1PEDA 4IIUA 4J7CA 3JQ8B 3KRTA 2NWQA 3RD5A 5CEJA 1HTBA 1PJ3A 3TZ6A 2NU9A 3GDFA 3W4JA 5I7EA 1JVBA 2ZB7A 4BNJA 3QVWA 4JXKA 1DFGA 4BKOA 2HLPA 4IQGA 1N9GB 1YL6A 4FC7A 1KIFA 3O38A 4DIBA 3ADOA 2XXBA 4A0SA 4FN4A 3V2HA 2Q2QA 1K6JA 2ILTA 1WZEA 2BLLA 4OIMA 2P4HX 3OBBA 1KC3A 3OETA 4X54A 1KERA 1MC5A 1DXYA 2PGJA 4IDDA 3WFIA 2NUAA 1NFFA 2VYVD 1MLDA 4GL4A 4BNHA 4CV0A 1Z7EA 1ZK0A 2GN8A 3DB2A 3R0IA 3ZV5A 4B8ZA 3L0DA 1LLQA 3HADA 4D0SA 3E9NA 2QX7A 1E3JA 1MX3A 1T1RA 3WBBA 4J1SA 5B4VA 4F46A 4ZQEA 4ALNA 3JQ9A 2VYNA 3PQDA 4J2HA 4PZDA 1QP8A 4YAKA 4JJGA 2JCXA 3AU8A 4J0FA 4HBGA 2DPHA 1ISGA 2VOJA 2BGKA 3DEYX 3PGXA 4BGIA 4CM8B 1K89A 4XRRA 3PZRA 4IDFA 3V1TC 1JW9B 4O63O 5KTKA 2R00C 4KWHA 1IOLA 2FR1A 3I52A 1N8KA 3P2OA 4E4YA 1YBMA 3JD2A 3PPIA 3V1YA 4CLOB 1F8FA 1UP6A 2V7PA 3QLJA 4WJZA 1SBYA 3GMSA 1A72A 1D1SA 3PI7A 3RIHA 4DLAA 1WW8A 4NBTA 4CQMD 4MP8A 3UKOA 4AJOA 4OM8A 1GYPA 1F0YA 4Z0HO 2ZB3A 5CDYA 2NU6A 5KKAA 3PP8A 4W6ZA 4CLDA 3VZQA 2B35A 4PLPA 1M75A 1FDSA 5TIIA 4YRDA 3CZMA 2EGHA 4BNYA 3AUSA 1P74A 3QWIA 2Q2VA 3PYXA 3NKLA 3N74A 2PLAA 1K5HA 1QYCA 1D4FA 4RZIA 3MJSA 3ZH2A 5JLAA 5IXSA 3VZPA 4MVJD 1PZFA 1MP0A 2P9EA 1E7SA 3NX4A 2AQ8A 3GZNB 4WOKA 2O3UA 1NXQA 1T26A 4PG7A 4EEZA 4ZRNA 1YQGA 4YT8A 5A5FA 2W2LA 2XOXA 3TFQA 3PFWO 5ES3A 4S1VA 1J0XO 4BNFA 4HFNA 4CR7A 3M6IA 4KMSA 1H5QA 2CSUA 1DOHA 2PH3A 2IEBA 2YZ7A 3DMTA 3W4KA 3HB5X 5A9RA 1U8XX 4RVSA 5L45A 5KKCA 3SC6A 1YONA 1HDCA 3DOOA 3MZ0A 5K6AC 3K9QO 3RC9A 1U1IA 1U3UA 3UOGA 4ZD6A 1GEEA 5CAEA 4FR5A 1E77A 4BO2A 1BWSA 5JAIA 2ZQZA 3GAZA 4ILKA 5IG2A 1HWYA 2FPGA 5JSFA 5KVSA 1X15A 4GX2A 1HE5A 3IQDB 3KYBA 3GGPA 3I9LA 4RPKA 4PLHA 1BXGB 2HRBA 2QG4A 2NV6A 1DEHA 2D1YA 2HJSA 4CUKA 3EC7A 3BZUA 1ZH8A 1E1LA 1FJHA 1GPDG 3DR3A 1JKFA 3F4LA 3AUTA 4WNCA 4YT4A 3H5NA 2CY0A 4W99A 2EW8A 1B16A 2HK8A 1XWFA 3S2IA 5T6BA 1E5QA 4GX5A 1E3WB 5ER6A 1OOEA 4IJWA 4TVBA 1CERA 3DDNA 5GY7A 1CDOA 2VWQA 3CUKA 1QRRA 3D4OA 7MDHA 4R69A 4C7KA 5JC8A 4FPXA 3K8ZA 5JS6A 4FOOA 3GPIA 4DIOA 2EKQA 2Q46A 1XDWA 3E1KA 3N7UA 5IDYA 1Q0LA 2X1HA 4TRMA 1KY5A 2J3JA 3DZJA 2O7SA 3OEYA 3R6DA 3U9LA 4CV3A 1YOVA 1OC4A 2DFDA 4KQXA 1R0LA 2DVMA 4CV1A 3ROMA 1B7GO 1W6UA 1SB8A 3DOJA 1WP4A 3JD0A 4Q3NA 2I76A 4E5PA 3CE6A 4BO5A 5DN9A 1ADGA 1LDNA 3WJAA 4EUFA 4TRJA 1AGNA 1C0LA 5KJCA 1GFSA 2UDPA 1P1HA 3K6JA 4NBVA 4XKJA 3ROKA 3EDMA 1NYTA 4CUZA 3H8VA 3CKYA 1E1MA 1A5ZA 1GEGA 1KEUA 4L4RA 1DIGA 3MEQA 5TQVA 2O23A 1Q2XA 1LBEA 1Q0HA 1ZSNA 5JFOA 4HXYA 4MJLA 1WMAA 1U5CA 4BNVA 2HU2A 3TJRA 3QSGA 5L53A 3DAPA 4WKGA 5CHEA 4PCVA 4LISA 4Q3AA 6LDHA 5J23A 2HO5A 4ZRMA 4FD3A 3ANMA 1IYZA 1YKFA 3K73O 4YJHB 1ZEMA 2VNAA 4Z3DA 5IN5A 1R4MB 2WDZA 3IKTA 4FFLA 3WNQA 3TOXA 5JNLA 1EFLA 3BMCB 3ZWMA 3DHEA 4JLWA 4RVHA 4PLTA 4YAIA 3H9UA 2XXJA 4GQAA 4O0LA 3G3EA 5TT0A 3UCXA 1P3DA 4D43A 4IS2A 1NHGA 1DHRA 3O9ZA 3I4FA 2ZKLA 1NAHA 5G4KB 1YWGO 3JQBC 2Q4EA 2JAHA 1YRLA 5H81A 1AUPA 4XYGA 1H6DA 3KEQA 3HB4X 4XYLA 3GFGA 5JDCC 4BMVA 5EQDA 3RKRA 1P1KA 2VHZA 5L7WA 1SEPA 4QUKA 4HFRA 1PGJA 1XQ1A 3OJFA 3GPDG 3HQ4O 5THQA 3EK2A 3TDKA 5C5IA 1SOVA 3Q3CA 1MXHA 4E2YA 3UAGA 1B15A 2YJZA 4DMLA 4NFHA 4YDRA 4CMHA 3AI3A 3DBHA 1DO8A 5T8KC 3FNFA 1AXEA 3PJEA 3NJ4A 5IDQA 3RUFA 4CM1A 4OO3A 2VTEA 4JROA 4JN6B 4UUMA 3FR8A 4PG6A 1UP7A 3RQSA 5HTOA 2O50A 2VHVA 4YCAA 3PIIA 4R01A 1DPGA 1GTMA 2WE8A 1HDGO 2AMFA 5FI5A 2FN7A 4IY1A 1V9LA 2CF5A 4BNZA 1SOWA 2QRKA 2GYYA 2D4AA 2Q4BA 3LLSA 2GN9A 4AVYA 5A06A 4MVJH 3OJEA 2I9PA 3LF1A 4MINA 4TMFA 4B3JA 2BRUA 2R00A 1Q7GA 3GDGA 3B1JA 1S6YA 3IDSA 1JN0A 1GPJA 2B69A 2EIHA 4BHTA 4Y9DA 3B70A 1ENYA 1LSOA 3O8QA 3O4RA 4J91A 1AE1A 2UUOA 2RHCA 2B0JA 4XB2A 2V6FA 2ZTMA 1YBAA 2BHLA 2W2KB 3C85A 1D7OA 3GNTA 4Z9YA 2UUPA 1M6HA 3P19A 3Q0EA 5COQA 2A9FA 4DLLA 4N5NA 2GPTA 1O8CA 2JCVA 4UUNA 3ZV4A 5TGDA 3PWKA 2JKVA 4PG8A 3LSYA 4J1TA 3TZQA 3UCFA 4UUPA 2X7HA 1GQQA 2X86A 4XGKA 2I67A 2X9VA 4FOSA 4PGFA 4ZICA 5IXYA 1C0PA 3DZKA 1T2AA 4Q39A 4J3FA 3LF2A 4ALKA 1DHTA 3VAZA 4YRAA 2V6BA 1GU7A 4DYDA 2J5RA 5TX7A 3KHUA 3GG9A 4E32A 4FB5A 4R51A 3V5NA 3TL3A 5AXDA 3RI3A 3C1AA 4IIVA 3UHAA 4NK5A 1U4OA 1LDBA 2X22A 4U0KA 4BNLA 1GR0A 1NVTA 3Q9NA 4CLXA 1ID1A 2FPIA 2VNSA 1PGOA 1Y8RA 3HN2A 3WFJA 1E3IA 3JYPA 1ZCJA 1IULA 2OO5A 3GHYA 4PZCA 2YV1A 5BQFA 5K6AA 1A7AA 4WK6A 3AFMA 2C54A 1ZK2A 3VVCA 1NQ5A 3MOIA 3UH1A 5DBFA 2DM6A 1GUYA 1E7MA 3E48A 1PWZA 3OSUA 4NZ9A 4XWYA 2P9GA 1I3MA 4LSWA 4KUEA 1Z74A 1CWUA 3VZSA 5JAZA 1H6CA 4IUYA 5MDHA 3E5MA 3RBVA 4LK3A 4B4WA 4I5DA 5I9NA 3CINA 3ZWCA 1NQAO 1DJQA 1E6EA 3ETGA 3IJPA 3X2FA 4CMGA 3BMNA 4TKMA 3KETA 2GASA 4CMKA 5A9SB 1U2DA 2WWRA 3P7MA 3ZHBA 1CETA 1ISJA 3C24A 3JQGB 4Y67A 3ETEA 3WIDA 3A06A 5A03A 3FSRA 4JBIA 2FOIA 2EWMA 4WOJA 1KVRA 4AJEA 5BSHA 1EFKA 1E3SA 1A4UA 4J0EA 4R5MA 4CM4B 2VWGA 2NACA 3NDIA 1GZ3A 2WTBA 1F06A 4NBWA 5KVVA 1EE2A 2BFAA 3H65A 2VYVA 3LT0A 4QFDA 1XEAA 1SB9A 2I66A 2ZCUA 3QVTA 1DC3A 3JQ6A 1IE3A 3JTMA 4XDZA 1R0KA 5A1TA 2Q3EA 3SJUA 2Y0DA 1EDOA 4IQ8A 5CDSA 3EUWA 5F1KA 4XZ3A 5DCYA 2C5AA 3KLMX 3QY9A 5FEUA 1PGPA 4RF3A 2W90A 5ITVA 1D8AA 1JAYA 3VH1A 3JQ7A 4FBGA 4HADA 2VOEA 1T2EA 3GH3A 4IGEA 4ZQHA 3U4DA 3I9JA 4H15A 5CDTA 2BFOA 1N92A 4WASA 3U49A 4G81A 3ONDA 4WGGA 4FS3A 2JCYA 4UVHA 3AY7A 5KJ6A 3TNLA 3WWZA 4OHUA 4CLEA 2JL1A 1MC4A 3LZ6A 2QZZA 3D3WA 1V3UA 4KDFA 4BL5A 2ZK7A 3D64A 4CM9D 3OQ1A 3JD4A 3T4XA 2PZKA 4WEQA 3O03A 3TQHA 4BGUA 1VJ1A 2UVDA 3BMOA 2EJWA 5JMWA 2EJVA 4MVJA 1U7TA 2NQ8A 2YW9A 4PLWA 2HJRA 5BT9A 4AJNA 1ZW1A 2X8LA 4UEJA 3RBXA 3GVPA 4AJPA 2JD0A 3TOZA 1O94A 3F1KA 1OBFO 1YQXA 2Y0EA 4BIIA 5BNIA 5I8WA 3WBFA 2EF1A 3GAFA 4OOEA 2H6EA 4BV9A 4UVEA 1K2WA 3GVIA 4XQ9A 1LQTA 3DMYA 3EW7A 2TMDA 1Z73A 1BHSA 3JQBA 1ISHA 1Y5MA 2PY6A 3RC2A 1V6AA 2GR9A 4P8RA 2Y93A 4BMSA 4IDEA 1DJNA 1EUZA 1R4NB 4BQPA 1LA2A 1PJLA 3WQQA 5JDCA 1IZ9A 3WGQA 2Y1EA 1X13A 1U2GA 3MJEA 2B4QA 1YL7A 4W4TA 2HAEA 3NV9A 3JQ8A 1U3TA 2WD8A 4YB8A 4CQLB 4PLVA 1O6ZA 3ZI0A 4EUHA 2RHRA 3ZHXA 1RPNA 2X5OA 4YJGB 1KYQA 2BFMA 4MIYA 2J3IA 5T8KA 3WGYA 1N9GA 2HRZA 4P4GA 1QKIA 1XGKA 2AQKA 4P22A 5KJEA 4BO3A 3SLKA 5EMHA 1W8DA 3ONEA 5CPFA 2F00A 3ANNA 3FPLA 1VL6A 4JP2A 5G0WA 3LT1A 5AVOA 4J4HA 2JHFA 4C7JA 1UAYA 3N58A 2X5JO 3GQVA 3WOHA 2H1SA 2W4QA 2YFHA 4OOFA 1P31A 4QFCA 3W8FA 1ORRA 5I7SA 5JDIC 5JPIA 4CR6A 3PDJA 4B7CA 5DT9A 1BMDA 3QRWA 3GGGA 3ITDA 3PWZA 3ZNNA 1U28A 1RM4A 2X5KO 2C82A 2ZYAA 3AOEC 2DTDA 4EJ0A 5IDWA 1LSJA 5GZ6A 1ISMA 4CM8A 1LDMA 1HZZA 1RM3A 2HCTA 2FY8A 2ZYGA 1KOLA 5IFLA 4E2XA 2VRBA 3S2EA 3DZBA 4E2ZA 4YRBA 1PU2A 4XEHA 2CF6A 3QIVA 4ITUA 3VTFA 4I9UA 2X58A 4CLOA 1ADCA 3EHEA 4MKXA 3H5RA 3JQAB 3FHLA 4W7IA 4I08A 1PQUA 2OZPA 1NM5A 5AQ1A 2JJYA 4ONEA 2RBEA 3KO8A 1M76A 3PZBA 3NTQA 2VWPA 1AXGA 1SO8A 4FFMA 4EEXA 4NI5A 2VT2A 3ENKA 3JD3A 4F45A 1TEHA 1EZ4A 2VHWA 4YQYA 2IXBA 4L74A 4R1SA 3WQRA 3B1FA 4XGIA 2D5AA 1B26A 1I36A 4I5GA 3K31A 4QO7A 5CDUA 3ZV6A 1JDJA 1LRLA 3GZNA 3DL2A 4GVLA 3ASUA 3OQ6A 4J7XA 1Q1NA 1FDWA 1GCUA 3T7CA 5LDHA 3ENNA 4WLFA 1WLYA 1QMGA 3H9JA 3PLNA 4PLZA 3QWFA 3C8MA 1LLDA 1H2HA 3HDJA 5DP1A 4R1UA 3DAGA 2RIRA 3AOGA 4QXMA 5ADHA 3S1LA 2PFGA 4OSOA 4E5MA 5L7TA 1XYGA 2IDZA 4AJJA 2VHYA 1V3TA 4NMHA 3E82A 3SXPA 1Q7CA 3FR7A 4JBGA 1JKIA 1B8UA 4L76A 3WMWA 3A14A 3VDQA 3GOHA 1GQ2A 1HLPA 3NAQA 1RYDA 3F9IA 3RUCA 3I9MA 1ZNQO 1IY8A 1IB6A 4B4OA 2F1KA 1JTVA 4WUVA 1BXGA 4Q3DA 4DVJA 1NR1A 4AJHA 3OJOA 1EEHA 2PZLA 3H7AA 4AJ2A 1QLHA 3QQPA 3BHJA 3K2EA 1BSVA 4O59O 3WYBA 2CDAA 4D46A 3HZZA 3ZW9A 1UJMA 3PGJA 3HFGA 5AYVA 3WX0A 1E3WA 2QHXA 1C1DB 5DCUA 2Y1GA 1E3EA 1X14A 1JKJA 3AWDA 3DBLB 3GEDA 4N5LA 5A05A 3ZWVA 4CPDA 2C29D 2OBYA 4TRRA 2FPPA 4CJXA 3OQBA 1YB5A 5COAA 2GRAA 2OFPA 4A73A 5C3MA 5G2OA 1NFQA 1E7WA 1HRDA 2J3KA 3BTSA 5KJ1A 4IJKA 5EERA 2LDXA 1W0CA 4WLNA 4DGSA 1BTOA 1FXSA 4ND5A 4IDCA 2GN6A 3L6DA 1IHYA 1KEPA 1XHLA 2Y1CA 4RF2A 3QHAA 4DTIA 1EUCA 5JO9A 4W82A 1TI7A 3ZWXA 4JNKA 4Y6PA 5KJFA 4MVJI 5BR7A 3R3SA 4Z9FA 2AEJA 3L77A 5T5QA 2WYWA 2Q1TA 4ZHSA 2NU8A 2H63A 4NU6A 3JQAD 5L7YA 4CM3A 4KQWA 4P38A 2E4AA 1A9ZA 4WLEA 3GY0A 4YT2A 1GADO 3WWYA 1Y9EA 4CM7A 1UXGA 1C3VA 1O5IA 3EY4A 2VN8A 1KEWA 3VPHA 3E5RA 3FF4A 3QW2A 4DL9A 3WGIA 4LMRA 4ND4A 1DDOA 1MXFA 1QV7A 2X4GA 4MVJE 2D0IA 3L4SO 3WJ7A 3C7DB 2P4QA 2GD1O 2OP0A 3KVOA 1HDZA 4WPGA 3H2SA 3IJRA 1QYWA 2VUTA 4YJHA 3KEOA 4J1QA 2X23A 5HS4A 5TNXA 2D5CA 1R4MA 6ADHA 3JQEA 3RJ9A 3WDSA 4ND2A 4U8GA 2OXIA 1GQYA 2Z1NA 2Y66A 3BMCA 5FFFA 3DOCA 3PDUA 1IPEA 3IUSA 4RPHA 1R15A 3GFBA 2YV2A 2E37A 5L4SA 4DMMA 3KXDA 3S2GA 1ENZA 2PD3A 2X0JA 5DDIP 1P1IA 4XIJA 1X7HA 5JCJD 3I6QA 4XGNA 4QQRA 4JX8A 2UYYA 5G4KA 3EGOA 2OOSA 1UDAA 2OGUA 1PS0A 1ONNA 1Z7BA 4II2A 2DUWA 4ALJA 2ZB4A 3CH6A 4E3ZA 1PQPA 1PGQA 1WZIA 3ROPA 1AHIA 5JAMA 3T4EA 2Q45A 5L4NA 2QQ5A 4BS9A 3ZU4A 2VZ9A 8LDHA 2IYOA 4BNKA 1VL0A 4RF4A 1T24A 3HE3A 1LQUA
chains in the Genus database with same CATH superfamily
1UZMA 3OD1A 4EHAA 4LSGA 4CDMA 2B4TO 3L7NA 5EXTA 1USIA 4ABTA 4QG3A 1G0NA 4RTNA 3A3YA 4M6WA 1R0ZA 5LM3A 1US8A 4LUCA 4R71A 3PNLA 1HQDA 1IJEA 4ZV7A 5JDIA 2Z04A 2O8CA 2ZRJA 1JEDA 4Z86A 2W22A 4M1SA 2QLFA 4WOBA 4PFSA 2IHTA 3CHYA 3PICA 4EA9A 2F48A 2FRDC 2JRCA 4UQOA 3FVQA 5HIJA 1Q3HA 2Q5CA 4JJEA 1ML3A 1RU3A 1UBMS 3NTOA 4KXFB 1RYNA 1I7DA 1Y3CE 2PAFA 4I8DA 3RROA 3VR4D 5IFKA 3VR5H 3L8ZA 2IGTA 2XDAA 3K1TA 5CW1A 3J81k 1HV8A 2HNAA 5JAPA 1P4HA 1G8GA 3C6ZA 9GPBA 5BMOA 1QO0A 4E12A 1U7WA 2GZ2A 4U6SA 3QVVA 5IWAB 4P86A 1N6LA 4B47A 4KB5A 3ZE7A 5JZSA 4JQCA 2XH8A 4KIJA 2J0QA 1N2BA 1OWLA 1CUYA 4N3BA 1ABEA 2EP5A 2JVIA 3K0HA 1UZNA 3D02A 2R1UA 3OQIB 1H94A 4QOEA 3ZY5A 1N2JA 2PKWA 1E6KA 2ET6A 2WYIA 1RADA 2WV9A 3A9UA 1N5OX 2PO5A 4GRDA 3VDRA 1VYVA 1FJXA 5FF9A 1TAQA 5F1PA 3F3SA 1P1FA 1RBMA 1WG8A 3K5PA 2ZUBA 1JG6A 1B76A 1N5LA 3HACA 3N87A 2FUEA 5AK4A 1T6YA 2FWMX 5CBPB 3TSOA 1X8KA 2QV0A 2HL6A 1SK9A 3QNUA 1O95A 3B6ZA 3NEAA 4OL9A 1TXGA 3HKBB 4OHPA 3IP9A 1VG9B 3E70C 3GPLA 1Y89A 3BFXA 2VBGA 4F1JA 3JRNA 2P6UA 3GIDA 3C16C 4EZBA 1G55A 2WUVA 3I37X 5FLEX 1HOTA 5C7LO 5K4HA 1P7VA 1V95A 2OG2A 4L7QA 4D3DA 3IP6A 3AI2A 4NDNE 3CVJA 4YGXB 5AXCA 1L7RA 5JSUA 3UG7A 1I3KA 2BISA 2QB5A 2FI1A 4X8LA 1L6IA 4IOKA 3IAXA 4YAEA 3ET4A 4BGEA 1DBWA 3X0DA 2WQZA 1GUZA 2B99A 3AZPA 4QTTB 5HF8A 5EVCA 1FNMA 4DT1A 4C03A 3BWEA 1THGA 2J6HA 5ICSA 1DKUA 2DWOA 1T34A 4KPGA 1WKBA 2BI7A 4QOFA 1YO6A 1Y1SA 2QXYA 4M88A 5DBOA 2WB4A 4AG3A 2V0GA 4ZQFA 4FQ8A 2WA1A 2HZ7A 3L8GA 4WECA 1ZD1A 1NIPA 4Q12A 4ZQIA 3A4LA 2CDCA 5E7MA 3PEFA 5LKAA 4JYZA 121PA 3UAYA 1T2DA 1P81A 2C7VA 4DG9A 4OAOA 4DREA 1TLFA 1NX6A 3L5OA 4LJ9A 3DOUA 3QEOA 4E5DA 1E2GA 3ADCA 3NVMB 2CVOA 3HWRA 4F4FA 2ZRGA 2BTOA 5GGXA 1JWLA 1M67A 1V8ZA 1XZPA 2GZ1A 3QNWA 3VU3A 3EZXA 4ES6A 5DN6D 5AM2A 1KI6A 1YSCA 1VLLA 3P0FA 4B6QA 5T57A 4FC6A 1HX7A 4CFSA 1NYLA 3PJGA 2O8VA 3LHKA 4BB0A 2ZWOA 3LD9A 4P4NA 3KKZA 3IBFA 4G07A 1NQVA 3OM8A 4S12A 3PK0A 4LCEA 2NU7B 4URFA 2VFAA 4Y3UA 2EJUA 4UM9D 2A67A 1N25A 4WA8A 2ZBDA 5HKKD 2MSCB 2O3SA 2O54A 5A9SA 1EP2B 5KC9A 2P69A 4ZKDA 3C39A 4Z4FA 2VP9A 5JZBA 5HWSA 3AZOA 1CQXA 5AHWA 3QFSA 4IMIB 4ARZB 5EXDA 1VM6A 3EIEA 3KR1A 4GQBA 3B1ZA 4FFOA 3G2KA 4ENVA 2GK4A 1VJTA 3KB6A 1C4KA 2OGTA 3DVLA 4UE6A 2X0DA 4JWKA 5SYNA 1Q12A 1XQ6A 2XIJA 3E61A 1T4DA 3L8CA 1A2QA 2REXB 4LXYA 1IZ7A 1H2AS 1I4OA 3KUKA 3EQ7A 2D8AA 3FI0A 1ZZEA 4MHOA 4E30A 4BO8A 1SVMA 1YC5A 4MDYA 4G5QA 5GJBA 1PR2A 1IH8A 1U9YA 1RWBA 2VLIA 2RD2A 4BWFB 1B6GA 1ZAKA 3E9QA 3L4BC 1W4CA 4Y9UA 2Q5JA 1POWA 5KQRA 5GZ3A 2OYSA 1QANA 3LY8A 4Q6BA 1V3VA 1QP0A 3STTA 4PXSA 4M38A 3CVVA 2BE7A 1ZZGA 2GTPA 1ZUNA 4AG5A 1Y1QA 1PJ2A 1C9JA 4LXHA 4DA7A 3PEEA 4H1HA 2GKGA 1CLEA 5CD9A 2IC5A 2DQ4A 4M9CA 2J8ZA 2ZUDA 1XTUA 1I2MA 1ICEA 5IVHA 3KVYA 4ZU1X 3R77A 2DC1A 3EA4A 4UREA 3PI6A 3KDSE 5ITZA 1A96A 1GUFA 5CR9A 3F8WA 2BFNA 3GN1A 3GD7A 2XT0A 1Z29A 2F64A 1MGOA 3KL2A 3KE9A 2O2EA 3PJDA 4FKMA 3SC2B 4MV1A 3KJZA 4QEZA 1ZCBA 2IXAA 2AW5A 3B3JA 3QLVC 4U2GA 5TY0A 2WWYA 1I9GA 5J9FA 4TV8B 1YJ8A 1ID8A 4RHCA 3PKJA 1AC5A 3GG2A 1GKLA 3OECA 1KH2A 5DV9A 2QJFA 3T3NA 3KS9A 4J49A 1R37A 1ZHOA 3FTCA 3GC6A 4A10A 4BNGA 4YRTA 1E2LA 1GG8A 4E03A 3AF0A 4H4CA 1PDWA 4S04A 1RLOA 2CLSA 2GKOA 5B55A 1RKBA 2BTQA 3KAPA 3KB2A 3SNHA 3BTOA 3WYGA 2KE5A 1SVWA 4M36A 1AX9A 1ZK4A 3RT1A 1NFRA 5LQRA 3TLZA 1CSEE 1RZUA 4RLHA 5A4JA 4KACA 1ORHA 2VP6A 2YX1A 1MORA 3A9RA 4LVOA 4Q4HA 5TJHA 4WADA 3WHLA 4G0QA 3ZQKA 3KXIA 1H65A 3TVYA 1QOPB 4M0MA 3B2EA 1LC3A 3KE8A 1M73E 4QUGA 2FSIA 4OA5A 4MSUA 4NC9A 2BONA 3KYDB 1Q74A 2CZCA 5D1HA 2Z6QA 1JV2B 5CXSA 1SUDA 2VJYA 1CE8A 1JQJC 1SUEA 1MA0A 2FEMA 1NPDA 4JVLA 1R4NA 1WUJS 4RVGA 3QPDA 2AF4C 4LZWA 3DLAA 2JGFA 1NXSA 5BSVA 2BBWA 5EZYA 4BYGA 2FFAA 4KXMA 4PLFA 1VIAA 3F9CA 2VRWA 5FPTA 4RQAA 5JU6A 2ZWMA 3AB7A 3CMMA 4MS1B 4R98A 5G4LA 4RULA 1DBPA 5K3OA 4EFLA 4ZXFA 4MRRA 1E5XA 4WRRA 1J0DA 2X0KA 3GT7A 2ZSDA 3DAHA 4L0MA 3ZU3A 4Z51A 3HXOA 4YJGA 3OE5A 1N1GA 3DL0A 4KXWA 4BBZA 4D9BA 4DRYA 3RC8A 3U7EB 2JIOA 1YRWA 2ZREA 4GE3A 5EMLA 4Z4QA 2WPNA 1R12A 3A26A 3CJQA 2LD4A 5E9WA 3T7RA 3OHSX 2FG6C 1GCAA 1QYXA 3JVUA 4RFSA 8ADHA 1J56A 3W8RA 4TL7A 1FLVA 2B7BA 3BIWA 4LVCA 1JKMA 1U8TA 4B7UA 3II6X 4RMHA 1NQTA 4NJOA 5FKJA 2E9SA 3ZVLA 4CDNA 5TR9A 3E3AA 2ZU6A 2JFYA 1CX9B 5E1BA 4BDTA 1JEEA 3EZLA 3PPYA 5BV7A 3GB9A 1I7PA 3OOSA 1C3LA 5EC8A 2E48A 5IP5A 2J45A 4F5EA 5F9FA 2VXBA 3VNUA 5AICA 2DFVA 5K0BA 2CXRA 4RVDA 2INGX 4XQGA 4RVFA 5HA5A 2AJ8A 2B5WA 1KEVA 4WDQA 1PT9A 4PYMA 3U7IA 1XJ5A 3AK4A 2PQ2A 3TNDA 5TPWA 2GK6A 3KKEA 1TM1E 4F4UA 2V98A 3RCBA 4P08A 4OX9Y 4CM6A 3HXTA 3CRZA 4NATA 4JHLA 1A2BA 4NEQA 3WLFA 2YBDA 4F4IA 1Y37A 4QVIA 3H19A 4BRZA 2V7BA 2B20A 1J8YF 2ALJA 2C4UA 2H08A 2O2HA 2BMFA 2Z3VA 3HDQA 3OCCA 4JYPA 3SKXA 2XPCA 4P83A 3TNYA 2OD9A 4DQUA 3ZWNA 2ZIUB 4HLUA 4Q66C 3VPBA 5BWNA 1VDZA 2VBFA 3VPCA 5ESRA 1HYEA 3ESZA 2ZTLA 2Q5IA 3DVAA 4GI2A 1K3TA 3JQAA 4F1KA 5FBQB 4DARA 4BY9E 1PK7A 2C7BA 1SHZA 3GVHA 1B23P 5FLKA 4IAOA 4RF5A 1TO2E 5E9QA 3R9KA 2SHKA 5TQJA 3LXXA 5IZCA 3EG9A 4YA6A 3OTQA 5JVDF 5D7BA 5KQGA 2VT6A 4ANFA 3DEZA 1C1HA 1N5IA 2QM3A 3L6CA 4CG0A 3VO9A 4UC0A 3GRKA 3KKQA 1RVV1 2BH9A 3L7BA 3IHKA 1JIQA 5GJWC 4MUBA 1OVGA 2C0CA 3DWFA 4ZI5A 5FJIA 1NI4B 5JEEA 1RHRA 1X80A 5KWIA 3UMYA 1TLLA 3ELYA 4MLCA 3S55A 1Z13A 2J7PD 1UK9A 1X7XB 1ZI9A 2C0QA 3ESCA 4GWGA 1JE0A 4U5QA 3RGGA 1W5EA 1DUSA 2LCFA 1LW7A 5CJJA 1YDFA 1Z15A 2BVNA 2IZ0A 3KDPA 2D5LA 1U98A 3TLBA 4C30A 1EZZA 3DMGA 4YCJA 2H9IA 3SPXA 1KJNA 4FZ3A 4ECEA 1UMKA 3FE2A 4N8DA 4WFKA 4XR4A 3IH5A 1N9KA 3MJTA 2ZSEA 3ZG6A 2I9KA 3EMKA 1XU4A 1T8RA 4MMYB 4C0BA 1YASA 4EMSA 5T67A 1LKZA 3GFFA 1ZC4A 1X1CA 2NO7A 5DHTA 1VMAA 5TF4A 4RETA 2VTBB 3UMCA 4MR8A 3WNZA 5I3CA 1Q50A 1EM8B 3EYWA 3TMYA 2WAYA 2QJRA 3Q2KA 4EY8A 3Q8MA 1E0AA 1J25A 3DE1X 1IN7A 1R0CA 3BL5A 4P54A 5DM1A 4PIMA 2XBUA 5SICE 2VH2A 4WESA 4F9FA 3TGLA 3V9PA 2VNHA 2W43A 4ZXPA 3A28A 1DC5A 2XMPA 4JOSA 3CVWA 1V2HE 3L9WA 5FTLA 1MO2A 2OZLB 3Q87B 3DVRX 4MVJM 4RPCA 4DR2B 3QFHA 4DWJA 4GZ3A 1L1EA 4JOQA 2GSDA 4YMLA 2WG1A 3WLKX 1KRXA 1ZN9A 1L5KA 4PR0A 3DOHA 2XIQA 3HC7A 3NOVA 5K4AA 3L40A 3PGVA 3VNRA 1P44A 1O5TA 3H3JA 4EKDA 1H2EA 3VNAA 3ZCVA 4F21A 2XA2A 4EDHA 3VH4A 1JF8A 1QIJA 3KJIA 1LFAA 4GMFA 3C6QA 5B1YA 2FLVA 1DC6A 1FBNA 1PG2A 4H7KA 3CUYA 4X7PA 4ZRDA 4PG5A 1QH9A 1R16A 3ERCA 1T36A 3ZWBA 1P45A 4GPAA 3ZDZB 3ZCQA 4EAQA 3A6PC 2P3OA 1MJ5A 2FEXA 1LJUA 2R8XA 4IHKA 1R4AA 4HUQA 3TRIA 3OZIA 3HJFA 4Z8XA 4QXAA 1JKXA 4PF1A 1QHSA 3VYVA 1YS4A 5C51B 3R5TA 4KLAA 1EUDA 1M34A 1ML4A 1GL6A 4IFIA 1U63A 1I2ZA 1L5WA 1GGJA 1RSZA 2XMQA 1SVKA 4L5YA 4F8YA 3WKBA 4E4RA 1WB9A 1YRHA 1A9PA 3K53A 4I8XA 4H7PA 4UCXA 2BBOA 4LHYA 4JI0B 4UVGA 1SPBS 4M0DA 1NQUA 3W9BA 2WBLC 3LM8A 5BNFA 2QE7D 4KHPB 4I1OA 2IUUA 2LR0A 1ISFA 2EP7A 2XTZA 2EKLA 3PNYA 1OIVA 2H2DA 4P1ZA 4TS3A 5KQLA 3ZHOA 1HZJA 2AEMA 2ZZKA 2AKYA 2H4WA 3B8EA 3HYNA 3KOMA 1MG0A 4F5WA 3AI1A 4TKLA 2ST1A 3BFPA 3FYTA 4MKIA 5DSZA 4LE1A 5H68A 4J7UA 1Z2CA 1Q5PA 3MCVA 2QUJA 3JYQA 3KTDA 4DIKA 2PRKA 2HF9A 2O5EA 3AG6A 1W5AA 4NV3A 2ZZNA 5GIPE 4PYOA 1Z2DA 2WD7B 5ALPA 2Y1FA 3JALA 2BMVA 3JARA 4FUQA 3EBPA 3V4VB 1ZUIA 5B2ZA 4X65B 3UK2A 3D6VA 3F96A 1E9CA 1L5RA 1TB4A 1UBLS 2HF8A 2ZIFA 3H11A 4LZAA 3E4CA 2OR3A 3ICCA 4O25A 1FNBA 4LNAA 4RDHA 3V3KA 1YR7A 1VMDA 3GQBB 4ZOEA 2QRVA 4KGXA 4LGCA 3HXMA 3G2QA 3EQ2A 3PHJA 1P9NA 1R6TA 2P11A 5DB4A 3QUQA 1WETA 3RF6A 4C7OB 4DA6A 5AW0A 2YHUA 4Y7DA 1OXMA 4TKZA 4Z4GA 4ZZ1A 2IPLA 2ZQYA 2RFLA 3PC7A 2W6QA 1CRWG 4XFJA 1E0DA 3AVUA 2PD6A 4UU1A 4YUXA 5SYMA 3T9BA 4E11A 1XELA 5CA1B 1SEVA 2DWPA 3TO5A 4XIYA 1G8MA 4I4TB 3LPDA 1OE0A 4FHGA 2BWJA 4K9LA 3IAHA 5CFRA 1B8PA 2Q1UA 1WPGA 2HSZA 1CY4A 1UBHS 3JATB 2DWCA 3QMMA 1L5HA 4HAXA 1O58A 3NG1A 5CFLA 1V26A 4RFVA 3CBGA 5J2UA 4NMMA 1IWOA 1FTSA 3UWSA 3HB1A 4OLBA 2E4YA 3QU4A 3WRXA 2FRVA 2BCJQ 3O1JC 4IDPA 3VVLA 2OV4A 4F2DA 4Z3OA 2FUNB 3HUDA 5EQJB 4BATA 4TQAA 3IBGA 1HYHA 2Q1XA 5JRJA 3RG2A 1UBNA 4F8JA 4KE7A 4L8FA 3CX4A 2F1HA 2J9ZB 4RY2A 6YASA 4GVXA 3CVYA 1QK3A 1DCTA 3C70A 4DLXA 4ARCA 1Q6YA 2Q0SA 4Y9RA 4ZVKA 3WNDA 1YC2A 4BNIA 2K2QB 2AFVA 1JG3A 1R10A 1D4OA 1V8DA 4U7WA 1C14A 1RW4A 4WCVA 1BWQA 1GPNA 1GXSB 3CXRA 3RREA 4CLHA 2OAP1 2QQEA 3EAQA 5ALSA 2O59A 4FOPA 5EXXA 1ELOA 2QTNA 4Z3KA 4NHOA 1CD5A 1J39A 1RJWA 5COBA 4YHBA 5I9BA 3D5QA 1IBMB 1MB0A 2DKNA 4PVCA 5H3HA 1SQ0A 1RXSA 1K4MA 1W44A 2Z6VA 3DGEC 4RMJA 5P21A 3WAKA 1XLTA 2NAPA 4QD3A 1PJ4A 4BQFA 1DSSG 3OZFA 4V0LA 2I78A 2AOWA 4KV9A 4EOGA 1PJZA 1M2NA 4C88A 4CDRA 3KT0A 3PHLA 1KYZA 2IZ6A 4LC1A 1RM5A 2FMIA 2JGLA 2GS9A 3ITEA 3WAJA 2PUVA 3D6UA 3KBOA 3VOAA 3FPEA 3UJ7A 2HIHA 4GC9A 5BPHA 1X1SA 2ILVA 2C1XA 2WHRA 1K6XA 4EPYA 2F8MA 3M5WA 3ORYA 1E1QD 3NT4A 3ZNPA 1OLUB 4DSAA 3NNDA 5IARA 4DY4A 2EZ4A 1EBFA 2IWRA 2W8ZA 3MS2A 5U9CA 2F7SA 2V9ZA 3EODA 4XJTA 4GSLA 1KBOA 2PG3A 2D2EA 2A1IA 3QUAA 4FFVA 4H4EA 5LP6C 1KZHA 5L95A 3OQIA 1J23A 2A57A 2QP3A 1M1YB 1Z2EA 4Q7EA 4QBGB 2BMEA 3D8BA 1BVHA 1OZGA 1GG9A 2PSJA 1L4UA 3PD0A 3BE5A 5HCIA 3FHOA 3KKPA 1HMYA 4PFKA 4PX5A 3I9V6 1P0FA 4GSYA 4EG7A 4INZA 5KINB 5CBPA 4MHSA 2VRCA 1GPWB 5GM2A 4G4SO 3ZWPA 3DV2A 3HKBA 1TTHA 3BKWA 5KHLB 2GBPA 2XA9A 3E9YA 1Y6RA 3IE1A 2NO5A 3MBOA 1O9BA 1W4RA 3RDPA 2ZYTX 1I2DA 4I6JA 1X39A 2B1GA 3WWEA 4LQLA 3UFBA 1U99A 4HX9A 2WNHA 4E5VA 1QUFA 4UM8B 3GRRA 4D98A 2OORC 2GOYA 3DBIA 2CNWD 3Q85A 3IEIA 3SYMA 10MHA 4QT0A 3CUEF 1XMQB 5IAJA 4GGMX 3KSDO 3N8DA 4JBWA 4YQFA 1CIJA 3TSAA 5TEWA 3TCXB 1PK8A 1JB1A 2FSSA 2W6NA 1K7EB 2XD4A 3A0UA 1A82A 1F8UA 2Z43A 3P2YA 4GPBA 4ER0A 1E2IA 1QRDA 1T5BA 2HGZA 1V39A 1NGSA 1GUAA 1IM5A 3FZQA 4RSMA 5CM9C 5KMGB 1JAZA 2ZM5A 1F2TB 1ICIA 1VKOA 4RKWA 3VAYA 1UT8A 1QGYA 3CH7A 4DR3B 2A35A 3M0EA 2WZCA 1I6KA 2DHRA 3SF0A 2AZDA 4CT5A 1HNNA 1NR7A 1M2VB 3M4NA 3FUCA 4HLNA 4URHA 2QZPA 5CNMA 3W05A 1SVLA 1D5CA 1DFIA 1VC2A 2QTMA 3R3VA 4GPZA 5A4FS 1LBQA 3R23A 1FRZA 4FYJA 1KH1A 4B1FA 1MMFB 4NPCA 1CIVA 3D4BA 3BRQA 3ZKWB 2FZVA 1EJ2A 3DMRA 4J0GA 2PS3A 4NWIA 4HCJA 2EBHX 4RZQA 2NU7A 2OCYC 1Z0IA 2RCYA 4B6RA 3PVZA 4WXRA 3ZWOA 1UXHA 1FP2A 2XUFA 1I7SB 3OHMA 3WSVA 4TWRA 1YMVA 2C9OA 3RS2A 4OMFG 1P9RA 3LQFA 2OCIA 3VR3D 2PMKA 2RAUA 4JA0A 1ILWA 4MUAA 1R8JA 4JIGA 1P61B 3MGCA 4NH4A 3EN0A 4ARZA 3QHPA 1DBQA 3LX4A 4RV9A 4ZAXA 1SU8A 3PQ8A 4JLJA 4YWJA 1QU2A 3MWEB 3DDHA 5BSMA 5L4LA 4WIAA 1K3UB 3COJA 4YCCA 4AY2A 2A33A 1ZXLA 1UKAA 3FPAA 1EVEA 4AL4A 5KWVA 4BLRA 3WLTA 2A5YB 2GVDC 3A6FA 2GF0A 4MUKA 2DR2A 3CW2A 2Y4OA 3TR5A 2RAPA 4MWCA 2PM8A 3TG8A 2CJFA 2PV7A 3RLFA 1O1YA 3GLUA 2OGZA 3EPPA 5AQ1A 1P3Y1 2R6JA 2VDUE 2XMGA 3AR7A 2QYTA 3FF1A 4Q3CA 4UUOA 4AY5A 3T99A 1KBZA 3J81A 3WL4A 2DE0X 3C0KA 2HLNA 4XVRA 2GJAA 3JRWA 1PX0A 1SIWA 2IE0A 4B40A 5C7IO 3GUHA 5C4MA 3K92A 1OJ7A 1N0IA 2OGSA 4K9SA 2JD1A 3QA9A 4PYLA 4WV3A 4YXWA 5KOHB 5E6UB 4UTRA 3B12A 2IUFA 2WIDA 5JY1A 5EIFA 1QXSA 4HO1X 3V4RA 3VAAA 1RS0A 4H17A 5J63A 2C8LA 1PR5A 4O2BF 1S3SA 3BM5A 2FCAA 4AAYA 1G66A 3OX2A 1M1UA 2HMAA 3EOBI 3ND6A 4FLMA 4M8KA 3TEMA 2PBFA 1QPZA 4OU5A 3SC2A 1SCBA 4MUHA 1OH5A 3AVXA 1U0FA 2FSVA 4WZZA 2G70A 1X3LA 4C0AC 5AUPB 5AXBA 4YDQA 3G0HA 2I3GA 3O8NA 2Q5OA 3ETDA 4TV8A 3SSNA 2HMTA 1EWYA 3NHSA 3P9RA 4LJ7A 4D79A 2WAOA 5KWEA 4G9GA 3FNHA 5FWDA 4B82A 3A70A 1E5DA 3FUTA 2ZJ3A 4HX5A 4I8IA 1AUOA 1A71A 2AK3A 4JI1B 4BLPA 2HFJA 1NSTA 4NU8X 3COSA 3B7WA 1U0RA 2CLHB 4RPJA 3T7SA 1OFVA 3QENA 5BSFA 1A1VA 5K01A 3TF5A 4HVAA 3DZHA 3CZ9A 1M5UA 2H8GA 2O7QA 1TF5A 4B4DA 1NXOA 4JP5A 4XSHA 3RVDA 1CXZA 3G0BA 2E49A 1CUDA 3K5HA 2CXTA 4W1RA 1PFGA 3I2YX 4UVDA 4HSEA 1CR2A 5ERGB 1JSXA 3HLKA 1KDZA 1TC1A 1NMSA 2ZYUX 1HI9A 2VHTA 1PJRA 1L4NA 3JQCA 4U2DA 1ZVMA 4CODB 3U62A 4KQCA 3QP9A 1GARA 5BR8B 2PRYA 2TSYB 3P71T 1QLJA 3WBJA 5C37A 4F3RA 3DKPA 2BEWB 3KYDA 4RPGA 5IYZB 1LPMA 2XTMA 6GPBA 5THKA 2GCNA 4HK4A 3FNRA 3FROA 4PZ9A 3IRVA 3TAXA 1PJAA 1EVIA 2EQBA 3C15C 4L3WA 2D06A 1RQ2A 4Q9NA 4OATA 4MS4B 4IMPA 4J6EA 4E1BA 3HJGA 2QLBA 3L9XA 2C8VA 2I99A 3NETA 1CJSA 2WF7A 3C7CB 4MB6A 4OM7A 4QO8A 1VIYA 4DMCA 3BK7A 1VG0B 2ZT8A 1UBUS 2R25B 4MS1A 2Y68A 5TRTA 3PTZA 3P9NA 4H59A 1ZU5A 5JSYA 4KO8A 1X7GA 2VJOA 2Z5LA 5CLGA 5F4BA 3BXGA 5IH3A 4E15A 1TQ8A 4EB8A 8ABPA 1HMPA 1A76A 5AKZA 3CWQA 1OXXK 2AE2A 5JXWA 1BGXT 2ZTVA 1DMRA 1IEQA 1UFKA 2OBXA 4ICIA 4L4UA 4OI4A 3S29A 5TJ9A 3F5QA 2KJQA 3PGKA 3CF0A 5B53A 2YASA 5BVHB 4LGVA 3N53A 4RL4A 2VYND 3PT5A 1M2EA 5F35A 2BN4A 1OGIA 1YH3A 2F2TA 2KYRA 2WF8A 5CITA 5I01A 1U31A 1K5PA 2UXCB 1X0VA 1GA6A 5CYGA 4OQNA 1NF9A 1ZU4A 3H5VA 4Q37A 1E96A 3HNOA 5DTRA 3MT0A 2GWHA 4O4IB 2ZZMA 2YXBA 1RXVA 1NJ6A 5DNEA 1I4LD 1GQFA 3BIXA 4MI1A 4P0PB 3CNEA 3L01A 2VPQA 2JANA 4HP8A 4J3JA 4O4LF 4Q9KA 1NATA 3ZQ6A 1GRVA 3WGTA 1L9KA 5U4QA 2H16A 4AI6A 5EKXA 4EARA 1NONA 3CIOA 1TM2A 3TH5A 1AN9A 4AY6A 1DPFA 2QY9A 1KGDA 4WBSA 5AW1A 1RTTA 2AG5A 4TS1A 4F5ZA 4IIEA 5JYEA 3FDJA 3U60B 4DUGD 2I2WA 1F0PA 2JPDA 1TCAA 1EVZA 3CJRA 1YR6A 4M7PA 2Y67A 4R9RA 3RAJA 3AV3A 2YZ2A 5AKXA 6NULA 2VRCD 4WI1A 3MTDA 4KDRA 3UPTA 5AQEA 3ZJYA 2PK3A 2X6TA 3ICQB 3MRVA 4A0RA 4EF5A 1G4AE 1MOPA 1X0XA 3FKQA 2HWXA 1TUGA 3SOZA 4ALMA 4TWIA 1ECGA 1N1EA 2LIPA 2QTAA 2YWCA 4XLZA 1I32A 5E4JA 2ASVA 3UMGA 4XGQA 3AUXA 3R7SA 2FA9A 2IYWA 4C14A 1TDJA 1LF0A 1X1RA 4LRSB 2O2YA 2GHQA 5JNRA 5UKDA 1HNZB 2L17A 1MFPA 4MUFA 3U19A 4PYNA 4RCZA 1Z2PX 4OQPA 1XEXB 3DE3X 5CIQA 3UB2A 2GXQA 4DR1B 2OLKA 3U6KA 3LX8A 4LXIA 4ZCMA 4YQZA 1XZGA 2BHRA 2FKNA 3I01M 2P9CA 3PEVA 3NBQA 2MSWA 4QRDA 1ZR4A 3EF1A 1QQBA 2G76A 5LBUA 4PLGA 1NI4A 2P40A 3GV0A 2FPUA 5CCDA 3U4AA 4ZCRA 5AP9A 3MXOA 5JWHA 3ZCTA 1X7XA 1VIDA 2FZGA 3SI7A 1A8PA 1PDVA 1SKBA 4B9AA 1OFGA 1TVMA 2HEGA 4BO4A 5KREA 3EDQA 1PZNA 3RS4A 3M6FA 4AJIA 5I8ZA 1M8GA 2NZVG 1XALA 1A2OA 3E7FA 3GVCA 1QIDA 3GUCA 4NHEA 3BGIA 5ECYA 2G5PA 3BQ9A 3TGPA 2A59A 2ACEA 1Y82A 2F4NA 1WHTB 3INRA 2GNPA 3MTBA 4IZIA 3S28A 3W5AA 2XI4A 2IK8A 2QTTA 2VSOA 4ZGGA 1Y4UA 1YS9A 1I1OA 1RJ9B 2CYBA 4JJIA 5LMUB 5FBHA 1MFZA 3EA5A 1NPYA 2HMWA 2E4VA 4V38A 4MW0A 4N6GA 4BVFA 3IUMA 1R88A 4YV0A 3LQ4A 2VTBA 4LV6A 1DCMA 4RD4A 3U9TA 4FJ2A 1RWKA 2R7KA 4MKZA 3NRCA 3AKZA 1EM8A 1W8IA 2EFCB 3FNIA 3JZMA 3UWDA 1RBZA 1T9KA 3R2JA 3U4GA 1IK4A 1GUBA 1XXLA 2B6NA 3B51X 1SJ9A 2CXQA 3CRRA 4PO8A 1CRLA 1GITA 4YLEA 3AERB 2C59A 2Q4RA 1JDUA 3ZCRA 4OQZA 1QS0B 1ARZA 1JPNA 3WTCA 3E0QA 3MSCA 4L08A 4MDHA 3SIRA 1T2CA 2HM7A 2G4VA 2OZLA 3ZCXA 1LX6A 3OPYB 4RYLA 2BFBB 3ZN2A 3C6XA 1ZD3A 4YRJA 4JC8A 4H60A 3LBIA 5ALHA 5HUHA 3IDFA 1QIKA 2BI4A 3L8MA 4OSPA 1HE8B 1CR6A 3I6IA 3QUBA 2ZRFA 1DIAA 2BSAA 3BAFA 2JDIA 1G5FA 2WUWE 3EARA 4MP6A 1N57A 8OHMA 3B6KA 1FVFA 5I7RA 3GJSA 1VB3A 1NVVR 4AJKA 2JG3A 1IXKA 3ABZA 4UHBA 3G8BA 4I50F 4PAMA 4CF6A 2FPLA 4HNTA 4W63A 5C8YB 4XM0A 4XSGA 4JLSA 1BKYA 3SHOA 5KNDA 1KETA 2FPOA 1AG9A 4EYSA 3LMKA 4DFDA 4PPYA 3NVKI 3FSEA 4K3UA 3AUAA 4J9VA 3RRZA 5LMZA 1K9SA 2AD1A 1XBTA 2FQYA 3DC7A 1IVNA 3R0VA 1B1CA 1Q0UA 2LIVA 1GLVA 1L5NA 2VQEB 4C7XA 4GXNA 3IDZA 2AN1A 1B3BA 3K9CA 5EXSA 1HLFA 5G41A 2YIVX 4ND3A 4UHCA 3STVA 1SBHA 1Z6XA 3PRKE 3K6RA 4TVOA 5EMMA 2CHFA 4NF2A 3U4MA 4RJ2A 1KJZA 1QWOA 2BM8A 4UEKA 4I1IA 1SUFA 3SCZA 3U9SA 4Y1RB 2WUFA 4FFDA 3G8CA 1GO2A 4E21A 3GK3A 4A16A 3G0GA 2YZGA 4DILA 4G41A 4C78A 3OLWA 3KQVA 1NA5A 4M37A 3A36A 3KSZO 2QR2A 3P9YA 2HMVA 3RC7A 2CNOA 1KNXA 3LYLA 3OUZA 1PL8A 4MGZR 2DERA 1TEXA 4YYZA 4LJ6A 4K03A 3NEYA 1XT6A 2NSDA 3F5DA 2VDVE 1AQYA 5HILA 3SJ7A 4YRRA 2RGUA 3HBNA 1VPTA 4XUEA 4F93B 1Q44A 2FWNA 1N2CE 1P33A 3NHWA 4G1CA 4JCCA 3BXHA 1KHHA 2WD7A 3OHPA 3TPCA 3DFIA 3UWOA 4C4OA 3DNPA 2YQ5A 3OA0A 4IH1A 4ZAGA 2X15A 2C7RA 2PT7A 3P97A 4OHMA 3WS7A 1RRVA 1WL8A 2OUIA 4K6FA 5MGBA 2XE6A 1Q7BA 1B41A 3CWCA 4LKRA 5EGSA 5ULLA 2OGWA 1QE0A 2QQ0A 3GQBA 2BR5A 1JH8A 2PT6A 1MAVA 3L43A 1XQ9A 3VTAA 1OFTA 1FYDA 2ZJAA 1GSOA 3FCOA 3W6ZA 1XAHA 2DJ5A 3VOSA 1E2JA 3GNQA 5CD1A 4C7OA 3LT2A 3F6RA 4L8GA 4DBLE 5LDDC 2FMTA 1GRCA 3IOYA 4G0NA 3SJAA 2OCKA 3W5DA 3ENQA 3EXFB 1GPMA 5K4GA 5B1HA 3MGAA 1BX0A 1D2MA 1RRCA 1UKVY 4V0KA 5DM4A 2JIBA 3OP4A 5CA1A 1UANA 4Q7KA 3CR7A 3IODA 5JWOA 3L8EA 1PZEA 5BV8A 4I4TA 4ZO9A 3SBOA 4EG4A 1BHJA 2ZI7A 1KO7A 4U6QA 4LXGA 3JATA 4PQGA 2WKQA 2QZSA 3C6BA 3I1IA 3QA3E 4JXJA 2XWJI 1WVMA 2K7ZA 2FZEA 1C3EA 3ZIDA 3YASA 3L0OA 2XD9A 4TT8A 1CHNA 4I1UA 4V0QA 4DDWA 1SKMA 3DHYA 2JFQA 1QUEA 2OD7A 2QTLA 5H59A 5JC1A 5LWQA 1SHKA 3FTNA 3HHPA 2VJQA 2F3RA 3MINB 1J7KA 3K0CA 4R1PA 4ZGWA 1K92A 1VL2A 1B2LA 1CBUA 4C5CA 2WSBA 4YQEA 2ZRLA 1C3OB 3G5AA 4F92B 2J9RA 1WDLA 4HAVA 4YONB 1UL1X 1DINA 3IEXA 1CHDA 4LJYA 4KRGA 5HF5A 4M86A 3FTFA 1TQHA 4I14A 3KOUA 1GXSA 2O48X 2HUPA 4C1BA 1GFWA 1FQKA 1RP7A 3WYNA 4ZCTA 3ORFA 3M89A 1UDWA 1RWOA 1GRRA 3EVEA 1HDXA 4FGSA 4B2LA 1JMVA 2P4EA 3OZSA 2J4FA 1CUAA 1WUYA 5A7FA 4BU1A 1MEOA 1O08A 1NT2A 2GAJA 2JLWA 1EA7A 1KZ9A 1CUFA 3RJ5A 1JPJA 1WXDA 4TL6A 4H3SA 2JLYA 3BQMB 1IWPB 4L8YA 3BEDA 3EDCA 4N3NA 1WDMA 1SG6A 4UZSA 3WG9A 1J2UA 1R0RE 3AQIA 4B6PA 3BXEA 1A4IA 1VLHA 1YVDA 2R6FA 3FPGA 3KAQA 3O90A 4I4LA 4L9WA 4WFJA 3KG2A 2LTAA 2A4KA 4DIMA 3O8LA 3ZD9A 4YTEA 1RWWA 2R86A 3D1LA 3LRPA 4LE0A 4WY8A 1U2SA 1OLUA 3LCVB 5IN4A 2VK4A 3UANA 2CV1A 3KQHA 1ULHA 3MJDA 3AEZA 2LDBA 1G8PA 1TIBA 2ZJBA 3QPAA 1YVRA 4KP7A 2GJ8A 1W6RA 1DRWA 3WGHA 1M1YA 1QHGA 4C87A 3WGUA 1EK6A 4N6NA 3BMOB 3DZIA 4XR9A 3RSGA 3RUHA 1KZ7B 4NECA 1JR4A 4RK0A 3QKWA 1J8DA 1J97A 3CM0A 5DTJA 3V1NA 2NLOA 4D9IA 1Z6ZA 1YNOA 1ZGZA 2FSFA 3I3OA 2H11A 4GR9A 4L73A 1UMCB 4PSDA 3SS7X 1M0EA 1WZ2A 1TLTA 4NZYA 1OYWA 5DHFA 4TTAA 3C1TA 3L6EA 4ZARA 1FBTA 2DR3A 3T7AA 5CG1A 1QVZA 4TTRA 1KTVA 1Z7GA 1D04A 1AN0A 1J0AA 1F9EA 1JYSA 1OZAA 1TZBA 3MJCA 3NFYA 3O2QB 5JAQA 5LBTA 7ADHA 5FAXA 2ZUUA 2WE7A 1D2AA 4GYWA 3KTFA 4ZVMA 1E58A 2CB9A 4EB3A 4QIHA 1MH9A 1HG1A 1N0HA 2ZYRA 1ETUA 3O9VA 3VU0A 3WMEA 4L2IB 4PONA 3D3JA 1SC1A 2I65A 1QO9A 3KQQA 4TMZA 1XEFA 3UGTA 1G19A 1GPAA 3PENA 4Q3LA 3WHIA 1A9XB 2QR3A 4DAOA 1P1JA 5C1OA 2FJUA 4ZWNA 1VLQA 1Z28A 4L9RA 1MJGA 4AKHA 3ZGNA 3MT8A 1C30B 5FBWB 3JASB 3BFJA 2RG1A 1EE9A 4EVRA 3LOPA 5I51A 3R5HA 1Q19A 3DYBA 2Y1OA 4BP1A 3U56A 4JBYA 3HV2A 3THSA 4J7CA 5TQ2B 3FGOA 5C46F 1RPJA 1U02A 4IG4A 2NWQA 3RD5A 1WRBA 3SX0A 1HTBA 1BWPA 3TZ6A 2OE2A 3T3GA 3UK7A 5KMGA 1WQ1R 1R0YA 2G7MC 2ZB7A 1F2TA 2O0KA 2O14A 3QVWA 5KZMB 2HLPA 1KR2A 1XV5A 1QDEA 1M2VA 4DIBA 2I6FA 3HA2A 2ZR9A 2P3SA 4A0SA 4FN4A 2Q3CA 4RGVA 3WLRA 1I6MA 4PZZA 3MVEA 3F7OA 3O3NB 2P4HX 1SIOA 4M4SA 1WXWA 3OBBA 1KC3A 4BN4A 1GG2A 5AM4A 2XUQA 4NX2A 1X2EA 3ZKWA 4KLNA 1PNOA 4DZTA 4KH1A 1Z9BA 1RHKA 2ID8A 1ZD2P 4P81A 1R6UA 2PX3A 4CV0A 4QFBA 3ZV5A 2E21A 4ZV9A 4Z7NB 4DHWA 2GZRA 3R3XA 4D0SA 3BQNB 5EP4A 2QX7A 1E3JA 5B4VA 5HG0A 5BURA 2HBYA 3DO6A 2YBEA 3JQ9A 4J2HA 1MTZA 2WZQA 3DUFB 5ICEA 3DEHA 2XUHA 2I7VA 1DI0A 4CXMA 1KQNA 1BA2A 1FS6A 2JFZA 1CUHA 5U4XA 4F72A 2XVAA 3MWEA 1CZUA 2IVFA 1ISGA 3DEYX 4HWTA 1UZAA 4QUBA 3VC3A 4CM8B 4COKA 5ESDA 4G5YA 4BE4A 2FMFA 4NV1A 5KTKA 3BIFA 5F52A 2PUDA 4RY9A 3A1UA 1IOLA 4F8EA 2FN9A 3KR0A 4XPZA 5LJIA 1VJRA 3PPIA 3JD2A 5K8LA 1F8FA 1UP6A 3NAMA 3QLJA 4OF4A 4WJZA 1Z17A 5TARA 4OHFA 3PV0A 1NMXA 4JI4B 4ZDIA 1EGVB 1LJLA 2FHPA 1WW8A 4HX2A 4O2AB 3KPWA 4B7AA 5ITWA 4OM8A 1XEWY 3UV6A 3NTLA 2EFEB 4MUXA 1FQOA 1RI4A 2I2BA 1P60A 4Z0HO 5ALUA 4A23A 5EUMA 3C8HA 2JLAA 2POCA 4HZGA 4J1TC 2B35A 1VHWA 1KDOA 3FPKA 2O8EB 3VUFA 2O05A 1U04A 2BGGA 2EGHA 3QITA 3GUVA 3QWIA 5KOHA 5E6UA 2II6A 2PMDA 2F1RA 2YXPX 3NKLA 2HY7A 1E62A 4FNGA 2X6RA 1MO3A 2N1BA 4OMCA 3WK6A 4RZIA 4U7PB 2I29A 3ZH2A 5SV2A 2QNIA 2QOEA 3F78A 4DM3A 5AW7A 3GEBA 5CFPA 1SD2A 2V9CA 2QR5A 4KVAA 2ZSAA 4X3CA 4MJ7A 1UZUA 4L28A 1NXQA 1T26A 3DXYA 2EX0A 3P9XA 4ZRNA 3W5JA 4EEZA 5A5FA 1O94D 2BV3A 4TQUS 2ZJ6A 1WBBA