4AJOA

Rat ldha in complex with 2-((4-(4-((3-((2-methyl-1,3-benzothiazol-6yl) amino)-3-oxo-propyl)amino)-4-oxo-butyl)phenyl)methyl)propanedioic acid
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
330
structure length
330
Chain Sequence
ALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
total genus 116
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajoA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajoA02
1Y6JA 3A28A 3W8FA 3INGA 1U3UA 1I5RA 2LDBA 1FDSA 2J3HA 4GLLA 5KJCA 4R51A 4YYZA 4WNIA 5J23A 1TEHA 1U3VA 2C59A 2EP7A 3PJEA 5C7OO 4BHTA 4R54A 3IKTA 4NBRA 3ZU2A 3E6AA 4E5KA 4RO0A 5CG1A 3MEQA 4GH5A 3Q6IA 3FNHA 4PN3A 3P2OA 4ZA2A 3GHHA 2JD0A 2Z1NA 4XYBA 2WTBA 1PS0A 5JDCA 2D5AA 4YDRA 1HDYA 3FR8A 4BNLA 4TKMA 4WEQA 2PTGA 4L9RA 5F1PA 2HRZA 4Y9DA 3FPLA 1Y8RA 4YTEA 1XSEA 3ANMA 5G2OA 4CMIB 4EJMA 3KRTA 3MJVA 2HMWA 1X13A 3SLKA 3GAFA 1IULA 2QRKA 3ONEA 1T4DA 2BHLA 4BO3A 3LT0A 4WK6A 3AFMA 2IZ1A 3AUSA 1F8FA 1UUFA 2FPIA 4OYRA 5TRTA 1QYCA 5A03A 3VH2A 1H94A 4D0SA 1MG5A 4PLGA 1I2ZA 3AUUA 4I8XA 3CKYA 2I3AA 4RGBA 3WSVA 4OO3A 2Q46A 1HETA 3U62A 1IOLA 1I3NA 2Y0CA 4CLRA 3KYDB 1FF9A 3NGLA 4BNJA 4FDAA 1FJHA 4IDDA 2HMTA 2NVBA 3ZCXA 1MP0A 1I2BA 3QY9A 5TS3A 3E9MA 4TQGA 4JIGA 5TSDA 3OJFA 4CM9D 1PGJA 3C1AA 4ESOA 3CH6A 3WDSA 1NWHA 4CM9A 3FNFA 1GQYA 4U8GA 4AICA 1QSGA 3A1NA 2PKRA 3L9WA 2ZCVA 3KYDA 3ADOA 1AE1A 4CJXA 1N7GA 4PLZA 2C5AA 4GX5A 4F3YA 3AOGA 2VT2A 3BTUA 2VYVD 3B1JA 2D0IA 2C2YA 3F5QA 3HDQA 4J6FA 1QORA 2UUPA 2EKPA 1R12A 3DOOA 2X0NA 3L4BA 5CDUA 3FTPA 1LRLA 1SC6A 2EKQA 2NTJA 4J1TA 1IUKA 4MJLA 2AQIA 4RVHA 1QYWA 2H6EA 3TL2A 3GVXA 2GN4A 1JN0A 4PG8A 4OKIA 4KUGA 4MVJH 2NQ8A 4OXKA 4XB2A 1QYXA 1E7MA 3JQ8A 4L8VA 4MVJE 3HN7A 2BFPA 5F1OA 4CMCA 4AJEA 2HAEA 2P68A 3RU9A 4BO4A 4E33A 4NBWA 3I9MA 1NX6A 4Q9NA 3SX2A 5LDHA 4E2WA 4CM7A 3G1UA 4WASA 1LC0A 1BDBA 1JLLA 4QXMA 4TRRA 1KYQA 1N1EA 2YHIB 3DB2A 3IOYA 3U4IA 3OIGA 3PEFA 1GTMA 1Z82A 3L77A 4AJPA 3DBRB 3TF5A 1A7KA 1OFGA 3VC7A 1U9JA 3A14A 2EF1A 3JV7A 1I3LA 4H15A 2VYVA 1R0SA 3W6ZA 2GRAA 4MVJI 3GDOA 3E9QA 1ADFA 4D41A 2Q45A 5AXBA 5L45A 1DRUA 5GZ3A 4U0JA 4YAGA 2OZPA 1ZSYA 4IJWA 4GMFA 5FI5A 3WICA 3ZWWA 3DEYX 4II3A 1AHIA 3KSUA 2IEDA 4R41A 3WFJA 1NYTA 2NM0A 3BZUA 4YJFB 2D3TA 3AUTA 5KVVA 3GC6A 3EAGA 2OL4A 2HMVA 3H7AA 4S1VA 4UULA 4XRRA 2GR9A 1P1HA 1LQTA 2NADA 4J90A 3QQPA 5TJHA 3WGZA 3PWZA 5A9SB 1NNUA 1BRMA 5IZ4A 1LSUA 2O4UX 4GL4A 5C7IO 4UVGA 5K9ZA 3PZRA 3ROMA 2C0CA 5GZ1A 3WTCA 3TZHA 4ZRMA 2E49A 4ALLA 3WSWA 1DIRA 1U2GA 1YB5A 1P9LA 3ZWBA 3K73O 1XHLA 5CEJA 3AK4A 2B0JA 4FD3A 4GVXA 3O8QA 4IMPA 3PWKA 2HLPA 1TLTA 2AEJA 2WJPA 4R3NA 3PJFA 2FSSA 1R4NB 1XQ1A 5JE8A 1E1KA 3UAGA 1U5CA 5CDTA 2B69A 3ZWCA 1BHSA 1ISMA 1IYZA 1P3DA 4RPJA 4CMEA 1LLQA 5JAIA 2W4QA 3T4EA 4AL4A 2VQ3A 3BHMA 4IIUA 1RM4A 1MV8A 2BGMA 4R1NA 1EVIA 4ZQGA 1ZBQA 2DTDA 2ET6A 4J2HA 2POQX 1EK5A 8LDHA 5A5FA 4TKLA 2X22A 3DHYA 2AA3A 4J9UE 3WYCA 2J3IA 4DLAA 1Y9AA 1ONOA 4CQMD 2O2YA 4P4LA 1HE2A 2X5JO 1U4SA 2ZJ1A 4NR0A 3ON5A 2C07A 2EXXA 2ZTMA 3H5RA 4E31A 4KQWA 1UDBA 1GD1O 3I9JA 5ES3A 1DOHA 2YDXA 3G1TA 3PVZA 5EIOA 5CG2A 5JBIA 2ZYGA 4GKVA 5I8ZA 1E77A 3PYXA 5A5EA 4RVSA 1O89A 5CEEA 3DFZA 2QHXA 3D4PA 1P77A 3INRA 3GK3A 3OECA 4QUKA 5BSHA 2YFQA 4J7UA 3SLGA 5JCJA 3LLVA 4IZIA 3GEGA 4CMGA 3HDYA 5IN4A 3WYEA 2SCUA 2UDPA 3UN1A 5B4TA 1SCUA 4ROSA 1F12A 2VT3A 2O3JA 3QVTA 1ARZA 3H9UA 4FJ1A 3WGTA 1H0KA 1F0YA 2BFAA 3I23A 3TZ6A 4YRDA 3RUFA 1DDOA 3L6DA 4ID9A 4GGOA 3DC2A 4NMHA 2PD6A 5TQVA 2NTVA 3K6JA 1R4NA 4FBGA 4IJUA 1JA9A 4FGSA 3GOHA 2DFDA 1NQAO 2VN8A 3L9XA 4LCJA 2J6IA 3CTMA 1B14A 3O8QB 1YVEI 4NDNE 1RYEA 4TVBA 2V6FA 4BO8A 1P1IA 4ZICA 1XLTA 4UUPA 1EDOA 5F1KA 4E3ZA 4RF5A 2Y1OA 4MVJA 3K92A 1D3AA 1UXGA 1WLYA 1XDWA 4M55A 2HSDA 2P9GA 1KY5A 5B1YA 1QYVA 2OOSA 1EUCA 4JGBA 1YOVA 1M2WA 1XIVA 4BNNA 2W2KA 1B15A 5EESA 3U4DA 5KIAA 3WJ7A 2YY7A 4LCEA 5DP2A 4EZBA 3V2HA 3G49A 4GBJA 3UCFA 2G82A 3HADA 3PK0A 4QTZA 4FR5A 3BIOA 3WXBA 4KQXA 2CZCA 1NVGA 1MGOA 1OI7A 2O3TA 4F45A 1N9GB 1H6DA 3F4LA 5G4KB 4EBFA 1GQ2A 1Z73A 7ADHA 3GZNB 3JD4A 1YS4A 2Q2VA 5JO0A 5CDYA 4I1IA 4MDHA 2X7HA 2YQ4A 3E03A 4J49A 1R0KA 1DIBA 1VL6A 3LK7A 2PGLA 4J43A 5CAEA 1IB6A 2X1HA 2G1UA 5BNTA 1G6KA 2VRCD 3KM0A 3D3EA 1J0XO 3EY4A 3QV1A 4W4TA 2P4HX 1JDJA 1UJMA 2QRLA 3JYQA 3PIDA 4CMHA 3U09A 3B20A 3ROQA 1WAMA 5KWEA 2Q3EA 3HG7A 4CV1A 4R01A 5DN9A 1YXMA 4A10A 2W98A 3CXRA 3AWDA 2Q4EA 4YCAA 5EQFA 2Q1SA 4DTIA 1N5DA 4WCFA 3FD8A 5G0UA 3MJEA 4QSMA 1DC6A 5DP1A 1P1RA 3OA2A 3BAZA 3TSCA 4UVHA 2Y1EA 2VHYA 4N5NA 4BV9A 2WDZA 3ETEA 3I1JA 4CMEC 2FPGA 1ENOA 1EVZA 2BI7A 3I52A 3UVEA 5JMPA 1G0OA 3ZU4A 5EERA 2I65A 4EDFA 5DULA 1R37A 4A5OA 4FFOA 5IZCA 5JMWA 2QYSA 3GT0A 3UF0A 1P1KA 5BQFA 2QX7A 4UEJA 1P0FA 3WX0A 1D1SA 3QWIA 4L4RA 5JAZA 3OICA 4PG5A 4B4WA 1XEAA 2V6GA 2VYND 2Y1GA 1BXGA 3PYLA 3K8ZA 1AN9A 3H5AA 3RROA 4NI5A 4DWVA 4Q3EA 3VVCA 4II2A 1J4AA 3EVNA 1IPEA 3SEFA 5KJFA 2WE7A 3WNQA 3WMXA 3W4JA 4CM4A 3I83A 3A4VA 4TMFA 1MFZA 1T1RA 1D7OA 1R66A 4FS3A 5ITWA 4CM3A 1Z45A 3H6KA 4Y6RA 2JD2A 5JFOA 1KC1A 5H81A 2GNAA 1PL7A 4J91A 4INAA 3RUEA 2Y99A 3GEDA 4AJ4A 5FFFA 1ULSA 1P0CA 1ZXLA 4TZTA 5L4NA 1Z74A 1DHTA 1Y9EA 3HE3A 2X0RA 3I5MA 3WMWA 1O8CA 4YAIA 2Z95A 3CPSA 4F6LA 1DFGA 4L74A 3F3SA 3HNPA 4S3MA 4HFJA 4CPDA 1GZ4A 4JBHA 1PQUA 2XAAA 4UAGA 1GUFA 4NH4A 2HO5A 5BNFA 4BNWA 1DHRA 3NDJA 2PA3A 4KOAA 3E82A 3S2EA 3PJGA 4BV8A 3NJ8A 2ZYAA 4YEDA 3GUYA 2IRWA 3ZH2A 4RF2A 2IYPA 1UZMA 1ID1A 4K26A 1I01A 4L4SA 3QSGA 4EW6A 3ENNA 2DBVO 1WMBA 1PJCA 1X14A 3BMQB 1B8PA 1ZZEA 1H6BA 2Q49A 1GFSA 1UDCA 3JYPA 1A9ZA 2FR1A 2R00A 3NV9A 4WEOA 3NRCA 3TJRA 2EERA 1CQJA 1U7TA 4GVLA 3OQ1A 3BMCA 4YT4A 2P4QA 1JKJA 1D4FA 2GN8A 2PK3A 4OIMA 4TZKA 9LDTA 3E18A 1EUZA 2EJVA 5CFZA 4XKJA 3KSZO 2X8LA 4IXTA 3UUWA 4Z0PA 1BWSA 4BGEA 4R16A 3K31A 1YJ8A 4HFRA 1X1TA 4A7PA 3ANLA 2GCGA 5EL0A 2JFGA 1BVRA 3GGGA 1DLJA 3JQGB 2VUSA 4W7IA 5A3VA 1WDLA 3RKRA 2XOXA 4RQUA 4QFDA 4PLCA 1PL6A 3JQ9A 4NHEA 4XB1A 1B3BA 1B8UA 4XWYA 1EEHA 4DBVO 1NTOA 2UUOA 1PIWA 1NAHA 3AFNA 2WSBA 1HL3A 4H7PA 3BMNA 4ONEA 3D4NA 1NP3A 3VPGA 3ZNPA 4CLOA 4R9RA 5KKAA 5IJZA 2VTDA 3UOGA 1DJQA 3MTGA 4AJLA 1Y1PA 1QKIA 3KSDO 1A4IA 5L7WA 3NGXA 3KHUA 1XU9A 1UXJA 4BIIA 5BR7A 3GRKA 3QIVA 2Y05A 5ILGA 3RVDA 3DMTC 1QRRA 2IZ0A 1ISFA 3ULKA 4XA8A 3W6UA 1B2LA 4YAJA 1NFRA 5A4DA 1I0ZA 5THKA 4G81A 3WGHA 4DPLA 1NFQA 2FRDA 3COSA 4MKZA 1MA0A 1ISHA 2DUUA 3PQFA 4FC6A 4FFPA 5DDIP 5DNAA 1KC3A 4UVDA 5JO9A 3GFGA 3O38A 1LA2A 3AU8A 4N18A 1E3WA 1OC4A 1ZCJA 4KTTE 3RWBA 4TRJA 1ENPA 4JQCA 4HXYA 3W8DA 2PZLA 1CWUA 3I3OA 3OM9A 6ADHA 1E1MA 2Q4BA 2Q2WA 1CQIA 2ZCUA 4D3DA 1GPDG 2VHXA 1Z6ZA 3DZJA 3RFVA 4CM1A 1X7DA 3TDKA 3W4IA 5L4SA 2D59A 3D3WA 3PQDA 5I8WA 1VC2A 4CODB 5BNIA 1X0XA 3QHAA 4YVFA 4IS2A 2JHFA 3ZNOA 2ZB3A 5I7VA 2AHRA 2NACA 2AW5A 1E7QA 2ZTVA 2F1KA 3LZ6A 3ZWMA 3DHEA 4CM8A 4G2NA 2ZTLA 5JYDA 5L7TA 1OZAA 1T2DA 5T6BA 4MINA 5JDIC 1LSOA 1K2WA 1PZFA 5IDQA 1E3SA 2DBRA 1HLDA 2I99A 2C7VA 4PRLA 4I5EA 4FC7A 2DAPA 4JJIA 3U4CA 1XCBA 3S2FA 3IP3A 2FZWA 5TX7A 4BB5A 3JD3A 2VOJA 3F46A 1J6UA 1PJTA 4YJGB 3TFOA 2Q1TA 3EC7A 4R9SA 4MOWA 1MX3A 2C7GA 4NBTA 3IIEA 2TMGA 3DAFA 2I67A 4RZIA 1BXGB 4CL8A 1VJ1A 5A06A 4UUOA 3OJEA 1BDMA 4IINA 2CMDA 4IJKA 4BGVA 3LT1A 1LDMA 3BMQA 3ZV4A 2PY6A 4GQAA 1KEWA 4FFNA 4B79A 2JL1A 2IYOA 5K6AA 3CZRA 3JQ9C 3VOSA 4R1SA 5CEFA 1KOLA 2GASA 2VWPA 3RC9A 2GLXA 4QEDA 4WLVA 4ZQFA 3ZWYA 2A4KA 3EZLA 3OP4A 1IY8A 3RC7A 4A2CA 3JYLA 3F1KA 1GUYA 3KYCB 5KJ6A 2EEZA 1HYGA 1NAIA 1C1XB 1HRDA 3D64A 1LLUA 2WD7B 3V1UA 4IMRA 4DMLA 1XELA 1V3TA 4WECA 3D5QA 4G5HA 4CMAA 4YBZA 4LSWA 2FHSA 3VZRA 3JQFA 4PRKA 4M87A 4UEKA 3FWZA 3IUPA 3QA9A 5JS6A 3FCOA 4J16A 3FF4A 4DC0A 2B4RO 1W6UA 3PDJA 2EHDA 1LJ8A 2DVMA 2Y0EA 4GKBA 4PVCA 3DMTA 4BNFA 1SO8A 2B5VA 3GLQA 1ZW1A 1LLDA 4TRNA 5FYDA 3K2BA 2Q2QA 2X86A 4PIVA 2QG4A 2V6MA 1KEVA 3GNSA 1N2SA 2AEMA 3OQBA 4MKXA 1ISIA 1T4BA 3EW7A 5G4KA 4YACA 3GZ4A 5FI3A 3WGQA 3EK2A 3DZKA 3IQDB 4UUNA 1MC4A 3VAZA 4OM8A 4WLFA 5IN5A 4TSKA 4BKRA 2J5RA 3OH8A 1QV7A 3EVTA 4UREA 5FF9A 1RKXA 3GMSA 3KUXA 3OSUA 1GDHA 1Q2XA 4XEHA 2P9CA 1W8DA 4GWGA 2B35A 3PLRA 1VSUA 1HLPA 2XXBA 1R0LA 1QR6A 4R68A 4YT2A 1MXFA 1HKUA 1OOEA 1WZIA 4BB6A 3C85A 5B4UA 1T25A 1L7DA 1DC3A 2RH4A 2WD8A 5KVQA 3VTFA 1SZJG 2UAGA 1YO6A 3KTDA 4CV2A 3LSYA 2DKNA 4J3FA 2O3SA 1QLHA 2GZ2A 4URFA 2GZ1A 3D3WB 1EZ4A 3F6YA 1XYGA 4KUEA 1DLIA 2QW8A 5I9LA 4XGKA 1I30A 1Y5RA 3JYNA 1ZK0A 3I4FA 4ND4A 4BNUA 3OJ0A 4BMSA 1ZIDA 4BQPA 5FEUA 2GDZA 1DRVA 1OMOA 5KJEA 4UVIA 3ZWPA 3ITDA 3CSDA 1NM5A 1CRWG 1BMDA 3NKLA 3P5SA 4CLEA 3ZHYA 4E5YA 1Y8QB 3RQSA 1DO8A 2BLLA 3IKVA 1GPJA 2PKQO 1ZSVA 1HSOA 1XG5A 4PLYA 1JAXA 3PLNA 5T57A 4IPTA 1W0CA 3WIEA 1QG6A 2JD1A 4ZVVA 1F14A 2HCTA 4E32A 3QE3A 2JFHA 3WGIA 2EWMA 4BKPA 5DCUA 1MXHA 1E0DA 4Q39A 5T8KC 3CE6A 1GZ3A 2I76A 1NR1A 1XWFA 5JY1A 3VH4A 4YQZA 4AJ2A 3OEYA 4BQRA 2NNLD 3C8MA 3EDMA 1XGKA 4KWIA 2CY0A 3QWFA 1C3VA 3R6DA 3A06A 2TMDA 5CDSA 5JAQA 3HB5X 4D44A 4DIBA 1ORRA 1M67A 5IFLA 4JN6B 1RJWA 3B6ZA 3GF4A 3IAHA 3NJ4A 5JYEA 4JNKA 3WGYA 1N7HA 1YOVB 4PGFA 1LSSA 3H4VA 3VVBA 1LDNA 4J4HA 4PLTA 4ALKA 4LMPA 3DBRA 1V9LA 5COBA 2PLAA 2A92A 5GMOA 5IXYA 4KUHA 4JX8A 3NT5A 1B16A 1PQPA 1YKFA 2PFGA 3PZBA 3ZDFA 3RBZA 3OA0A 4J1QA 4L73A 1PJ4A 4E30A 4XD2A 2OFPA 1DB3A 2FOIA 5F3RA 1P31A 5BT9A 2C54A 1GQQA 1GL3A 2Y1DA 1WDMA 4HUJA 4K6FA 4ZU3A 5KJ1A 3BA1A 3L0DA 4NG5A 4NZ9A 2JKVA 1HE5A 1C14A 2AG8A 1RM3A 1XKQA 4MO2A 3K9QO 3R3SA 4BNGA 2FR0A 1NFFA 4LN1A 2XF8A 2Q99A 3GVCA 4XYEA 1KVSA 3INTA 3D1LA 4A0SA 1TA4A 4OSOA 2DUWA 3JQBA 1PL8A 4JP2A 1GV1A 1I3KA 5T8KA 3AOEC 4BNMA 2IDZA 2IZZA 1JAYA 1LSJA 3FNGA 4RLHA 4U7WA 2Y0DA 3Q2KA 3WIDA 3SVTA 5CPBA 1DC4A 2VRCA 1VPDA 2WMDA 3DONA 1H9AA 4CLXA 3LYLA 3LF1A 4FOSA 4N5LA 1NPTO 4O5OA 2IODA 2E48A 1PR3A 3GVHA 3VPHA 9LDBA 4EITA 4Q3DA 3X2FA 5KVSA 3DXFA 4MPDA 5AVOA 5C7LO 1YL6A 2P2SA 3LU1A 5EMHA 1DIAA 1DJNA 2JFFA 5U1PA 3RI3A 1PTJA 3HN2A 4CLOB 4M89A 4WOJA 3TZKA 4IXWA 1LDGA 4OSPA 4TVOA 1EDZA 4RVGA 3PI7A 4MVJG 2BMAA 4N7RA 4DGSA 4WOKA 5L7YA 1ZJYA 2CVZA 4LMRA 4GGPA 2O7QA 3FBGA 1LDYA 2ZK7A 3B1FA 5ENDA 3FTNA 2X5OA 1HF3A 3V5NA 1QXSA 4R5HA 3E5RA 5DBGA 2VNSA 2ZB7A 2VTEA 1V3VA 3UGKA 4BVAA 2DPHA 1PQWA 3BHJA 4MVJD 3RCBA 3OF2A 4XQEA 1P45A 3NTRA 2R2GA 2JAPA 4B8ZA 1Q7BA 2CF5A 4JP3A 3U5TA 4J9VA 4YT8A 4YAEA 2J3KA 3BHIA 3KEQA 3ADPA 1CETA 4RVFA 1F17A 3DZBA 2RBEA 4FPXA 3AY6A 4IDEA 1E6WA 3OIFA 1AUPA 5BSFA 3O9ZA 3PJDA 4I9NA 2QRJA 2ZYDA 3JQ7A 5U4QA 3I9OA 4PLFA 3TZCA 4RVUA 4M1QA 1ZSNA 2VWHA 1X1EA 3JQFC 3GMDA 2RAFA 3L6OO 2CF6A 3AY7A 4Z0TA 1PGQA 1S7CA 1H9BA 3I9NA 1PGNA 3LT4A 4JCOA 2OMEA 3ORFA 3V8BA 1PR9A 4I9UA 1M6WA 1BXZA 2AQ8A 2VOEA 4BNKA 2ZB8A 4AVYA 4H16A 3V2GA 1O95A 4L76A 5F5NA 2BD0A 2AXQA 4XJTA 3W8EA 2BF7A 4XQGA 3BTSA 4HADA 3H9EO 1D8AA 2LDXA 4RPKA 4B7XA 1HXHA 1WXDA 3M6IA 3RUCA 1WNTA 1LDBA 3OEWA 4JBIA 3TQHA 4DMMA 2JCXA 3R1IA 1UH5A 3LVFO 3B1KA 2A94A 1EUDA 5ER6A 3RUAA 4B4VA 3JTMA 3PWSA 5IF3A 4IQGA 4DLBA 2DM6A 2VUTA 1H2BA 2GGSA 5T5QA 4DA9A 4XIYA 4NBUA 3V1YA 1WVGA 4KTVE 4Q3CA 1ULUA 2PD3A 1P44A 3NT4A 4RL6A 3EHEA 4FOOA 4I5GA 1KIFA 4FCCA 2GN9A 1C0PA 1P74A 2ILTA 2JCVA 1KS9A 5JXWA 4ZQEA 3S8MA 3IJRA 3OHSX 5F5LA 1WMAA 4BOYA 1VKNA 3L6EA 4OAQA 3I4CA 5DT9A 4CQMB 4Y8VA 2NU6A 3ZWOA 2DLDA 3H2ZA 4BO1A 4IQ8A 5AXDA 3WLEA 3IP1A 1ML3A 5L3ZA 3UXYA 1PJLA 1H2HA 1SAYA 4QO7A 4RCVA 4BNXA 1YH3A 3GVPA 4RDIA 5JC1A 2V65A 3LF2A 2HK9A 3GH3A 1CDOA 2HU2A 3MJTA 3G17A 4WLEA 2FMUA 1NWCA 1E5QA 1PZGA 2B4QA 3HB4X 4WCDA 1ADBA 4CL3A 1MLDA 5JPIA 4RF4A 1G0NA 4XQCA 1JTVA 2H5LA 1LRJA 3D4OA 3DWFA 4GPD1 4WCFB 4BNIA 3GGOA 3HDHA 2UYYA 2X5KO 4MKRA 5DCWA 4Z0HO 1NQOA 5LCXA 4D0RA 1LLCA 4TRMA 5ER9A 4EUFA 3JSAA 3GAZA 5LC1A 3JQGA 4AJ1A 1EK6A 2HJRA 5C37A 4MIYA 4NFYA 4CM8B 4F6CA 4O59O 2EP5A 3NEPX 4GWKA 1ZUD1 3OJOA 4J4BA 1ADCA 1AXEA 3WOHA 1YQDA 4GI2A 1Q0LA 3MJ4A 5MGBA 3IDSA 2P5UA 2RCYA 3D5TA 1TT7A 4E4YA 4CV3A 2NVWA 5KNLA 4OXNA 3DZFA 4E21A 1TT5B 1ZXBA 2RIRA 1NQ5A 3F4BA 1ONNA 5G0TA 4M54A 4JJFA 2X6TA 4NJMA 1GV0A 1NPYA 1YDWA 1ZEMA 1GCUA 4YRAA 5A3JA 5MDHA 4OOFA 1NHWA 3G0OA 5DCYA 4B3HA 2NV6A 5CP8A 3I9LA 2FWMX 4CLDA 3K96A 2ZIZA 1JW9B 1VRWA 4YR9A 3AI1A 4Z6KA 4RZHA 1A7AA 3FRJA 4PLVA 2VUUA 1UZNA 3RASA 3ZHZA 3JQAA 2PZMA 4A73A 4XYMA 4NPCA 2IXAA 4HFNA 2GO1A 2QZ9A 4IUYA 4E2XA 1NASA 1RPNA 2ZB4A 2O48X 3GPDG 4IM7A 1M76A 3PHJA 5DBIA 1HDXA 4D42A 4Y6PA 4O6VA 2X23A 4QECA 1QMGA 3BMNB 3BTOA 4PG4A 1IZ9A 2PD4A 2CNBA 3GDFA 4ALIA 2YV3A 3GG2A 1CYDA 4LW8A 4XX0A 4KDFA 1LUAA 1H6AA 1I8TA 5A1TA 4AG3A 2JCYA 4WUVA 4E0BA 3E5MA 2JJYA 2GZ3A 4DPKA 4JROA 4XR9A 4WGGA 1A27A 3PIIA 1HSZA 1C0KA 4DIFA 4HWKA 4M8SA 1GAEO 1AXGA 1K5HA 3PYMA 5JDCC 2NWQA 5ITVA 2EJWA 3RJ9A 2YHIA 1ONPA 3L07A 3V2UA 3RBVA 2NVUB 3P2YA 5EN4A 3M2TA 1PJ3A 4JJGA 1U28A 4LRSB 4R1UA 2BGKA 5TLSA 4O0LA 3S2GA 3NDRA 3C3XA 3FSRA 4LVCA 3WTBA 4RPLA 3U0BA 4F46A 1Q7CA 4LISA 4XIJA 1FK8A 1MC5A 4XYLA 3JYOA 2W2KB 1U8XX 1MG0A 2C82A 4ZRNA 2IXBA 3VTZA 4JK3A 2NLOA 3CEAA 2RH8A 4DYVA 1PS9A 4DQXA 3WLFA 1B7GO 2G5CA 4E5PA 3C1TA 4BO5A 3GNTA 1ZK2A 4DREA 4U5QA 2V7PA 5IXSA 3KZVA 1R4MB 3FWNA 3GHYA 3PHGA 3PDUA 2VNAA 4YJHB 3VH1A 4BO0A 4BNVA 1F8GA 4FFRA 3S2IA 1ZK4A 1T1SA 3DAGA 5ILOA 1FXSA 3X2EA 5L40A 4Q3AA 5F21A 4K28A 4BKQA 4WNCA 2AE2A 2DT5A 3JQEA 4U6QA 2O3UA 3ZV3A 1QP8A 3ZWNA 3WQQA 1E1LA 2HK8A 3DAPA 3ZW9A 4CV0A 4E6PA 3TWOA 2WD7A 2QIOA 4TWRA 3ZI0A 1C1XA 1XR3A 1U7HA 2BKAA 3KOUA 1GYRA 3QLJA 3TN7A 3K30A 1F06A 4RPHA 1JKIA 1UP7A 2W2LA 5IZCC 2DBZA 4ND2A 4K6CA 3CINA 2GF2A 5JCJD 4PLHA 2XPCA 3LC2O 2ZATA 2VZ8A 1JVSA 1HDCA 1T2CA 3C24A 3LC1O 2O7SA 1EFKA 2BFOA 3Q3CA 3NUGA 4Z9YA 1TXGA 4UEOA 4QO8A 3DBHB 1DRWA 4Z3KA 3GUCA 3JQDA 4TROA 4I5FA 4DL9A 1DIGA 4G65A 1RM5A 6LDHA 1SMKA 1YGYA 5G0WA 2DTXA 4Q3BA 1LQUA 1UAGA 3PFFA 2GPTA 3JQ7B 4RJTA 4PCVA 3T7EA 4RF3A 2X58A 3F5SA 1JKFA 2EIHA 2RHCA 4L4XA 3DO5A 1UP4A 3CMCO 1H93A 4FQ8A 1EMDA 1HEUA 1YBVA 3GPIA 1WWKA 1WZEA 4LRTB 1WW8A 3EZYA 4NFHA 3T4XA 1SOVA 3TPCA 1AGNA 2JAHA 4C7JA 1L7EA 2PZKA 4E2YA 3SXPA 1PWXA 4FIZA 1PU2A 3ZN2A 1LDEA 5C3MA 2D4AA 1I24A 1DIHA 1P33A 2XXJA 4A03A 3DBLB 3OQ6A 4KMSA 1HT0A 4HFMA 2H9IA 2FSVA 5TT1A 3ENKA 2CVOA 2VZ0A 3CUKA 2AQHA 2IE0A 1R15A 1PJQA 2CSUA 1Y5MA 2B83A 5FWNA 3F47A 4IDFA 5I7SA 3ZU3A 4AFNA 2O3RA 3NDIA 4MVJP 2PWZA 1ENYA 4FN4A 1QYDA 2A35A 2VWQA 2YJZA 2X0IA 5JNLA 3O03A 1ZK3A 1K6XA 4XZ3A 1X15A 1I2CA 3OMLA 2NU7A 2DTEA 1JWAB 5TNXA 4XRGA 1KVUA 1Y7TA 1X7HA 2EW8A 3WS7A 4LGVA 4B4OA 4CQLA 1E3WB 3H9QA 4DPMA 3TRIA 4E12A 3JQAB 1K89A 3MOIA 3QWBA 2X0JA 4IY1A 4MP8A 4W82A 1KBZA 3D7LA 5AQ1A 2B36A 4N5MA 3JD2A 3VH3A 2NUAA 1OBFO 1VM6A 4J1SA 2I9PA 4GSLA 3VHRA 4YPOA 4DQVA 4RLSA 4FFLA 3UICA 4OMUA 1YQGA 1K6IA 1RM0A 1YBAA 2BFMA 1DSSG 2C2XA 3DBVO 1KEUA 2I3GA 2OBNA 1VLLA 1CF2O 1I33A 4MP3A 3OETA 3TNLA 4P38A 4ALJA 1BG6A 3AOEA 3ZV6A 3ANNA 4IBOA 2X9VA 1PZHA 3ETGA 4DIOA 5L51A 2GN6A 2YV1A 4BMVA 4WLNA 2PGJA 3DZIA 2DFVA 2J3JA 4L75A 1IL0A 3KLMX 3STHA 3ZWVA 4YJGA 1Z75A 5CHEA 2VHZA 2HK7A 4DVJA 2CD9A 2PNFA 4M86A 3NYWA 1XQ6A 3QRWA 4PZEA 1HWYA 1LX6A 3PP8A 1ZNQO 4MVJM 4NU6A 3IJPA 4ZGWA 2DBQA 2I5PO 1DEHA 2BGLA 1HYHA 4IDCA 4AJNA 4GAEA 3FN4A 4ZJUA 1C1DB 3AUAA 2VHVA 3MZ0A 4QX6A 3WGGA 1OC2A 3DFUA 3JQAD 4CUZA 1GR0A 2H63A 2E37A 1VI2A 1IZ0A 4RQTA 1J5PA 2ZJ0A 4YJHA 1PJ2A 1T2AA 2FR8A 2H1SA 4NFSA 2O50A 3HFSA 1KETA 1PZEA 5DOVA 1E3LA 1U3WA 5ICMA 4XDZA 3RUIA 3M1AA 2C20A 4CM6A 5IAAA 3VKVA 1PX0A 4NBVA 3ZWAA 2DU8A 3GZNA 4I08A 3AY3A 1A4UA 3RC2A 4B7UA 3ROKA 4GMGA 3PQEA 4NJMB 4OKNA 3MTJA 3RC1A 3ST7A 1E3EA 3C7CB 2C29D 2DPGA 3I6IA 2CUKA 1ISGA 3VPFA 3GG9A 3W1VA 3JCZA 3HZZA 4CUJA 2OHXA 3VDRA 4NJOA 4XCVA 4CQMA 1S6YA 3NT2A 4YWJA 1BSVA 2WE8A 2I6TA 3WNVA 3RIHA 5KCZA 1ENZA 2PGDA 2RHRA 3MOGA 2ZQZA 2Y1FA 2J5QA 1P1FA 1YQXA 4IDBA 4R3WA 3GR6A 3UH1A 5TJ9A 2PR2A 5I7EA 5L53A 1O94A 2BH9A 3DR3A 3IS3A 1IHXA 2CDAA 3QP9A 4D79A 1YONA 1E6UA 2EGHA 2VWGA 3WQSB 3QWHA 4KDEA 4BO6A 1MUUA 3WGOA 3HFGA 3TZQA 3RFTA 3PHLA 4IJVA 4BO7A 2G17A 3K5PA 4AJOA 4B4UA 2HQ1A 1M66A 3R0IA 3AI2A 4QT0A 3RAJA 5I7FA 4R69A 1TB4A 4Y67A 4U0KA 4YAKA 1LTHR 7MDHA 2WEKA 3EUWA 5JAMA 2JHGA 5I9MA 4DQUA 1WPQA 3KBOA 4WCFC 3FHLA 4HKTA 1LU9A 5ADHA 2NTNA 4O1MA 5K0ZA 3Q9UA 4BNTA 3VZQA 1EVYA 1M75A 3A9WA 1HDOA 3GRPA 3PXXA 3AM5A 3SC4A 1BVUA 3OJLA 4PZCA 1YL5A 3KB6A 1KERA 2YHUA 3K2EA 3ASVA 5G4LA 3PGXA 2FY8A 4LSMA 3WFIA 3FNEA 4AJIA 4CMBA 4IIVA 2WYUA 3MWEB 1WDKA 4H3VA 1V8BA 3R3JA 2D8AA 3GVIA 4YJFA 4AJJA 3KXDA 3SBOA 1YB1A 1I10A 4YB8A 4IQ0A 2P9EA 1RWBA 3N58A 3H9JA 4GX2A 4WKGA 5JSFA 1HTBA 4KP7A 3RBXA 3Q1LA 5JC8A 4OH1A 2HRBA 1HE3A 1O9BA 2E82A 5JDIA 3FBTA 2VRBA 2HMSA 1EQ2A 4YA6A 4CLHA 4D3SA 1TT5A 4J0FA 1DFHA 5JY6A 3HJAA 4N54A 4XJSA 4R1TA 4E5MA 3VZSA 4XYGA 4GSKA 1VJ0A 4KWHA 4DLLA 3UHAA 2NSDA 1HE4A 2B5WA 1Q1NA 3AW9A 3H9GA 4XGNA 3DDNA 4WPGA 3W4KA 3RKUA 4ND5A 4UVEA 1NHGA 1E3JA 4M49A 1Z7EA 3OIDA 1YWGO 4BS9A 4R5MA 3N7UA 3EGOA 1BW9B 3GNQA 1ZVMA 3JQ8B 4W99A 1BTOA 5HBRA 4IZHA 3PPIA 3DZGA 2UVDA 1W4ZA 5DZSA 4Z9XA 3RJ5A 3ZW8A 4DC1A 3Q11A 3LLSA 1EFLA 5BSEA 3QWAA 4CMIA 4HNHA 2GD1O 4YQYA 1GU7A 3UFXA 3TL3A 1XU7A 2W90A 5JLAA 1E3IA 3VPSA 4J1NA 1VKOA 5EPOA 1EE2A 1SB8A 3KLPX 3L4BC 3ZGYA 5K6AC 2PZJA 4P22A 2D5CA 5EQDA 1U1IA 3MJSA 3KV3O 4J7CA 1Y81A 1QV6A 1A9YA 4QQRA 2FP4A 3GDGA 4GX0A 3I9KA 4B3JA 1M6HA 1PEDA 1T2FA 1E7YA 1UXHA 3C7AA 1CERA 1SB9A 1IHYA 3OBBA 3FR7A 3JQCA 4PG6A 1J49A 1ZFNA 5COQA 5TF4A 2O23A 4BUCA 1DAPA 4DRYA 1LNQA 2OUIA 2V6BA 4PLWA 1ZMOA 2CVQA 2EKLA 4OOEA 2YYYA 3DL2A 3LQFA 3OFSA 4CR8A 4EJ6A 3H2SA 4ZQHA 4PFJA 3DOJA 2Q1WA 1YL7A 2D2IA 1PJSA 4EUHA 3VKUA 3QW2A 5COAA 1B26A 3KVOA 4B7CA 2GERA 1N8KA 1O5IA 2X4GA 4PVDA 2Y67A 3AU9A 1YDEA 1LXCA 1XA0A 1BGVA 2R00C 2OXIA 4C4OA 5L4LA 3WB9A 4OJNA 3VDQA 5H82A 3ZNQA 5TGDA 2YFHA 3BTVA 4Y6SA 4A27A 4HNGA 4HP8A 1PS8A 2EGGA 3RSHA 5L9AA 2YW9A 4OQYA 3H3FA 1Y8RB 1NXQA 2F00A 1DXYA 5HWSA 3GN2A 4YJDA 3WG9A 4EEZA 2YQ5A 1ZKMA 3M1LA 2HDHA 3BMCB 1UP6A 3QVWA 3G3EA 2FZEA 1NPDA 2X9GA 5THQA 3ZNNA 3IC5A 5T64A 5IDYA 3ITKA 4HV4A 1C0IA 1NBOA 4I9HA 5HA5A 4AJHA 3RUHA 2EV9A 3SJ7A 2D1YA 5C5IA 1VJTA 5ICSA 4UUMA 4YT5A 2GSDA 1GYPA 3NX4A 1GYQA 3RFXA 3T7CA 1E7SA 1E7WA 4JXKA 4XGIA 3PFWO 1JQBA 2VYNA 1V3UA 4J0EA 4PLPA 1FMCA 4IDGA 4ZN6A 2IEBA 4O63O 5HS4A 1DPGA 2WYWA 2X9NA 2NU8A 5KOIA 3HSKA 3DTYA 4BNHA 1ZEJA 3BMOA 2QYTA 1DAOA 1HDRA 3NTOA 2Z1MA 4EJ0A 4A26A 5IDWA 2FPPA 3Q2IA 1LRKA 1FDTA 2PH3A 4DBZA 4B8WA 4NK4A 1PGPA 3UKOA 1E7RA 1YE3A 1KVRA 1HDZA 1LI4A 3MCVA 4Q3NA 3N74A 2DQ4A 1NR7A 3B70A 3VZPA 3S1LA 5B4VA 3S55A 3PTZA 5I9NA 4EI2A 1T26A 1GZ6A 3KEOA 4XDYA 3HHPA 3LDHA 4ZD6A 2C5EA 2Y1CA 5G0SA 5A05A 4DXHA 1KVQA 1SPXA 2HKIA 3DTTA 3GEMA 4MIEA 3TOXA 2E4AA 1LBEA 4BNZA 4D7AA 5EJ2A 4MIOA 2E6UX 4WJZA 3WYBA 1Q0QA 1JU9A 4CUKA 2HJSA 1FDWA 3JD1A 3E8XA 4QFCA 4ND1A 3SC6A 3TOZA 1ZMTA 4BGUA 4Y98A 5JW6A 3HUDA 5HRUA 1X0VA 5DBFA 1I36A 1SNYA 4E2ZA 2GUGA 1EBUA 1LC3A 4IS3A 4W9NA 2VCYA 1PJBA 4W7HA 1UAYA 2G76A 2YDYA 5HM8A 1SEPA 1H6CA 4BKUA 4CMJA 2A9FA 1O6ZA 3V1TC 2W8ZA 3PGJA 1N1GA 3JQ6A 3ROPA 5L95A 2Q1UA 4FJ2A 1EBFA 1I32A 1NVTA 4WLOA 3WBFA 3C7DB 3F9IA 1ZO8A 1EQUA 1C1DA 1TVEA 3WWYA 1T2EA 2P91A 3U9LA 3QVXA 1UZLA 3O4RA 1U5AA 2WWRA 4LVUA 3DBLA 2OBYA 5T67A 4BGIA 4FFMA 1KEPA 1AHHA 3VPXA 3EMKA 1UXKA 2Y66A 2Z5LA 4HY3A 3KO8A 1N92A 3DMYA 2YZ7A 2O2SA 1ZJZA 2J5KA 2PH5A 4LK3A 5A9SA 2ZKLA 1JVBA 4DUPA 4PZDA 3AM3A 1Q0HA 2BRUA 4OQZA 2FN7A 2VHWA 1CEQA 2Y68A 2B37A 2UV8A 5KVCA 4NNJA 3GY0A 2CDBA 2OP1A 4EGFA 2NU9A 1N9GA 4K9DA 1K6JA 1MFPA 5GY7A 3HDJA 5U9CA 4PG7A 3AI3A 4ZHSA 5LDGA 2P5YA 1JWBB 1L1FA 3EYWA 2BELA 3DBHA 3CMMA 2QQ5A 5DOZA 1V0JA 2QZZA 3GA0A 3H8VA 3P7MA 4CR7A 4FW8A 3ETDA 1CIVA 2O3QA 2OGUA 1NQTA 1HYEA 3H65A 4MVJF 5A9TA 4D46A 5G0VA 3UCXA 5TC4A 1OAAA 1YRLA 4J7XA 1YJQA 5GZ6A 3FI9A 4NK5A 3ASUA 2NVUA 4OHUA 4R4JA 1KVTA 4Z3DA 3QJ5A 3ZZNA 1A71A 1ZH8A 3H3JA 1C0LA 4J4TA 1GEGA 2EW2A 4EUEA 4EYEA 3DZHA 1MB4A 4MP6A 3ONDA 3C1OA 1VL8A 1DFIA 3UCEA 1W73A 4CLRB 4J2OA 4E13A 1VE9A 1PSDA 3ABIA 1WP4A 4ALNA 4P4GA 2AG5A 4ND3A 4ITUA 5A9RA 4HBGA 4EEXA 5IDXA 4W9NC 1U3TA 2AEFA 1I3MA 1QLJA 2J8ZA 4GLOA 1ISJA 1UXIA 4CMKA 4ALMA 1V6AA 5HS6A 1YB4A 4ZQBA 4OXYA 4WLUA 2EG9A 1EVJA 5IG2A 4P8RA 1D1TA 1PWZA 3UW3A 3HWRA 2Y93A 1BXKA 4E5NA 4FGWA 2AQKA 3PRJA 3Q9NA 3FPCA 3LT2A 4JBGA 1FDUA 3WWZA 4YXFA 3NAQA 3KETA 2YV2A 3DOCA 3GN1A 4P4NA 4D45A 2VZ9A 3IL2A 4CM4B 1A5ZA 4ILKA 4RORA 4RDHA 2AMFA 3NTQA 3Q0EA 3G79A 4CR6A 3GQVA 3WBBA 1UDAA 2NQTA 3ZU5A 4BO9A 1P1JA 4CQLB 3WQRA 1DBVO 2PV7A 5CDGA 2HMUA 1E5LA 4NU5A 2B4TO 4C7KA 1GY8A 3QVSA 3F1LA 1IPFA 1YBMA 2ZQYA 2WM3A 4OGWA 3U3XA 3RUDA 4BL5A 3ZHBA 1H5QA 3E9NA 4K1LA 1O0SA 3E1KA 4YRBA 1BW9A 4JLWA 4RPGA 3DQPA 1K3TA 3ZV5A 1Y8QA 3U4HA 2W2LD 4BO2A 3AM4A 2BI8A 3QVOA 1B0AA 3HQ4O 3PHHA 4U6SA 3O26A 2CFCA 3PHIA 5AYVA 5KTKA 3E48A 4DYDA 3JD0A 3ICCA 1NVMB 4BNYA 1ZK1A 3LC7O 3KYCA 5A02A 1K0UA 3IUSA 4FB5A 1GADO 2PKQP 1B3RA 4FSHA 2Q50A 4IGEA 5TT0A 1U8FO 3ICPA 3KYBA 1E92A 1DC5A 1UR5A 4RVDA 4Z9FA 5AXAA 1CJCA 1R4MA 1FDVA 2OP0A 3ZHXA 1Q7GA 3U49A 1IE3A 3AJRA 4HX5A 3H5NA 3WR5A 4OL9A 1RYDA 4WE3A 3TFQA 4W6ZA 2CDCA 1HZZA 5ENVA 1TI7A 3ZWXA 3JQBC 3RD5A 1A72A 4XR4A 4KZPA 4D43A 5H83A 5A04A 3P19A 5B37A 4AJKA 1SBYA 1EE9A 1HDGO 2R6JA 3DHNA 1GUZA 2G0TA 4D3FA 2DC1A 2OORA 5AXCA 5AOVA 3GGPA 4RV9A 5JCXA 3BYZA 1ADGA 3MJCA 3M2PA 3ONFA 1SEVA 3RU7A 5HTOA 1R6DA 1Z7BA 3IMFA 1GCOA 1B8VA 4CM5A 8ADHA 1VL0A 5TIIA 5B12A 1HZJA 2HUNA 5EINA 2OO5A 3CIFA 1G1AA 2I66A 3I6QA 2YUTA 4I5DA 4XQ9A 4BMNA 3SJUA 4BKOA 2ZTUA 3BXXA 5BSGA 1U4OA 4B3IA 3MWDB 1SOWA 1KY4A 5CPFA 3BMOB 1R16A 1T24A 1LEHA 1X7GA 1PGOA 4NQZA 1VSVA 1V35A 3L4SO 4FJ0A 4GX1A 1U2DA 2WYVA 4NIMA 1GEEA 5KKCA 4X54A 3CZMA 4IGFA 5DF1A 1E6EA 3WJAA 4L0QA 2O4CA 3D0OA 3GFBA 4IDAA 2AE1A 2GYYA 1E1NA
chains in the Genus database with same CATH superfamily
3OTGA 1Y6JA 4FR0A 4OJKA 1VKRA 4BWYA 3DT8A 1F2UB 3K0HA 1U3UA 4M7OA 5H3HA 1YZVA 4CKBB 5K5EA 3JZAA 1FDSA 2IUSA 2J3HA 4GLLA 1CVRA 4TQUS 3Q0IA 2AV6A 1Y80A 2X3FA 2E1PA 3FHCB 1SVNA 3S68A 4YIHA 4BPBA 1N8NA 2F3RA 2C59A 3PJEA 4TXNA 5EUQB 2DP4E 3IKTA 2VP6A 3E6AA 3VAYA 4HRVA 3GDHA 3HYRA 1QG4A 3MEQA 3DUFA 3H7IA 4KI0A 2NP7A 2ID7A 1UANA 1G63A 2CLFB 3EE6A 4PN3A 2R48A 2Z1NA 4QUJA 3W3AA 2WTBA 4WXHA 4XYBA 2EDCA 1TZBA 1QVRA 3L8YA 4FYIA 3WHLA 2G0NA 5FFNA 2O2XA 4QJIA 3IMEA 4LDNA 3EJWA 2GO7A 4MLZA 5J59A 5TQ0A 5EA2A 1OV6A 3FR8A 4YX9A 4DRXA 1ZISA 2HRZA 3ZGXA 4YTEA 3ZXXA 4CG1A 4QARA 2G5PA 2QQ0A 4BE7B 1C8VB 4EJMA 3MJVA 1MPTA 3ND5A 1X13A 4P4SA 1S01A 1DMRA 1VHJA 1YOBA 1T4DA 3NP9A 4BO3A 2QRVB 1Q3TA 4C3OB 3VNVA 4OYRA 1IN6A 1CUHA 3A7EA 3TE7A 5SY6A 5CLHA 1ULBA 1U8ZA 4B40A 2IYSA 2NXWA 3VH2A 3OQJA 4W5QA 1H94A 3M9XA 4UQLA 2O0MA 5AHXA 3AUUA 4F9EA 1HGXA 4YMHA 1V8ZA 2I3AA 3ZBQA 3WSVA 4EI9A 4Q01A 1C3OA 1HETA 2G6BA 4U7TB 3O90A 3KWJA 3C6KA 2JZCA 3W04A 1FF9A 3IMGA 3D3JA 4FDAA 2A88A 2PRIA 3CZCA 5DX0A 4QG7A 1FJHA 4DDMA 1Y0BA 3O8OA 2HMTA 3L3BA 3QX3A 3ZCXA 4H7JA 3QY9A 4TQGA 4J1TC 1PR4A 2X19A 1NJ2A 1PGJA 4L4UA 3WDSA 1NWHA 2ZUEA 4U8GA 1T9GS 4AICA 4CG3A 2MSWA 3LPCA 5K03A 5BSRA 3KYDA 2QTVB 3TQQA 1AE1A 1GRNA 3PIRA 1L7RA 3R3UA 5CNMA 3VO2A 2ZPAA 4CJXA 4MHOA 2C5AA 4GX5A 4TTJA 3WGKA 4ABYA 2VT2A 3PQ2A 1JXQA 1OLSB 1TGVA 2J0VA 2C2YA 2A9PA 2YR0A 5F1YA 1HTWA 1SBCA 3ZGNA 4L15A 4F5YA 3Q4GA 1XNQB 2IPOA 5AVQA 2C77A 4ZGBA 1YKSA 2E1RA 3GVXA 3EVAA 1TQ4A 1XRSB 2GN4A 3ZD8A 1ACJA 4AU1A 4RV4A 4AKGA 3MWGA 4PG8A 4P53A 3KG2A 1IM5A 1HI9A 3JR3A 3SQXA 2R6HA 4MVJH 1NXOA 4ZT5A 2LKCA 5JROA 2GMWA 1PP4A 2EIXA 4B6JA 3JYHA 1DG9A 1IXSB 3SZRA 1KZGB 2EW1A 3PDIB 1HEYA 4L8VA 4MVJE 4ER3A 1OLSA 2HA2A 3LMKA 4AJEA 4CMCA 4BO4A 4Y6GB 3W3AD 3ABSB 2SKCA 4IMIB 2YX1A 4N5IX 2C0QA 2Q7OE 2PAAA 4N7MA 3ADDA 1W5EA 3QGMA 2OVFA 4TGLA 2BSXA 4OUKX 1R0YA 5TMEA 2NTYC 3SX2A 3E1GA 2OKCA 1C9KA 1XKLA 3G1UA 4AUNA 4CM7A 4DYHA 3V4OA 1JLLA 1CR2A 1W88A 2H1LA 3KD3A 1KYQA 2NAPA 3GAMA 3H11B 1A7UA 2QUAA 1N1EA 2DUJA 5JASA 4INJA 1ODSA 4GXRA 2WSSA 3U4IA 3OIGA 4X84A 2H7YA 1GTMA 5TDHA 3L77A 1XPJA 4RANA 3DC7A 2H16A 4AROA 4HXGA 2IS4A 5BXQC 1U9JA 1I7LA 3IBSA 2QVBA 1W2GA 1VFPA 3H5LA 1QU2A 4HDAA 4CTMA 4HC4A 4G1EB 5IASA 1QJCA 1G9XA 1HL7A 2CLMB 2AJTA 3EODA 1MDFA 3JV7A 3PNSA 3IURA 1I3LA 2PLFA 3GFRA 1YU9A 1R0SA 1RWMA 1ZD8A 2ZRAA 3N28A 3OF5A 4IIEA 1ZU5A 4LKOA 1RU3A 3WLJA 2VKTA 1CUIA 1S7GA 2GRAA 5D3QA 5E7IA 1WULS 5CB4A 4MYRA 2QR2A 3LL7A 1Y63A 2ZRIA 2Q45A 3DBOB 5L45A 2W00A 2YH2A 5GZ3A 4U0JA 2Q2OA 3EEFA 5D6NA 2OZPA 3QE2A 1XJCA 2AOTB 3UWSA 3K9BA 3Q5DA 3C39A 1W36C 4H1UA 3ZWWA 1RJ9A 3LQ1A 1OIVA 3DEYX 4MPRA 4DCGA 1E3MA 1SBHA 3N6RA 1UBGA 4YDQA 4II3A 1NVXQ 3KSUA 4QHSA 4E11A 1COZA 4UUAA 2NM0A 3X43A 4H1VA 2FMXA 3IPYA 5KVVA 4CEHB 2OL4A 1HQYE 1XZAA 4UULA 3DT6A 1Y4SA 2GR9A 4FFSA 4CDRA 1LQTA 2NADA 3OE7D 1JLRA 1UL1X 1YDGA 2XIQA 4AW9A 3SZOA 1T9KA 4L4YA 4QYWA 4OHKA 3ABOB 3PWZA 4OV6B 3HV2A 5CM2Z 2JANA 5BWCA 5JS8A 3U3RA 1A5SB 1M5TA 2GBGA 3BFVA 3IP9A 3ROZA 1QCYA 2FZGA 3BKWA 3D7RA 4UVGA 5LMNB 1LS1A 1L7PA 4MJ7A 3WTCA 4A91A 5EZYA 1YZNA 2E49A 5ALUA 3AYZB 2VVTA 4ALLA 1F0NA 1T9BA 3WSWA 3BL5A 4L6CA 1YB5A 2I2FA 2P5SA 3VSCA 1I6KA 5K8TA 3VZBA 2HRRA 3AK4A 1RE1A 4X91A 4GVXA 3GARA 3CONA 1RABA 2ONYA 2PZFA 3O8QA 5JVDB 4FDUA 4PNPA 1QK4A 2WJPA 2IYUA 2K2WA 1QGUA 3COWA 1ZUIA 4JOCA 3CN7A 2X3UA 1I94B 4Z7OB 1E1KA 3ZDAA 3ZWCA 4EVSA 1IYZA 2XJ4A 2YVAA 2VXOA 1X1CA 4R0VA 3PXGA 2AC2A 4CMEA 4DOMA 6AT1A 4AN4A 5BQOA 2QX6A 2PZ8A 4AYTA 2UUBB 5F3WB 4YP6A 1RM4A 3IMKA 4P93A 1MV8A 5FOVA 3UK1A 3DVQX 3VO9A 4EJSC 1M3SA 4NJEB 2PNJA 2Z83A 2R86A 4ZQGA 3PUXA 5TXGA 1PV1A 1BOOA 3RAGA 1FP1D 2DTDA 4J2HA 2POQX 4MWEA 8LDHA 4UHBA 3TPFA 1AZWA 4N76A 3ROEA 1KGDA 2ZREA 4J9UE 2XMBA 1TCCA 3RVQA 4E88A 4GPIB 1EFPB 2LD4A 2ORED 4BX9A 2ECKA 3QXGA 2X5JO 4M0FA 1KP3A 3ZZUA 1U4SA 4H1TA 4DNOA 4HEA6 4JNCA 2WWVD 4HQNA 1IMJA 3WDLA 4GP9A 4U9HS 5KVAA 4DCPA 4YRQA 3ON5A 1OREA 2C07A 4E31A 4KQEA 2VI5A 5BPFA 5DX1A 2I34A 5HJ7A 1I4LD 1KI3A 2PMKA 2QNIA 2JJ2A 1JS1X 3A9CA 4BVBA 3TB4A 5CXSA 2R3SA 4GKVA 4OHZA 1DC7A 4RVSA 1COWA 4XSVA 2KWIA 2QSZA 2FJPA 3OZDA 2QT0A 1WVMA 2DPYA 3WRYA 2PT6A 3E81A 3INRA 4Z1OA 4HUTA 3F73A 1Q0ZA 1IQ0A 3ICWA 3VHXA 2CZQA 2DWUA 4IP0A 2RHJA 2QL5A 4H7IA 2Z4RA 4NNOA 3IP6A 4ZOLA 2HIMA 4N03A 4CMGA 1GTG1 1BWPA 1OZGA 1UT8A 3R3VA 1CFJA 1G3IA 4LBZA 4MI1A 5GVRA 3WFZA 3I01A 5JS2A 3GLIB 1OGJA 1EFRD 4ROSA 5EXDA 1U04A 1T6XA 1F12A 2IVZA 2YWXA 3BB3A 3BDIA 3K4HA 4NP6A 2ZUTA 3AFOA 2VT3A 3VU3A 4B45A 2DH5A 1L5QA 1E3DA 1Q2UA 1ZCZA 1ARZA 1WZNA 1B74A 1GNQA 2BFAA 4WW0A 4YRDA 4JP8A 4YDSA 3L6DA 4ID9A 3TZ6A 3DC2A 4EJSB 3GGDA 3GIDA 1E5DA 1UPUA 2QZJA 2V58A 1R4NA 4IJUA 2LCFA 5KAMA 3NALA 1MRZA 4IFBA 3DDHA 1NQAO 2UKDA 3L9XA 1E9BA 2JJ8A 5E2IA 2J6IA 5A6VA 5JNSA 1B14A 4NDNE 1RYEA 2NYAA 4PZ9A 4LNAA 3EEBA 2W2VA 1P1IA 4PZ0A 1XLTA 4PXAA 4F5DA 4E3ZA 1ATZA 5F98A 1SUWA 2AH5A 2J9GA 1J0EA 3NNDA 3GLIA 4IF4A 4J0DA 4N01A 3F78A 4UU7A 2X0FA 4GE0A 1S89A 2ONZA 4YIKA 5EGSA 3FKQA 1QYVA 1FNDA 3DO6A 2FXVA 1YOVA 3EAFA 1U6IA 2H4ZA 1KP2A 1E4EA 2MSLA 4U7DA 3JRNA 1EWVA 1N6KA 3H9BA 3O84A 1R7RA 5BSVA 3M83A 1V8OA 4R05A 5HZGA 4LCEA 4EPYA 1K7FB 2RI0A 4O25A 5F78A 4GBJA 1J8DA 3QVLA 1V25A 4CTOA 1P1CA 3VDMA 5AOBA 1S8OA 3SKVA 2QT9A 1DAGA 2VPIA 3FUUA 4H3SA 4MAFA 4O29A 1LY1A 1G9TA 4UMEA 3RS7A 4ENRA 3AR2A 4GLBA 3UUGA 4R2XA 1MGOA 1OI7A 4ARZB 2O8BB 3E7DA 2JARA 2O3TA 5LP1A 1N9GB 1C7JA 1NN5A 1JECA 3KQSA 3WA6A 3TSYA 4DZTA 1AKRA 1JB1A 1QRDA 4A0FA 4RIEA 5BPHA 3G7SA 1EGAA 3OLVA 1N0IA 4TTPA 4X1IA 3H5OA 2J9YB 2L17A 5AH0A 5J4KA 1R0KA 3ZTTA 1VL6A 1V3QE 2NUAB 5CAEA 2QUZA 2Y1LA 3CNEA 4DILA 5FNVF 2LV8A 4AI6A 3LDFA 1E99A 3IT1A 5M2QA 2NZJA 2ZJZA 2I22A 3QV1A 2Z9CA 3CXUA 2QRLA 1Q77A 4G85A 1GPYA 3B20A 3ROQA 1BVHA 3M5DA 1L7NA 2FAXA 4MEJA 4B48A 2OC9A 4DHEA 4KK4A 4TKVB 4M0UA 3T9CA 4AO8A 4BEWA 4A10A 4DA6A 5JXHA 4DTIA 3DFIA 2Y2UA 1ORVA 3BFJA 4Y2UA 1N5DA 4KKVA 3TIXB 3GBVA 3MJEA 1UM9A 5ALMA 2CBXA 1DC6A 4J0CA 3VU9B 1JR6A 1P17A 1FYFA 4B8YA 5DP1A 2JFOA 1TF7A 4KRYA 2G0AA 2NZYA 4PYRA 1QRTA 1P9RA 4NX2A 5B2ZA 2Y1EA 1CY6A 3DEAA 2VHYA 1DNPA 4C7OB 3AIIA 4OJMX 1K8QA 1Z4NA 2BI7A 5JMPA 4UQOA 2XGMA 1H3NA 4Z8XA 4OATA 5EERA 3ZX4A 5AW0A 1EA7A 4IHJB 5EJEA 4M21A 2R65A 4ARIA 4I46A 5IN4A 1N25A 1Y48E 1R37A 3EF3A 1MQAA 1APBA 2GM4A 1N2CA 1AGRA 3N2KB 4I81A 1P1KA 3TW6A 5BYAA 5IT4A 1X3SA 1YS6A 5JSZA 1P0FA 4DV1B 4AT1A 3CVUA 4D3YA 4EIWA 4ZYTA 2P2ZA 1I3OA 1P2FA 2GDJA 2JGEA 4MQ4A 1QHIA 1RQPA 5JLJA 3L7IA 1T8UA 3OICA 3L4JA 3BE4A 2V6GA 2XVXA 3D6MA 2G4VA 2ONKA 2ZM5A 2D00A 4NI5A 2ECQA 4X1YB 4TS9A 1A3CA 2F67A 1XKTA 4Q3EA 5H4GA 3C6XA 4EHNA 5HQTA 1Q44A 1Z2DA 1ZCBA 3WNQA 3WMXA 1UBNA 2WNHA 2RSLA 5K0SA 5LWQA 3TEMA 1CZKA 4WZAA 5KOHA 3A4VA 1MFZA 1K7CA 2OSBA 1CCWA 3HJHA 5FL7D 3K6SA 2C8LA 2XOKD 5CFRA 3AR8A 1A9XB 1E2LA 4Y2HA 6REQA 1E6MA 2ZR7A 1KC1A 5H81A 5DO9A 1CY1A 3STXA 3GFFA 4C21A 1Q84A 5DHUA 1AQIA 5C5CA 1CUXA 4INAA 3F6EX 2P65A 3GEDA 4LV6A 3QPWA 4RFSB 4UC0A 4S0ZA 3PC7A 2CXTA 1DHTA 1Y9EA 2P2NA 3EIHA 1AKWA 1RJDA 1T9ZA 1RZVA 4YO7A 1U31A 2VPYA 2IHJA 3PNVA 1DFGA 3A1CA 4L74A 3F3SA 4FYPA 2ZIFA 5IBPA 1MOSA 4S3MA 4V1CI 3G5LA 2BEVA 3I76A 3VU8A 2P30A 4HFJA 2GD2A 2QN8A 4V0QA 5JQGB 3Q15C 1N7IA 3IA7A 3NYIA 3BB1A 3VX4A 4YRGA 1TA9A 1NBWB 2H2FA 4LJSA 4WXEA 2XAAA 4LJ9A 1TLFA 1RCUA 5B6PA 2NIPA 3FYUB 3I9V6 4GKAA 2XX3A 5FUQA 1UEJA 4W7SA 1Z63A 5A0VA 3KUUA 3MBIA 4MWZA 3HY3A 3GEPA 3KQLA 4A23A 2X40A 2QUBA 4GPTA 2ZSIA 2FDRA 4YEDA 2C4NA 4LC0A 4DAOA 3WK5A 4IHJF 4G37A 4H7FA 4O2BB 3SAJA 2IRWA 1ZJJA 1Z7WA 1UEIA 2HN9A 3BFKA 4W6QA 3ZH2A 2P35A 4MRRA 3T4PA 2G70A 3UXEA 5K8LA 1RFGE 1N36B 4K26A 4EW6A 4C0BA 1QQ6A 4EF6A 1C2YA 1X14A 1PJCA 2FFRA 1B8PA 1HNNA 1KFJB 1RLOA 2BEUB 4P7KA 3BZBA 2HGSA 1YFJA 1D6MA 1GFSA 2VQSA 1E9DA 4N6GA 2FR1A 3NV9A 4FE3A 4EYQA 3C3EA 1SKUA 2EERA 3NUZA 1FP6A 4FXPA 3L2OB 4GVLA 4KMRA 5DGCA 4HDOB 2G1AA 3CT4A 3OOYA 1K88A 4MEBA 4K6GA 5ALGA 2FWIA 4X85A 4C89A 4OIMA 1ZL0A 4TZKA 3FZYA 4L6AA 9LDTA 5CFZA 4XFDA 4Q1DA 1ITZA 2QY6A 1G21B 4KVZA 1QBKC 1N3IA 4EKNB 4HWGA 2BBSA 2X8LA 4Z0PA 3DW3X 4M4SA 3HUUA 2Z9DA 2YWEA 1IUNA 3U7FB 2H85A 2J9ZB 1DG3A 1X3LA 2FPPB 3P2IA 3NONA 4A7PA 1U0JA 4XXHA 5IJXA 2PYIA 4I55B 3NP7A 3FSJX 3ZCUA 4W7IA 3GGGA 4HD8A 3JQGB 2B1RA 1XX6A 5A3VA 3RKRA 4BLPA 1NRJB 2ZAOA 4NHEA 4LJAA 1RHQA 4L5BA 4P81A 1N34B 3HVKA 2QK4A 2APJA 3A9UA 3STVA 3V8PA 2J7KA 4DBVO 1HNZB 1UC4B 4TV8F 1PIWA 1NAHA 3IEMA 2X8BA 3UJCA 5JNTA 4KXVA 1M34A 4UBOA 3TCKA 4JASB 4INZA 4OUDA 2WSBA 4H7PA 4ONEA 3BMNA 1BA2A 2JAXA 4RSHA 4XUCA 1IM8A 1WJGA 5E6SB 3R44A 4R9RA 4C4TA 4Z9AA 2VTDA 2JVIA 4AJLA 1Y1PA 1ZD2P 4K40A 4URXR 1QKIA 3KSDO 2W83A 4HYQA 5A4FS 2HTEA 3GT3A 1XU9A 4BIIA 2Y05A 3EEIA 2XDAA 3RVDA 3ZLUA 1QRRA 1T0PA 1GNLA 1ISFA 3QLVA 721PA 3SM3A 4EY8A 4XA8A 4H6PA 1C9DB 5EC8A 4YAJA 1NFRA 4Q6BA 5A4DA 2YJTD 4FDVA 4CU2A 5JV5A 5THKA 4ZPXA 6CHYA 4QODA 4MUBA 3CO0S 4M9QA 4DV2B 4A8HA 5EHXA 4OI0A 2VF5X 1XNJA 3A1SA 2O8DB 1NBIA 5JO9A 3GFGA 3FYTA 3L8CA 4N18A 1E3WA 4ZT6A 3B52X 4ZC1A 5TEWA 3V80A 1UPFA 3E15A 5IC5A 1YT5A 4KTTE 4UU0A 5EWJA 4LBWA 1TVKB 1EWTA 3H2BA 4BDTA 4TRJA 3BXEA 4HXYA 2BI4A 4JQCA 3FNIA 3MWJA 5BR8B 1K5GA 1R0ZA 1CQIA 2ISSD 5EE9A 5EUCA 4KFRA 2Y8EA 4NE2A 4D3DA 4DJAA 1BHO1 4R1MA 1C9MA 1HUQA 1TM7E 2H07A 5CVUA 5LQDA 1USKA 2Y0PA 3VZDA 4JL5A 4CM1A 4A9AA 3P32A 4NY1A 2DJ5A 3KSRA 4TM7A 1A69A 2YWHA 1VC2A 1N2XA 1T0BA 1FYXA 1X0XA 2HM7A 3QHAA 5A4IS 4TLMB 3SSMA 2QRGA 4U8HA 4JZKA 3FWHA 5FA6A 4K1XA 1YSCA 1RYMA 2GZAA 3DHEA 1E2MA 1RRKA 4G89A 4PAGA 1JGTA 4ZKEA 3ZY6A 5JYDA 1QHFA 1T2DA 2FJ0A 1GSIA 4X7RA 2VJYA 3DE0X 3ZEIA 2NZWA 1LSOA 4TL7A 3SYLA 1T9GR 2FUKA 2ZJ4A 3KV1A 3HYTA 2J09A 1E3SA 4Z7JA 5L3QB 1EDBA 1OR8A 1R0WA 1HLDA 1RLTA 2JB9A 1K27A 3MTQA 5ALKA 4PPFA 5HUJA 2CCGA 1FS5A 4FC7A 4Q4AA 1AUOA 3GJ3A 2DAPA 2PUJA 4G5FA 3ZXUB 2R7KA 1W7AA 3E9EA 1XCBA 2IHUA 3S2FA 5TX7A 3AR9A 3JD3A 4B6GA 1J6UA 1PJTA 3TYXA 2Q1TA 2L42A 3O2NA 3RC8A 4BP9A 4LX0A 9ATCA 5HK9A 2FA9A 2FPSA 1POXA 3CVOA 4MV7A 4UTNA 4AUKA 3CV3A 1CLEA 5A2QA 1ORTA 2I67A 2LXNA 3K94A 4RZIA 1TPZA 4PO1A 1BMQA 2KBEA 4NEHB 2CMDA 2OE2A 4IJKA 2ZE8A 3SXUA 3TRFA 2OCKA 4QXRA 4CIAA 1LDMA 1L5SA 2XUGA 2YOGA 5DGDA 2H65A 3V34A 4WY2A 2E87A 2W22A 3M6XA 4W1RA 4G63A 3D5EA 1G3UA 3JQ9C 5KNBA 3WL5A 1Z0DA 1DUVG 1P39A 2FSGA 5IAGA 2GASA 4KV7A 3ZCPA 2O5EA 2VTVA 3I1FA 3L05A 2YCLA 3LLCA 2GLXA 5CB8A 4HDNA 1QF7A 5FI1B 3BRWD 3T7RA 3ZWYA 4MMYB 1O9GA 4NAUA 2IZ6A 3MUEA 3PTLA 2ZW9A 1L5LA 1IY8A 4A2CA 3VR3D 3LWNA 1NUQA 5KJ6A 1DJOA 2EEZA 2W2PA 1HRDA 4J6EA 3UT5A 4CEIA 1RHUA 5IVDA 1CQPA 3CLSD 4UM9D 4IMRA 3AX6A 2ERCA 4S1OA 3HU3A 1T5HX 5LYJB 1T9HA 4CMAA 3PGKA 3TGPA 2VDVE 4QBTA 4TV8B 1MH1A 3VZRA 3HPQA 2BN4A 4BJ5A 1B23P 4BATA 5JS6A 3QA9A 4H35A 2XQVA 3FCOA 3R0VA 3AONB 4LZLA 1GGMA 3OURA 1XEXB 4MS3B 1M2FA 4PGHA 3A58B 4TS1A 4DXDA 3BDAA 3ONNA 1W6UA 3BF8A 4O4JA 1TK9A 1LFAA 2PX6A 1U0GA 2EHDA 2Y92A 1L8LA 4U1RA 5DYGA 1PK8A 4MCIA 1VG8A 4TSFD 2PKCA 2IXFA 2Q5CA 3USES 4DARA 4F8JA 5HSGA 3BXPA 5D84A 3GLQA 1ESNA 4OTZA 5FYDA 1J2TA 2QUKA 2HLDD 2X86A 2Y9PB 2Z3WA 1NVWQ 1UOOA 3FCXA 1N2SA 3OQBA 4MKXA 3PPWA 3TLEA 2IF0A 4Q4DA 5G4KA 3O4VA 4YACA 4W1QA 3UH0A 3GCXA 3STWA 3G9XA 4YC7A 4IKEA 1AQUA 5E4YA 1MC4A 5A5DA 5BYKA 3ZEAA 4I2NA 5IN5A 4TSKA 1NMYA 2J5RA 3FOCA 4UREA 4A0RA 4CVNA 1RKXA 3L1UA 5JI3E 3BAFA 3KVNA 3KUXA 1Y7IA 3OQPA 4Q3OA 4DR7B 1VJDA 2BAGA 4FWBA 4XEHA 5B1EA 2UU9B 3IDOA 4Q4AB 1W8DA 2VDQB 5FAXA 2B35A 2XBUA 3SYTA 3WP0A 4B3CA 2A0KA 1W9MA 2H0QA 2Z9BA 4N82A 5L3QA 3OC0A 1ZP6A 1Z6YA 1C9EA 3PB3A 1HKUA 1DCMA 1OOEA 4FOTA 4MVCA 5DT2A 5C1BA 3IPLA 2OHIA 3C3BA 2LR0A 3IHTA 3GFSA 1G4AE 3PFHA 2WU3A 4DM4A 1Q1ZA 2B1GA 4V38A 3KKKA 3AXTA 3C3CA 1N5RA 2D0PB 3LDGA 4UTXA 5KVQA 2CUTA 1B41A 2UAGA 3P52A 3LSYA 2DKNA 1DAFA 1V1MA 3WL4A 1Q3KA 1KAGA 4URFA 3PC3A 5E6SA 3WK6A 3D3WB 3N0RA 1BE1A 3F6YA 4JC5A 4XD7A 5KTSA 3U4QB 4AC9A 1KMCA 2P67A 3ELWA 4PCUA 3UXMA 1GGFA 3RUDA 1ZJ6A 5GVSA 4MWCA 4EB6B 1FX0A 3NC4A 3I4FA 2GXAA 3CZ5A 2G36A 2KHZA 4P2GA 3O8LA 5AW3A 4IQFA 4BQPA 5FEUA 2GDZA 1OMOA 4Y6OA 2CC2A 3CSDA 1PHPA 4FE7A 1VG0B 2VQFB 3H4MA 4CLEA 1NXSA 1IJFA 2HJ9A 1BDHA 1JZQA 1YS9A 4HGOA 3LSTA 2OD9A 4N40A 3HB7A 1QG6A 4ZI5A 5B1SA 1NMEA 2IOHA 5DASA 2G4CA 1TM3E 3WIBA 4R8KA 4BKPA 1UK8A 1H0SA 1DUIA 3G5AA 3SN6A 3SQMA 3DMHA 1P19A 2CJWA 5JY1A 1WF3A 3RFFA 3W5AA 1LGYA 3JATB 2OXTA 2WK1A 2DHCA 4V2IA 4EHIA 5CBPA 4KWIA 1P7CA 1GSAA 3K1YA 1C3VA 4WRRA 1QANA 3P2KA 3ZDXB 4TLBA 1FRFS 4KYVA 3U7QA 1P5ZB 3IP5A 2Q41A 3N75A 2Q5QA 1KYVA 1J2EA 2FPMA 2II6A 4Y2GA 4BP8A 4DIBA 2RHLA 3OUTA 4I4LA 4JN6B 1RAHA 4UTVA 3NJ4A 4HYEA 4OL0A 1RSZA 4UBKA 3WGYA 2DFLA 2IKSA 3ZK9A 4GKJB 4J4HA 1RIFA 1M6NA 4PLTA 3CURA 1GL6A 4BC0A 4K3VA 5IXYA 3B78A 2OY0A 1YZ3A 2ZYIA 4P08A 4AS3A 2D2EA 1OB2A 5F2NA 3O3CA 1G5FA 2I6XA 1CHNA 2QX4A 4X1KB 1GTVA 5E9AA 4MUXA 2VLIA 5A9SB 5CLLA 5BUZA 3LK6A 1JEOA 1X7XB 2D74A 3E3LA 1EB8A 3OA0A 5TF0A 4IUCS 2VPQA 3PD0A 1U3DA 4UTOA 3KEMA 2FK8A 4AY2A 1DB3A 5AKXA 3AUJB 5F3RA 4Y2VA 3DOUA 4K3UA 1IN5A 1E89A 1CR1A 1Z47A 2Y1DA 3MCAA 1M8JA 1CFZA 3D0RA 4HTFA 4K6FA 1L4FA 1UC9A 3BA1A 3CW2A 3KB2A 3L0DA 3AB7A 4M2LA 4NG5A 2IL1A 1H0RA 3WLPA 2JFNA 1DWOA 1UOPA 2AT1A 4L3VA 1V8DA 1XKQA 1VPVA 2FR0A 5KYVA 5J9FA 2E4YA 2ORWA 3Q1KA 1BE8A 2XF8A 2PKWA 3E4DA 2PRYA 3HHEA 3K8OE 4XYEA 5D87A 4YRZA 2PL1A 3ZJTA 1OGYA 5SYNA 2JNWA 4A0SA 5F12A 3IQFA 4Z53A 2DUWA 3JQBA 3H5IA 4BNMA 4YMTA 4MV9A 3VBEA 4EPWA 1JHDA 4FZJA 3K7EA 5CPBA 3RYCA 3RUPA 4NV3A 1DC4A 1M0TA 2VRCA 3SIPA 2ZJ5A 1SUIA 4JVOA 4CCWA 3OCWA 1JEDA 3A1FA 4LZNA 3UEOA 4E09A 4K9OA 4CI0B 1AMOA 5EI5A 1TC1A 2RE8A 4Z4GA 5KYTA 3MMZA 3S70A 3KR2A 3VPHA 1AJEA 2J33A 4QGHA 3X2FA 5KVSA 2QAJA 3DXFA 3WL3A 4GZ5A 3K70C 1P6UA 3EG9A 2Q3CA 1JIQA 4PR0A 2JFFA 4Q7MB 3RI3A 3GMIA 4AXXA 4RKYA 2ZRJA 3RVSA 1UBFA 3GJSA 1TMYA 4CLOB 1IZYA 1FUYB 2G6TA 2JDID 3TZKA 4TVOA 4W8GA 3E22B 3FNQA 1K0FA 2WW8A 1Q5PA 4YWHA 3Q5EA 4WOKA 2OAGA 3D8SA 2BTOA 3D6JA 4GZMA 3FGZA 3RSCA 6REQB 5I8PA 1RKBA 2Z09A 3AJAA 4BLTA 3FBGA 1XEWX 2P4EA 3B1FA 3FTNA 3HCEA 2NO0A 1HFKA 1QXSA 3FF1A 4Y2YA 3V5NA 4R5HA 3HL4A 4ETNA 3VR5D 1UBUS 3EIOA 2VNSA 4GUDA 4HTAA 3FTFA 3FZNA 1H1LB 4BVAA 2DPHA 2JFQA 2OZVA 3B5JA 1ZUNB 2BM1A 2QTWB 3B9QA 4PYMA 1GRRA 2QBYB 1THTA 3AZOA 1ETUA 4XX1A 3DEZA 4WV3A 2JAPA 5C8YA 4L28A 3E5NA 3A9SA 2AKAB 2XEXA 4RQAA 3QLUC 1SBIA 4DDWA 3U5TA 4YAEA 1L5YA 4O02B 1T6YA 4X45A 3B1YA 1E2GA 2PSEA 1W4RA 4PTZA 2CFTA 4EATA 1NQVA 2XVMA 4MUYA 2FW6A 3DAHA 3GROA 4RVFA 2ZQ5A 4EG5A 4GG1A 1K4KA 4EBBA 5HIMA 4GFDA 2HPZA 1FE8A 1AO3A 2PX5A 2XMQA 1YHYA 3ZVRA 1UWKA 4JGIA 3VPAA 5IPFA 4A2PA 4FGZA 4JDUA 5AKIA 5BQ3A 1ZSNA 4PSVA 5EWLA 5IAEA 2FPKA 4N5DA 3ELBA 1T4GA 1RPZA 3MIZA 4WNAB 3R20A 2XMZA 1S7CA 1ZW6A 1IN8A 3BA6A 1PGNA 2QE6A 2ZIVB 1TEZA 3LT4A 3M3HA 4WKBA 2OMEA 4QOEA 3ORFA 1BU8A 2CLIB 1XEXA 2H1WA 1KH1A 3OT1A 2PFSA 3C8DA 1QWOA 3B1ZA 1VHTA 1Z4KA 4QPNA 1M6WA 4LPKA 5ANRB 3RYTC 1N0WA 4AB1A 1VB5A 4JOSA 4N3BA 5HVNA 2G25A 3TXYA 3V2GA 2GF9A 2QSUA 3QBTA 2F1IA 5M7EA 4MKFA 4IIBA 4TM8A 5I9SA 3ODPA 4KB5A 1WG8A 4XQGA 4N0MA 2XHEA 1VDMA 2F55A 1MB9A 3GRYA 2LDXA 5GGYA 2VATA 4B7XA 4O2RA 1WNTA 1LDBA 3OEWA 2OZKA 3GP5A 3SHFA 1UH5A 4CKXA 5D86A 4MA5A 3B1KA 1L7XA 1EUDA 4LYYA 3NATA 1SBQA 5ER6A 3JALA 2HA6A 1RC1A 2I4OA 3JTMA 3VO8A 4RFSA 4YFYA 2I1QA 1WMSA 1OJLA 2XNDD 1XI2A 1P81A 1QX3A 3OZTA 4FVTA 4ZYWA 2DM6A 1BXRB 1H2BA 4KTVE 4E03A 4PSCA 4DNXA 4CIYA 2DY1A 1P44A 3BRQA 1XQYA 3NT4A 4RL6A 2ZI3A 1JIXA 3UC5A 4GEGA 2R8PA 5CVTA 4MDYA 5HRCA 4FCCA 4F3RA 1P74A 2FRXA 2JCVA 3ICQB 1UK6A 4BFXA 2BKUA 4RHEA 1R6BX 1HFJA 1Q74A 4WMLA 2ZDQA 1BWRA 3BICA 3OCXA 1FIUA 2C9BA 4ASUA 1M2EA 2ZUSA 1AKEA 3ZH9B 1JLKA 4F3CA 1K7SN 1XRMA 2I4IA 2QPOA 3L6EA 2DHQA 1NRXA 3M5PA 4M60A 4S1WA 2NU6A 4I8IA 3AF4A 4NBNA 1ATIA 4V0ME 3RVLA 3W90A 3ZWOA 4JOQA 4MMXB 1QWSA 2B6HA 1Y1TA 4IQ8A 1XC7A 3IAM1 4OEHA 4E7PA 3WLEA 2WFAA 4QOSA 1UBOS 4QO7A 2GD6A 2GKGA 3GVPA 1KS2A 4DLWA 1KZ4A 3JR7A 2AX4A 1HY3A 1NT4A 1SRRA 4EL5A 3S81A 1M34E 4URVR 4OJQA 2J5XA 3GH3A 2XCIA 3OKAA 2HU2A 3MJTA 2JIOA 1II8B 3M33A 5K99A 4EG3A 1SCIA 2C2MA 3GIWA 2A7XA 3DEIA 4WCDA 3JWJA 1ADBA 1G5TA 3G9ZA 3KOXA 3LZDA 1DS6A 4YV0A 4BNDB 2B34A 2X15A 2FLKA 2R96A 4XQCA 1BOFA 4EMTA 1JTVA 2H5LA 1ZH6A 5BNZA 4EFNA 4GPD1 4BNIA 4D02A 3JQPA 3T94A 5FLYA 4PC1A 4ASUD 3EDQA 3WV5A 1ILEA 5JU6A 3DAYA 2B78A 4BEVA 3DKRA 3FTDA 4LE1A 4Z0HO 3H0CA 1NQOA 4N65A 5FXMA 4D0RA 1ZBDA 2FCRA 3AVQA 2I6QA 1JV2B 1LLCA 1K4MA 3JSAA 4WVFA 3GAZA 4AJ1A 3JQGA 3BJZA 1EK6A 2HJRA 4CM8B 1O58A 2C88A 1RR6A 3RT1A 3I92A 1D2EA 4HSGA 4HDCA 4LX8A 4XJVA 2RC5A 3OJOA 2BJHA 3OBIA 4I3HA 1TF2A 3HZOA 4J4BA 4XCXA 3QFSA 3OQIB 4KBGA 3R7DA 2C78A 3AUXA 2NXEA 3RS0A 3IDSA 1SZCA 3U7QB 1YQQA 1DKUA 1TT7A 3CNQS 1ZDMA 4L9SA 4E4YA 2AR9A 2NVWA 3R3ZA 2WM9B 1D09A 2B30A 3OM0A 4HZIA 5CX1A 2FSPA 2HI0A 1VXOA 3H83A 4OXNA 4TN5A 1TT5B 4PX3A 2WJHA 3EG9B 3F4BA 1AXRA 1ONNA 1V7PC 2ALJA 2BFBB 3SICE 1U94A 2EP8A 1SN7A 2X6TA 2GD0A 1AU9A 4JJFA 3B82A 2AJBA 1Q95A 1Y7PA 1A96A 2Q6KA 3Q12A 4P36A 5ARDA 4E4RA 3IBFA 5B2FA 1HNWB 2F43A 4OOFA 5DCYA 4B3HA 4C08A 5IM4F 3S2YA 1XD2B 5PGMA 2CUZA 5JNUA 2UYHA 4OHOA 1JQJC 2IIBA 4KCGA 4RW0A 3UXHA 2DFTA 4JAVC 3KXPA 4CLDA 4E94A 5IHPA 1VRWA 4IV0A 1CUJA 1HZZC 3AI1A 3MWKA 1T6NA 2CNDA 4P4TA 4XTCS 2WTNA 4ZO8A 1KHTA 3NHUA 3ZHZA 3UJHA 1C8KA 2PZMA 4A73A 2IXAA 3K9NA 4HFNA 4ZHQB 5LP6B 2GO1A 1ECLA 3D4IA 1NASA 3FX2A 5K20A 2W6ID 1FLDA 1IQPA 1WBJB 3RW9A 4HH4A 4IM7A 1SC3A 1X2BA 2X6QA 3KSMA 1HDXA 3KFXA 4HBZA 1NDQA 4Y6PA 4D42A 2BGUA 2P0YA 4EB8A 4K0KB 2C57A 4RGVA 1KY3A 4TXJA 3BTOA 1D9ZA 4Z8YA 4GL2A 2AZTA 1R9MA 1CJUC 4YCMA 2DR2A 2CNWD 2CNBA 1CF9A 1X1RA 2D5BA 1O6GA 2FSVC 2YV3A 3CX8A 1CYDA 2BMVA 2XHZA 3BE5A 1LUAA 3BK7A 3MB5A 5EJ7A 1O8BA 2JCYA 3ZI7A 4WUVA 2ZI6A 2P4UA 2JJYA 3ANXA 1MV5A 4E2FA 4MA4A 3K4QA 4DPKA 2A58A 2PLWA 3FUVA 4E51A 1HSZA 4OXXA 2BR5A 4HWKA 3RF7A 4DZRA 3IT3A 2ZTHA 1KH2A 1AXGA 3D8BA 3GZTB 5IT5A 1ZINA 3QFRA 5FA8A 1G8MA 4KHPB 2Q3FA 2EJWA 3ZY2A 1S8NA 3W6PA 4M0PA 3RBVA 2NVUB 3P2YA 3ZQKA 4U9IS 5LU9A 3HXQA 3B3GA 4NXNB 3B13B 1DQRA 3M2TA 4BLWA 2IQIA 1JJVA 5C8DA 3DEJA 2NX2A 4OX9Y 5FP0A 2YHSA 1E63A 2ZBEA 3NDRA 4QU8A 1O08A 4UBMA 4X61A 3BDVA 4WTOA 4OF4A 3WTBA 5DHAA 3TO5A 5C4IA 1YB7A 5LN1A 1U65A 1YUMA 2ZJ2A 3I12A 2G04A 4F46A 1A9QA 2WJ3A 4HNTA 1Z22A 4MW2A 4XYLA 2CFRA 1MJNA 2I4LA 3ANTA 5ALIA 4AS1A 4RGYA 1L7QA 4JK3A 1JBEA 2NLOA 1XDGA 3CEAA 2RH8A 1UFOA 4DYVA 3C4JA 1PS9A 1R18A 3HB9A 2ZIWB 1C8BA 1ZXXA 4FT2A 3RVMA 3T54A 4EFMA 1B7GO 2G5CA 4KBYA 4OFZA 5EUMA 2ZAGA 1ZK2A 4OHXA 4P7FA 4U5QA 1WKVA 5DM60 3L82B 2V7EA 2HA5A 2X77A 3G2NA 4EAAA 3RHFA 4WINA 4L07A 1XZIA 2XKJE 3DLPX 4EOGA 4QRDA 2A59A 3KTAB 3OOJA 3TNFA 3PDUA 5FWYB 4D92A 3IOBA 5EHGA 3HKEA 1W48A 3O2QB 3AKYA 4ZVUA 3S2IA 3L7JA 1WVIA 3P2EA 4GBED 3LPDA 3SI7A 1IONA 5HFNA 1EM8A 5ILOA 4Q3AA 2X5XA 5DBEX 5AJZA 4WNCA 4CG2A 2IX3A 2AE2A 1UM8A 5JATA 1AUVA 1QP8A 1GT91 3TLAA 3LXRA 1CEYA 3HXKA 2Q6TA 3TR5A 3EWSA 2CL0X 1YHZA 3K1JA 4QPPA 4JENA 2B7CA 4CV0A 1Z2OX 3V3TA 3QF7A 3TWOA 2Q8QA 2AN3A 3UTCA 2XBMA 3ZI0A 2FWAA 4MWTA 4IKOA 5CA0F 3KOUA 4JI1B 1GYRA 3C5VA 3QLJA 4V03A 2J4CA 3S4YA 4EB6A 4HMQA 1ECJA 1F6WA 1GQRA 2VH5R 4P83A 5HQJA 4EFKA 1FXUA 1UDXA 2A0YA 2R7LA 2GF2A 2Q5JA 3CINA 3NAZA 4G1UC 2CDRA 5JVDA 5HK8A 2VZ8A 1JVSA 2LW7A 3SD7A 1T2CA 1I1HA 3TLGA 2YNMC 1FUUA 1PJAA 1TXGA 3TNDA 4QO8A 1RYZA 4PZAA 3DE4X 4Z3KA 1NC3A 3FFBA 1P72A 2X3YA 3LHDA 4DL9A 1N5MA 3JY6A 4M7RA 2AG0A 1SMKA 2DGDA 4FU0A 5EWMA 4BVJA 4ZEOA 3H84A 1R4ZA 1R50A 2N1BA 1Y1KE 2B21A 2X58A 4LHZA 5KSYA 3PUIA 4N3NA 1L0BA 3DO5A 3ONVA 2HA7A 1Z35A 2ODEA 3CMCO 4UATA 4XPIB 3U39A 4ENPA