4AJNA

Rat ldha in complex with 2-((4-(2-((3-((2-methyl-1,3-benzothiazol-6- yl)amino)-3-oxo-propyl)carbamoylamino)ethyl)phenyl)methyl) propanedioic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
330
structure length
329
Chain Sequence
b'ALKDQLIVNLLKEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
molecule tags Oxidoreductase/inhibitor
source organism Rattus norvegicus
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
total genus 115
structure length 329
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajnA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajnA02
5FI5A 4CLOB 3Q9UA 4P22A 1GEEA 5T8KA 1B8PA 1I2CA 5JDIC 4AJ2A 4JP3A 3BTSA 4YRDA 1JKJA 3VH1A 1XELA 4BKRA 5CP8A 4ZD6A 4QQRA 3W8DA 1UZNA 3DTTA 1FK8A 3AUTA 3HN2A 1EFLA 3BMOA 3PRJA 1N9GB 4UEOA 3FRJA 4WECA 4YJFA 3I6IA 1JAXA 1YKFA 1EBFA 4RVHA 4RL6A 5GZ6A 2FZWA 2CZCA 3I9MA 5T5QA 3BMQB 1ZJZA 3DOJA 4TQGA 1DLIA 2P91A 5AOVA 2DBVO 2WDZA 4JBGA 2Z1MA 3STHA 4BO5A 1J0XO 4E12A 3PDUA 2HKIA 5I8ZA 4PRKA 1WZIA 3VZQA 1OC4A 4FR5A 4GAEA 3ULKA 4BQRA 4RF4A 4CQMD 1U9JA 2AQ8A 1X14A 5DZSA 1E7RA 1XKQA 2FSSA 1NFQA 1PQWA 1EFKA 4B4OA 1RYDA 3L07A 4FSHA 1U2GA 1RJWA 3JQBA 3KYBA 1YE3A 2VUTA 4PG5A 4I5FA 5BSFA 5FYDA 2Y1CA 4RORA 4R51A 1WDLA 3RCBA 4PFJA 4WLOA 1Y8QA 4R3WA 3E48A 3Q6IA 4WCFB 5IXYA 3DZGA 4YQZA 5IZCC 1AGNA 3PDJA 4IDGA 4E32A 5I7EA 1U4OA 2V65A 1GZ6A 4FB5A 1DIHA 2IE0A 4PZDA 4F3YA 5ICMA 3VVCA 1E7WA 3RC2A 2YW9A 3UN1A 2V6BA 1SPXA 3EW7A 3WQRA 2I67A 1IE3A 2Q49A 2RHRA 3GHHA 3W4IA 3GVIA 5IF3A 3KV3O 3I4CA 3JD1A 3DMTC 4TROA 1P74A 3PHHA 3D4PA 4LRSB 4TVBA 2VHVA 4K9DA 3E18A 2HRBA 4XDYA 4IDAA 4FGSA 4B79A 2G1UA 3H7AA 4CLDA 4L73A 3TZQA 1T25A 3NTRA 1B26A 4XRRA 4R1SA 1ZZEA 3GEDA 4RQUA 4IQGA 1DSSG 4MP3A 3HN7A 1X15A 4OQYA 2DPGA 6ADHA 1D4FA 2GZ2A 4M8SA 3RBVA 3FTPA 3BHJA 3AOEC 2DTXA 4OOFA 1JN0A 1Y8QB 2PGDA 4ZHSA 1Z7BA 4D41A 4R16A 1NVTA 3DBHA 2R2GA 3N58A 4OL9A 3H65A 1N2SA 3ZWPA 1LQUA 1SNYA 1ZKMA 1IPEA 2JD1A 3MZ0A 4R1UA 2ZTUA 4ZQHA 5CFZA 2YDYA 3HDYA 1VJ0A 2V6MA 1G0OA 2J6IA 1R16A 1ULSA 5G0VA 2ZJ1A 2VHZA 1XDWA 1PR3A 3AW9A 4DIOA 4OAQA 4WLVA 3M6IA 4S1VA 2H9IA 3AI3A 2QZ9A 4L8VA 5IDXA 3IJPA 4XJTA 3ZHXA 1NHWA 1LSUA 1MG5A 4I5EA 2VN8A 3JD4A 3RAJA 4E31A 5C7OO 3KZVA 1VPDA 3INTA 4RPJA 1A71A 1GADO 5JY1A 5B37A 2LDXA 3HQ4O 3MTJA 1OMOA 4BO1A 3E1KA 1PZGA 1PL8A 2ET6A 2PA3A 1DHRA 4IJVA 4IXWA 3NGLA 4WKGA 1IULA 3GOHA 3W8EA 1ZK1A 1NQOA 3DZHA 4INAA 5C3MA 1LJ8A 4YAGA 4TKLA 4DIBA 3CINA 3WWZA 3UICA 3JQAB 4UVGA 4A26A 2XXJA 5AQ1A 4E0BA 3DBHB 2GSDA 2B36A 3OIDA 4GQAA 3GZNA 1O9BA 1H93A 3AFMA 3DBRA 4W7IA 3GFBA 3I1JA 3CMCO 1CJCA 4W7HA 2PKRA 1EQ2A 3KO8A 1PGPA 3OBBA 4XYBA 2I76A 4I9NA 4K6CA 3ITDA 2FN7A 4BO7A 3LC2O 4J7CA 4N18A 4XRGA 3L6DA 3AUAA 4WNIA 5COBA 4J6FA 4E2YA 4RO0A 4EGFA 1KEPA 3K5PA 1ISIA 4OJNA 3IUSA 3RUAA 3QRWA 3S2IA 4BMVA 1LUAA 1YWGO 5EMHA 2VUUA 2PGJA 3L9XA 1CERA 3LYLA 4GMGA 1C1DA 5FEUA 4IMRA 1NAHA 2O3SA 1LX6A 2PZKA 5JDCC 2VTEA 4IJUA 4I5GA 2CF6A 2O2YA 1H9AA 4CM8A 1T26A 2POQX 4JGBA 2C54A 1LRJA 3H9EO 4II2A 3PTZA 1LEHA 3LT1A 3DBRB 3VKVA 3PYXA 2NTJA 3IKTA 4CM7A 3K73O 3K9QO 4CMIA 1DJQA 4R1NA 1A72A 3UGKA 1DIRA 3AOEA 4JBIA 2WE8A 5COAA 3NGXA 1WP4A 3VPXA 3GDOA 1PWXA 4PVCA 1R4MA 1GTMA 4DPKA 1R4NA 3G49A 3UHAA 4II3A 3CZMA 5LDGA 2DBZA 1PIWA 2D0IA 3B70A 3HDJA 4FFPA 5JCJA 4OM8A 3U4DA 4CV1A 4A03A 1F17A 3WG9A 4CLOA 1GFSA 4IDDA 3AU9A 2D5CA 9LDTA 4CL3A 3WOHA 3GH3A 4FC7A 4B8ZA 4MVJG 3E03A 4QFCA 4ALMA 1HE3A 1PX0A 3QE3A 1NP3A 3LC7O 1U3UA 2RBEA 1I10A 4B8WA 1ID1A 3ZU2A 2BGKA 1TVEA 3NJ4A 4ZN6A 1CYDA 4TRNA 5FI3A 4RZHA 3BTUA 1JVSA 2Q2WA 4HY3A 2Q1SA 3UOGA 4DUPA 4BKUA 3WNQA 1Q7CA 4FFRA 2X58A 4MJLA 4CMIB 4CLRA 1BRMA 2P4HX 4RDIA 2Q1TA 2OOSA 1E92A 4ILKA 2BD0A 3V5NA 1WMAA 2NU9A 4TRJA 1HSOA 3QSGA 4KOAA 1EDZA 1A9YA 3ABIA 1IHYA 1Z45A 2HDHA 3DAPA 3K31A 3PYMA 4XWYA 2E48A 4Q3AA 3JYLA 3IS3A 2SCUA 4TKMA 1IZ0A 3O26A 4HFNA 1TT5B 1K89A 1E3EA 1SBYA 2OP1A 1EUDA 1YBVA 1ZSYA 4YDRA 3EHEA 1G6KA 1I0ZA 3QW2A 4Q9NA 3PFWO 4YRAA 1G1AA 1NR7A 2NLOA 1OAAA 5IDQA 2BLLA 2FSVA 5KJCA 3VDQA 2ILTA 5J23A 3DO5A 3TZCA 4PZCA 3H4VA 3KYDB 2JHFA 3G0OA 5LCXA 5L40A 2BHLA 1EK6A 4NBUA 2YUTA 4IINA 1N9GA 1CETA 4A5OA 4GGOA 1WPQA 1H5QA 1U5AA 3PWKA 3ZWOA 4IIUA 2WYUA 3LT2A 4DWVA 5A3VA 3G3EA 4Y6RA 3ORFA 5IG2A 4J1SA 1C0KA 1ZSVA 1M67A 1LDNA 3IP3A 4L9RA 4BGEA 3QQPA 4XIJA 5K0ZA 1ZFNA 3MOGA 4BHTA 4DMLA 4ZGWA 1PEDA 3DBVO 4GVLA 5CHEA 3UXYA 4EUEA 2YHUA 3ZHBA 4EI2A 2B4QA 2GO1A 2VWGA 2GN6A 3AY7A 3NUGA 2FY8A 4YT5A 4C4OA 1ISJA 1ADFA 1FXSA 5ITWA 5A02A 5KNLA 2RAFA 2WE7A 4U0JA 3KLMX 4EW6A 1U28A 4PLGA 3NT2A 4BOYA 1NWHA 1I30A 4F46A 1XU7A 2AEFA 3COSA 4DYVA 3C1AA 1O95A 3I9LA 3PEFA 5L7YA 2J5KA 4S3MA 5TIIA 2JD2A 4UVEA 2GNAA 3DEYX 1GPDG 4F45A 3RIHA 3RUHA 1OI7A 3TFOA 1DRWA 1ISMA 1DFHA 2PZJA 3X2EA 3AM4A 5G0UA 3PJEA 4W99A 4JIGA 4B3HA 4BGVA 1RYEA 1P33A 4UUMA 1GR0A 3WQSB 3QVSA 5JAIA 1FDVA 1HSZA 1Z7EA 1DC6A 5TT0A 1BW9B 1T2FA 1U2DA 3HE3A 5CDGA 1P3DA 3WGIA 1YL7A 3DOOA 3FTNA 2EEZA 4D3SA 4YAKA 4CM4B 1NFRA 4IPTA 3I83A 4RPHA 5TRTA 3RVDA 4GMFA 2X0NA 3UCFA 1AN9A 1PJ2A 3DTYA 3U62A 4GX1A 5L95A 4CV3A 3CTMA 4Y6PA 3WR5A 4CMEA 2TMDA 1VL8A 2R00A 1PQPA 1EQUA 1VSUA 1NM5A 4MP6A 3ZV6A 1QYVA 2D1YA 2Q45A 2O7QA 2HO5A 4TZKA 1U1IA 1DLJA 4BB5A 3SEFA 4WCDA 1V3UA 1HKUA 1VSVA 4R1TA 3CZRA 1DBVO 2HU2A 4A73A 1VRWA 3B20A 3EGOA 3KXDA 3JCZA 1ONOA 2FWMX 2YV2A 4CM3A 1PJQA 3AI2A 1C0IA 1MG0A 3WGOA 2AEJA 3E5RA 4XQGA 1X1TA 2OHXA 1J6UA 2A4KA 3GT0A 3GR6A 5ES3A 4D79A 3S2EA 2RIRA 3TL3A 4FD3A 1JVBA 1BSVA 3T4XA 1EUZA 1ZVMA 5B4TA 2OZPA 4BNYA 1H6BA 3FBGA 3C8MA 1ZIDA 4HADA 1HL3A 3L9WA 4GSLA 1QLJA 4G5HA 4DC0A 1NHGA 1UXIA 5KCZA 1A4IA 5KOIA 4BV9A 5TS3A 2QW8A 1DIAA 1KVQA 3AUSA 3GGOA 2O2SA 1X0VA 3JQ9C 2P9CA 3GHYA 3SLGA 5ENDA 2DKNA 4DYDA 3PWSA 2JAPA 1BGVA 1ZEMA 4WK6A 4N5LA 1ARZA 3UVEA 4CR7A 2JL1A 1GZ4A 5L51A 2Y68A 2FP4A 2FMUA 1ZJYA 5BSEA 4BO2A 1OOEA 1EK5A 4GBJA 1TB4A 4GKBA 5K9ZA 3F47A 4DREA 1YGYA 1WZEA 1N5DA 3PP8A 4BNTA 3O03A 4AJNA 3ZWAA 1Q7GA 1GV0A 4LSMA 1HYEA 1MFPA 2CUKA 2YJZA 2Y1GA 2EIHA 3V1TC 3CXRA 5CEJA 4PGFA 1YRLA 1P1RA 4EDFA 1BG6A 4AJJA 4MVJH 3GF4A 3WJAA 4BNVA 1WNTA 2GASA 2IODA 3GA0A 1I01A 2X7HA 4PLYA 1QV6A 2VRCA 5DBIA 4TZTA 4YJHA 2EW8A 3ASVA 2IZ1A 4A0SA 3QIVA 4Z3KA 3ZU4A 1PS0A 2X5OA 3F1LA 4AJ1A 3TN7A 1Y8RB 3KTDA 1KVRA 4IDCA 4NK5A 2O7SA 3OJ0A 2RCYA 4NJMA 3ROQA 3WQQA 2PD4A 2R00C 4DVJA 1LRKA 1LXCA 1U8FO 1ADGA 1ZXBA 3MJEA 4CMGA 1I3MA 3N74A 3TSCA 3PIIA 4L4XA 3OA2A 4CM8B 2CSUA 3WBFA 4CUZA 1MFZA 2EJWA 4TVOA 1SB8A 4IQ0A 3I52A 1GQQA 3VH3A 2Y93A 3FHLA 3GMDA 3IC5A 3VH2A 2E4AA 5ER9A 1PQUA 3AJRA 3JQDA 4NFSA 4R69A 4MP8A 4LMRA 5AXAA 4J2OA 4ZRNA 3MEQA 5L45A 4EEZA 3RKRA 3SXPA 3WDSA 4DLBA 3W4KA 5HBRA 5DN9A 4Z0PA 1PSDA 1XG5A 1ONPA 3IJRA 4UVIA 4I08A 3TF5A 1HXHA 1GCOA 1JLLA 3M2TA 2FPPA 1EDOA 2C7GA 3A14A 3TFQA 3VC7A 4CV0A 1P9LA 1E7MA 1KVUA 1NPDA 5F5NA 1X7GA 3ZWYA 3FCOA 1QYXA 1MLDA 3HDQA 4D0SA 4KDEA 2HMVA 4KZPA 2OFPA 1MXFA 3L77A 4OXYA 2CVOA 5G0TA 3W6ZA 2ZYDA 3OQBA 1HZZA 4ZQEA 2J5QA 2ZIZA 3WFIA 5TSDA 2YDXA 3S8MA 2EG9A 1E7YA 1CEQA 3ZI0A 3AM5A 1YQXA 2GUGA 2GD1O 4N7RA 3FI9A 4IS3A 2D3TA 3U4IA 2Y1DA 2X1HA 3I4FA 2YV3A 3LT4A 4ID9A 4KUHA 2ZCUA 4Q3NA 3DR3A 3OQ1A 4JXKA 3KRTA 1UZLA 3BYZA 4NQZA 1LC0A 4CMEC 4WE3A 3EK2A 3H5RA 2IZ0A 2A35A 1NPTO 3H2SA 4J9VA 2WEKA 4UVHA 5COQA 4EJ6A 1V6AA 2I65A 1PZEA 3WWYA 1DC4A 4PG6A 4BNUA 2DFDA 1MXHA 1L7DA 1UZMA 1XCBA 4J4HA 4O59O 5FWNA 3DONA 1V3TA 1ISGA 4KQXA 4EUHA 4IDEA 5IZCA 1YBAA 4P4GA 4YT8A 2O3UA 1C1XB 3Q3CA 3EYWA 2EP7A 1E3SA 1GCUA 5F5LA 5K6AC 4IXTA 4YJGB 1GD1O 1LRLA 1LC3A 2WYWA 4YT4A 1I3NA 3RUDA 5JSFA 5EPOA 4XD2A 4XQ9A 3RC7A 3JQCA 3WLEA 2AXQA 2XPCA 3FR7A 5F3RA 4JNKA 3TQHA 2D2IA 3C3XA 4XYGA 1K2WA 3UKOA 3KVOA 3TRIA 3OEWA 1GY8A 1GU7A 4CQMB 5JXWA 4PRLA 2Q2QA 1SEPA 4GL4A 4PZEA 3M1AA 5EESA 4WLEA 1RPNA 4XJSA 2WD7A 1WMBA 2X5KO 2FOIA 4TWRA 4DPMA 4IDBA 1LDMA 4OQZA 4QX6A 1LLUA 4ZJUA 4B3JA 1ADCA 3KLPX 1RWBA 3CIFA 2H63A 3H2ZA 3QWFA 4BO4A 4NJOA 1U7HA 1M2WA 5A4DA 2NV6A 4DLLA 5HS4A 1FF9A 4LGVA 5U1PA 5DULA 3ONEA 2CDBA 2CVZA 3QVWA 4A7PA 4MDHA 3JQAD 4FJ1A 1JWBB 2FZEA 1KEWA 4YJGA 4ZQGA 2P5YA 3ZHZA 3G1UA 4RVUA 1U3TA 1SAYA 3I9JA 5ITVA 5JYDA 4J91A 4NIMA 4JBHA 1YDWA 4AFNA 4E5MA 2IXAA 1BWSA 3JYNA 3GVHA 3UUWA 2V7PA 4QXMA 1TXGA 1NXQA 3GC6A 3W1VA 5G0SA 5DCWA 2XOXA 2O50A 4YA6A 4DXHA 1CRWG 1UXJA 5A9RA 3WGZA 4BV8A 1HYGA 4H3VA 1X1EA 2NM0A 1SZJG 3I23A 3MJCA 2B4TO 2UDPA 4HX5A 1MC5A 3A1NA 4LN1A 3RROA 3U09A 5I9NA 4RV9A 3VKUA 5KWEA 1VKNA 1UJMA 3VPGA 4Y9DA 3U3XA 1R0LA 4DC1A 3BA1A 2HCTA 3VZRA 3QVOA 3C24A 3FNGA 2NNLD 3DHNA 2EV9A 1T1RA 3TNLA 2JFFA 1WW8A 1E6WA 1H6AA 4L74A 4U0KA 1R6DA 2HMTA 2GR9A 4E3ZA 1ISHA 3PVZA 2HLPA 2VT3A 2VHXA 1I36A 3HADA 1KYQA 4E6PA 1PL6A 1ORRA 4O0LA 3ON5A 5DCUA 3ZWNA 3CSDA 4Z6KA 3PZRA 4FFNA 4J4TA 1ZXLA 2OUIA 2I9PA 3I9NA 2UUPA 3Q2IA 3ROPA 4BO3A 1ZEJA 3ZNPA 3P5SA 3MJTA 2C29D 4ALJA 4FPXA 2PH5A 1ULUA 1HT0A 3TJRA 1XYGA 1E5QA 3DFZA 4ITUA 2Q4EA 1YH3A 2VWQA 1FJHA 3E9MA 2NUAA 4IZHA 3D1LA 3KYCB 3VPFA 1YB1A 2EXXA 4NMHA 4ALIA 5IJZA 5TF4A 3ADPA 3CEAA 3GEGA 6LDHA 3F5QA 1NQTA 1V0JA 1K6IA 1T2AA 3ZU5A 1DEHA 2C82A 3ZGYA 4E5YA 4DTIA 3OIGA 1I3KA 1AHIA 2I5PO 3NEPX 3WGTA 1BVUA 2FR0A 2AG5A 3OJEA 1N1GA 1FMCA 4J7XA 2AQIA 2ZYAA 5BR7A 2VZ0A 1R0KA 4ALLA 1GYQA 4J4BA 1M76A 2ZK7A 4LCJA 2FR1A 1JWAB 4BNZA 2YZ7A 2AHRA 1B3RA 1NQAO 3B1KA 1XQ6A 4NHEA 4Z9XA 3PHGA 5JC1A 3JD0A 4H16A 5C5IA 1HWYA 2OXIA 3RUFA 1BW9A 3NTQA 4MO2A 2PGLA 4XB1A 1X7DA 1E7SA 2C20A 1IHXA 5IN5A 1ENPA 2BFOA 2HQ1A 3S1LA 1E3IA 2Q2VA 1MA0A 1Y81A 4PG4A 3ZV5A 1YONA 4FCCA 2WWRA 2DAPA 2NQ8A 3HB4X 3KETA 3UAGA 4UUOA 2E6UX 5JO0A 1E3WA 3KB6A 4Y8VA 2VCYA 3F46A 4EBFA 3GAFA 1PJ4A 3KM0A 4FC6A 4PLFA 5ADHA 3QWBA 3HSKA 1HLPA 2EKQA 2PKQO 1VI2A 2G76A 3F9IA 3RASA 4E4YA 3VTFA 4IBOA 3NV9A 3ONFA 2NTVA 1UXHA 4B4WA 1I3LA 4D44A 3BHIA 2AW5A 3S55A 3IDSA 1B15A 3AY6A 1DC5A 4CR8A 1YOVB 3B1FA 3ETEA 1LLQA 2GLXA 4AG3A 1P31A 3OJOA 3I6QA 3NDRA 4J1QA 2HRZA 3H5AA 4PIVA 5MGBA 4BVAA 3SLKA 1NQ5A 4O1MA 1DFGA 3L4BA 4NFHA 5GZ1A 5TJ9A 5MDHA 3U4CA 1LQTA 3D0OA 4LCEA 1T1SA 1E1MA 3DHYA 4RQTA 2TMGA 3WLFA 3BXXA 1C1DB 3B6ZA 1DJNA 1PU2A 3FN4A 3JD2A 1YDEA 2VRBA 5L9AA 2D8AA 3JQ7A 1A7KA 4MVJD 2WMDA 3LF2A 2EHDA 5ICSA 3BMCB 4WLNA 5JC8A 3GNSA 4GI2A 2Y05A 1CQIA 3DBLB 3DWFA 2I6TA 2NVWA 4AJEA 4XX0A 2F1KA 3W6UA 3GY0A 1IB6A 4ND1A 3C7AA 3WNVA 1ZK3A 4FJ0A 5JMPA 4BMSA 2RH8A 4M86A 1YOVA 2ZTLA 1FDUA 4BNHA 1TLTA 3FR8A 3GGPA 3D3EA 4MVJP 3WFJA 4QFDA 5H82A 1O6ZA 2HK8A 2GPTA 2W2KB 3DDNA 4RVGA 3PQFA 2BGLA 3PQDA 2ZCVA 2B4RO 4KMSA 3Q0EA 1BHSA 3BTOA 4ND3A 3VZSA 3VDRA 3SBOA 4WEQA 5DNAA 4UVDA 2J3IA 2O3QA 3TOZA 4MVJE 5BNTA 2JKVA 3DL2A 3AU8A 1HTBA 4FFMA 2JFGA 1YJQA 2DTDA 1I33A 4ONEA 4Y67A 2BKAA 2NU8A 3TZKA 4RJTA 5T8KC 4Q3EA 3U4HA 2G5CA 4GGPA 1E1NA 2GCGA 2QRKA 4AL4A 3BAZA 1I32A 4BGUA 2JCVA 1GYRA 4NU6A 1YXMA 2FRDA 3GVCA 5DOVA 3WXBA 4YB8A 1LBEA 1PJTA 4M54A 3RUCA 1WAMA 4D3DA 3RC9A 4RVDA 2Z95A 3WMWA 1B2LA 1H2BA 4BO8A 5ILGA 1DB3A 4A2CA 2Q3EA 5KJ6A 3RFTA 3QWAA 1D8AA 5F21A 2BMAA 3A28A 3H9GA 2DU8A 4JX8A 1ISFA 8ADHA 1NX6A 4ESOA 2X0RA 4CQLA 1VKOA 2ZKLA 4QECA 5CDUA 4URFA 4QUKA 4XYLA 2D59A 1UDBA 2I99A 5ENVA 3HFSA 2AE2A 2AQHA 3GRPA 3SVTA 4OSPA 3V2GA 4WEOA 2ZTVA 4DQVA 1R66A 4W4TA 1LI4A 1Y1PA 3ZZNA 4U6SA 5G4KB 4ZVVA 1B3BA 1HE4A 1LSSA 3IIEA 1TT7A 5I7VA 3FNEA 2DUUA 2JHGA 3GNTA 1N92A 3NJ8A 4XQEA 4UUNA 2BFAA 3GVXA 1WVGA 4JQCA 1JAYA 3ANNA 1HE2A 1N7HA 1GYPA 3KEOA 3JQ9A 4GX0A 4LRTB 3MJ4A 3ZWWA 2CVQA 2Q4BA 4BO6A 2IEBA 3KYDA 1GEGA 3DAGA 1RKXA 1P1IA 1ZSNA 5DBGA 4EJMA 2VYNA 5I9LA 4L76A 4OXNA 2QX7A 3JD3A 3AK4A 3K30A 5HS6A 2J3KA 4BKOA 4CL8A 4TSKA 2NVUB 3V2HA 1KY4A 5B1YA 3OM9A 3IUPA 1DIBA 3NKLA 3C7CB 4B4VA 4BNIA 3C1OA 3Q9NA 2YV1A 3PHIA 1R37A 3LLVA 2YY7A 3FPCA 1KVTA 4HUJA 2W2KA 1PGQA 3MWDB 1MX3A 2RH4A 5LDHA 3WIEA 4PN3A 4MKXA 3G1TA 4YBZA 1BXGB 1E7QA 2QQ5A 2GERA 4WCFA 3ROKA 4ND5A 2A94A 2O3JA 4J0FA 2BRUA 2VOJA 4E2WA 1NVGA 3L4BC 5HWSA 3DZKA 3JQ6A 4DQUA 5AXDA 2O23A 1M6WA 3RBZA 4YYZA 1XEAA 1UP7A 5EJ2A 2BFMA 2Q50A 4JP2A 4MVJA 1AUPA 3WJ7A 3DZJA 4WGGA 3D3WA 4XGNA 1UAYA 4EUFA 2C5AA 4CQLB 1Y6JA 2PV7A 3F3SA 2C07A 1LSJA 2WD7B 5T67A 4BS9A 1M6HA 3P7MA 4UEKA 5HTOA 2J3JA 1YB4A 3NT4A 1O8CA 3WYCA 2YFQA 2FHSA 4QT0A 1ZW1A 1JW9B 2WJPA 4W9NC 1OZAA 4FBGA 3WTCA 5JS6A 2WM3A 4E5KA 3HHPA 3KOUA 1EMDA 1XA0A 2VQ3A 1SO8A 1EZ4A 4FDAA 4BO0A 3VHRA 3ETGA 2ZB4A 5IAAA 5KJFA 3MJVA 1YB5A 3LF1A 1YQDA 1XGKA 1J4AA 4CODB 2D5AA 1A27A 4J16A 4IGEA 3C1TA 3NDJA 4M87A 3QJ5A 1V9LA 5T57A 1YBMA 2PWZA 3GPIA 3WSVA 4D7AA 1OBFO 2I3GA 4M89A 3ZH2A 4JJFA 4F6LA 5I7SA 3I5MA 3F1KA 5B4UA 5U9CA 1O89A 4YT2A 1PJ3A 3CKYA 3CMMA 3VPSA 2H5LA 4ZU3A 3GDFA 3CH6A 4OO3A 1NAIA 5DBFA 3UCXA 3KBOA 3RUEA 2CF5A 3O8QB 5KVSA 1LDEA 1YQGA 1R0SA 5CAEA 4BMNA 4CR6A 2FPGA 3BMCA 4KTTE 5EN4A 2P9EA 3DFUA 4MOWA 1DFIA 1E3JA 1O5IA 3MCVA 4HNHA 3WYEA 3WTBA 3JQAA 3DHEA 4RF3A 3QHAA 4U6QA 3DC2A 3PWZA 1T4DA 2ZQZA 1J5PA 4GLOA 5TQVA 4CMKA 5B12A 4DLAA 3K8ZA 1Y9AA 3KEQA 1VE9A 2W98A 4FN4A 4R3NA 2CDCA 1HDRA 4K28A 4IUYA 1IZ9A 4F6CA 3E9NA 2B37A 3S2FA 4E5NA 3LK7A 3V8BA 3ZWVA 3JYQA 4BNMA 4YR9A 5I8WA 2A9FA 3TOXA 5JCXA 3GRKA 3PJGA 4WOJA 2Y1FA 1RM3A 4RLHA 1I5RA 1Q0QA 1VLLA 4IZIA 3RU9A 3GFGA 3A4VA 4OKIA 5TJHA 3PFFA 4M1QA 3PJDA 4HXYA 3UF0A 4W9NA 5JLAA 4J0EA 4CLXA 2XF8A 3D5TA 4OYRA 1V35A 2VZ9A 5EQFA 1QP8A 1A7AA 4XA8A 2DUWA 2H6EA 3OICA 2V6FA 3D5QA 2IYOA 1KC1A 1HDCA 1UXGA 3I9KA 5A06A 2Q1UA 5A1TA 5FFFA 5I7FA 2B0JA 4AICA 1B7GO 1PWZA 4E2XA 5B4VA 3K2BA 2VWPA 2VNAA 1Q0HA 2DT5A 2EWMA 3PYLA 3M1LA 5EERA 3SC6A 3DBLA 4RF5A 1EVYA 2PZMA 4RPLA 5EQDA 4IDFA 1TEHA 1BMDA 4MIEA 4EITA 1H6CA 2PZLA 7MDHA 1T24A 2GF2A 4J90A 1WDKA 4J49A 1GQYA 2UAGA 4QTZA 3JQ8B 1R4NB 3H3JA 3GGGA 2H1SA 2Y67A 3BHMA 3GUYA 4I5DA 3WSWA 1LU9A 4OHUA 1DIGA 3WGGA 4B3IA 2AE1A 2W2LA 1RM5A 3ASUA 5CPBA 1IOLA 2BF7A 3WMXA 4ROSA 3TL2A 3B1JA 4LISA 1YO6A 5BNFA 1GZ3A 5JAMA 3WYBA 4J2HA 1W73A 1LDBA 4M55A 1ENZA 1Z6ZA 1P0FA 4NG5A 1JDJA 3ZCXA 1H6DA 3EVTA 3HG7A 2BGMA 4NI5A 2G17A 4I9HA 1S6YA 4CJXA 1E6EA 4H15A 1EE9A 4NBTA 1H9BA 1Z82A 3O8QA 2CFCA 5JW6A 3ZNNA 4Z9YA 2BELA 4UREA 1DPGA 3OFSA 1KBZA 2VZ8A 2QIOA 1CDOA 1OFGA 4LVCA 4Z0TA 3OMLA 4R5HA 4CQMA 4CLRB 2IXBA 4D45A 3PQEA 5EIOA 4CUKA 3F4BA 3SC4A 3EC7A 4G81A 2YHIA 3I9OA 4JJIA 2OGUA 1XHLA 2ZATA 1BXKA 1AE1A 3PI7A 4MVJM 1FDWA 4K1LA 1XU9A 1XIVA 3L6EA 1SC6A 5JFOA 2Y0CA 4DBZA 5A9SB 3E9QA 3AOGA 3DZBA 4PLHA 1NFFA 4BNKA 1DXYA 2X4GA 3OA0A 3FD8A 1QV7A 1QYDA 2XXBA 1M75A 4R5MA 1P1HA 4Z3DA 3T7EA 2P9GA 1GUYA 1G0NA 1BXGA 2ZQYA 1MC4A 2NTNA 4G65A 4IQ8A 3RSHA 1NVMB 1P45A 2Q99A 2J5RA 3R0IA 4BNLA 2UV8A 2GN8A 1EEHA 4KWIA 3AI1A 5JDIA 4RVFA 4JCOA 3ZNOA 2DVMA 4HFRA 4K26A 4I1IA 5L7TA 3DMYA 4P8RA 5FF9A 5CG2A 3G79A 3UH1A 4BNGA 3OJFA 2E82A 4R9RA 1EE2A 1WLYA 3C85A 4CM9A 5JDCA 4P38A 1DRUA 4OGWA 3WB9A 4MKRA 4YRBA 4XYMA 2X0JA 2GN4A 4XGKA 5KIAA 1H2HA 2B69A 4HKTA 3ZHYA 2EKLA 2P5UA 4NDNE 2C7VA 1LA2A 4OKNA 5H81A 4L0QA 1DOHA 4UAGA 1F14A 4J7UA 4LW8A 5AXCA 1ZK4A 1SCUA 4GH5A 4WLFA 4AJKA 4GWKA 4J1NA 5BNIA 2HMSA 3X2FA 4KUEA 5DOZA 1T2DA 3ZN2A 2PY6A 4RZIA 2RHCA 1OC2A 2HMUA 5IN4A 1D1TA 5JBIA 3OSUA 4NNJA 1GUFA 2P4QA 4Z0HO 3ZW9A 3EMKA 4P4NA 4CM6A 1BDBA 4MKZA 1TA4A 4PCVA 1HDXA 4N5MA 4ZQBA 1ZMTA 3BMOB 2PFGA 4YAEA 5TT1A 5THKA 3IOYA 5A5EA 3EAGA 3H5NA 2Y0DA 1BVRA 3D7LA 5DP2A 2FR8A 3H3FA 1E77A 3BMQA 4B7CA 3PK0A 5GZ3A 1K6XA 3VAZA 4NZ9A 3L0DA 3IKVA 2GGSA 3INRA 2O3TA 2B5VA 3IP1A 1VJTA 1KC3A 4X54A 1E1KA 1DRVA 3U0BA 1NNUA 1U7TA 1NTOA 4LVUA 2XAAA 3D3WB 1NPYA 2CY0A 3PHLA 4K6FA 5ER6A 3MWEB 4AJIA 3TZ6A 1GUZA 4CM4A 3E6AA 2D4AA 1P1KA 5IFLA 5AVOA 1BDMA 4MINA 3PIDA 1M66A 4L75A 1ZBQA 2IEDA 3FSRA 1XR3A 4BNNA 5CEFA 3Q11A 5F1KA 3HNPA 5G4KA 4E13A 5C7IO 5BSGA 5JYEA 4CM9D 3IMFA 2NADA 4ZRMA 5IZ4A 3MTGA 5C7LO 5CPFA 2C2XA 2NSDA 3DZIA 2V6GA 4HWKA 4HNGA 4BL5A 2DBQA 3K96A 1JU9A 2VOEA 3ANLA 4YAIA 2VNSA 2VUSA 1C14A 4WJZA 1QG6A 4J1TA 2C2YA 3D4OA 1SOVA 2YFHA 1QR6A 4WLUA 4CPDA 3HJAA 1T4BA 1Y9EA 1F06A 2OBYA 1E1LA 2J8ZA 5L53A 1I2BA 5F1PA 3EUWA 5A05A 2C0CA 4YVFA 1PJSA 3ENKA 1N1EA 4XCVA 5TX7A 1A5ZA 2OP0A 5KKCA 3KSDO 1QORA 3RJ5A 3GZNB 5T64A 4C7JA 1UDCA 4Q39A 1V8BA 9LDBA 5KVVA 1E3WB 2X9NA 3Q2KA 4DRYA 2OBNA 4PG7A 3EZLA 4BKQA 2I3AA 1CIVA 4U8GA 4XR9A 1LDYA 1PL7A 1C0LA 1Q7BA 4XYEA 3O38A 1GDHA 4BKPA 4YCAA 1X13A 1ZK0A 3V1YA 3NTOA 2ZB7A 2Y99A 1ZCJA 2Z1NA 2ZB3A 3R6DA 4BUCA 3JV7A 4CLEA 3O9ZA 4BIIA 4BNJA 2GN9A 2ZJ0A 4ALKA 1L1FA 3FWNA 2AG8A 4DIFA 3DZFA 5A3JA 1SMKA 2AEMA 3VZPA 4B4UA 2AQKA 2GYYA 3UFXA 1VL6A 1YS4A 3D4NA 5AYVA 5L4NA 1ZO8A 2JCXA 3NRCA 2OMEA 3MJSA 1KEVA 2VYND 4WPGA 3R3JA 4XR4A 3QWHA 4N54A 3GG2A 1YL6A 1R15A 3OP4A 1YL5A 4RCVA 4YJHB 2C59A 1K3TA 5TC4A 5A03A 1D1SA 2Y66A 3GMSA 3HZZA 1Y8RA 2CDAA 2DQ4A 1GV1A 5HM8A 3FNFA 5DDIP 3RJ9A 2VYVA 3K6JA 4YWJA 5CG1A 4DBVO 1KS9A 1PS8A 3OIFA 1I24A 4HFMA 4WOKA 4YAJA 3JQ7B 5DCYA 4FGWA 1BXZA 1Y5RA 3P2OA 5TNXA 1T2EA 1LLCA 3OECA 2BI8A 1MV8A 2QZZA 4H7PA 4L4RA 4NH4A 3QVTA 1HF3A 3JTMA 2NWQA 1NWCA 3LZ6A 4NBRA 4OMUA 4NBWA 1KVSA 4FOSA 4GWGA 1HETA 4YEDA 1XWFA 3BIOA 2NQTA 4AJ4A 3IQDB 3ROMA 2C5EA 1LTHR 2A92A 1XSEA 4D3FA 1K0UA 2AMFA 1UDAA 2CMDA 4KDFA 3NYWA 4BB6A 3A9WA 2O4UX 2QG4A 3DB2A 8LDHA 3LU1A 3NX4A 3PLRA 4R9SA 1AXGA 4XQCA 1P1FA 2JD0A 4QSMA 3CPSA 3H9UA 1U8XX 5JCJD 4ND2A 2YYYA 1ZH8A 2PD3A 1D7OA 2Q1WA 4GX2A 1A4UA 4NFYA 4XIYA 3ETDA 4D42A 5LC1A 1YJ8A 2X9GA 4IS2A 1GL3A 2QYTA 3PXXA 4XKJA 3WS7A 4NR0A 5AXBA 4EZBA 5IXSA 3HUDA 1LLDA 3QA9A 5DP1A 1W0CA 2OORA 2HK7A 3W8FA 4AJLA 2X0IA 5C37A 5HRUA 3ICPA 2P2SA 2GZ3A 4M49A 4E5PA 1IYZA 3CUKA 4IJKA 1DAOA 1PTJA 1VJ1A 3L4SO 4RDHA 4XEHA 4UEJA 3TDKA 2J3HA 1ZUD1 3O4RA 1N8KA 3FBTA 5JO9A 1QKIA 4NBVA 4WCFC 3A06A 2EW2A 2DBRA 2W4QA 5EINA 1HDYA 3I3OA 1HYHA 4W6ZA 3AY3A 3LLSA 1U3WA 3NAQA 2HAEA 2HMWA 3LC1O 1EBUA 3H6KA 2YHIB 2VHYA 2X86A 4A10A 3AM3A 1GPJA 2Q46A 4XDZA 5BQFA 3QP9A 5G0WA 4G2NA 4MPDA 3RQSA 5HA5A 1C3VA 1HDOA 3H9QA 3DXFA 3NT5A 1C1XA 4PLCA 2IYPA 1GAEO 5JPIA 3LQFA 3DQPA 1QXSA 1SEVA 3H8VA 3VOSA 1ZMOA 4MVJF 3OQ6A 3WIDA 1XLTA 4IGFA 4DMMA 3JYOA 4ND4A 1MP0A 4OIMA 1O0SA 3GG9A 3HWRA 4GSKA 1J49A 1X7HA 2QRLA 4NPCA 3TPCA 2UUOA 4Z9FA 2B5WA 1MB4A 2EP5A 4B7UA 1T2CA 4KUGA 4RPKA 2HSDA 4BGIA 1KERA 5JAZA 1EVIA 3MOIA 5JMWA 4IM7A 4QO7A 3JQGA 4DGSA 3PZBA 3JQBC 1X0XA 3WBBA 4PG8A 1S7CA 4PLTA 5KJ1A 2X23A 2FPIA 4PLVA 3PHJA 3T7CA 2IRWA 2DLDA 2W2LD 1FDSA 4D0RA 4XB2A 4KP7A 3RWBA 1K6JA 1O94A 5THQA 5L3ZA 3RC1A 2W90A 3OF2A 3AFNA 3VPHA 2O4CA 2YQ5A 4DA9A 2HK9A 3FF4A 2LDBA 2PR2A 1QMGA 3RU7A 2HJSA 5A5FA 1V3VA 1TT5A 4E33A 2DC1A 4R54A 3GUCA 3E82A 4MIYA 4QEDA 4FIZA 3VTZA 1E0DA 4TMFA 2PH3A 4CMJA 1VM6A 2Y1EA 5GMOA 4YXFA 1HZJA 1P0CA 4HBGA 5IDWA 2X9VA 4GPD1 3R3SA 2JAHA 4LSWA 2JFHA 3VH4A 2DFVA 3WX0A 1TI7A 2ZTMA 3F4LA 3FPLA 4WASA 3DMTA 2VYVD 2DTEA 3RI3A 1CF2O 4HFJA 4TRRA 3F6YA 1U4SA 4BNXA 2Z5LA 2NU6A 2ZB8A 4FJ2A 4XGIA 3ZW8A 3GDGA 3U9LA 2O48X 2QHXA 4J3FA 4W82A 3GEMA 5F1OA 1AXEA 4CMBA 3GVPA 1YVEI 1U5CA 2EJVA 3PGJA 3PLNA 1W6UA 3H9JA 4EJ0A 5CDSA 3ENNA 1AHHA 1QYCA 1P44A 4EEXA 1E3LA 5JNLA 1Q2XA 3D64A 1A9ZA 1Q1NA 1Q0LA 3DAFA 3OHSX 1E6UA 5CDTA 1B8VA 2VWHA 4HV4A 5U4QA 1PJLA 3WGQA 2X6TA 1UXKA 1Z74A 2B83A 4IIVA 4IY1A 4OSOA 3RBXA 2NVBA 5KVCA 4B7XA 2PKQP 1PGJA 3CE6A 1U3VA 1NASA 3C7DB 4L4SA 1QYWA 4MVJI 4FS3A 3EY4A 4AVYA 4J43A 2DPHA 3GLQA 1LNQA 3F5SA 3Q1LA 4J9UE 3NDIA 4Q3DA 3QV1A 3V1UA 4DL9A 2PLAA 4EYEA 4AJHA 4RGBA 3RFVA 3OH8A 4JK3A 4KQWA 1K5HA 3KUXA 2VRCD 3INGA 1BTOA 3JQFA 3T4EA 1B0AA 3GQVA 2IZZA 1CQJA 1JA9A 4I9UA 3QVXA 4DPLA 3EZYA 3JSAA 4E21A 1PGOA 4D43A 2O3RA 2CD9A 4O5OA 1HLDA 3WGYA 3BZUA 3LDHA 3ADOA 4WUVA 1UP6A 2PK3A 5K6AA 4AJPA 1WWKA 2R6JA 1NR1A 2NU7A 4BQPA 2VTDA 4Y6SA 3PJFA 4CMAA 3N7UA 5T6BA 3ANMA 3KYCA 2NACA 1PZFA 3ZNQA 1NYTA 3LSYA 2HUNA 4GKVA 4IJWA 4WNCA 4I8XA 1MGOA 1DDOA 2X5JO 1SB9A 3GPDG 2AA3A 2PD6A 2HJRA 4NK4A 3PPIA 3R1IA 1QRRA 1LSOA 1EUCA 4AJOA 2G82A 1ONNA 1Y7TA 4RLSA 4KTVE 1R4MB 1VL0A 5DT9A 1QLHA 1IY8A 1EVZA 1W8DA 1R12A 5IDYA 3WICA 2BFPA 2EGHA 3TWOA 4ZQFA 1Z73A 4C7KA 1HRDA 1PJBA 4FOOA 3GAZA 1DC3A 4NJMB 4UUPA 1KY5A 5L4LA 2Y1OA 1KIFA 3ONDA 5GY7A 1C0PA 3ITKA 4RPGA 3JQFC 3M2PA 3ZV4A 2GZ1A 2WSBA 3RD5A 4YQYA 3K92A 2PNFA 4LMPA 3JYPA 5DF1A 4OOEA 2F00A 1RM4A 1F8GA 1JQBA 3DOCA 3ZU3A 3GZ4A 1PJCA 4ZICA 1F12A 3OJLA 3ZWCA 3QLJA 5A9TA 5L4SA 4Q3CA 3EDMA 1PR9A 2EKPA 3QY9A 3SX2A 2EGGA 2JCYA 4PLPA 3HB5X 5KVQA 1H94A 4U5QA 3S2GA 5KJEA 3JQEA 1FDTA 4Y98A 4PLWA 4R01A 4OH1A 1CWUA 4YJDA 5I9MA 4ALNA 1KOLA 1HDZA 3RUIA 3GN1A 5G4LA 3ZV3A 3KSZO 1GQ2A 4YPOA 7ADHA 4O63O 1XQ1A 3ICCA 1HDGO 1B16A 3EVNA 1WXDA 3GN2A 3W4JA 1JKFA 1UUFA 2EERA 4P4LA 3QWIA 1ML3A 4XZ3A 1W4ZA 2WD8A 2UVDA 2VT2A 4CMHA 1D3AA 2Y0EA 1UAGA 4CMCA 2IDZA 4HP8A 5CDYA 2P68A 1MUUA 3L6OO 1LDGA 1UP4A 4JN6B 2ZYGA 3GNQA 2VHWA 5KTKA 3E5MA 4CV2A 3HFGA 5CEEA 1HEUA 4CLHA 1PS9A 4N5NA 4A27A 2X22A 1ENOA 2QRJA 3PGXA 3AUUA 1JKIA 4ZA2A 3LT0A 3IL2A 3RFXA 4MIOA 4CM1A 4D46A 1N7GA 1SOWA 2UYYA 3KHUA 1H0KA 1IUKA 4LK3A 4CM5A 1PGNA 1P1JA 4IMPA 4U7WA 5G2OA 3G17A 1RM0A 1B14A 2X8LA 4FFOA 3BMNB 4GLLA 3AWDA 3V2UA 2BH9A 2GRAA 2BI7A 4R41A 1KETA 4GX5A 2DM6A 5BT9A 2W8ZA 3U5TA 3GK3A 3KSUA 4R4JA 4JLWA 4O6VA 4PLZA 1I2ZA 4QO8A 5TLSA 5A9SA 2JJYA 3E8XA 2E37A 4TRMA 1Z75A 3SJUA 1E5LA 1ENYA 1WDMA 2EF1A 1QSGA 3VVBA 3FWZA 1IPFA 2NVUA 5EL0A 3JQ8A 4FQ8A 3U49A 4YTEA 4R68A 4PVDA 4DQXA 3ZWXA 1P77A 4E2ZA 3FNHA 4FW8A 1DHTA 2B35A 3HDHA 4Q3BA 1F8FA 4RF2A 3TZHA 1UR5A 1NBOA 2CNBA 4GVXA 1VC2A 3P19A 4FFLA 5ILOA 3BTVA 4JJGA 3ZDFA 3ZWMA 4RVSA 5KKAA 1DAPA 4YJFB 1IL0A 2WTBA 4BNFA 4JROA 4NU5A 1F0YA 4YACA 4CUJA 4KWHA 2WYVA 2OL4A 3SJ7A 3ST7A 1ADBA 1UH5A 1JTVA 2E49A 5JY6A 5TGDA 3JQGB 2YQ4A 1L7EA 5JAQA 3BMNA 1B8UA 5A04A 3OETA 1I8TA 1DO8A 1EVJA 1Y5MA 2G0TA 2GDZA 5JE8A 1ZK2A 1HE5A 3ZWBA 5BSHA 1ZNQO 3K2EA 3UW3A 2QYSA 4UULA 1KEUA 3LVFO 3UCEA 3IAHA 4BNWA 5L7WA 4E30A 3OEYA 2I66A 2OO5A 5H83A 1PZHA 3P2YA 4OXKA 3RKUA 4BO9A 2PTGA 3WGHA
chains in the Genus database with same CATH superfamily
2ZVDA 1Q0PA 1D07A 1V8OA 3VPAA 4ZCPA 5FI5A 3IAAA 4ZO7A 3NHZA 2IXGA 2I3ZA 3I5UA 3Q9UA 2GQ0A 2P27A 2IPNA 1B8PA 2L19A 2WAXA 5DFAA 2HFKA 3QXXA 5ALHA 5LZ7A 3S8EA 4IF4A 1JKJA 5CT8A 1V41E 3N59A 1QONA 4M76B 4FNAA 3HCOA 4HDNA 4OI2A 4U2CA 3AUTA 3GNLA 3RVPA 4EVQA 3HN2A 1EFLA 2LUOA 3K0AB 4M60A 3AEKB 4MV7A 3I62A 3NEJA 4DANA 3IALA 1PRYA 3H1TA 3I6IA 3M81A 4EHAA 8ATCA 4W1SA 1G38A 2RI6A 1XDZA 1OCEA 2Q0SA 2W2XA 1Z16A 3ZHSA 4GZLA 3I9MA 5T5QA 4TQGA 4MWSA 4U00A 2P91A 3VYSB 4BQSA 3AR5A 5AOVA 3S27A 2X6QA 4LFBB 1ECFA 3I01A 1J0XO 4E12A 4K7JA 1VHWA 3HJUA 4UBIA 3SEAA 3LTNC 2WTAA 5JEDA 2F90A 2JJQA 3U3DA 1SPBS 3BF7A 2HQBA 2HJ9A 1I4EB 2OZKA 2VJBA 1PSZA 2QD3A 4DDHA 3UKDA 2VF7A 1YT5A 1UK8A 4JT4A 2AQ8A 2KS6A 1XA3A 3O8NA 1NIJA 2FSSA 1XZCA 3ESQA 4QNRA 2BMVA 3O74A 1R5OA 3WV4A 1EFKA 4E7PA 2ZRFA 4LY9A 2HPHA 4U2GA 4XWTA 3LQRA 1KJYA 5IC6A 3BJMA 2WNHA 3LBYA 5BSFA 4I5FA 3KQNA 1JJ7A 1KZGB 2OB1A 4AXBA 3IT3A 4R51A 4QPDA 1QQ6A 3R4VA 3RCBA 1LNSA 3BXEA 4B0OA 2UZ0A 5MHTA 4R3WA 2PR7A 3E48A 4WCFB 1AGNA 3V6LA 4BKMA 4TLCA 4N6NA 3U3ZA 4K9KA 3EFOA 4F3KA 1PFYA 2V65A 1E2MA 4NOJA 1MW9X 4AIRA 1QIEA 2HT6A 2P9BA 2R8BA 1IXSB 1V7QA 2IE0A 2X8AA 3ENZA 5IAJA 3I58A 3VVCA 5ICMA 4EO7A 4WZAB 2YJ4A 1TLFA 4X84A 4YI5A 2V6BA 2Q3CA 1FSPA 2I67A 2IV2X 2Q49A 2RHRA 4DR1B 1X3SA 4LJ5A 3GVIA 5DGIA 4TWJA 1TQ6A 1OKKD 2QTFA 1C7EA 3A1TA 3I4CA 5CR9A 1P74A 3PHHA 3N2KA 4EY3A 4TVBA 4EPVA 5FTLA 2F8TA 4XDYA 1RKQA 4PS0A 3Q41A 4HRAA 4B79A 5HSGA 3QXHA 1QH1A 2QMZA 1TJ3A 1A77A 1DEKA 3QE4A 3MFQA 5D86A 1SHUX 1B8OA 3TDMA 5AKHA 2QL6A 1XTJA 3KQVA 2ODAA 4PAGA 5LYYA 4OJTA 3E23A 1ZMXA 1USIA 1Y6ZA 1TTPB 1VDZA 4IQGA 4RQUA 4TV8F 3HN7A 3OPYI 4UZFA 3SSNA 2EL7A 2H1FA 3GGDA 1S2GA 4GOJA 4AMUA 4WXMA 4ZARA 1RZUA 2WHRA 3GEEA 2GZ2A 1NVVR 1GITA 4O2AB 4Y7DA 2H08A 3MT9A 1CFZA 4BBZA 5I4IA 2XR1A 1JN0A 1Y8QB 3IODA 1AZSC 3LOUA 2B1IA 2J5XA 2XOKD 3H2IA 3SVZA 4D41A 1AGRA 1D2MA 2EDAA 2NGRA 3HJHA 1OLXA 1XRSB 3H65A 5I9IA 1O6GA 5M3BA 1LQUA 4R1UA 2JD1A 4ARZB 4EKIA 1QH0A 2ZTUA 3LGAA 3HDYA 4ASUD 1DX9A 1G0OA 1TFUA 2HQOA 1L8OA 1XDWA 2JGMA 2FW7A 3L1IA 3ZK9A 3PL1A 4Y3UA 4D97A 1C29B 4OAQA 4Q15A 1FZQA 1SXJE 3T7SA 1GOTA 4S1VA 1I0LA 2K4MA 4PR3A 2QZ9A 4P84A 4CT5A 3QEMB 4L8VA 5IDXA 2FKAA 4EK9A 4YASA 3UMYA 1QPBA 1T4GA 2Z5VA 4B8YA 5MFPA 2NZVG 4I5EA 3PX3A 3WQHA 4BMPB 4D9EA 2W93A 4R8VA 5ECGC 1YSCA 3RRFA 4C78A 2OSBA 3A4MA 1R4ZA 3GPLA 3GEPA 2XDAA 1XU4A 2C84A 2XNDD 2IV3A 3STYA 3T5CA 3R9XB 3OT1B 2OO7A 1NQUA 1SWWA 2OV1A 3HQ4O 3MB5A 4MDFA 4BECA 3U6KA 2FJUA 1PL8A 4UFPA 1L5KA 4JEMA 2F8MA 3NGLA 4Y7CA 1IULA 1B1CA 1EP1B 4JL5A 2QT0A 4MS1B 1AQLA 3DZHA 3N8DA 3LXRA 1N5RA 3AIIA 3BD6A 4DT1B 4YAGA 3WWZA 4A26A 2XXJA 2G83A 4N6OA 5IJ9B 3SDZA 2WWWA 3OIDA 7REQB 5D5HA 2WHEA 1FRQA 1PYDA 4D82A 1W36C 5LQCA 2D6FA 3KS9A 1W5SA 3G2KA 4P3PA 4MW7A 2XDWA 4EAAA 3DDOA 1YBFA 3N5KA 4UHFA 3DJYA 3K0FA 1W1WA 2ISCA 3QNUA 4JWTA 2I76A 3G89A 1BEUB 4LUCA 4Z51A 1E2HA 1GNRA 3FLAA 4IHQA 5KVAA 5HKOA 1YJBA 1DO2A 2VDWA 2GARA 3CZAA 3DKVA 3DE1X 1AIPA 2Q0XA 3UMMA 1SC4A 1Q6YA 3AUAA 4WNIA 3W9SA 1CEYA 3SZUA 4E2YA 2N3ZA 1JB1A 5LJIA 1CY7A 3I53A 4R2KA 2ECQA 2NQ2C 4BMVA 1E8NA 2VUUA 3DE0X 1LFDB 3L9XA 1CERA 5JS1A 2B2XA 1QS0B 4LZLA 2JLYA 2JFQA 3L1HA 2HMYB 5JTUA 1WF3A 2MINB 1RIFA 3TLAA 4RK4A 2MSNA 3ID6C 3EIQA 2Q4OA 2FLVA 3DYIA 4M83A 4ZFNA 4A3SA 1QP4A 5C1BA 2RB5A 2O2YA 1CQIB 1X8KA 4MJXA 1T26A 3OLXA 4X1KA 1KYWA 1N2CA 1QUFA 2AYXA 2Z3WA 3KKLA 2C54A 3OCVA 5DHAA 2F1OA 1U9YA 3H5LA 4II2A 2OYRA 2EBHX 3TTWA 2ZT7A 3JYHA 1LEHA 2WFLA 1ULTA 1T6ZA 3PTZA 3VKVA 4EF4A 3PYXA 3SYMA 2PWAA 3R8FA 3A26A 3DTNA 4HX9A 4ZYZA 4HQRA 5GAJA 3B2EA 4DKJA 1MRNA 2J4FA 3CVOA 3IPXA 2H4HA 2ZXEA 2C1EA 3BORA 2CVPA 3F3KA 3OIUA 4LWPA 3HY4A 1ESMA 2VXYA 3AOEA 1SVOA 4I1UA 4X63A 1Z3CA 2VK2A 4AO8A 3ZHRA 3NGXA 4X6XA 1RD4A 5JJCA 1KJJA 3TW8A 4I4LA 3Q6NA 5F7JA 4DILA 1A8HA 3BT7A 1A4RA 2H4JA 1IXZA 3M49A 1ZN9A 4DPKA 1Y4ZA 4WXYB 3A04A 4OHPA 4UBKA 3DMDA 2X42A 1FS6A 4OM8A 1WABA 4QL3A 1RXSA 4X7RA 2NUPA 1WKVA 5LLSA 1A8IA 4M7OA 3QE0A 9LDTA 5I4BA 1M7HA 3BXHA 1CQZA 1MN6A 4OM7A 2FE4A 4B8ZA 1E1YA 1HE3A 3LL7A 3QE3A 1ML4A 4X66B 5IANA 4XDGA 5JAUA 3VHXB 1ID1A 1Z7GA 1X1RA 4N8EA 4C3UA 2JAUA 2C2WA 3ZYCA 5AJXA 5K5EA 1D2HA 1I51A 5GGYA 4Y2XA 4EF5A 2IHZA 2WBLC 1BS2A 1DAFA 5FI3A 3PE4A 3DYBA 3DCJA 2CGEA 1K7SN 2ZPAA 3BTUA 5DK4A 4DMFA 2I2DA 2R6HA 1XMJA 5FBZA 5IBQA 5KCMA 2VAMA 4OL0A 4BCDA 2CXHA 2IU4A 2XIJA 4JWKA 4N3CA 5AJTA 3ZVRA 4DIDA 1SOUA 3U26A 3WLTA 2P4HX 2QMYA 3KKMA 1E92A 2OWDA 2HT1A 2PBLA 1NBME 1WMAA 2Q5CA 5LBTA 4TRJA 3UV3A 2IX3A 1L8LA 1Y3FE 4FXPA 2XEXA 5DTEA 3SXUA 1EDZA 4PO8A 1KQPA 3DAPA 3K31A 1P7VA 4MA0A 5IFKA 1XA4A 2ZRLA 1TM4E 2ATXA 3C2QA 1ULHA 3HEBA 4HMQA 2PVSA 4XCQA 4Q4JB 2PS0A 2SCUA 1GKUB 3FGZA 2H4WA 3O91A 3HZHA 3OF3A 3SP1A 1Q19A 1NONA 2FPWA 3D6UA 3DOFA 1TT5B 2BCEA 3O26A 2QS9A 3CUSA 4JITA 5FOUA 2C7RA 2G9QA 1K89A 2NSLA 4BX2A 5EKSA 3M4YA 2AOXA 4DM7A 1DGQA 1LPBB 4HLDA 1JHYA 1SHKA 1G6KA 3E61A 3TSWA 1AZWA 3PFWO 4LJ9A 4YRAA 4ZI3A 4TWBA 1NR7A 3W2EA 2B6HA 1OAAA 2BLLA 4YMIA 5KJCA 4MRSA 1U0HC 3TRDA 1HC7A 2ILTA 1YTLA 1M10A 1Q1ZA 4KO3S 2G5PA 3KYDB 1Q20A 1O58A 1GJRA 1E79D 4OQDA 3GCDA 4Q7EA 4WIAA 5AM1A 2Q9CA 3B6JA 3FWHA 5HJEA 5KYWA 2L69A 2EHJA 4L4ZA 1UKCA 4RFSA 2EGUA 3TLMA 4A5OA 1JQDA 2JIDA 3A0RB 3EA4A 4GGOA 5HKAA 4OG2A 3ZWOA 3ZXYA 2P6NA 2V7BA 1M73E 1H0RA 1YJCA 4DWVA 3V7FA 5HKKA 4L3VA 4Y6RA 1GUDA 4J1SA 3UATA 3PFKA 4LXUA 4TLLB 1MENA 1JDPA 1GAQA 1K7YA 1WTCA 3IP3A 5EE5B 4AROA 4QWWA 4BHTA 1XC7A 1CX9B 1PEDA 2G3YA 2WG2A 5BN5B 3U48A 3ZJTA 3X1JA 4HRYA 4EUEA 2HF7A 2NXCA 4A9AA 3C7TA 1M2VA 3AZQA 4FFVA 1Q3KA 1IEXA 2NG1A 4F8EA 5ITWA 3LBNA 3PF8A 4DLTA 1DAIA 4EW6A 1G2IA 4M3NA 2CLKB 3SDSA 3NT2A 3DV0B 3KKPA 4BOYA 2W6JA 4ESEA 3NAMA 3ZWKA 2WVAA 1IUNA 4BUZA 3PXBA 2WU8A 3TM4A 1KK0A 4G9BA 5HUJA 4N82A 1CP3A 5L7YA 3FCEA 3OZXA 1LVHA 3VRHA 3KJZA 4Q37A 2PKYX 4B3FX 1RPAA 5JSUA 4WGFA 3RIHA 3TB6A 5A0FA 3EFOB 4D2IA 1DFHA 1NJ6A 1D2GA 1QNLA 4BVJA 3BCSA 3HRIA 2WWIA 3AM4A 4DLPA 2FHPA 4BFVA 1Q6ZA 4W99A 5ALPA 2CL0X 4JIGA 4EUKA 3O8BA 2BV3A 2CLCX 4NYJQ 2QU7A 4C0BA 1Z7EA 4BASA 4MNTA 3F5FA 4CFSA 1R0ZA 3C3PA 4FNMA 2D00A 1E9VA 2BOVA 2PRYA 2JGFA 1BW9B 1T2FA 4M4SA 5HIAA 1OROA 4YJ2B 3FUCA 1YL7A 2QL9A 4ZK6A 2X40A 3H7IA 3M5CA 5BR4A 5KSWB 3TK1A 4N76A 4D3SA 2YXNA 1TE2A 4IPTA 4ZTBA 3I83A 2XVAA 3C6ZA 1G17A 2R65A 1AN9A 4GQIA 2ZJ6A 3T0FA 1PJ2A 3VO2A 1FC0A 2C5SA 1JI0A 2Q5JA 2R7LA 4KK4A 4IIBA 1E5XA 4AKEA 1EI9A 2BE9A 1KSJA 1N1MA 1VPEA 2ETXA 4KN8A 4R6XA 4Y6PA 5DI9A 3L0CA 1V5FA 2R00A 4CKYA 4CMEA 1FLNA 2ZUVA 4FMCB 3MS2A 1PQPA 1EQUA 1VSUA 1NM5A 2Z43A 4J0DA 1K3UB 1EFPA 3DUFA 4I3GA 3FYHA 3IA7A 3P9RA 2DOKA 3KPYA 2H29A 1DLJA 2Z8YM 2EFYA 1KXZA 1HKUA 5BRAA 1K3FA 1W0JA 3TVTA 5MN4A 3HB0A 3T3DA 1LS6A 3QI2A 3B20A 3DE7X 1VGVA 1UQTA 4CM3A 1XTBA 1JEAA 2FQXA 1BNCA 2JFBA 1PJQA 3ISJA 2QXTA 4NU0A 2BBTA 1BXRA 4A92A 4EHIA 1T8SA 1S8NA 1PWEA 3WP1B 1AA9A 4E70A 2WU1A 3E5RA 4XQGA 3U13A 1F60A 4I99A 2OHXA 3UK1A 4AS3A 4AYXA 5ES3A 4GE3A 3S2EA 1BWQA 1J1IA 1FA9A 5DIFA 1P6XA 3T4XA 3GJYA 4K03A 2OBBA 1ZL2A 1ZVMA 1TM7E 4Q4DA 2ZYVX 4BNYA 3KE8A 3M6XA 1D6MA 3C8MA 2OXTA 1ZIDA 4D98A 5B4TA 3HZRA 3JALB 2BEUA 4KO1S 3EF3A 3BH6A 4X6UA 4EA6A 5CXUA 3L8CA 1QE5A 4GSLA 2PYDA 1QLJA 4G5HA 3FHJA 4J3JA 4QYWA 4ZYTA 1SXJC 4L4YA 2XUOA 5C35A 5IK2D 5KCZA 3BE8A 2QW8A 1DQYA 3R4CA 1DIAA 1F8YA 2FWBA 1X0VA 4R81A 3GLHB 3PQ7A 4NATA 5FWXA 5H4HA 3SLGA 5ENDA 4DYDA 3PWSA 1DBPA 1BGVA 2QRVB 3KP1A 4CR7A 2XOKA 2JL1A 4UKDA 4TTPA 4GKJB 2R47A 1WCWA 4Y9RA 4M22A 3CG4A 5HW0A 5BSEA 3VUEA 1V39A 4MW5A 2HHLA 5CB6A 1F7UA 1OOEA 1EWYA 1L9KA 1XALA 3EE6A 1KZ7B 4GBJA 1TB4A 1H65A 1TECE 1TIBA 1Y80A 1YGYA 2BZ0A 3PVCA 3QKWA 3R6TA 3SF8B 1H3NA 2CJFA 1W4AA 3LHDA 1AKVA 1OXSC 4US2R 4L0CA 2WI8A 4UE6A 4BWVA 2CJYA 1PX2A 2WINI 2Y1GA 3DC7A 3G5TA 3GL9A 3K0KA 3NP9A 4WL0A 4ED9A 4F3RA 5JU6A 1FTQA 1BG6A 4WJKB 2P30A 3X1KA 4EDFA 3LFUA 4KQCA 1OGJA 2IODA 3GA0A 2PUDA 1KR5A 2HI0A 5DBIA 1WLSA 4KR3A 4YMLA 2AR7A 4B6JA 2FZ5A 3MSXA 2IZ1A 4KL8S 4A0SA 3A36A 2I6QA 4Z3KA 3COJA 3K8OE 2DWQA 4AJ1A 2CLEB 3ESAA 5EE0A 1Y8RB 3TN7A 3VHXA 1X9GA 4DLNA 3P9SA 5CM8B 2O7SA 2QUJA 4LF5B 1OLUB 2YYAA 4PQEA 2QI9C 4KKXB 1MGPA 4ND8A 1EGQA 1YZKA 1GWNA 2IGTA 2YWRA 4RFVA 1K4YA 1HG0A 3HO8A 3L82B 4OJQA 2IDMA 1NE7A 1SFRA 2B61A 4H3SA 4BFYA 1BHJA 1IMJA 1ZXBA 3ADKA 3I45A 3MJEA 4CMGA 1ZA1A 2REQA 1GPH1 1RC1A 1IN7A 3N74A 4LOHA 4L4XA 4R9NA 4Q4LA 2LXNA 4CM8B 5C5EA 2IYAA 3JWEA 2IOHA 1MFZA 2AFIA 2EJWA 3OEED 4IQ0A 4D9BA 1GQQA 2ZXUA 3COYA 1X70A 3E2MA 4YMTA 5HIKA 2Q6OA 4HBZA 3IC5A 4DCMA 5ER9A 1CB0A 1PQUA 3UB3A 4P33A 4NFSA 2C5LA 4LHWA 4CF6A 4R69A 3BQMB 1M6YA 5KNDH 4H17A 1K06A 3MEQA 1DCKA 1R9MA 4EEZA 4GOND 1WEHA 1QCCA 3WDSA 4DLBA 1MO6A 3W4KA 5B2FA 2ZI4A 4UBMA 2ZG6A 1XG5A 1XP5A 4GYWA 4UTRA 3IO3A 4UVIA 2XUQA 1U8CB 5KYGA 1Z4LA 4HGOA 1HXHA 1GCOA 3CLKA 4CV0A 2FCAA 1EDOA 1PLKA 2FPPA 5CFMA 5JJKA 1ZC4A 1P9LA 2OGWA 1KVUA 3HCFA 4C7XA 4H7JA 4DF3A 2IOFK 1OBCA 1K7FB 2JIQA 3FCOA 2IF0A 4F9TA 5AW7A 1MTZA 5GIOE 3FOZA 2HMVA 1UPFA 2OFPA 2PBRA 3L77A 3LI2A 2CBXA 2CVOA 4KYIB 4OBXA 2BZSA 3OQBA 5G0TA 2VKQA 1D1QA 2VK1A 5AVJA 1FFGA 2R1TA 4FT2A 2EG9A 2XMQA 1RXUA 3RT1A 2GYVA 3SBEA 4Z8YA 5KOJA 2GD1O 1QQAA 1ABFA 4NENB 3FI9A 5LMUB 3AIKA 4QT4A 2YV3A 1QZZA 3LT4A 4P54A 1NVWQ 1O4VA 2QRGA 2VJNA 2YQZA 4Q3NA 4X3OA 2CYCA 3BN3A 3FA2A 1V5GA 3KRTA 1UZLA 3CONA 3RB8A 1QCZA 3K5WA 4AX4A 1LC0A 1UM8A 4XUCA 5A0VA 5G41A 3OF5A 1RQXA 3B7GA 1Z0JA 3P52A 3QW4B 1ZI6A 3VNRA 2IZ0A 3MIIA 4BX3A 1W8IA 4Q7QA 1FMFA 4Y9TA 4E5DA 3ZJ4A 2WEKA 3FSGD 1ZJJA 4EJ6A 2EX0A 3QFSA 1WD5A 3HB7A 1F2DA 3UWDA 2B7BA 2PRIA 1O08A 4PG6A 5FBHA 3OCWA 4C2BA 4EB8A 4H7EA 4ISCA 1HORA 4YDHB 1H5UA 4TWZA 5DWVA 2HSZA 2ZI9A 3RHSA 4JXZA 3BSFA 4P0QB 5GOZA 5FB3A 2YC2C 3DONA 2VQDA 3HL0A 4II7A 4R98A 4EUHA 3BL8A 5FV4A 1ZNXA 4P4GA 1PSWA 1S8FA 1JIIA 1M8FA 4JZKA 4WXEA 2BTQA 1PYOA 3PUWA 4HUQB 5AM4A 4B74A 3VTKA 5K6AC 1ZCFA 2H2WA 4Q5IA 2C7QA 2ZU0C 4YJGB 2WYWA 1LC3A 3D2AA 1ZHOA 1I3NA 1AU9A 3RUDA 5JSFA 1JHUA 2GEVA 2PN1A 3GYGA 3MELA 4YREA 1UBFA 4XQ9A 5LIPA 4YCNA 1GP2A 3DEHA 2E2WA 1JMVA 1WY5A 4MS3B 2XPCA 3G9QA 5A6SB 3FR7A 5HMLA 3RVBA 4BLWA 3HXQA 3C3XA 4GRDA 1D4ZA 1PFGA 1HG1A 2HIGA 4YAUA 5BV0A 4Y2GA 3ICEA 3NANA 2AOVA 4GL4A 4MQ5A 4PZEA 2WQ7A 2CMGA 1RPNA 3RW9A 4A0QA 4AN4A 4CTKA 2XITA 2WD7A 2OHJA 2GK4A 1K97A 1SXJD 2J30A 4HB0A 1GKIA 2FOIA 4TWRA 4M2LA 3HP4A 5AKLA 2H1HA 3L4EA 1JTEA 2QD5A 4IDBA 4QX6A 5ED4A 3O94A 4FNOA 3KLPX 3A1WA 1RWBA 1ZUIA 4A2WA 2C2OA 2C00A 3F6CA 2ZSAA 1TK3A 4R1NA 3X3HA 4LI0A 1CIPA 1A95A 5GM2A 3STUA 1VL1A 3OC0A 2A67A 1FF9A 4H2DA 4P6VF 4LGVA 3KQSA 1RQ2A 2YWGA 1XDSA 1Z33A 3QBEA 1PNOA 2CVZA 5U1PA 1FNCA 3QVWA 1BCSB 1RYFA 4A7PA 1YZUA 2V9PA 4EMTA 2QTMA 3GFOA 1JWBB 2Q5LA 1KEWA 4NZNA 2YIVX 3UWMA 1OPXA 1VJCA 1TIKA 3BS4A 4KXVA 2DQYA 3G1UA 4Q1BA 3T5MA 4E1AA 2JPDA 2NV0A 3N2IA 3TEMA 3WZLA 1GGEA 1XTVA 3DULA 1R00A 3HLKA 5JYDA 3T7RA 3BL5A 1E60A 4Y1RA 4RD2A 1PZXA 2ZUWA 1Y34E 4X6YA 1J5XA 1DUVG 2W42A 4QXMA 4GYYA 1NXQA 4GD3Q 4KMRA 3KZCA 1LW7A 5TE9A 2WHXA 1ORHA 5D1NA 5G0SA 3M3DA 4BLSA 5JXJA 5KZMB 4V1CB 5JYBA 4BC1A 1P8AA 3ED1A 4KH1A 1W36D 5AI8A 3T3PB 3FPJA 3EXG1 4OQ4A 5P21A 3FBWA 1NVFA 4PQGA 4IVRA 5A9RA 3WGZA 3IAS6 4UBNA 4HN2A 1COWD 1RCUA 5F9MA 1N25A 4BV8A 1H5NA 4O33A 5F12A 1UK7A 5IH7A 4CKCB 5GADl 3I23A 2JI4A 3I42A 3MJCA 3R5TA 3L06A 2UDPA 3WGVA 1Z18A 3IAM6 4IHJA 4U7TB 4KVFA 3IEUA 1Q14A 3KVYA 4QICA 3VPGA 4N65A 4Y9DA 4D8WA 2O5VA 3JAKB 3QU2A 3GXBA 1QC5A 1NRIA 3FNGA 2OLJA 2YMPA 3Q5EA 2PRSA 4JJ7A 1KJIA 1EVEA 4ZT4A 4B09A 3LDAA 1EDEA 3NBMA 3MMXA 4L74A 4U0KA 2HUPA 4TUYB 1XD2A 1UFRA 4HVCA 2A9QA 4Y2TA 3PVZA 1VG1A 2P3SA 3E05A 3LCVB 1V37A 3QVVA 5CRIA 1AKWA 2VHXA 1I36A 1RAIA 5K1ZA 4D3DA 2JLBA 3HADA 1JR3D 4DLSA 1ORRA 4B82A 5SY9A 2A9KA 2J5BA 4O0LA 5NLLA 3HBLA 1N2IA 5DCUA 1IJBA 1RABA 2O57A 4G5RA 1SBZA 1C8LA 1PBTA 2AW3A 1ST3A 5FNVA 5K0SA 3ONNA 3QELA 2OUIA 3DL7A 3LCUA 5EHNA 4DG9A 2ADFA 1B41A 3C8UA 3DE2X 3F6SA 1ZN7A 3P5SA 4HDSA 2I55A 4B4KA 1UMCA 2VPQA 2YMLA 3N0WA 2AJLI 4FPXA 3ZTTA 3TJRA 4DDMA 4EI7A 1OILA 3DFZA 3CRZA 3QE2A 4LZWA 4QARA 2XKAA 3FZEA 3PPWA 4XWKA 4YECA 4WZAE 5H3LA 2NUAA 1EHIA 1VG0B 3OCYA 4P83A 2QTWB 1YB1A 2RHGB 2XF2A 3RAPR 5IJZA 2NU7B 3B38A 3R7NA 1X2EA 3GEGA 2DXIA 4JJ6A 3JWIA 5DM1A 1J0DA 4V3CA 3PQ6A 1NKVA 5HDQA 4P0TA 4QNNA 3AIMA 4JI1B 4C6RA 1I0IA 1V0JA 1K6IA 1T2AA 1CHNA 2D1FA 3KTFA 3ZU5A 2CXUA 1REQA 4DTIA 3RR2A 3TLGA 3E15A 1NN1A 2I5PO 3DGFC 3NEPX 4NOMA 5HIIA 4BFWA 2FR0A 1NI5A 1GAXA 2A1TR 2AG5A 3OJEA 1N1GA 2ZSFA 4GT1A 1Z2OX 3IUMA 1TKAA 2AQIA 2ZYAA 4W1RA 2MWMA 2VZ0A 1DZ3A 1R0KA 3BXPA 3RSOA 4LCJA 1N0WA 1QAMA 4JOQA 2FR1A 4QDOA 5IUKC 5CCBA 1CNEA 2RKBA 3BA6A 3R20A 5JATA 4LDQA 1NMSA 4Z9XA 1N2EA 2I4MA 4MI1A 3GLGE 1NA5A 4XW2A 4H6XA 4LNHA 4DIKA 1TKBA 1BW9A 2MMCA 2J07A 3CYFA 2CLSA 3I0ZA 3NQ41 3UWKA 1ZCZA 4J0HA 3WZ2A 3N2EA 3S1AA 4BYGA 5IT5A 1L5ZA 1VP9A 1X7YB 1IHXA 2GN2A 3M5DA 4YCDA 2HA2A 3HDVA 1DCMA 5IYZA 1XZHA 6Q21A 1R10A 3LHKA 4OA5A 3S1LA 5FOQA 1E3IA 2Q2VA 1QG2A 4ZVRA 4ZIRB 1YONA 4FCCA 2WWRA 5CJ2A 3HB4X 3CLRC 4KYTA 2OVFA 5BNWA 2I8AA 3I04M 4GXNA 2OC4A 3UC9A 3F46A 4LNUB 4D8TA 4PYMA 1CIJA 1G19A 1TUIA 2HEGA 5ADHA 1C9KA 3GELA 4LJ6A 3QWBA 4O25A 2ECOA 3W6NA 4MJ7A 1MIOB 4URXR 2PQ6A 1QK5A 4FYJA 1G1MA 2EKQA 2PKQO 4EG5A 2GAJA 4DNQA 2RIPA 4IBOA 3CQ9A 2F55A 1UXHA 4XX0B 5EFZA 4UM9B 4WFKA 2N0SA 4ZOLF 4CI0B 3R7DA 3LFTA 1L7RA 1T9AA 3OI7A 1E1RD 1CVRA 1DC5A 1SBQA 3Q2OA 4DLUA 2AN5A 2JCSA 3LKBA 3SHWA 1OAOA 5J4KA 3D7NA 4QD3A 4YGYA 1CLEA 1L1RA 1LLQA 3F4KA 1CUEA 1P31A 3HO1A 3QENA 5IHXA 4BFXA 5ALWA 3NDRA 1YNSA 5BN3B 5CFQA 3ZK8A 4I4NA 4YPVA 2I2XB 4BVAA 1XN4A 4Z4CA 1NQ5A 4O4IF 5IMBA 2IYWA 2Y77A 3K0CC 5C4MA 4AP6A 1Y7HA 2BGJA 3KOWA 1NW5A 1NY6A 3EC1A 2YRFA 4W6QA 5MDHA 1PG5A 3NOQA 4LZJA 4Q16A 1T1SA 1QGDA 3LHSA 3LXMA 2CEKA 1E1MA 4ENSA 3DHYA 1L5HA 2TMGA 1FRFS 3QM1A 3CWCA 1C1DB 5LM3A 4E22A 1UBRS 4US1R 2H17A 4KV7A 2RKWA 2VP3A 5A6SA 3DMNA 3JQ7A 1A7KA 1QTIA 3HU3A 3LF2A 4MGZR 3WKAA 5CM9C 3T3EA 5JC8A 4BU0A 5IKOA 2FG5A 5HE9A 4AKGA 2PSHA 2OPBA 2B1RA 2VCEA 3CH5A 3KQWA 3MRTA 3G2NA 1A98A 3NBUA 2OV2A 2JGDA 4L9AA 3C7AA 1UMBB 4ND1A 3WNVA 4CEHA 4AX8A 4FJ0A 4OMFG 3P0IA 3E53A 2YVQA 1RI5A 1BX0A 5DK6A 1KQOA 2XGGA 3NDPA 4KBYA 3RRYA 1S02A 3ZLBA 2J3QA 1FDUA 4BNHA 2Q3BA 4B5KA 3A7DA 4ITVA 3IP6A 3NBFA 3D3EA 5A2QA 3L5OA 4PX3A 4QFDA 5H82A 5A0TA 4EHHA 1N1DA 2XVXA 3DDNA 4ZC1A 3PQFA 2QEQA 2GI4A 3NIFB 1X80B 1J21A 2HOQA 2B4RO 3BTOA 3VZSA 4P93A 1CUHA 3FOCA 3ESXA 5HRAA 1PV4A 1M8GA 1OIVA 1Y8AA 2F1RA 4LZPA 3SBOA 4UVDA 2J3IA 2O3QA 5LQMA 5CLIA 1WB6A 1M33A 1R0CA 5FBKA 5EG5A 2HYDA 5BNTA 1RP1A 1WXIA 4EYOA 1C9YA 2R6GA 5BWBA 2NVUB 3QOWA 3K0EA 5LOVF 4MUAA 5A2GA 1YJQA 1G7SA 1FNSA 2DTDA 4YBRA 3TZKA 5EMNA 2AFHA 4RJTA 2JFPA 2OAQ1 2VT6A 4JSYA 4Q3EA 1Y5LA 4GGPA 4XVHA 2WAMA 2HDOA 3FDJA 3BERA 4HXEB 2I2FA 1JG2A 2DPLA 5C9ZA 3BAZA 4BGUA 1X74A 2GX6A 2IPOA 3OY7A 5AVXA 2ZIXB 4MQEB 1WU7A 5IJ0B 5INTA 2A59A 1YXMA 2FRDA 2L2QA 3GVCA 5DOVA 4D3XA 4FZ5A 3QLVC 3RUCA 1UT6A 3G1WA 4TKZA 2X8JA 5IBRA 3U2QA 1IAVA 3WMWA 1B2LA 4MS3A 1LFAA 1XK6A 2J3DA 1DB3A 1G5IA 1EM6A 1BEEA 4GP6A 2VPXA 4D4GA 3JWJA 1D8AA 5F21A 2BMAA 3VISA 3O2NA 4A6DA 2O8BA 2N46A 1I6MA 2DU8A 1R0YA 2WJ3A 3FSGA 4AU1A 4F5EA 2PMDA 5BQXA 1JLKA 4ESOA 3U5ZB 4B43A 5JD6A 2ZKLA 1ZM7A 4JJZA 1U9CA 4RPIA 2FF5A 4HMOA 5ENVA 2JLCA 1JRLA 2XLCA 5H70A 4BJ5A 3DCIA 4UNPA 2AE2A 1OLSA 4GXQA 1JDUA 1YJ5A 1ODCA 2I1QA 2Y3IA 3O0DA 1M7GA 3V2GA 1R66A 4DQVA 3P9QA 1NVAA 4F60A 1G5PA 3UOAB 4BE9A 2ZS8A 4EMBA 4P36A 4RHYA 3FPGA 2OILA 4FKMA 5DHRA 1B3BA 4KPEC 1MV5A 1TT7A 3D31A 3D2CA 1JT2A 2JHGA 4LJRA 3H99A 4HAUA 2V0NA 2EARA 3CCCA 3RDPA 5KYVA 1WVGA 2CNOA 2GBLC 2R1TB 3GEHA 3NW9A 4BZQA 3EVCA 2MYPA 5GQSA 1JAYA 3WOVA 2CNKA 3J81A 4QM7A 1HE2A 1B1AA 1P72A 5DB4A 3ESZA 4ANFA 1M2KA 1N2OA 3QLTA 2HGSA 4C0KA 5M04A 1UOOA 1YC2A 3JQ9A 2X0DA 1N2BA 2J9XB 2Q0QA 1GQSA 1Y3IA 3X1DA 4BVGA 1DIOB 3FZYA 1ORVA 1GEGA 4IMIB 4NE9A 5AM5A 1OFUA 3DE4X 5HF9A 3WV5A 3SGLA 3ENWA 4WN9A 1P1IA 3KJGA 4L2IA 1GGVA 3IOBA 2N9UA 4GPBA 1JIXA 4IVPA 4LDAA 4OXNA 2HH9A 3TX6A 1M34E 3NNSA 3TQRA 2XYGA 4OP2A 2QTCA 2Y9MB 1S2IA 5D1HA 3I64A 4KKVA 5HS6A 4CQLA 3SQXA 4BKOA 4HZGA 3FFBA 3GLHE 1WVIA 2G70A 2QZPA 1XYVA 3BREA 3IUPA 4HGYA 4Q66C 4B4VA 3HKDB 4QGAA 2XMRA 1YS2X 3SPXA 1FFYA 5DLDA 3MUEA 4ECAA 4MGHA 4RY8A 2YV1A 3K1YA 3B5JA 1ACMA 5ALUA 4AKSA 5K6RA 5DASA 1K6EA 1VBFA 4L5YA 1KI6A 3FUXA 3FY4A 4EABA 1JZSA 4RTNA 3LGSA 3MWDB 1K5DA 4Z4QA 1JSZA 1MX3A 3ETLA 3L6BA 2IS6A 1OGYA 1G3UA 1RKUA 1VKZA 1X87A 1UBNA 1E7QA 2RJOA 2LP4Y 2XCUA 1OGIA 3EGIA 3M83A 3IOEA 4LHZA 4LC9A 4S1WA 3MTDA 3HWX1 1V1MA 4J0FA 2UYGA 5FJJA 5REQA 2BJHA 3IT2A 4FFBA 1V4NA 5FPYA 4X7PA 3CR3C 1C3JA 2DFLA 5K8LA 3C5CA 1H2ZA 4NYIQ 1GNTA 1UOPA 2EBWA 3QG5A 2WWVD 1SIOA 1UBCA 2MSWA 2ZRKA 3KKOA 3EIOA 4RY2A 1AKNA 1KHHA 2PUGA 2Q6VA 2CJWB 5AJVB 4Y1EA 1BDHA 2BZGA 2AZMA 2X6RA 2YS7A 2CHEA 1UAYA 2YHBA 3L7DA 3OTGA 2C2KA 2EZ9A 1Y6JA 1RJ9A 3AVQA 1YZFA 4S05A 5B58T 4KDCA 4D4IA 1Y48E 3N0TA 2C07A 4D9HA 3GJSA 4YCLA 2PZEA 3PEWA 3BFVA 2HF9A 1NBMD 1ZGGA 1G55A 2A4MA 4LV8B 4UEKA 5AHOA 4F1JA 2J3JA 5G1OA 4ZIRA 3N07A 1CS4C 4FIDA 1UDRA 4JBWA 4OK3A 4PFSA 1DG3A 1ZW1A 4MV4A 1JW9B 2WJPA 3ZBPA 2V8OA 4YMUA 2WM3A 4AI6A 1P4GA 3EDCA 3R76A 1OQAA 2OAEA 3LGXA 4DC9A 2VDOB 2LKDA 2PX8A 2AZ4A 2LWIA 3OCXA 5C8XA 3WWOA 3ETGA 1T6XA 4RA9B 5IAAA 2V59A 5KJFA 1DKRA 1M3SA 3CRMA 3T06B 1P7PA 3ZE6A 3UJPA 1J4AA 2ZSIA 2G9UA 2ZITA 1A27A 2MMGA 2QN1A 3SQOA 3C1TA 3NDJA 3IPCA 2E5FA 4JT9A 5KYUB 3HL4A 1I7LA 3QEKA 4HNSA 3TJZA 1V9LA 1YVRA 3FUTA 3KOOA 5T57A 3ZPXA 2PWZA 3VDXA 4EPTA 2G63A 2GJ8A 1QZXA 4QDKA 1QAQA 1OBFO 1XZ8A 5C4GB 1L5RA 1Q77A 1MT3A 3ZBTA 2AZTA 4BGDA 5DRTA 5K51A 2HJVA 2G7MC 3A2LA 3HTXA 1PWYE 1ZGBA 2DECA 4ARUA 3ILVA 2EF0A 1GG5A 3DFFA 4ZDWA 3DM5A 4EG1A 1HYBA 3CMMA 4IOJA 1F2UA 5EP1A 3VPSA 5JQGF 2XJ4A 1GT6A 2RAUA 4U39A 8GPBA 4PBSA 1A7JA 5EIEA 3G0IA 3WO1A 5DBFA 2GAAA 1HV8A 4DT1A 1YR7A 3EVFA 3O8QB 1DEAA 2QPTA 5KVSA 1R0SA 2IYUA 3GGCA 1P6UA 5CAEA 4KRFA 5LD2C 1Q50A 4KTTE 5A62A 3HWWA 3R40A 1TJPB 2QLMA 5CYGA 5KYXB 1KEEA 1SCBA 5FIUA 4UJ5A 3WJ1A 4ZMSA 1U99A 4R8RA 3WYEA 2ZT8A 4Q19A 1SU4A 5B58C 3IB6A 1WP9A 4MR8B 3SR0A 4B4DA 2X1MA 5HQTA 5K3CA 4KFTA 3T7IA 4WERA 1T4DA 3EULA 1TM2A 2RGWA 1MQSA 5IC4A 2F67A 4I4TB 4R7GA 1DKNA 1KP2A 4DLAA 3UPDA 1Z63A 2BW0A 2YXEA 3M9WA 1V8ZA 4L22A 5KQSA 2G9VA 1VE9A 3MIZA 4CEJA 2CDCA 2H7VA 2HRRA 4K28A 2VDWB 3E9NA 4FMBB 2BDUA 2B37A 3IVGA 4EPRA 2OORC 3KT3A 4LF9B 1F9AA 1XDGA 2ZRBA 3KFXA 1IQRA 4YR9A 2DERA 2F17A 3B2QA 4F0JA 2JK0A 3TOXA 4KXMA 3LL4A 4AULA 1CUWA 2H1OA 3VVMA 1H8EA 4M6WB 4BVFA 4DCOA 4OKIA 3CPHA 3ICOA 3UF0A 5B30A 1KPIA 4W9NA 4MR9B 3K6SB 4MZDA 2IW1A 4J0EA 5HF5A 1MIHA 3QXGA 2WY2D 1L3CA 4AKTA 2XGJA 1P4SA 4W5HA 1GSHA 1V35A 2WA1A 4IQ4A 5JECA 3RV4A 4PNPA 3KIPA 2DUWA 4PSUA 2GYUA 4HSEA 1AB5A 1TUEA 2IYOA 1KC1A 4L27A 2HA5A 4PGAA 5A06A 5BYKA 2CL6X 2NW6A 2CMKA 4QUHA 4TTSA 3DXZA 4P08A 2P90A 3ZQ4A 3U6BA 3ESDA 3OG9A 4AICA 1Z5UA 3QU7A 1BAPA 1XEXB 1NY5A 5B4VA 821PA 5D7NA 3O7MA 4HVAA 3C1UA 1JLSA 1Q0HA 2DT5A 3D5EA 3GARA 3UXHA 4EYSA 4I36A 4B83A 1FYFA 4LEIA 4HXGA 5FPSA 5LXTA 4IDFA 2I6UA 2PFKA 2PWPA 3PEEA 4Y1GA 3N2GB 1KE1A 1T24A 4KIWA 4AN0A 2I1VB 4CYMA 4J90A 1WDKA 1NVDA 3H2BA 1SVLA 3HCPA 3KSMA 4NCKA 1A76A 1LI7A 2GFHA 1QIGA 1O1YA 2UAGA 3ZDQA 2FFJA 5J1SB 3L4KA 1YZTA 2ZZNA 5CB4B 3BHMA 5JXGA 1R5NA 4GZ3A 4MVCA 4MCHA 3DNFA 1EG2A 1SGWA 4RC9A 3WGGA 3QOYA 2I7CA 4B3IA 2AE1A 2VPYA 2XMGA 3OZWA 5D3MB 4P5DA 1N6KA 1TKCA 4C2TA 1XXHA 1DKUA 1HOXA 3B1JA 3D4BA 1H23A 2ZUTA 1GZ3A 2NXNA 1W9HA 2AI2A 4J2HA 4RBNA 4WXHA 1TW3A 3ONVA 2E4XA 1GNSA 3QKSB 4Z53A 1AQYA