4AJNA

Rat ldha in complex with 2-((4-(2-((3-((2-methyl-1,3-benzothiazol-6- yl)amino)-3-oxo-propyl)carbamoylamino)ethyl)phenyl)methyl) propanedioic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
330
structure length
329
Chain Sequence
ALKDQLIVNLLKEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
total genus 115
structure length 329
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajnA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajnA02
4XX0A 3BMOA 3AWDA 3ZHBA 2FP4A 2QRLA 4QT0A 4QTZA 3G3EA 1LLUA 4GLLA 2FPPA 4R69A 1GZ3A 4C4OA 1GAEO 1HKUA 4RPHA 3BA1A 4WUVA 4BNIA 4EJMA 3WG9A 4MVJF 4J43A 4IXTA 4OSOA 4OXNA 5FI3A 1E3IA 2Q2QA 3K6JA 3S1LA 1IY8A 2BGLA 3E9QA 3RUDA 4RZIA 3IIEA 1YB1A 4MVJI 4Q9NA 3RCBA 1M2WA 4OXKA 1AXGA 3LF2A 1AUPA 4M89A 3VVBA 2Y0EA 3I9LA 4AJOA 2NACA 3AFNA 3DMTA 1YB4A 1YXMA 4J1TA 3GEGA 1YWGO 1ZMOA 1QYVA 4BHTA 1GL3A 4GX1A 4EI2A 2NU8A 3MEQA 1X7HA 1ISJA 4DMLA 3IP1A 3PZRA 1U1IA 2HU2A 2D5AA 2VHWA 4PN3A 4J6FA 1I3LA 2J3IA 5LDHA 3RI3A 5JLAA 4OOEA 3A28A 3OF2A 1SNYA 3PPIA 4PIVA 2JHFA 4BV8A 1ZXLA 1M66A 2VWGA 1U3WA 3C85A 2WYWA 4BNHA 1FJHA 1EUCA 4ZA2A 3PJDA 2P4QA 3ZNOA 4EDFA 2E48A 4CM7A 5TS3A 3RD5A 1LEHA 1DIBA 1JWBB 1LDNA 1QRRA 3LK7A 4NU6A 1VJ1A 3DFUA 1D4FA 1YOVB 1SB9A 4UEJA 1HYGA 1HDOA 2X1HA 4U8GA 2CVQA 1I2ZA 2OZPA 3ZHYA 4OL9A 1I01A 1PGQA 4M1QA 1HE4A 2OHXA 4OKIA 4HP8A 3CKYA 3RVDA 3V1TC 3P2OA 2FSVA 4XRGA 2OUIA 5IAAA 3PFWO 4NBRA 4RORA 1ZMTA 4RLHA 3AY6A 4G81A 4UEOA 3GGPA 4PGFA 3QA9A 2Z5LA 1A5ZA 2R00C 1E7YA 3ZNNA 3JQBA 1EFLA 4TROA 3ZHXA 3D4PA 4TVBA 3VH1A 3MJCA 3EZYA 2PV7A 2A9FA 4WLEA 2NADA 4D43A 4JQCA 1ZK1A 3INGA 3FPLA 3QSGA 3U09A 2WD7B 5KKAA 2YV2A 1A7KA 3LC7O 4ID9A 3BTOA 4LCEA 1P45A 3IKVA 4PRLA 5IZCA 5B4VA 1WMAA 1DRUA 1XELA 1XR3A 1BW9A 2QYSA 1AGNA 5DCYA 2Q45A 3JD1A 4R1NA 4R16A 1Y7TA 4ONEA 2I9PA 5JDCA 5TLSA 3IUSA 4D7AA 4PG7A 5I9NA 3KOUA 3QRWA 1NXQA 1Z73A 2JAHA 2DBVO 3C8MA 4CV2A 4CV1A 4UULA 2Z1MA 1C14A 3I1JA 1MC4A 1J4AA 2VTEA 2OBYA 3K92A 4AVYA 1ZW1A 2EKQA 2ZJ0A 1ENZA 2ET6A 2IEBA 4TKMA 1WDMA 3QIVA 3QV1A 2Q99A 4RGBA 1CYDA 3GEMA 3PI7A 4A73A 1XEAA 1E7RA 4QX6A 5TQVA 3OJOA 4YXFA 3GY0A 3E1KA 1P1KA 5JAZA 1YQDA 1O9BA 3RUEA 4NJMB 1FDSA 3ONEA 4Q3AA 2PZKA 3KLMX 4J9VA 4CMEA 2E6UX 1YVEI 5THQA 5JAIA 5T8KC 2RBEA 1F06A 1ZJZA 2PFGA 4N18A 1D1SA 1P33A 2RHCA 1NR1A 3BZUA 3AUSA 2P9EA 5A9RA 4TZKA 4NJOA 4J7CA 2UV8A 3UF0A 4BNNA 3PQFA 3ETEA 2WDZA 4IIUA 3JQCA 2HDHA 4Z6KA 4I8XA 1Z82A 3S2EA 3X2EA 4S3MA 1ZK3A 5ILGA 3HQ4O 1C1DB 4BVAA 4AJNA 1JU9A 4DPKA 3IJRA 3ZH2A 1EQUA 2J6IA 3T7CA 2BFAA 3I4CA 2HKIA 4ZRMA 3DEYX 5L7YA 4H7PA 4MKRA 4XYLA 4CM9D 5IG2A 1EDZA 4IY1A 1R4MB 1W8DA 2J3HA 2YW9A 3GR6A 1RM4A 3JYOA 4CMKA 2VTDA 4WCFC 4YRBA 4EBFA 4BKQA 3DAPA 2Q1TA 2X22A 4LRSB 3AM4A 3HFSA 4EUEA 1WZIA 3ABIA 3Q11A 4I1IA 3S2FA 1QLJA 2ZATA 3I4FA 2DBZA 1U5CA 2OL4A 1GQYA 1NVMB 4P8RA 3Q9NA 3DONA 1N9GA 5GZ6A 3RUIA 1H5QA 1ENOA 4TVOA 4FS3A 2Q2VA 5K9ZA 1VE9A 4TRNA 4J7XA 3OIFA 1EBUA 1GYPA 1P74A 3OQBA 3PYMA 1D3AA 2VHZA 4J1NA 4G65A 1Y8QA 1ENPA 4J0FA 4LSWA 3E6AA 2PLAA 1UAYA 1PX0A 2VHYA 2O3TA 3I6QA 4L0QA 2B4TO 3MJSA 1LC3A 2Z1NA 5F3RA 3EVNA 2C59A 4RVHA 3IL2A 5A02A 3B1JA 3U4DA 1Q0LA 4B7UA 1S7CA 5ITVA 3WJAA 4S1VA 4W4TA 3L6DA 1F0YA 4ND1A 3PHJA 1UP6A 7ADHA 1DJNA 4OSPA 4CM8A 3W8EA 4MVJG 4MP8A 4CM5A 4TRMA 5IXSA 4DIBA 4ALIA 2QIOA 3WYBA 4E13A 3WSVA 3OJFA 2X86A 3TPCA 1P0CA 2DAPA 1BHSA 1H6CA 2Q49A 1PS9A 4IXWA 2H5LA 4MPDA 1JVBA 2WYUA 1I3MA 4BB5A 4CUZA 1I24A 2CVZA 2FMUA 2JFGA 2GF2A 4L76A 3JQDA 5G4LA 4MOWA 1PL6A 4DMMA 3KHUA 4MIEA 1GEEA 1GUYA 2I6TA 1OI7A 1AE1A 3F6YA 4NH4A 3GGOA 4GKBA 4LGVA 2PR2A 1MG0A 3E9NA 1YO6A 2WWRA 4IZHA 4BNMA 3GHHA 4O59O 2VNSA 4I9HA 1DDOA 1HE2A 2C82A 2JFFA 4B7CA 1T4BA 3IUPA 3FN4A 4J90A 2O4UX 4PFJA 5BSHA 1ISHA 3ZZNA 5L9AA 5A3JA 3QLJA 4TRJA 4ZQGA 4D42A 2Z95A 3C1TA 5FI5A 1A72A 3A1NA 4GX2A 3BMQA 5EQFA 4ZD6A 1JLLA 1NX6A 2GR9A 1NAHA 4NQZA 1T2FA 1IYZA 1NR7A 2CNBA 4TKLA 3RU7A 1PGNA 2EERA 4MP3A 1OFGA 3KYCA 1ZO8A 2WE8A 4YJFB 1ZXBA 3S55A 5DCWA 2JD0A 3NEPX 3CMMA 4Y6RA 4AJIA 4BO0A 2EW8A 4AL4A 4BO2A 2NVWA 3CIFA 4OM8A 4D3FA 5H82A 2X0RA 2VUTA 4A10A 3F4LA 1B0AA 4RF2A 3IKTA 3ZWAA 2X8LA 3DAFA 1D7OA 1PR9A 2FY8A 3EHEA 1NP3A 3ITDA 5A9SB 3DBRB 4RQTA 5FF9A 3FRJA 5CAEA 3DZIA 1PJ4A 3I83A 1M67A 2NVUB 2FPGA 2B0JA 5B12A 4HWKA 1X7GA 1YGYA 4NI5A 4NPCA 2Y66A 1ZH8A 3JQGB 3FI9A 1GY8A 1ZK4A 4LRTB 1KC1A 2D59A 3ZHZA 3B20A 4AJEA 2B35A 4A0SA 1SAYA 3VDQA 1ZVMA 1XCBA 4Y8VA 2C5EA 1WNTA 2NWQA 3GOHA 3FCOA 4R1UA 4AJHA 1GUZA 3JCZA 3OBBA 4KDFA 4BO9A 4YT4A 1I5RA 2BF7A 4EEXA 1AN9A 3QVTA 1EE9A 1TA4A 4B7XA 1ULUA 2P2SA 3F47A 1PQUA 3RAJA 2C5AA 3QVOA 3ICCA 1H6DA 5F1PA 2O2YA 3H9UA 3SBOA 5TIIA 2V65A 4IDBA 3MOIA 4KUHA 5ER9A 5IDXA 3MTJA 4R41A 4IDDA 3U5TA 5FWNA 2E37A 1ADGA 2YHIA 1WWKA 3WJ7A 4YRDA 3RC2A 1BXGA 1PJ2A 4IS3A 4K1LA 1C0PA 1VSVA 2GD1O 1P77A 4P38A 1GU7A 3VAZA 1LQTA 1E3WA 2PNFA 2V6FA 4GVXA 4L73A 4W9NC 1DB3A 2IYOA 3KM0A 1ZNQO 5AVOA 5DT9A 4BGIA 4PZCA 2ZCUA 2HMSA 4NBVA 3TZKA 3PDJA 2R00A 1EVZA 1CRWG 4DA9A 4CM6A 3GEDA 3H6KA 5BSGA 2EWMA 1A4UA 4BQPA 3GVCA 1GZ4A 1DAPA 1PZHA 1VPDA 2DU8A 3H65A 2OOSA 3JQ7A 1SCUA 4J9UE 5KJCA 2D1YA 3OEWA 4GSKA 1SZJG 1IZ9A 3FTPA 3VPFA 1E6UA 3DZFA 3LYLA 1NASA 4RVDA 4D3DA 3RROA 1KYQA 4Q39A 1ZUD1 3A14A 3K5PA 1U3UA 3JQBC 4BOYA 4P22A 2X4GA 1KIFA 1DIGA 5GY7A 3RJ5A 1HZZA 1U8XX 1V3UA 1I33A 2VT2A 2Y1FA 3DTYA 3GRPA 4BNXA 4F6LA 1YL7A 3PLRA 1GTMA 4IM7A 1PZFA 3WGYA 3BTUA 3GAZA 4L74A 1KC3A 4WCDA 3H7AA 3M1AA 1C1XA 4OGWA 3STHA 1TVEA 3MWEB 2JFHA 1KBZA 4J2HA 3NUGA 2X9NA 1K6JA 4JJFA 1XQ6A 3H9EO 4I9NA 3RUCA 1N2SA 2R2GA 4JBHA 4PLCA 4QSMA 1XIVA 1WMBA 3UW3A 2NTVA 3L6EA 1W0CA 4WLFA 3VZSA 3VH2A 3LT2A 1DAOA 1Z7EA 1PSDA 5T8KA 3PJGA 5F5LA 4PG8A 5A9TA 3HNPA 1B3BA 4RCVA 4A2CA 3HWRA 2YUTA 5IZ4A 1OC2A 2Q3EA 4A03A 3PWKA 2XOXA 4JLWA 2Q1UA 1U7TA 1QSGA 4HFMA 2AEMA 3V5NA 5EJ2A 3WICA 4CJXA 4JGBA 4CMEC 5JS6A 3OJEA 5TT1A 2DBQA 4NZ9A 4W7HA 1F8FA 2G1UA 4KMSA 1EE2A 4BNVA 2IODA 5G0UA 2PKQO 2Y1EA 1RM3A 4XR9A 1QR6A 3SX2A 5JCJD 1RYEA 2I66A 4WCFA 1LUAA 5CPFA 1HZJA 2EHDA 4YAIA 1RJWA 2IZ1A 1U9JA 1GQ2A 2AQ8A 4RF3A 3ORFA 4XGKA 3DDNA 5DDIP 3ANMA 4A7PA 3GFGA 3UCEA 1F14A 4IUYA 3VPHA 4E3ZA 3ONDA 4BNLA 1NHWA 4CM3A 5JXWA 4WASA 4FJ1A 3O8QA 5DZSA 3GG9A 3MCVA 4WNCA 2HLPA 2O48X 2QRJA 1NFFA 4GSLA 5I7SA 2VYVA 2UUPA 1KEWA 4GVLA 3ST7A 1X14A 3R1IA 5A3VA 3WGZA 3ITKA 4E2ZA 1X7DA 1YH3A 2I99A 2JAPA 2WSBA 2HJSA 2W2LD 1J5PA 4OQYA 2DT5A 5H83A 1T4DA 1E7SA 3WYCA 1PZGA 3NJ4A 4HKTA 4BMVA 1UXHA 1K6IA 3KO8A 2GERA 2GYYA 5U1PA 2VRCA 3ZU3A 2EF1A 1VL8A 7MDHA 2X9GA 1KVTA 3NX4A 3WS7A 4JIGA 3UCFA 4G5HA 3WTBA 2C7GA 3ZWXA 5TC4A 1NTOA 1Z7BA 1U2DA 2JD1A 5BSFA 5JMPA 1V3TA 3QY9A 4CMJA 5K0ZA 1GPJA 2P5UA 3BMNA 4CQMB 3E9MA 4U6QA 5KJFA 5G0SA 1LLDA 4UEKA 2VQ3A 2AEJA 1GUFA 1N7HA 1PQWA 3GVXA 4PG4A 1KVRA 1PWZA 3RUHA 4DC1A 4CM9A 3FR7A 4PZDA 3AOEC 2NLOA 4KDEA 4RDIA 3LSYA 5I8ZA 4EJ6A 4IQGA 3PQEA 2DTEA 3G49A 3KYDA 3D4OA 4BNFA 4B79A 3O4RA 5L3ZA 2WEKA 1JKFA 1QKIA 2IZZA 4KTVE 2HMTA 5COQA 3WGQA 4IJKA 1S6YA 3GN1A 4U5QA 1UXIA 1H9AA 4Z3DA 3DBLA 3KSZO 2H6EA 3L4SO 1YBVA 3K2EA 3BHMA 4HX5A 2XAAA 1HDZA 3RUAA 4KUGA 1HYEA 3AJRA 5DP2A 1NPTO 1A27A 1QXSA 4CMCA 3WDSA 2O4CA 1XGKA 4MO2A 2UVDA 3GRKA 1V9LA 2NSDA 1LRKA 4HADA 4RDHA 3R6DA 5F1KA 3VDRA 4CMHA 1BDBA 3JYQA 4FQ8A 2POQX 2J8ZA 4C7KA 5I9LA 4J16A 3EUWA 1R0KA 1N7GA 1YL5A 3MZ0A 1VL6A 1X15A 5T5QA 3H2ZA 3GZNA 4ILKA 3RU9A 3RIHA 1VJTA 3G0OA 3ZWPA 2FHSA 4DBVO 3PVZA 4CODB 1GV0A 5L7WA 3SC6A 2ILTA 1HTBA 1SOWA 4PG5A 1B3RA 1OMOA 1VM6A 1ONOA 3MJ4A 1KETA 1TB4A 4WLNA 1XKQA 2GN4A 2Q46A 1N9GB 1W73A 4UUOA 4Q3NA 4WECA 3TNLA 2DM6A 5JFOA 1ZSYA 1IPFA 1Q7GA 5TGDA 5AOVA 2O3JA 3H9JA 4DVJA 4UVDA 4QO8A 3H8VA 1CF2O 1F8GA 1E1MA 5EN4A 4R3NA 1PJSA 4BMNA 3KRTA 4NFYA 1Y8QB 2I3AA 1JTVA 3CSDA 4A27A 5JY1A 4YAJA 1U4OA 3KLPX 3FNFA 4ND5A 4GI2A 4F6CA 2G5CA 2CDAA 1WAMA 4AG3A 4J7UA 5AYVA 1U3VA 3EZLA 3F5SA 3DBVO 1XA0A 4BO7A 3GGGA 3L77A 2ZIZA 4P4NA 3UAGA 2AA3A 2EG9A 1HDXA 5K6AC 3GG2A 4KQWA 1I30A 6LDHA 3HFGA 4BKUA 3WX0A 2XXJA 3ZNPA 1YQGA 3FWNA 3MTGA 3TN7A 3E03A 4BS9A 4HNGA 4CQLA 4LW8A 3E18A 4R1SA 4W9NA 3U4CA 2OP1A 2PK3A 3V8BA 2I3GA 3HHPA 4ITUA 2PA3A 2GDZA 2NUAA 1M76A 1T26A 3F9IA 1XU9A 3K96A 4GQAA 1NVGA 5HRUA 1I0ZA 2BELA 4O1MA 4D0SA 1DC3A 3DMYA 3JD2A 4FFLA 3HDQA 4FCCA 2Y1CA 1Q2XA 2DC1A 1NQAO 2QW8A 2W2KB 1WP4A 2CZCA 1ZK2A 2GNAA 4LVCA 4R54A 3VH4A 3WLEA 4DQUA 1MFPA 2VOJA 2AE2A 2VWQA 3JYLA 3CH6A 4CLOA 3LZ6A 2YZ7A 3FD8A 3DBHA 4L4RA 1R16A 2VCYA 4XQGA 4JCOA 4YQYA 4M87A 4C7JA 5DBIA 2IDZA 4DTIA 2VRBA 2AXQA 4CR8A 2HK7A 3RJ9A 4R9SA 4RZHA 1EBFA 4OYRA 2ZB3A 4CLDA 3NDRA 2D3TA 2EV9A 1EVIA 3CTMA 1YB5A 3DHEA 2G76A 4IMPA 3ZV6A 4DLBA 3PWZA 4QXMA 1PJ3A 1R37A 4NFHA 5AXBA 3W8FA 5CG1A 1IULA 1F12A 3L0DA 5B1YA 4XZ3A 4E5YA 3RC9A 3D3WA 2PTGA 3PLNA 4GWGA 4L75A 3ZNQA 3Q1LA 4CL3A 5JYEA 3U3XA 4IQ8A 1EVJA 1RM0A 4IDGA 3O26A 1QYCA 1VLLA 1XU7A 2ZB8A 4JNKA 1U2GA 2JJYA 3DZJA 4CMBA 4X54A 3MJVA 5U4QA 5KWEA 3ZWYA 3OJLA 4RVGA 2DFVA 3ZWWA 2F1KA 4FC6A 1PJTA 3KSUA 1VC2A 2JCYA 4XRRA 3WOHA 2PZMA 4R01A 5ICSA 1NQTA 4E33A 4J4TA 2VYVD 1V8BA 5I8WA 4FPXA 5BT9A 3WFIA 4ZQEA 1WDLA 4ND2A 1E0DA 1GZ6A 3TZQA 3FWZA 5FFFA 3ASUA 3BYZA 1DLJA 4CPDA 1X0VA 1ZIDA 3DL2A 5I9MA 2QYTA 2QRKA 1PL7A 5KVVA 4GWKA 4NK5A 4YVFA 5JMWA 4QUKA 5DNAA 2W90A 2ZQYA 1ISIA 3AFMA 3JQ8A 4NIMA 3SEFA 1NQOA 2P4HX 3PQDA 2VRCD 3DTTA 3GA0A 3ON5A 3HDJA 3M2PA 1UDAA 1CJCA 1O8CA 1Z6ZA 1K5HA 1KEVA 2F00A 4AJPA 4N5MA 1FDWA 4WK6A 4IJWA 4PVDA 3ZWNA 4BKRA 3DC2A 4XYGA 5A03A 1BXZA 2FR1A 1U7HA 3DWFA 5ENVA 4YBZA 2GUGA 3GNTA 1RPNA 1PIWA 2FZWA 2H9IA 5CHEA 4U7WA 4PLGA 1PS0A 1W4ZA 3KV3O 1IHYA 3AUTA 1SPXA 4INAA 1E3WB 3LC2O 3QWHA 1IB6A 5ICMA 5HA5A 1R6DA 1Y5RA 4KOAA 3UICA 5HS4A 1YS4A 4PCVA 5THKA 3DHYA 5EPOA 1LU9A 3I6IA 1DBVO 1LRJA 4BNYA 4MKXA 6ADHA 1UJMA 4YAKA 3QP9A 1A9YA 2FOIA 2BHLA 2D0IA 3LQFA 1GEGA 1PWXA 4KTTE 3EW7A 4XWYA 1HEUA 2BH9A 5AQ1A 5JDIC 2D2IA 3GZ4A 5JW6A 4IDCA 1E5QA 3JQ7B 2EEZA 2DUUA 2GRAA 5B4UA 1B8VA 1Y1PA 2OORA 3G17A 3N7UA 5A06A 3GVHA 4XQ9A 4FOOA 4OIMA 2BGKA 5DOZA 4JP2A 3UN1A 2PKRA 3KBOA 3OIGA 4FFOA 2FSSA 4NDNE 4CV0A 1ZBQA 1I36A 2OGUA 4YQZA 1BRMA 1O6ZA 4R5HA 1I3KA 4QO7A 4ZGWA 1UUFA 1YBMA 4D44A 4XIJA 1LDBA 4RQUA 1K2WA 4BO4A 4W7IA 3HZZA 3IS3A 2O3QA 1ONPA 3HB5X 1R66A 5KVSA 5JCJA 4YYZA 5CDUA 3GQVA 2AE1A 1C1XB 1SB8A 3AOEA 5DF1A 1DLIA 2YDYA 3DXFA 5EL0A 3U49A 3V2HA 2A35A 4FC7A 5JYDA 3PK0A 2Y99A 4I08A 4ZJUA 3JV7A 1UZLA 3AUAA 4CLEA 2A94A 3WNVA 4XJSA 5TJHA 2P9GA 4RPLA 5G4KA 2RIRA 4HV4A 1ISMA 3UUWA 1P9LA 3JQ9C 2J5QA 2ZTLA 3FSRA 1MLDA 4YPOA 3OECA 3WIDA 1NQ5A 3WYEA 1FK8A 2PH5A 3NJ8A 5DP1A 3QWIA 5EQDA 4K6CA 1P1IA 1Y9AA 2GZ2A 1IHXA 2V6MA 4HFRA 5IXYA 4JXKA 2W2LA 2WM3A 3KETA 2X5JO 3OP4A 1BWSA 1VKOA 3P7MA 4UREA 2D5CA 1JKJA 2GZ1A 4TMFA 4UAGA 3RASA 4O63O 4H3VA 1KVSA 5A5EA 1PJBA 2X6TA 4NNJA 1H0KA 4J49A 2JCXA 3SXPA 3EDMA 4EW6A 3Q3CA 5B4TA 3KXDA 5BSEA 3PXXA 4DQVA 1EEHA 4PVCA 1D1TA 4IMRA 1IL0A 1NPDA 3DHNA 5CG2A 2BD0A 5JPIA 5A4DA 2HO5A 3GUCA 4LN1A 3TFQA 4DWVA 2E82A 4I5FA 2CD9A 4D0RA 4ALKA 4UVGA 3RC7A 1R0LA 2I67A 2EJVA 3E5RA 1GCOA 2DPHA 3K9QO 1LQUA 3PEFA 4KWHA 3WGOA 1KVUA 4LVUA 1XLTA 1NNUA 1X1TA 1DO8A 2DKNA 3W4IA 5ER6A 1U3TA 1LDYA 1PJCA 3WMWA 1R4NA 4BIIA 4L9RA 2EW2A 2XF8A 5HWSA 4WOKA 2XPCA 4Q3EA 1C0KA 4D46A 3K31A 2YHUA 4PLHA 1ISFA 1QYXA 1E7WA 4DL9A 3FNGA 4WGGA 2J3KA 3NTQA 3LLVA 4PLZA 4TRRA 2HSDA 1U5AA 5F21A 5HTOA 4WEQA 4DIFA 3RBZA 5K6AA 1KY5A 2NM0A 2OMEA 2Y1GA 2A92A 5JAQA 3ETDA 4GBJA 4D41A 1B8PA 3F1KA 1I8TA 3QQPA 3R3JA 3ENNA 2X0IA 1T25A 4FIZA 1CDOA 4B3IA 4YJHB 2C54A 4J4HA 3BMNB 3ZU2A 1WLYA 3JSAA 4HFJA 2Y1DA 2ZTUA 5COAA 3U0BA 3OA0A 1A4IA 2DVMA 4K26A 3ZU5A 4CLRA 4PLPA 4Z0PA 4NJMA 1I3NA 3AY7A 1QV7A 3PHHA 4H15A 4DLAA 4BB6A 3OICA 4Z9FA 1RKXA 4W99A 1ZFNA 4NU5A 2O3SA 1YBAA 5T64A 4BGVA 3DZKA 4DIOA 4OHUA 1E3EA 4E5MA 1UAGA 1GCUA 1MGOA 2AQIA 4MIOA 1LX6A 1P3DA 2GN6A 4O5OA 2Q4BA 4R68A 2X5KO 4AJ2A 2X23A 4XR4A 4FFNA 4YRAA 2GASA 3DBLB 1QMGA 1LSJA 4F3YA 5IN4A 1FDVA 1HDGO 2EP7A 2W98A 4WKGA 4XIYA 5TJ9A 1LA2A 1P1RA 1MA0A 3GMDA 3GDOA 4Y67A 1EK5A 3GPIA 5A05A 2NU6A 3H3FA 3C24A 4A5OA 1N92A 2C7VA 4YB8A 4FOSA 4WEOA 5KIAA 4ZN6A 4PLYA 9LDTA 2BFPA 3D5QA 1NYTA 3DB2A 1E77A 1LNQA 1UDCA 3H5RA 1SEPA 4XJTA 4E2YA 1T2AA 2PD6A 2DPGA 4HUJA 5L51A 3CZRA 3D7LA 3I3OA 3MJEA 1MFZA 5KTKA 5CDTA 3C3XA 3DO5A 4L4XA 4ALJA 4DPLA 3H9QA 4XCVA 4ZQBA 2ZQZA 3PHGA 3R0IA 3K8ZA 1KERA 3GZNB 4WLVA 3OQ1A 4IJUA 2GN8A 3C7CB 2B37A 2Q50A 3GT0A 1VSUA 3H3JA 1CETA 4ZQHA 3BMOB 1DRWA 1PJQA 3LVFO 3F5QA 2RHRA 2AHRA 1Z45A 4WOJA 4CLXA 3GNQA 1ONNA 4CM4A 5MDHA 1HDCA 2YFQA 1LLQA 3AUUA 5IF3A 5EINA 3ZI0A 1XHLA 2B5WA 3RWBA 1X0XA 1DOHA 1FMCA 4BO3A 3VH3A 4E21A 2WTBA 1DPGA 4I9UA 3JQAD 4MVJP 1DHRA 1H93A 3NTRA 2QHXA 4IDFA 3HADA 3SJ7A 1X13A 1QP8A 3AU9A 3WGIA 2LDBA 3WFJA 1GFSA 4AJ1A 2HUNA 2OXIA 4B4OA 2IYPA 3I23A 1E7QA 1TI7A 2V6BA 1BG6A 1JQBA 2NV6A 1LLCA 3A06A 3WNQA 4XYMA 3C1AA 3U62A 3KYBA 4DBZA 1LSOA 3OH8A 3IQDB 3PIDA 3PHIA 4GMFA 9LDBA 4OJNA 4YEDA 4YT8A 1K3TA 4B3JA 1YRLA 4I5GA 2EIHA 5EMHA 4J2OA 4GH5A 2GO1A 2CY0A 4XDZA 3VKVA 5JCXA 1MP0A 4FGSA 4R51A 3ZW8A 4RF4A 2I65A 4WJZA 4HXYA 3K30A 1LTHR 3NGLA 3AW9A 3LT1A 3X2FA 4BV9A 1B16A 4OO3A 1E92A 5G2OA 1FDUA 4YCAA 4JJIA 5CEFA 4AJ4A 5JDIA 3AI2A 2CF6A 4E30A 4YT5A 1L7DA 3UGKA 5CEJA 4GLOA 1DEHA 4GGPA 4CUKA 1O5IA 3WLFA 2OP0A 5TX7A 1MC5A 1HSOA 2YFHA 4E5KA 5LC1A 4CLHA 4YT2A 2HMWA 1KEPA 2ZYGA 4AFNA 1ML3A 1LDGA 1IPEA 2CDCA 2ZB7A 3D1LA 3WMXA 4J0EA 5CP8A 4Z0TA 2C2YA 1ADBA 1A71A 4HNHA 4YJFA 4LSMA 3I9NA 3K2BA 4UUNA 1FF9A 1UXGA 3PGJA 3UFXA 1CQJA 4EYEA 3L6OO 1AHIA 1K89A 1V3VA 1EUZA 3CMCO 3KZVA 4IGEA 4BO6A 5CDGA 3NT4A 1O0SA 3D3WB 4JJGA 5T6BA 1NBOA 4XA8A 5A9SA 3PWSA 3DBRA 3FF4A 3H9GA 4P4LA 2D8AA 1BW9B 4QQRA 3ROQA 1XG5A 2NNLD 2NVUA 3DZGA 4BMSA 1VL0A 4FFPA 4UVEA 5DCUA 3RKRA 1QORA 1VJ0A 5BQFA 3DZBA 1NWHA 3D0OA 1B14A 3FBGA 4ESOA 5L53A 4UUMA 3ROMA 4MVJM 3JQ9A 3S8MA 2Y68A 2E49A 1O89A 4U0KA 3ZCXA 1Q7CA 3TL2A 1IUKA 1P1JA 3W4JA 2IZ0A 4Q3BA 5TT0A 3UHAA 1Y6JA 1G0NA 3BTSA 3GVIA 1T2EA 2JKVA 1QLHA 5KVCA 3CE6A 4IDEA 3SJUA 5L95A 3SVTA 3U4HA 4BQRA 5C7OO 5MGBA 2FWMX 5DBGA 3BIOA 2R6JA 2VNAA 1ISGA 1ARZA 2O2SA 3DOCA 4EGFA 4ALNA 2C07A 2NQTA 3ZWCA 3OSUA 5KJ6A 2FR8A 1PEDA 3WBFA 5IDQA 2PH3A 3FPCA 3VC7A 3NTOA 2YQ4A 3IJPA 1WVGA 2FN7A 4RO0A 1UXJA 2FRDA 1PGJA 3DOOA 1ZZEA 3QHAA 1W6UA 2NQ8A 2VOEA 3EVTA 4JBGA 4N7RA 3ZV5A 1JWAB 1T1SA 1Y9EA 5BNTA 2J5RA 1BVRA 4BKOA 3WGTA 2A4KA 2SCUA 3OQ6A 4RPJA 3WGGA 3WQQA 5L45A 4BNTA 2JL1A 2PKQP 3WXBA 3K73O 5ES3A 5CPBA 4B8ZA 3A4VA 4E4YA 3VPSA 3H2SA 4CMIA 3ZW9A 4LISA 2BGMA 2OFPA 1N8KA 4MVJD 1A7AA 2C20A 4YR9A 2RCYA 1PTJA 5CEEA 2HMUA 3H5NA 3PGXA 2IRWA 3DQPA 3EC7A 4GKVA 2EJWA 4ND3A 3TDKA 1JAXA 1PJLA 4RVUA 2Q2WA 3QVXA 3TSCA 4E6PA 4EITA 1XWFA 2X9VA 3LF1A 4LCJA 5C3MA 5A04A 3R3SA 4PLFA 3OIDA 1SEVA 1PS8A 1B15A 1DIAA 2PD4A 2LDXA 3OEYA 4R9RA 4IINA 3JQEA 3V1YA 3VTFA 5L4LA 1WW8A 1JW9B 3FNHA 3PYLA 4MVJE 5AXAA 3BMCA 2VZ8A 3OETA 4UVIA 2WYVA 3O38A 2VHXA 5JBIA 2RH8A 5ILOA 3NKLA 2UUOA 4YA6A 1KVQA 1H2BA 2HCTA 3RFXA 4CM8B 1ADCA 2AG5A 4GAEA 1XQ1A 1R12A 2ZCVA 2YV1A 2EKLA 1HF3A 1CIVA 4L4SA 4JX8A 1U28A 3JD3A 1MXHA 3ASVA 4XEHA 3FTNA 5G0TA 2EGGA 1CQIA 1PGPA 2FZEA 3TFOA 2BLLA 3DZHA 5JAMA 3UH1A 2Y67A 5KNLA 1QV6A 4RF5A 4PG6A 2CVOA 2GLXA 2IE0A 1M6HA 3WBBA 2C0CA 4W6ZA 1I32A 5G4KB 2O7SA 4YAEA 5C37A 2Y05A 3EYWA 2HRBA 5T57A 1XYGA 2QX7A 3D64A 4E12A 1Y8RA 1HRDA 1H94A 4FB5A 3HN7A 3IC5A 4YDRA 5H81A 5F5NA 4FW8A 1D8AA 2H63A 3MWDB 3ULKA 4DUPA 3CINA 2GGSA 4OH1A 3F46A 1MX3A 3PZBA 1Q0HA 3JQFC 3T4EA 5U9CA 3GAFA 2EXXA 3LC1O 1YL6A 5L4SA 2GZ3A 3UCXA 2WE7A 4UUPA 1SOVA 4DLLA 4OAQA 2PZJA 3KTDA 4XQCA 3TZCA 4IQ0A 1TT5A 4FFRA 5JNLA 4BNJA 3BMQB 4R1TA 1JN0A 3DAGA 1UXKA 4B4WA 3V1UA 1E1LA 4K9DA 1BXKA 4MIYA 1GQQA 3INTA 3NV9A 4OMUA 4RVFA 2DUWA 3CUKA 4ND4A 8ADHA 2OO5A 5LDGA 4ZVVA 3KYCB 1SC6A 1P1FA 1E6EA 3ZV3A 4II3A 3ENKA 4AJLA 5JC8A 2I5PO 3W6UA 2Q1SA 3KEOA 1V0JA 1EFKA 1YDWA 3FNEA 1DXYA 1I10A 2QZ9A 1ZKMA 1HYHA 1QYWA 3GMSA 1ZK0A 3ONFA 3PHLA 4GX5A 3I9KA 4BNKA 2Q1WA 3RSHA 2RAFA 2ZKLA 5L4NA 3HN2A 1R4NB 5AXCA 2FPIA 1U4SA 4XQEA 1RWBA 4MVJH 5A1TA 3EY4A 1HXHA 5JO0A 1C0IA 1GV1A 3M6IA 1YONA 1T2CA 4NR0A 3L9WA 4N54A 5IFLA 4ZU3A 1V6AA 4RPGA 1N1GA 3M2TA 2VUSA 1C3VA 2CUKA 3FBTA 4CQMA 2IXAA 5COBA 4JROA 5JO9A 3I52A 4YTEA 4JP3A 4DC0A 1G6KA 1IE3A 1GR0A 5BNIA 5I7FA 1NHGA 1OZAA 2O7QA 3ROPA 1NWCA 1UR5A 1Q0QA 1LJ8A 2NTJA 2NVBA 2BKAA 4J3FA 3CXRA 4O6VA 4MP6A 4D45A 1HWYA 3WQSB 4CLRB 5GZ1A 3E82A 2PGLA 4BGUA 2V6GA 2WJPA 4F46A 3H4VA 1PL8A 1FXSA 3B1KA 4WPGA 2YHIB 1DFGA 3P5SA 1ZSVA 2BRUA 1GYRA 1BXGB 1YDEA 2AMFA 1QG6A 2Y93A 4B4VA 4DQXA 3CPSA 1WZEA 1EQ2A 1CERA 2W4QA 4MKZA 4OQZA 1Y81A 2BFMA 3BAZA 5GMOA 3UVEA 1DC6A 3VPXA 3JQ6A 2E4AA 1ZEJA 3LT0A 4HY3A 5CFZA 1HE3A 3BHIA 3C7AA 1A9ZA 3GFBA 1JA9A 1O95A 1TT7A 4M55A 1MXFA 3KB6A 3HG7A 2HMVA 4NG5A 5IN5A 3LLSA 2GSDA 3VZPA 1K6XA 4EUHA 1E3LA 3WWZA 3TQHA 3LDHA 4JN6B 4CUJA 3L4BC 2J3JA 4YJGA 5IDYA 3TZHA 3QWAA 3UKOA 3I5MA 3D4NA 4FGWA 3P19A 3JQAA 4BNZA 2P9CA 3LU1A 3PJEA 1UP7A 3V2GA 1LBEA 4XYEA 4FD3A 3GDFA 3TRIA 3QJ5A 4N5LA 4Y98A 2DTDA 1F17A 1I2BA 4Q3DA 4D3SA 3F3SA 4H16A 2UAGA 1HSZA 2P68A 2DTXA 2PY6A 3GHYA 1Z74A 1H9BA 5A5FA 1YJQA 4EEZA 4CMAA 2QQ5A 2Y1OA 5JSFA 1ZCJA 3C7DB 2UDPA 3BXXA 1AHHA 5CDYA 4CM4B 3GK3A 1PGOA 3KSDO 1C0LA 3RFTA 3W4KA 3O9ZA 2X0NA 4II2A 4XGNA 1I2CA 4PLTA 1XSEA 5EERA 4LMRA 4Z9YA 4BO5A 2VUUA 4FR5A 1AXEA 4YAGA 1MB4A 3ANNA 1J0XO 1DRVA 2VWPA 3JYNA 4FDAA 3QWFA 4O0LA 3DR3A 3OJ0A 1P0FA 3EK2A 1HLDA 5TRTA 4DGSA 4DXHA 4DYVA 5HS6A 4WLUA 3UXYA 2AEFA 3BTVA 3WGHA 4BNUA 1J6UA 1HDRA 3IOYA 1ENYA 3ZWBA 2ZYDA 3AK4A 1WDKA 2DFDA 3SLKA 5BR7A 3DFZA 3VHRA 1SMKA 3G79A 3NYWA 1VKNA 4Y9DA 4U0JA 3U4IA 5G0VA 2AQKA 1YOVA 4K28A 3W6ZA 1UP4A 4QECA 5KJEA 1JVSA 4R4JA 1MUUA 2C2XA 4FN4A 4PLVA 2W8ZA 4WCFB 4BKPA 3IP3A 2W2KA 2ZYAA 4A26A 2JCVA 3G1TA 1LXCA 3PFFA 2ZTMA 2O23A 2G17A 4CMGA 1HE5A 3FR8A 3Q0EA 1ULSA 1TLTA 4UVHA 3G1UA 1OAAA 3S2IA 3EGOA 3GLQA 4HBGA 1P1HA 2X7HA 3O8QB 3MOGA 3OHSX 4FBGA 3VVCA 4BGEA 2DBRA 2VYNA 3Q9UA 3TWOA 2QG4A 4M86A 3HDYA 3HSKA 4I5DA 3WSWA 2JHGA 1NFQA 2NU9A 2WD7A 1JDJA 3HJAA 4I5EA 4GGOA 3ETGA 3FHLA 4IGFA 3GNSA 1G0OA 2YYYA 5ENDA 3VPGA 1GADO 2ZJ1A 4QEDA 1V35A 3WR5A 3L9XA 1XDWA 3RBXA 3D3EA 4CM1A 5C5IA 2NTNA 3NDJA 3OA2A 1LSUA 1OBFO 3HE3A 4XGIA 2O3RA 3ZGYA 4M8SA 1VRWA 1EVYA 1ZSNA 4D79A 1BGVA 2EKPA 2PD3A 1E3JA 2B83A 1CEQA 4QFDA 3VKUA 3OM9A 4N5NA 3QW2A 1YQXA 1L7EA 4E5NA 2GCGA 3RUFA 4EJ0A 4E0BA 3GUYA 3VOSA 4B3HA 4TSKA 1HLPA 4TZTA 1BMDA 1QYDA 1LRLA 3U9LA 3IAHA 4YACA 3N74A 3KEQA 3KYDB 3HB4X 1RYDA 3NDIA 3TJRA 3W8DA 3JD0A 4B8WA 3DMTC 2Y0DA 1X1EA 2EP5A 3ICPA 1SBYA 5EIOA 4ZICA 2VZ0A 3BHJA 4W82A 4MVJA 4Z0HO 5KKCA 3CZMA 2HJRA 3JQFA 2B36A 1HDYA 3Q2KA 4XKJA 3RKUA 5KCZA 1RM5A 4J4BA 1Z75A 1DIRA 3ANLA 4CQMD 1C1DA 4CR6A 1M75A 3NT2A 5KVQA 5I7EA 4RV9A 3F1LA 2RH4A 4FFMA 1GD1O 4OOFA 3CEAA 1CWUA 4XB1A 2PZLA 3S2GA 4NMHA 1P31A 2TMGA 2B69A 4B4UA 1R4MA 2CFCA 1KY4A 3M1LA 3A9WA 3E5MA 3ZWOA 3DOJA 4IDAA 3Q2IA 1J49A 1E6WA 1GPDG 3TZ6A 3B1FA 4CV3A 4BNWA 5L40A 3I9OA 2BMAA 5TNXA 1VI2A 2O3UA 2AG8A 3RC1A 3QWBA 3NGXA 1FDTA 3PYXA 4CL8A 5ADHA 4U6SA 4XD2A 1B26A 1E1NA 1EK6A 5J23A 4PRKA 2X0JA 1YJ8A 4AJKA 2GN9A 3GF4A 5TSDA 4WE3A 2BI7A 1B8UA 3C1OA 2ZTVA 2X58A 3MJTA 4K6FA 3WIEA 4CMIB 1N1EA 1SO8A 3EAGA 3WQRA 2YJZA 3I9MA 5KOIA 1BVUA 1PR3A 4BO8A 2H1SA 2Y0CA 4RLSA 2OBNA 4RPKA 3QVSA 1JAYA 2TMDA 3PRJA 4Y6SA 2VHVA 2YY7A 4G2NA 3TOXA 4ZHSA 3Q6IA 5C7LO 2PGDA 2QZZA 5JY6A 4OKNA 3E8XA 1Q1NA 4GX0A 3SLGA 3AI1A 3VZRA 5GZ3A 4NFSA 5ITWA 1Y5MA 1BTOA 5DN9A 4Z9XA 1M6WA 1LSSA 3HDHA 5IZCC 4IZIA 2Q4EA 4EUFA 3JTMA 3RBVA 1TXGA 2YV3A 3GDGA 3AOGA 3BMCB 2B4RO 5JDCC 4YJDA 2DLDA 4Y6PA 4IJVA 1E7MA 2VT3A 1EUDA 4NHEA 5LCXA 3IMFA 3GN2A 1H2HA 5L7TA 2HK9A 4BUCA 4URFA 5DOVA 1NPYA 1H6AA 5IDWA 3WWYA 1T2DA 2AW5A 4FJ0A 3WB9A 4E5PA 2IEDA 5JC1A 1BDMA 4ALLA 1YKFA 5KJ1A 1B2LA 1NM5A 1DC5A 1TEHA 3T4XA 4CQLB 3VTZA 4WNIA 2HAEA 3GPDG 3NT5A 4M49A 4MINA 1LC0A 2B4QA 2I76A 3RFVA 3TF5A 4NBWA 5F1OA 1R0SA 4XDYA 2AQHA 5BNFA 4E2WA 2ZK7A 3COSA 2VN8A 1Y8RB 1KEUA 2G82A 1KS9A 4BNGA 3ROKA 4R5MA 3L4BA 4PLWA 4LMPA 1OOEA 3AI3A 3OMLA 4KP7A 3JYPA 2ZB4A 4OXYA 3B70A 3TOZA 2YDXA 1HETA 5DULA 3ZWVA 4KWIA 4DREA 4CLOB 4DRYA 1PU2A 3DBHB 3L07A 3TL3A 1UZMA 3AU8A 4PZEA 4XYBA 1ID1A 3PJFA 3LT4A 5JE8A 1OC4A 5FEUA 2DQ4A 4GL4A 2HQ1A 3ZN2A 4IBOA 4RL6A 4TWRA 1NVTA 5HBRA 2X5OA 1PZEA 3B6ZA 4J1SA 1TT5B 4IPTA 2CSUA 3ZV4A 2IXBA 2GPTA 4XB2A 1DFHA 1UZNA 4ALMA 4ROSA 4KQXA 2NU7A 1NFRA 1WPQA 3ZU4A 5B37A 3IDSA 1ADFA 1HL3A 2C29D 3KUXA 3P2YA 1DJQA 3PDUA 1L1FA 1H6BA 2O50A 4QFCA 5G0WA 4F45A 5IJZA 4KUEA 4GMGA 1MG5A 3INRA 3OFSA 4E2XA 1K0UA 3GVPA 1DC4A 5TF4A 1NAIA 3ADPA 3H5AA 3JQGA 4ZQFA 2D4AA 2XXBA 2WD8A 2V7PA 1DHTA 4NK4A 4RJTA 1E5LA 3EMKA 1T24A 2VWHA 2YQ5A 4MJLA 3GC6A 2JD2A 4R3WA 3NRCA 1Q7BA 2VYND 2BFOA 2G0TA 3AY3A 3UOGA 4Q3CA 2P91A 3HUDA 1DIHA 4FJ2A 4HFNA 4BL5A 1LDEA 1ZEMA 4FSHA 1IOLA 2HRZA 3RQSA 4BO1A 2HK8A 2FR0A 2BI8A 4YJHA 1U8FO 1B7GO 2UYYA 4IS2A 3ZWMA 2P5YA 1MV8A 8LDHA 3WTCA 5DBFA 4DYDA 3JQ8B 4CR7A 4IIVA 3SC4A 4J91A 4YWJA 4AJJA 2J5KA 4KZPA 5I7VA 5FYDA 3AM3A 4RVSA 4EZBA 3QVWA 1P44A 3N58A 3PTZA 1UH5A 1ZJYA 1ORRA 1WXDA 3W1VA 5HM8A 1N5DA 1EDOA 3NAQA 4NBTA 5T67A 1LI4A 3I9JA 3E48A 4GPD1 1O94A 1G1AA 2EGHA 4WLOA 4E31A 5CDSA 3ZDFA 3PP8A 4P4GA 1HT0A 2CMDA 1IZ0A 1LDMA 2PWZA 4E32A 4NBUA 2B5VA 4L8VA 4M54A 5AXDA 3V2UA 5EESA 3O03A 1T1RA 3AM5A 3D5TA 2VZ9A 1EZ4A 4J1QA 2CDBA 4ZRNA 1UDBA 4DPMA 1KOLA 1PQPA 1DFIA 4JK3A 4Z3KA 1YE3A 3QE3A 4LK3A 1GYQA 3VZQA 1GDHA 1BSVA 2WMDA 3KVOA 3GH3A 1JKIA 5C7IO 1EMDA 1DSSG 3T7EA 3ADOA 4TQGA 4YJGB 2PGJA 3JD4A 1E1KA 1E3SA 3F4BA 3JQAB 3PIIA 4MDHA 1R15A 4AICA 4JBIA 2CF5A
chains in the Genus database with same CATH superfamily
3WWOA 5F2OA 3TO5A 1BD3A 3TMYA 4E51A 3BD8A 1IBRA 1K4KA 1M2EA 1YBHA 3C3MA 4MWOA 1JSRA 4QT0A 3AEKB 1I2MA 1Z0AA 3ZE2B 1GAEO 2HRDA 1G9TA 1HKUA 1CUZA 3BDAA 1RYFA 2ALJA 1OYOA 4UMFA 4Q6WA 2VQFB 3FYHA 2PRYA 1R50A 2O5RA 4IXTA 2OB2A 1QX3A 2V3CC 1X8LA 4KU4A 3GX1A 4OXNA 4EPWA 2Q2QA 3K6JA 3NHRA 4ABYA 1IY8A 1NBIA 2BGLA 2ZDGA 2R1TA 2VT6A 4KE7A 4QICA 4ZQCB 3SVZA 1Y7LA 1YB1A 5DYNA 4MVJI 2AT1A 1Y3DE 1OASA 2P2DA 4H08A 4DCGA 1F60A 5EYPB 1MORA 3VVBA 4LJ6A 2BDUA 3O0TA 4JP5A 3QVMA 5EUMA 1DMRA 4LJKA 4D98A 1IB0A 2NUPA 3LQQA 4O0MA 1SVMA 1GL3A 1RAIA 2AI2A 4NZZA 4Q1FA 3SJAA 3UENA 4EJSA 3MEQA 1X7HA 5GIPE 4A1OA 4JEHA 3TECE 1JI0A 3GJXC 3ZZ1A 3DM5A 5LQJA 1U0FA 3MTEA 4W7SA 2ARKA 4JSRA 2DXIA 1IONA 4J6FA 3RSFA 3HDGA 3O3MB 3IDZA 4OOEA 3IUJA 4OQXA 1SNYA 4PIVA 2XD9A 4BV8A 1M54A 3I6ZA 3QUAA 5DT2A 3V1MA 2KBFA 1M66A 2P27A 1L8XA 2WYWA 3KEMA 4NBNA 2Q62A 1DKQA 2NO0A 3FSGA 5F1YA 1J7JA 3T7TA 2WPDA 4H1TA 2OV2A 1X38A 3DE1X 3MD0A 1SKUA 3DGFC 4LOAA 4H0FA 3W1EA 2E48A 3OMWA 4X3CA 3W2EA 1LEHA 4WACA 1C7RA 1YJBA 2HFJA 1UFRA 4A8TA 3QI2A 3CZ4A 4M0LA 1GGMA 3LCUA 3MXTA 2BMFA 4D8UA 1VJ1A 3DFUA 1FFWA 3ACDA 1G17A 4QOJA 4DEVA 3G7UA 5K3AA 1KK3A 5CDFE 4JNCA 2X1HA 3I8SA 1RI3A 2CVQA 4N6OA 3ZHYA 5DIZA 2B98A 4XWAA 2ATCA 2XYVA 1TW2A 3LPMA 1PG5A 4P82A 5TB5A 3RVDA 4BNFA 3IE1A 4RAQA 4PICA 5E9QA 4EYKA 4D0GA 4AK9A 3WC4A 4XRGA 3LKZA 5IAAA 3PFWO 3K1AA 4G5YA 4RCYA 1GT6A 4ZCQA 2P41A 1A04A 1MQ8B 2PGNA 3HCFA 2DH6A 4G81A 3WB0A 2GLTA 2OGSA 3MBKA 3HABA 4YV2A 5EJIA 5DBEX 3EMDA 4Q4JA 1XRSB 2ZUSA 3GJ8A 5ALUA 4EW1A 3HU2A 3BC1A 1GUAA 2J59A 3EZYA 2PV7A 4WLEA 3A1FA 2V59A 4DCTA 1YRAA 1ZK1A 3IAAA 3PKJA 1VJRA 2J41A 4AN1A 2P1DA 3LTEA 2RI6A 4ACAA 1M6YA 2V8OA 1KJNA 4QJBA 1XYVA 2GBLC 2ZSKA 2QU7A 3CO0S 1RRKA 3PGMA 1NVWQ 4XSHA 4DV6B 4LCEA 3IJ5A 2O8DA 4DJEC 2DBYA 1XELA 3EVDA 1BW9A 3BRWD 3UOAB 4R1NA 3JD1A 4R16A 2H2IA 4FBMA 2I9PA 5JDCA 3GEEA 3IUSA 4ZAYA 3MMPA 3KR1A 4DF3A 4JVSB 4QUBA 2JAHA 1UMKA 2DBVO 2ZRIA 2QD3A 3A2LA 3C8MA 3Q5EA 2Z1MA 2IHBA 3UMVA 4QFCA 4AP9A 5EJ5A 2VTEA 1WZCA 3OQNA 4AVYA 1EX9A 4BFVA 4X00A 2XA2A 2HU5A 1L4KA 2IEBA 2V7TA 4N4AA 4AY4A 1CJUC 4WZ6A 4YP5A 3F8TA 5GGYA 5TV2A 1GG8A 1PWYE 4RGBA 2VBGA 2FUEA 2LZ0A 4UU0A 4AUEA 3GJ7A 5K0GA 1CYDA 2XNDD 3BS4A 3PI7A 5KEIA 2C8VA 2ZRMA 1CSEE 4HZUB 4E4RA 4YXFA 2HA4A 3B6MA 1WKVA 3AUYA 3OPNA 3RUEA 3ONEA 4Q3AA 2I6GA 2M98A 4UHBA 2A1UA 2RG7A 2VP4A 4CFYA 5THQA 5DGCA 2GOYA 3C3EA 4JGIA 1USIA 2JLSA 3ZC3A 4ZCRA 1ZJZA 2PFGA 3QBEA 1P33A 1FEZA 3WA7A 221PA 3BSSA 1W5SA 5CK5A 1B43A 5IBRA 1I1QB 2ZR7A 3G0IA 2LP4Y 1PQ4A 2UV8A 5AJYA 4BNNA 4JB3A 2WDZA 3WB1A 5JADA 4A36A 2XITA 2I3ZA 4MJ3A 1UMCB 2HWXA 2PRJA 3P71T 4TTTS 1S96A 5CVCA 4DY6A 1USVA 1XJQA 2H07A 4I8XA 2XT6A 1Z82A 2AJBA 3DBOB 2X8JB 4REQB 4CF4A 3X2EA 5ILGA 4DEXA 1W5AA 1IUNA 3IJRA 5F2KA 2XCRB 2OO3A 4KWEA 2BFAA 4TLCA 3WYDA 4C01A 2JFYA 4ZRMA 5IS2A 2FOXA 4MMYB 1P6XA 4PAGA 1U6IA 3MWJA 1C9DB 3LWZA 3B36A 4CM9D 1U7XA 4XYLA 2J3HA 2YW9A 3IP5A 1IG0A 2PLRA 1Y7PA 2VTDA 2UZAA 3H2IA 3WFZA 4MVCA 3J7AC 4P5PA 1U2SA 4YLGA 3D6HA 5HUQA 1FNMA 4FOPA 1NT4A 1PUXA 3E9RA 4L5JA 4DRZA 3VU9A 3P4YA 1P4GA 4I1IA 1ZGZA 3MQ2A 2ZATA 3IXQA 2IC5A 1U5CA 3THWA 1G6Q1 1GQYA 1O94D 2QRPA 2R8EA 1NVMB 3Q9NA 4E03A 3WDMA 3ZZ0A 3M0EA 1O6FA 2QTNA 5IAOA 3GJ0A 3OZAA 4TVOA 4RTMA 2QYHA 5DU2A 4Y7DA 1U9YA 3FUTA 2QN8A 4TRNA 5K2OA 4CN8A 4J7XA 4A16A 1EBUA 1GYPA 1P74A 1DXOA 3A6KA 3PYMA 4J1NA 5EWJB 2PFKA 1HLGA 4G65A 3Q9LA 1T6NA 4RZIA 4YQEA 3JZIA 3SWWA 5AD1A 4OGGA 5EUCA 3ELYA 3MFQA 3MJSA 3PTAA 2OWEA 3BOSA 1D5WA 2DWUA 2VJOA 4TWZA 3EVNA 4RVHA 4C1NA 5A02A 4CIAA 2WJGA 1FLAA 3BRQA 2J0UB 1JLRA 4EQ6B 4ZARA 1GCGA 3GPLA 3S7ZA 4JC4A 2C5HA 1Q0LA 4B7UA 2HT1A 1WF6A 3LCRA 4LCBA 1UF9A 3CCBA 3EIFA 4WZAA 1H1DA 1V16B 3A70A 3GGCA 3GUZA 4S1VA 3WJAA 2QUBA 3RFCA 5LOVA 1UP6A 1F1JA 4OSPA 3LVBA 4RE5A 2YFKA 1FYDA 5IXSA 3VV3A 4DCSA 3IOCA 4DIBA 3LDAA 4EHAA 2JEYA 2Q4RA 1U2PA 4BP1A 4L02A 4IIEA 1P0CA 4H7DA 3KUCA 3ZLVA 2DAPA 4WZBE 1V1JA 3TSAA 1PS9A 5D7NA 2OA0A 2CK3D 1JVBA 1LWOA 1PLKA 2R4UA 2WYUA 3BWBA 1F4LA 1I3MA 5JAOA 1RRFA 4Q9IA 1I24A 2CVZA 2FMUA 2JFGA 4BFXA 5LU9A 4RTRA 1QFYA 5JUWA 1EZ1A 3C3KA 4UHEA 4XWWA 2VAPA 4MOWA 4Q15A 2B82A 2ZSHA 1PL6A 3F5DA 4Q19A 3RJTA 1GAQA 3GGJA 2QT0A 3D2BA 4NENA 4DMMA 3QKSA 1X8KA 1QHNA 2RHHA 4U2DA 5B2FA 3ZBUA 4TTSA 2ZM6B 3EPJA 3AL0C 1AE1A 4X41A 4NH4A 4TS3A 2PJDA 4ZCPA 1VGRA 1T9DA 3MJRA 2BBTA 2PR2A 3IE2A 3N2KB 3SYKA 3HR8A 2CKDA 3FKQA 4XIGS 4ZEWA 3KQMA 3SAJA 4ZRDA 1HE2A 2ZWVA 4BE9A 2JFFA 2K5UA 2V7WA 2ZGVA 3AUFA 3FN4A 3N7AA 4I6GA 2W0SA 9ABPA 5L9AA 1C4KA 1PWHA 1PZNA 4KWTA 5AI8A 3L7CA 3NC0C 2ZYIA 3L92A 5A3JA 4TRJA 4LVNA 1LVHA 10MHA 4EKEA 3F6PA 4D42A 4KFTA 2EFHB 2R751 4MHOA 4GHWA 1GLNA 1TMGE 4KXLA 4P31A 3DZ8A 4MZXA 5JRDS 1WTCA 1SU4A 3C39A 3NETA 5DLPA 3RIYA 1NX6A 1RXVA 1HRKA 3UPDA 3QX7A 2MR5A 4PBSA 3O6VA 1VCHA 4NQZA 2CNBA 2E1RA 2PU7A 4LDZA 3RU7A 4R40A 4D6YA 3WP0A 2EERA 4QVGA 4MP3A 2IU3A 3KYCA 3NYQA 3CCCA 3EULA 1MA3A 4NCHA 4AMBA 1I51A 2JD0A 5DCWA 4F56A 3NEPX 3CMMA 2QORA 4ITVA 1QTRA 2NXNA 5EUBA 5TPWA 4BO2A 4LYHA 3KVNA 1F0NA 3FPGA 3NHMA 5HHTA 4A8JC 3TW8B 4OM8A 4D3FA 1QQBA 2VUTA 2QTRA 4M1EA 3S70A 2QGNA 3ZWAA 1PW7A 4H6WA 1SOUA 2FY8A 3DKVA 1RRGA 2C4MA 1HY3A 2YWHA 3LECA 1NP3A 2FNAA 2GHRA 4R2KA 5CX1B 1SXHA 2QNBA 4N0PA 1KK2A 2FU5C 3DE2X 2ERYA 1RVV1 3FRJA 2X5NA 3DZIA 3ZLBA 4OHOA 1YNSA 3VR1A 4AZ3A 4C5BA 3QXGA 3I83A 4MCJA 1Y7HA 3RNLA 3F90A 2IYXA 3WIVA 1X7GA 3DE5X 3F8WA 1G16A 3N2LA 2Y66A 4NPCA 4AKTA 6NULA 1CJMA 2MYTA 4MRMB 1ZK4A 4LRTB 1BKSB 4M1TA 4V0QA 1ZN2A 4DCOA 1AA9A 1GL6A 3KV1A 4QDUA 1L5VA 1R27A 5LYJF 2LR0A 3Q8KA 4LXHA 3FKJA 4WI1A 3NH9A 4BX2A 4BL5A 4R1UA 1TZ2A 4KFSA 3WLTA 3VR4D 3VU1A 2P5SA 4GNKA 5DGHA 3IGFA 3HB1A 1JDVA 4IWXA 4M21A 1TA4A 1Z7WA 4ERNA 4Q1CA 4P35A 1QH8A 3R8CA 3THYB 4RFLA 3RAJA 2IUYA 2PVPA 4PX5A 1SCNE 1MJHA 2BGJA 1TVKB 2HOQA 3OLVA 3HA3A 3Q9SA 1RACA 3QXXA 4N65A 4TVSA 2NZUG 1BYIA 3NHKA 2XJ9A 3NWPA 3L84A 4IDBA 3MOIA 4LTNA 3ME5A 3RVPA 4UOZA 1OTXA 1KI6B 1AF7A 2QJFA 4RA6A 3T0IA 1I6WA 4QVIA 4DSUA 2P9JA 2E37A 2QPLA 1T3SA 5BRAA 3CUYA 4MUKA 5LQUA 2YHIA 3L4JA 1T0JB 4IKEA 2OHOA 3A1UA 4MR9B 2PZBA 4K1LA 3LV8A 2D0DA 3O21A 4L8GA 1OVGA 1P77A 2Q0HA 1IBMB 1A4XA 1VLJA 1MB2A 2OD7A 4KKVA 4F38A 2FMIA 3B52X 4TTRA 2PNFA 1L5LA 4Z2AA 5IT4A 1FMFA 1K3UB 1US8B 2NT3A 5KS2A 3KM0A 3WLJA 4ZO7A 5AVOA 5JISA 5DT9A 1O1YA 4BGIA 5CUQA 2D0OB 5K0SA 4F3RA 3R7WB 5LP6C 1CRWG 3DMPA 1C1HA 3H6KA 1Z22A 5FTKA 4M4SA 4WSOA 1TQ4A 5B1EA 2RGRA 3AVXA 4BQPA 2RC5A 4TQAA 1DAPA 4FDUA 1CY6A 2EKZA 1X7ZA 3AILA 2OOSA 3H65A 3KJNA 4RIEA 3FTDA 3HBAA 1JWLA 1UT8A 4J9UE 3OEWA 1SZJG 1CG6A 1P9NA 3HBNA 1IZ9A 2I1WA 3VPFA 1W29A 4N40A 1D2GA 1PHRA 2C4WA 3Q0IA 4BTEA 4LA4A 2PVCA 1P5JA 3B3QA 3RROA 4A5SA 5FCDA 1KYQA 4Q39A 4JJKA 4KIFA 2ZBEA 3D8BA 3VR5D 2CNNA 2GTIA 5ESDA 1DCMA 1PR1A 2IHYA 2ZS8A 4HTAA 1EK0A 3VDMA 2ZWOA 3GJQA 1AVTA 5EGSA 2DT8A 5GY7A 2H18A 3L7OA 4HRVA 3RJ5A 3EW9A 3GRPA 3GGDA 3S44A 4BNXA 1N5RA 5D3MB 3O8BA 3U3RA 4R98A 2N9UA 1AOXA 1GPLA 1GTMA 3O1JC 4IM7A 4KXVA 4NZPA 4DCUA 3BTUA 3VR3D 1KC3A 2G72A 3ISJA 4GM4A 3IKJA 4WCDA 1M8KA 1EGQA 1N25A 2PLFA 3M1AA 1IXSB 3MWEB 4MR8B 1VSQA 3ILSA 1EUQA 4LZOA 3NUGA 2ZR8A 2X9NA 3AJEA 4RGQA 4YR7A 3AKYA 3BZBA 1Q91A 3CA8A 3K4QA 4LYAA 3RUCA 2NZWA 2R2GA 3D7NA 4Z9BA 4JU9A 4QOSA 1OT5A 2W6OA 4PLCA 1H2ZA 4XCQA 5FOSA 1XIVA 4DOMA 3COPA 1WMBA 1YGPA 2WWFA 3FYDA 1VPLA 3K9BA 4X6YA 3OX2A 5FBLB 2PBRA 3IX7A 3WRWA 3KP1A 2F59A 3KXLA 3KPUA 3MUFA 3VH2A 1F1BA 1Z7EA 2WFLB 3P20A 5FUXA 4ZCIA 2Q3BA 5T8KA 1ZR4A 4MQMA 3ESZA 3Q87B 4UTNA 1WCYA 3NM4A 2ORIA 3CH4B 4QGAA 4QHTA 4RCVA 4RXTA 5K1ZA 1XMOB 5BSTA 5HFJA 4U7TB 4A2CA 4AY5A 4B6OA 2YUTA 1CQIB 3ZX5A 5CIQA 1I1NA 3KKMA 3UH0A 3PWKA 4IUCS 1ZHHA 2NU8B 5B3LA 2D13A 2G70A 3MTQA 4RPIA 3KZCA 4KRYA 3I1YA 2EBUA 3V5NA 5EJ2A 3GLSA 3PXBA 4YUXA 4LKRA 2PU5A 2IDKA 2DHCA 4IHAA 5TR9A 4NZ9A 4QEKA 5DMXA 4KMSA 2QAIA 3WMFA 3L7YA 2PKQO 5AM5A 1FYVA 2HV9A 3E7XA 1Q20A 3DEZA 1GN9A 1JDBB 4IOJA 4GR4A 1YR2A 5JCJD 1EUCB 1W25A 1RYEA 2HU7A 5ALMA 4KAJA 3ROGA 1E6MA 1FFAA 1LUAA 2FGJA 5CPFA 5FXMA 1K2VN 2Z98A 5FTMA 1WQ1R 4HPWA 2RGUA 1KOJA 4ZPXA 3B5JA 4JMPA 5CJ2A 3F73A 1O97D 4DR2B 3BRWA 1GQ2A 2IBMA 2I6SA 2J3EA 2VRWA 3DW3X 1FRNA 2QKYA 2RKWA 5EIBD 3W06A 4B6PA 1EFPA 3WLHA 5DDIP 2HQSA 3AT1A 4JYBA 4B5KA 1GXSB 2K4MA 4LYDA 1XXLA 1JE1A 1I7QB 1WUIS 1RC1A 1SULA 3ET4A 3IBFA 4BNLA 1BCRB 2GK6A 3PC8C 4YV0A 5I6DA 3OUTA 1OD6A 2R8PA 4FHEA 2F6RA 4UBJA 4OD0A 5AI5A 1GJRA 4EB0A 4PGAA 3HH8A 4FD2A 4JJZA 4ZQIA 3OCXA 2CCGA 1GGKA 3WK6A 4QOIA 2GEVA 2UUPA 1KEWA 1Z9BA 3HWWA 3ZDDA 3H0CA 3NHBA 2FPSA 1Z15A 2A84A 3KDAA 3R1IA 4Y2XA 3W7AA 5ITZB 1TE2A 2XNDA 5HF9A 2W6ID 4E2ZA 4X8LA 1RRVA 1Z3CA 2W2LD 1R0XA 1KYXA 4ZT6A 4EGSA 1J5PA 1P19A 2DT5A 1T4DA 2I6QA 1KKUA 2JGDB 2RGXA 2H48A 3D3JA 4NV3A 1E7SA 3HCRA 1I3OA 1S3SA 1U3DA 2AGVA 1KIMA 4L6CA 3WYCA 4BMVA 5CTJA 1UXHA 5GM2A 4DLVA 3AF4A 4BJ1A 1ETUA 1M7GA 2WIGA 3K70B 2HEIA 2ZETA 1NGSA 5JSZA 1XC7A 1H9CA 3IIIA 2EF1A 4LJSA 1XTRA 4D6PA 4LQDA 4ESVA 2WIKA 4E09A 2XADA 1KVTA 3NX4A 1WHTB 4ILEA 4K05A 4WX2B 2P9ZA 5DHSA 1RHUA 2JHAA 3FVTA 4UCWA 3UCFA 3WTBA 3ZWXA 2Z8ZA 4CZ2A 2C7BA 5TC4A 1NTOA 1D1PA 5NULA 4YN3A 3KJXA 3EWNA 1U2DA 1EJBA 2C3YA 1QR2A 1VE7A 2XLCA 5KO2A 3ETHA 3KT0A 5CTAA 3QUSA 4U6QA 3NR2A 3R5JA 1J0AA 1E0JA 1LLDA 2R8RA 3EIEA 2I2WA 3KKLA 4X7BA 3ED5A 4PG4A 5C46F 3B1XA 5C32A 3IBSA 4CM9A 3FR7A 5ARBA 2JFBA 1UEJA 4UDYX 4EJ6A 5C53B 3LSYA 2ADFA 1BU5A 1OLUA 1TFUA 3PQEA 1U11A 1SKYE 3D4OA 4JBNA 3WWPA 5JJCA 1XXHA 2V1XA 1RWMA 4MW5A 4YPFA 2OCXA 4UNSA 4KXQA 3TW6A 4FILA 4CU5A 1XCJA 3IVCA 3R3YA 1JR3A 3GUUA 3QFTA 1JKFA 2BDEA 3ENWA 4DMGA 4UBIA 4MUXA 2PSDA 4ES6A 2ZWPA 1SGWA 4RVCA 4Z3DA 3BL5A 3VHXA 3KSZO 3TTUA 1N2JA 3IQXA 4YMGA 3L4SO 3OLWA 5BO5A 1MTOA 2QSZA 3K2EA 1EA7A 1C4XA 3WMEA 1HYEA 3TCXB 3Q98A 3K5WA 3L6RA 3TSYA 1U8UA 2ACEA 2BR4A 3OPQA 4MKFA 2VZEA 1GITA 5E6SB 1LH0A 3CLUC 1FLNA 2XCTB 4MO2A 4QUJA 1CHDA 2UVDA 3NM6B 5ERGB 1UXOA 2NSDA 2PL1A 1LRKA 3OX3A 2WQ7A 1QAOA 2Z6UA 3DEFA 3ZHRA 3HI4A 2UZ1A 1RR6A 3O47A 2JGIA 4FNOA 3VDRA 1RYYA 4CMHA 1CY8A 2IYLD 4HDRA 1YZNA 4K9MA 3OZ7A 2ZRGA 3TTSA 1DT5A 3W78A 3O4IA 3U17A 1C50A 4E5VA 1Y8ZA 1IPHA 4J16A 4URYR 3EUWA 4RH1A 1YR7A 3SS9X 2BVNA 5MFPA 3ZTYA 2IHJA 2X1MA 4UDOA 3KLNA 1P4AA 4MS3B 3H2ZA 3GZNA 1T5BA 3RIHA 1VJTA 4CODB 1KK1A 4EMTA 4OP1A 3SC6A 2PBZA 3H11A 1AT1A 4KLRA 5LLTA 3P52A 1JXAA 1N5KA 121PA 1N78A 1OMOA 1VM6A 4N3AA 2J4FA 2CK3A 1B2RA 2VJCA 2QAGB 2ZIFA 4QXOA 4FEYA 4WLNA 2GN4A 4ZAXA 4ZV7A 4PXAA 4WECA 5B7QA 2BUAA 4Q3NA 4KQ6A 4ZYYA 2DM6A 1P4RA 1ZSYA 2RGAA 5TGDA 2CVPA 3H9JA 4AS2A 4DA6A 2E5LB 1V8OA 3OAAD 1HTWA 1CS0A 1YR3A 1SZDA 3H8VA 5AVWA 1WUTA 2MINB 1T9KA 3O92A 4ENQA 4P3OA 3OHMA 4BCBA 2FEAA 3KRTA 2R7MA 1E6KA 3SR4A 4Y2RA 2MSCB 4LGMA 5AI9A 4A27A 1JJVA 3BSWA 5HUJA 2WWYA 3RAFC 1U4OA 1PL0A 3ZY5A 4RANA 3FNFA 1IY9A 2G06A 4BVBA 4BAZA 4H1WA 5AYVA 3A32A 3FPFA 3DDZX 3BKXA 4I55A 2PRSA 3BD6A 1U3VA 3ZZMA 5LB2A 4AN0A 1GSIA 5I47A 3DBVO 1W5FA 4QULA 3OCVA 4K2AA 1HR0B 3GGGA 2ZIZA 4P4NA 3UAGA 3IEMA 2AA3A 1KZ1A 2JGNA 3AJ8A 2OMKA 1G55A 3G88A 2GM5A 1TIPA 3IQHX 4KQWA 3EZFA 3TD6A 5I7WA 2CNLA 3TMKA 1QAQA 3CRW1 3AJ9A 4IHJA 2IOFK 3ZNPA 4ND8A 1ZD2P 5ALDA 2ASEA 2ZSJA 1C4WA 3DXYA 1OAOC 2JLRA 3E18A 4MB2A 3SIWA 2R60A 4PZZA 1K63A 2OP1A 4PPFA 1AZLA 2I3GA 1FPQA 4J3NA 1U2RA 4EENA 3F9IA 4UOEA 2PR7A 1KYYA 5EE3A 1RT9A 3K96A 4H7IA 2CDNA 1SFRA 1Q7TA 3PKZA 4GQAA 4NATA 1NVGA 4B31A 4CW7A 2P4UA 4O1MA 2ZXFA 2O05A 1RQ7A 4N3GA 2GH1A 3ZE6A 4FCCA 1J2JA 2YIVX 4KO3S 5G41A 2Y1CA 1BNCA 4A8PA 1T4GA 4ZDWA 3LUAA 3N8IA 2GPJA 2GNAA 3AVWA 1ZXXA 1T5TA 1MFPA 3K9GA 4DHWA 4NRDA 1UJBA 2AE2A 2WWIA 2OGWA 2ZI5A 3JYLA 3O4JA 3K7EA 3KWLA 4MROA 5CVJA 1YR9A 4CLOA 1HPLA 1UQRA 1AS2A 2YZ7A 3LZ6A 3QVLA 4L4RA 5AM4A 4AMVA 4XQGA 1OWPA 2QLMA 4TMVA 5HK8A 2OCKA 2IDZA 4L3VA 4L22A 5DBIA 3ZUGA 5J2TF 4PNPA 4R9SA 4RZHA 2Q3JA 3RAPR 2LCQA 2JI6A 1G5TA 2IWHA 1Y6GA 2FV8A 2RJ3A 3LW8A 4HAOA 2VR1A 5HEKA 3ZV6A 3W5DA 1X3LA 1ZNZA 4EA7A 1B73A 3K6RA 3KSMA 4V0KA 4WXEA 5CLHA 3VI4B 1E1CB 4ARVA 5CG1A 1F12A 4KL8S 1G7SA 1FYWA 4HXEB 4ZAWA 3GLKA 3O4GA 2YC2C 4XZ3A 2NU9B 4R1PA 5B1YA 5HNKA 1HX7A 3MB8A 3D3WA 3X3HA 5A7FA 3FYUA 4GWGA 4UU8A 3ONNA 4JQSA 2FN4A 3ZNQA 3Q1LA 5FO0A 2EJTA 3C6QA 4L9SA 3BA6A 2P9BA 2V7UA 3CZPA 3NC1C 4IDGA 1ODTC 4OQMA 1TKBA 4JNKA 3T9FA 4OHMA 4WINA 4P0TA 3RPEA 3SI7A 1NXXA 5BMOA 3OU7A 2JLXA 3IPLA 5KWEA 2XCQA 5H9WA 3ZWWA 3SQNA 5CA1B 2F1KA 4UCFA 1PJTA 3BEOA 4V2IA 5FL7D 5M34A 4R01A 1JDTA 5ICSA 4GRAA 1LNZA 1GKUB 3TQCA 3VSEA 2AC4A 4TWJA 2ODAA 3R9IA 2IUSA 2KPOA 3C3DA 4P36A 4Q03A 1XB2A 4FPXA 1V5EA 1AKTA 2AOXA 3AETA 2CE2X 2P62A 3CLSC 4MQBA 4ND2A 1VFNA 3WYNA 4F4JA 4P54A 3FTFA 2HY7A 3TLCA 1GZ6A 5DX8A 4JWTA 2ZPUA 3ASUA 2PE5A 1A8PA 4X1IA 4HS4A 3WV4A 3O2NA 4FLEA 1D0VA 2W6MA 4EL5A 3S3TA 5DRYA 1FUYB 2QYTA 2NSLA 1IAQA 1PL7A 2EQAA 2QRKA 2CMHA 3EXFB 3UATA 4YVFA 3HB7A 2FFRA 4UQPA 2A88A 3DLTA 4P9NA 1I1OA 1N75A 3DMHA 3SBEA 4IWNA 4DQLA 1HM5A 1ORDA 4LY0A 2V9CA 2ZQYA 2VZLA 3D4IA 3SEFA 1T6BY 3ZZUA 2VRCD 5D86A 1UKCA 4RY0A 1D07A 2QJRA 5JZSA 3GA0A 2CV0A 1T2NA 2DHRA 3M2PA 2WHQA 2ZVDA 3VXKA 3QBTA 1O8CA 3R0QA 2F00A 1Z47A 4N5MA 1ZM4A 4K2HA 3WO1A 4YJ2F 3VJMA 4EY7A 3D8HA 1OLSB 5JQWA 1VFPA 4RZSA 1J07A 4YRIA 4LDAA 1PBNA 3VR5A 2ZSUA 3X1JA 2EDCA 1ZISA 2FJPA 5IEJA 1ZQ1A 1O0CA 1Z3IX 3VI3B 1ILWA 4MYSA 1N5LA 3ELBA 1K06A 4MYCA 5GJBA 1U7HA 2DPXA 3BL8A 4DFDA 2C03A 5F35A 3DD5A 3UMGA 3QMMA 3V32A 3FX2A 2CXXA 3K35A 4YC7A 2H9IA 2FZGA 4U7WA 2HHHB 1H66A 1KEEA 2QDXA 1SPXA 2B1JA 1XAGA 3HMQA 4H60A 4INAA 5KAMA 3VR3A 4FZ5A 4UZSA 5ICMA 5EHNA 5HYVA 2QSUA 3GLHE 4RULA 1SIWA 3K4HA 3EFBA 5K0LA 4GOMD 5EOVA 2Q9UA 3RK4A 3VYSB 3AZPA 1T4CA 4AO6A 1SHLA 1NMSA 3UBMA 5FHRA 5K2MA 3PENA 5K09A 1PDVA 1PWXA 2WVAA 3QF4A 2BH9A 3D81A 5HIMA 3UMMA 4KSCA 3BCHA 4MQUA 2D2IA 5JW6A 4HEHA 3OJWA 2B4KA 1CUYA 1E5QA 3EXHA 4KGVA 3ICEA 3QVVA 4XLZA 2OORA 2Q3MA 4DA7A 3KKKA 3GVHA 4MS4B 1VI6A 4ZYXA 1AF4A 1H3FA 4FOOA 1JF8A 2KE5A 4I8IA 2JGMA 5JWOA 1IOVA 5DOZA 5A6SB 3R6GA 4HDNB 4N0MA 5DI3A 7YASA 4BQFA 2FETA 2Q9AA 2FSSA 3OPYB 2F43A 4NDNE 2AG1A 1F2UA 5J63A 4DIKA 3N2IA 4R8LA 2HNKA 5K0NA 2QW1A 2OV4A 2PEYA 4ZO4A 2CHUA 2XGSA 3AEKA 1RRPA 3IQGX 1I3KA 4U7PB 4D5GA 2ZRNA 1KNQA 5SZJA 1V96A 2F1IA 4M1OA 4RQUA 4XIJA 1K2WA 1BWRA 3A26A 3SQMA 1LBQA 3CW8X 4CMIB 3IS3A 2O3QA 1T0PA 4KK4A 2F64A 4JI5B 1MV5A 1R66A 5JCJA 3QXCA 4C0KA 1M2OB 1VJCA 2BHTA 4JBWA 4EELA 3KR2A 4R05A 4W5OA 1ECCA 1VDZA 1SB8A 3DMRA 3AOEA 3IPAA 3L82B 3PT9A 5CB6A 3O31A 2E3JA 5LQNA 4QGFA 2YDYA 2WJ4A 4OB7A 2XE6A 2AN9A 4UCQA 4A2PA 2A8YA 2J6BA 4UPVA 2IHZA 2HHLA 5DNEA 5JYDA 2VTBA 4OK5A 2UXDB 2GK7A 2RB5A 5D3QA 2R1ZA 1WTAA 1ZJ5A 1XVIA 4Z3OA 2WKRA 4YREA 4C2TA 3JVDA 4DDMA 5TJHA 4F21A 2C2WA 2MSWA 2A0KA 1XCOA 2OV8A 3UGQA 1TM4E 5G4KA 2RIRA 4HV4A 3UUWA 2YW2A 2XUFA 1JU3A 3U7QA 2ZTLA 3N3BC 2DETA 5B6IA 3FSRA 3VNAA 3SHFA 4YPOA 2VXCA 1OTHA 3G7NA 3LYAA 2HDNB 3DHWC 3I0MA 1THGA 4IOKA 1IFXA 4FCWA 5DP1A 3H8WA 4MV4A 4RFSB 4YRMA 3ADCA 2ONCA 3BB1A 3PGVA 2W6IA 4O2LA 4EUNA 3A9UA 3HJBA 1EVKA 4IRUB 5IXYA 2TYSB 1UFVA 3PXUA 4I14A 2W2LA 5IMSA 3KETA 4BJ3A 3OP4A 2EWWA 1VKOA 3K9CA 5FHQA 3VOTA 1M6NA 2D5CA 2D7CA 1XEWX 1M1NA 3E3LA 4TWBA 4UAGA 4Y2HA 1KBOA 3RASA 4PFKA 1N0UA 3TTTA 3E2PA 5GONA 1PR2A 4GC9A 3ROEA 5JATA 3H1EA 4Z4CA 3SXPA 2FE4A 2HK6A 4ZU1X 5CCDA 4B6RA 1KNXA 4D25A 3GDHA 4PYKA 3M89A 2RK6A 4R3UC 2H5JA 5HE9A 4AD8A 4IMRA 4CIDA 1IL0A 1IY0A 3TIVA 2YIJA 3SSAA 3RYCB 4EI8A 4KYUA 1SXGA 1PFWA 3D8RA 4R84A 3CLTC 1PEYA 4XTRA 2Q5EA 1G38A 4F2GA 1YQTA 2Q4DA 2PJRA 2H4HA 2VA9A 1VBKA 2GKSA 2CD9A 3RAGA 3CG4A 3OX1A 2ZUCA 1AKWA 2JF0A 4UVGA 3RC7A 2FPMA 2I67A 2AS0A 3FOCA 4FNGA 3VOBA 2QRGA 5ICGA 1Q1EA 5K0EA 4GPZA 2I71A 3PEFA 1T0BA 2QY9A 1V8FA 3HP1A 3KPJA 4KWHA 1W76A 2NU7B 4RZ2A 5AKLA 3SIXA 3X1KA 4QPNA 1NNUA 1X1TA 4HD8A 1U3FA 1RD4A 5J5VA 4RW0A 1V95A 4YRQA 5IDXA 1PJCA 4BIIA 2J9XB 4JITA 4DJFC 4QZVA 2F1HA 2EQBA 1YQQA 3IRUA 3B51X 5DXAA 1P18A 1ZN9A 1ZS9A 3C74A 4Q3EA 4F1KA 1TZKA 3K31A 3UGJA 2P9YA 2YHUA 1NJ6A 3DE3X 2IXFA 1E7WA 4MHTA 3KL4A 1YVDA 1L7AA 2Y9PB 3HFJA 1ULBA 3STVA 3NTQA 1A1SA 1GNRA 1NDUA 2I2XB 3LLVA 3QJYA 2HSDA 4KIWA 4YP0A 2X2PA 3K9WA 4IIHA 5LUBA 3T1NA 3UJ3X 1NQXA 4ZZ3A 3R3XA 4D4HA 3ZLUA 4DUGD 5KTTA 4DIFA 3ETLA 3RBZA 1G7TA 4F0JA 5K6AA 1J23A 1KY5A 2NM0A 1G5HA 2VPQA 4QIHA 5JAQA 1UC8A 3ETDA 2EKBA 4N82A 1XD8A 3F5MA 4D41A 4KXNA 2Z9DA 3LGXA 3Q5DA 1E6LA 4X8HA 1KQNA 2YZKA 1ORVA 1YR8A 3WL4A 5LJIA 2CJWA 2GAFA 1SUIA 4MI6A 2OHJA 1NY5A 4RA9B 1RVDA 3JSAA 4BTVA 5CA0F 5AUPB 2ISSD 4IEFB 5COAA 1PJRA 3NIFB 2KJQA 1A4IA 2DVMA 2XUDA 1FQKA 2HIMA 4IOMA 4PLPA 1MB9A 5DNCA 1T43A 4XOIA 2YQZA 4OMFG 3OICA 4Z9FA 4D9KA 5GAJA 2DY0A 4RY9A 3ZG6A 3LXXA 3CNLA 4ZZ2A 4DIOA 3ISTA 5DTQA 2CLKB 4OHWA 3DW1X 1YVPA 1NLZA 1U28C 4K0RA 1CR2A 1B0PA 1LX6A 4PYNA 1P3DA 2GN6A 1FSSA 1L1RA 3MJHA 3PC6A 2GPYA 4R68A 2QVBA 2X5KO 3CUUA 3I5XA 2X23A 4U1RA 2IITA 4XR4A 5FLYA 3KB8A 3M6LA 1ILEA 4KOEC 2RBGA 4QUDA 5A3RA 1UMCA 4C4RA 2BTQB 1HDGO 2OBXA 4G24A 4ZGGA 4XIYA 4NX2A 2X8JA 4REQA 1FSGA 2B3DA 2FMHA 3GDOA 2IDMA 3LMKA 5J2UF 2YXBA 4O29A 3M9LA 3D3QA 5A05A 2GVNA 3C24A 3H97A 4QUIA 3A7DA 4A5OA 4S05A 4H7FA 4OQEA 4YB8A 2WZBA 4WEOA 5JT1A 5IJ9B 2AFIB 3KOWA 4PLYA 2RAVA 9LDTA 3P97A 2JW5A 1NYTA 4EO7A 1E77A 1RC0A 2AOUA 5HQ3A 1P81A 1UDCA 1WBBA 1SEPA 3OZDA 1DDGA 4K1XA 3MUNA 5FOQA 1CZOA 1SR8A 1NI5A 2GCOA 2PD6A 3CNOA 3QM1A 4HUJA 4OSEA 4QRDA 5E95A 5EVCA 3SN6A 4Y9UA 4JJ6A 1JHDA 4GUDA 3CZRA 2Q8NA 3CO5A 3MJEA 4BMPB 1YRWA 3PNPA 2B30A 2VHCA 1N3IA 4L4XA 3H9QA 2G5PA 4ZQBA 5E0OA 1XTTA 1H0RA 4ZANA 3D3KA 1KERA 4CI0B 3WQHA 2Q41A 3W3ZB 5IXJA 4A2WA 2GN8A 2O2DA 2VJMB 3FGPA 2Q50A 4ZVTA 5LIRA 2BM1A 3F8SA 4UHJA 1JALA 4EPTA 4HAZA 1PJQA 1AK2A 1DQNA 1S5PA 2JNWA 4EKNB 1MTZA 1QWOA 3F5QA 4WOJA 2AHRA 5CU7A 3FMOB 1JFFB 4X20A 1XTJA 4CM4A 2FLWA 3PIRA 1O95D 3B9QA 4R9VA 2EVWX 4LNAA 4C7MA 3O84A 5IYZA 4J03A 3X1WA 5CXQA 1LLQA 3AUUA 3FZQA 2AX3A 5C35A 3QUTA 3ZGNA 1XHLA 1H0HA 2GKOA 3WLQA 2B5WA 3RWBA 3MT9A 4BLSA 1D6JA 4DRXB 4BO3A 2QD4A 3E7WA 1W0JD 3VH3A 2C57A 1C81A 2DUNA 1RXWA 3U19A 1Z4JA 4RIFA 1X13A 1MJNA 1QP8A 2JRLA 3EEFA 3VYUB 4AWBA 4KR0A 3WGIA 5ALFA 3D0KA 5FV4A 2DERA 1GFSA 2LKDA 1PJAA 2HUNA 4N9WA 3BIXA 1T3LA 4XE5A 4IUBS 5J40A 1W1IA 2EKDA 2Q07A 3DDCA 4C4XA 3DXXA 1LPNA 1SCKA 4QHSA 1LLCA 4V1CB 3UM9A 2HCBA 2G4VA 4HDSB 2HF8A 3BXPA 1YCFA 4QHYA 2XCIA 3GLRA 3PHIA 1J42A 4R71A 3NUZA 2OV1A 1CW2B 1UJ4A 4Q00A 4G0OA 4BB0A 1GQFA 1Q7RA 2XUPA 4LOLA 4B3JA 2BKEA 2HT6A 5KB3A 4ATNA 2QXTA 3WADA 3ZXIA 1FXWA 4I5GA 4XM2A 1PF7E 1JEYA 4KPGA 1KJ8A 1ZRNA 3A6LA 2GO1A 3RVKA 1UOEA 1T3GA 3HNRA 4HN9A 4YI5A 1HEYA 4V0RA 5LYJB 1RFLA 3G2MA 3VKVA 3RO7A 5D8DA 3OTQA 2R66A 1KO5A 4LDNA 4ZVOA 1KE2A 1MP0A 3REOA 3W6NA 4F06A 4LFCB 3SZLA 5F3WB 4WJZA 1NATA 1CUSA 1D2HA 2RSLA 1LTHR 3K30A 4HXYA 2QR3A 3W8NA 1ZM9A 3D02A 4J76A 4QYIB 5K3BA 3C3PA 3AW9A 3LT1A 3X2FA 1D0SA 2FJUA 4BV9A 4OO3A 3BORA 1GZUA 5G2OA 3GT3A 3EXEB 1GGVA 1GM5A 2HNAA 1ZA1A 1IVSA 4AJ4A 2FPUA 5JDIA 3AI2A 5FL7A 3F7OA 3A1VA 4AQDA 1KSHA 2GYWA 2D2VA 2YTZA 4I3GA 1L7DA 3JAWA 4WESA 1U98A 1JKXA 1GQOA 1DQRA 1DEHA 1MHPA 2A33A 5K0TA 2OP0A 4IFEA 4MRRA 1YMVA 4XDHA 4YT2A 3B89A 4US0R 3C3AA 1USKA 1U0TA 1IPEA 1G291 1U3GA 3A6GA 5KNDD 1XQ9A 5D1HA 2CXUA 3TQTA 4HNHA 5F3DA 1SG0A 1DKPA 1M2GA 4UUNA 3RBAA 1UXGA 3BE6A 4L5YA 3UGTA 3NMUF 4C20A 1D9ZA 2OT3B 4FQ5A 4C7OB 4QBHA 5BWNA 1RP7A 1UBJS 3EXHC 1UBGA 1Z28A 3O4HA 3JVEA 4GXNA 1JFSA 3VU8A 3KQKA 3RGGA 1WMSA 2BM9A 3DKIA 4WZAE 4KN6A 4E5DA 5B58C 4JJGA 1XEWY 3RS5A 4YAOA 2YVQA 2C3PA 2PGAA 3CH7A 2YNMD 3B5EA 4P4LA 4F5ZA 3ABOB 3L06A 4MWDA 1XG5A 1Z68A 3DPUA 5FV7A 4ADSG