4AJYB

Von hippel-lindau protein-elonginb-elonginc complex, bound to hif1- alpha peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ajyB00
4G3XB 2L76A 2KMCA 4AP4C 2KZRA 3QHTA 2XEWA 4ZYNA 2KK8A 2AL3A 2NPTA 2WYQA 3PT2B 2DENB 2L3ZA 3VH3B 4LJOB 3W1SC 3AU5A 2KTRA 3M63B 5AZGA 2LZ6A 2DAJA 4HJKA 3IFWB 1WXAA 2O6VB 4K81A 4FLHA 3ZW3A 3B1LX 2CKHB 2NS5A 2O2VB 5CX3A 1WYWB 2LD9A 4NQKE 5LXHA 1KOTA 4HPLB 2FCNA 2LRUA 2ZJDA 3U8ZA 2K39A 5D2MB 5JH5C 2N1WA 1WR6E 2NBWB 2K1FA 2AWTA 4FJZA 2JF5A 4AUQC 4WWPA 1NDDA 2A5UA 2L05A 4GU2A 2IO2B 3PSEB 3PHWB 4NJ7A 1RLFA 5DPTA 4GMVA 4W9IA 2BPSA 3VTVA 1LXDA 3UQBA 5E6OA 4WAAA 4W9KA 1LFDA 2GOWA 2ZCCA 4M0WB 2L0TA 2D2QA 3ZNID 3JSVB 3H7PB 3HK0A 2G4SA 2DZJA 3A1QB 3PLVA 3CMMB 2KDEB 4NJ6A 1OQYA 1S3SG 2WWZA 3RZWC 1KJTA 1E8YA 2FCQA 3QQ8B 2JPHA 4BVUC 1HE8A 1ZW7A 3PHXB 3VXWA 4KZ0A 4MGYE 2D3GA 2GBRA 4TQ0A 1UD7A 3APCA 3L10B 3L16A 4WJPA 4DXAB 3TJPA 3TIXA 4TQ1A 1KM7A 2LGDA 2ASQA 2BKRB 2YVCA 2KTRB 4IWPA 1V81A 4LCDE 1AARA 2G4DB 3QX1A 4GIVA 4EFOA 2GBKA 3ZNGC 4K1RB 3WA0A 2RD0A 2BYFA 4BKTA 2L7RA 2BGFA 5L83A 2QHOA 5TR5A 1T0YA 3EFUA 3O65B 1L2NA 3KH0A 1V49A 1VD2A 3QWZB 4ANVA 1I35A 5HKHA 2KDIA 2C60A 2DAFA 1UBQA 3EC8A 1EO6A 4F7ZA 3NZUA 3AU4A 1IP9A 2L00B 2RSUA 4W9DA 3WIMA 4ZRJA 2J0MA 2W9NA 3JYUA 1UH6A 3BINA 2PEAA 1WIAA 4PS3A 1ZKHA 3CF6E 1WJ4A 2N7DA 3DOWA 3W1YA 4G11A 3N30A 4IWQA 1V5OA 2HE7A 4OVVA 2KFJA 2JRHA 2JVCA 2LVOA 3ALBA 1Q5WB 1UBIA 1GC6A 1F9JA 4KIKA 1YIWA 2ZVOA 5IAAC 1C3TA 1JRUA 5JHBA 2MBEA 3VTWA 1GNUA 4EZLA 2V1YA 5CHWA 2N9XA 4E74A 2KLCA 3QCAA 2KTFA 1H8CA 1WX7A 1WJ6A 2LJ5A 2MLBA 3ZUNA 5D7GA 1QZEA 3EHVA 3I3TB 3KUCB 2JXXA 4II3B 4ICVA 2DYOA 1WM3A 3AXCA 2KN5A 4JQWC 1WJUA 2MBOA 3KUDB 1TZ1A 1MG8A 2M8SA 2KLGA 3A33B 2RR9A 3PTFC 3R66C 4IM3A 4WQOB 2FAZA 4EZKA 2MWSB 1I42A 2K25A 2KC1A 1TGZB 2PJHA 2B3AA 2MW5A 4GDLA 1L7YA 3RYTA 4EKUA 1WGDA 3DDCB 2LGXA 4HDQA 2Z0DB 2CU1A 2LUEA 4G50A 1UELA 3A1QA 1V9JA 4GXBA 5AZHA 2KANA 3RCZA 5BO4B 1RRBA 3JW0X 3A4RA 1EF1A 2CHXA 4M8MA 2UYZB 3BY4B 4II2B 1G6JA 3DQVA 1V6EA 2KQ7A 2LRWA 4J6IA 1VCBA 2M4NA 3L13A 3N3KB 1YQBA 3VDZA 4FHJA 4KIKB 4MM3A 2AEHA 4PS7A 2V4LA 4HCNB 2MCNB 5GMVA 4HPMB 4B6WA 4MGKE 1WGGA 5C23A 4BBNF 3ZO5B 2DZIA 4W9EA 2CR5A 4YL8A 1H4RA 3NOBA 4MJSA 3TCAA 4URKA 3R7QA 4W9FA 2BYVE 4HWIB 1PQSA 4ZRKA 4IM0A 1WI0A 3KW5B 2BWFA 5DPRA 3L54A 3CSFA 2LGYA 2KHWB 1K8RB 3B0AA 3V62A 1EUVB 3D32A 3WALA 1P9DU 4EEWA 3APDA 4DK5A 2RPQA 4CHKA 3PVLA 3IHPC 2BWES 2M0XA 2V3SA 2FCMA 4GDLB 3SHQA 3OJ4B 3H6NA 1WXMA 3KVFB 4HDOA 3H7SA 5DPWA 2LXAA 3DBRI 1P98A 4NY0A 1ZGUB 2FNJB 2KC2A 3ZVVA 1WGRA 1CMXB 3KYCD 4JGHB 1GUAB 3VUXA 1U4AA 2KOXA 1WXVA 4FJYA 3MTNB 3RUIB 3U7DA 4WJNA 2Z0EB 2A4ZA 4DDGD 4FA6A 2MQJA 4BKGA 3PREA 5LXIB 3L17A 1WJNA 4MDKE 1FXTB 2DYBA 1R4NI 2KWCA 1IYFA 4DWFA 3OAWA 4PYUA 2EMTA 2JRIB 3X0WA 1UZXB 3WAOA 2ZZPB 2PE6B 3A9JA 3PV1A 5JZEB 5KHQA 3B08A 3P2BA 3VQIA 1XQQA 4XC2A 4MJSB 3V61A 3ZIMA 5FR6A 4TKNA 2JT4B 3KYDD 4W9CA 1WR1A 1WX8A 4X57B 2MP2A 4PS8A 3IBEA 4A3OA 1OTRB 2L0FA 3PRMB 2GBJA 2N7EA 2KO3A 4RM9A 4BOSC 2J0JA 1P0RA 2RGFA 4W9JA 2J0KA 3L0WB 2IO0B 3VAWA 2K6QA 2KNBA 1J0GA 2KMAA 1WM2A 3V6EB 3VUYA 1V2YA 2I1JA 1P3QU 4B9KA 4BKSD 4DDID 3K9OB 3Q3JA 3PRZA 3UF8A 2REXA 3M62B 3DVNV 5IA7A 4FN2A 5AZFA 1E7VA 2XBBC 4I6PA 1LM8B 3H9DA 2NBUA 4HK2A 2C5LC 3T8MA 2FCSA 3T9LA 1TBEA 4XZ4A 4GN1A 4XX5A 3GOEA 5J17A 1R4MI 3HHMA 1E8XA 1WE6A 2J7QB 2N9PC 4KSLC 3Q3FA 3KUZA 5CHVC 3CSTA 3A9JB 4ASWC 4FADA 4EOYA 2G3QB 2HD5B 3S2AA 1RAXA 2DYMA 3U30A 4MEMA 3ZTDA 2JUOA 3PLUA 4DHJD 3VVWB 3OJ3A 2MP2B 2CHWA 3DBLI 4M8NA 2VRRB 1OGWA 1SE9A 4PYZA 2BYEA 4JLCA 2CS4A 2IY1B 2K8HA 2PE9A 1WH3A 3HM6X 3VHTC 4FBJB 3QK0A 3ML9A 3ZDTA 2KX0A 1YX6B 2JZ3B 2K6DB 2MA9B 2MBHA 4MSQB 3ONSA 4NNJB 1KLVA 2EMSA 2KWUB 4RMAA 3TBLD 2DZKA 5CHFA 3LDZE 3QJZA 2MBBB 4DHZE 2D07B 4K7UA 3VTUA 2JWZA 3NHEB 4ANWA 2YLMA 4GDKA 2O6VD 3DVGY 3JVZX 4AJYB 3ZDMC 2KXJA 4EZJA 4G0NB 5C1ZA 3K9PB 1A5RA 2CHZA 3ML8A 3PZDA 2ZPNA 3R7RA 2Y5BB 1X1MA 2DHZA 4NPNA 3C0RB 4IC7B 3ZTCA 4HCPB 3NS8A 1V80A 1WGYA 2GBNA 3OLMD 3HIZA 1RFAA 3W1SA 3AI5A 1Z2MA 1GJZA 4WJQA 4ZDVA 2K8CA 2KDFB 4A3PA 1XD3B 1V5TA 4HLEA 3A4SC 2C7MB 4MH0E 3NZSA 2ZCBA 2OJRA 3LJ3A 4HVBA 3L08A 2IZVB 3HM3A 4IUMB 4LJPB 4TUUA 3SU8X 4IM2A 3ECIA 1WGHA 3TMPB 1TTNA 1WRDB 2IY0B 2KX3A 3APFA 1BT0A 2KFKB 1P1AA 4IG7B 3SD5A 4DHZB 4KDLB 1D3ZA 3PRPB 3ZNZB 4ICUA 3MJWA 4MGZE 3VH4B 1GG3A 2BF8B 2HJ8A 2WDTB 1M94A 1WY8A 2IYDB 5AEKB 3TL5A 4ANUA 3UGBB 2NBVB 3DBHI 5E6PA 3R3MA 3NY5A 4FJVB 3V60A 2C7HA 4GDKB 1IPGA 2KWVB 5DPSA 4P7IA 3GZNI 4JIOU 2ZNVB 4FULA 4GSWA 2D11A 2BKFA 3ENEA 4FHKA 5JHAA 2LVPA 2XK5B 3QIJA 5L95C 4N9F4 2ZVNA 3QC8B 3ZRCA 2FUHB 3UINB 2WX0A 2IO1B 3PPAA 4I6NB 4KVGB 4BOZB 2WX1A 1WZ0A 1YJ1A 3PS6A 5EDSA 3M3JA 1Q1OA 4GGQA 3ZKJC 4DBGA 3SDLC 2KJ6A 2GBMA 5D94A 4EUTA 3DBSA 3VUWA 1E8WA 2C7NB 1E8ZA 4W9LA 1J19A 2MX2A 1WXSA 2NPTB 2PPHA 3IVFA 1YD8U 4BKSA 4NAWA 1SGHA 2C9WB 2KVRA 4W9HA 3UIOB 2R2OA 3RT3B 3H1UA 3UQAA 1OEYA 4BFRA 4F1SA 1EF5A 1OEYJ 1WE7A 2I1KA 2KD0A 2LASA 2M1MA 3EECA 3N32A 4WWNA 5E6NA 4B95A 3RZFA 1LQBA 1Q0WB 2D10A 2ZPYA 4AJWA 2NVUI 4AWJA 4TV3A 2M17A 2NR2A 2ZEQA 3IG3A 4CYEA 2KKCA 2AL6A 2GMIC 5D6JB 2JY6A 4OVUA 4IWOA 4RM8A 5LLIA 2JZZA 4MSMB 1WX9A 1UGMA 3DCGA 3X23A 3AULA 2KJHB 1WZ3A 2FIDA 2IO3B 2KQSA 4CO7A 4K7WA 3V6CB 4A20A 3MHSD 4AOFA 2L8JA 3A9KA 3VFKA 2LWPA 4LDTD 1WMHA 2Z59B 4K7SA 4MELA 4KDIC 3RD2A 2MSED 1E90A 2G45B 1C1YB 3WAMA 4ANXA 2FIFA 2KDBA 2IBIB 4F8CB 1E7UA 5DCNA 3QAQA 1WF9A 2MRPA 5G2NA 5KHOA 3DVNU 2EKEC 5J2RA 4E3CA 4KV2A 5CTRC 3WANA 1S1QB 3ZNHB 5G55A 3DPDA 4W9GA 3UIPB 2KFKA 4I6LB 2O6VA 1E5WA 2LXCA 2DZMA 2O2VA 4NAWB 2N4FA 2AYOB 1Y8RC 2UWQA 1Z5SB 2KJRA 1NBFC 4WWOA 1ISNA 2NCNA 3PGEA 1V86A 4MGIE 2N9EB 4HXDA 2R2QA 4WJOA 4JL9A 4NQLB 4E71A 1YX5B 2K8BA 3DVGX 3RULA 2LVQA 2DX5B 1XT9B 4LDTB 4KSKC 1GC7A 5J18A 4BBNC 2LI5A 4GB9A 2XK5A 1NI2A 2MBQA 4IW0A 1SIFA 3ZRFA 3JSVA 3QARA 3H7PA 3ZLZA 4DHJB 2HTHA 3A9KB 2ZNVC 1J8CA 4KZCA 3M95A 3QA8A 4GOCA 1WFYA 1WMHB 2N1VA 3WAPA 2OOBB 4ZRIA
chains in the Genus database with same CATH superfamily
1PGBA 4G3XB 3B2FA 3QHTA 3V05A 1D5XC 2QC8A 3W1SC 2KTRA 3Q3OC 1WGKA 2LZ6A 4C7ZA 4HJKA 3IT6B 1WXAA 1QQRA 2O6VB 3IT4B 3B1LX 2NS5A 2O2VB 2LD9A 4NQKE 2FCNA 3U8ZA 4A90A 2AWTA 2JF5A 4AUQC 3GB1A 2IO2B 1KF6B 1N61A 3Q69A 3Q3MC 4W9IA 1J7CA 1LXDA 4W9KA 2GOWA 3NVYA 2ACZB 3A1QB 2KDEB 3RZWC 1QOBA 1ZW7A 3PHXB 3VXWA 1ET6A 3APCA 3NG0A 2KYWA 2QCZA 2QSDA 2YVCA 4IWPA 1V81A 4LCDE 1F77A 2G4DB 3QX1A 3WA0A 2RD0A 2BGFA 2QHOA 4D2KA 2V3NA 3O65B 5IOIA 1V49A 4ANVA 4C00A 1I35A 5HKHA 2JQRB 1T5XD 4ACFA 4HKQA 1IP9A 4OZBA 2RSUA 4ZRJA 1UH6A 2MJDA 2PEAA 4PS3A 3CF6E 2HE7A 4OVVA 3W9CB 3ALBA 1PFDA 2GB1A 1F9JA 4XDCA 4PK1A 1JRUA 5JHBA 1DGJA 1LO5D 4EZLA 5CHWA 4E74A 1H8CA 2LJ5A 3ZUNA 4ICVA 3BK2A 1XXGA 1NEKB 1MG8A 2QEJC 3AEBB 3DHIC 2KLGA 3R66C 1YN5A 2K25A 2K0PA 2PJHA 1TGZB 3RNGC 2I2YA 3DDCB 2LGXA 4HDQA 4A55A 1TY0A 1E6EB 2KANA 3EFCA 4M8MA 1TKEA 2BB5A 1G6JA 1V6EA 4XYCA 1AW7A 1VCBA 1EU3A 3VDZA 2AEHA 5H8YE 3I9V1 4HCNB 2BB6A 5H92C 2WLBA 2MCNB 1B9RA 4HPMB 1UWXA 4B6WA 4JX1C 1WGGA 2CR5A 4J3OD 1I4HA 1PQSA 5DPRA 2KHWB 1K8RB 1EUVB 2KWDA 4EEWA 2WXNA 3APDA 4DK5A 1TS2A 3E56A 4GDLB 3OJ4B 5DPWA 3DBRI 3EGRA 3R2IA 2LHEA 2KC2A 2FNJB 1WGRA 3PZ7A 3VUXA 4FJYA 3RUIB 2Z0EB 2A4ZA 4FA6A 1CQVA 3PREA 5LXIB 2JYTA 1R4NI 4XWTA 4PYUA 1UZXB 1E10A 5BYRA 5KHQA 4XC2A 1TY2A 5FR6A 4TKNA 2L83A 2YEPB 3AM9A 3NVWA 3NRZA 1GB4A 5HI1A 1I4QA 4BOSC 4ARIA 2KO3A 1Y56A 2CJOA 3VAWA 2SAKA 2MHJA 3B9JA 3V6EB 4OVZA 1V2YA 5G5HA 1T0QC 4BKSD 4DDID 1RYJA 3K9OB 3AEFB 3UF8A 2REXA 3DVNV 4FN2A 4I6PA 2NBUA 4HK2A 2PKOA 1TBEA 4XX5A 5J17A 1AN8A 1WE6A 2JZPA 2N9PC 3ZYYX 1AWDA 3AE5B 3IAS1 4RGMA 3C19A 5C3JB 2OEDA 4JWSC 2WXHA 4EOYA 4OZAA 4MEMA 3ZTDA 3PLUA 2VH2A 3VVWB 3OG5A 2VRRB 4YSZB 4PYZA 1V1OA 1WH3A 4FBJB 3ML9A 4LNOA 3URYA 1SEBD 4MSQB 3ONSA 4NNJB 1KLVA 3T3OA 2EMSA 4RMAA 4HRSA 4XE0A 4DHZE 4LNFA 3JVZX 3DVGY 4AJYB 1FM0D 1A5RA 2X8XX 2V4IB 4NJCA 3R7RA 2Y5BB 3N1XC 1ZDXA 4S0RA 4NPNA 5I4DA 3LYYA 1DYQA 2BS3B 2ON8A 4HLEA 3RNFC 2GI9A 1AYFA 4YTPB 2IZVB 4TUUA 3N20C 1TTNA 2IY0B 2KX3A 2QMTA 1BT0A 2KFKB 2WXQA 1RWSA 3TEWA 3ZNZB 3AECB 1BMLC 3NZ3A 3UGBB 5E6PA 4KX6B 2C7HA 2ZW0A 4P7IA 2DLBA 1ZPSA 2G1EA 1XF5L 3ZQ4A 4ARCA 4JIOU 4GSWA 2D11A 2BKFA 3ENEA 5JHAA 2XK5B 4N9F4 3ZRCA 1YN3A 3UINB 2WX0A 3I57A 3PPAA 4I6NB 3SR6A 5EDSA 2VH1A 4GGQA 4DBGA 1HXYD 3DBLB 4LLGM 1V1PB 1E8ZA 2LFIA 1IGCA 3CWIA 2PPHA 1WXSA 1Q10A 4BKSA 1YD8U 4NAWA 2KQ4X 2JU6X 3PO0A 1OEYJ 4US9A 1SXTA 3RZFA 1Q0WB 4N59A 2NVUI 4AWJA 2NR2A 3RPFC 2JY6A 3Q2AC 4OVUA 2ICIA 3C8YA 4RM8A 1LGRA 5LLIA 2JZZA 5EE0A 3HVDA 3X23A 1QOGA 1BUIC 2KJHB 1F0ZA 4K7WA 3MHSD 3A9KA 3U2SC 4AQ7A 3RD2A 2L1AA 4ANXA 2FIFA 1FNVA 3DVNU 3SFDB 3UIPB 2E6XA 1KLUD 4C4VA 3ZGZA 2N4FA 1Z5SB 2KJRA 1B1ZA 2H88B 4TMAB 4WWOA 3Q8CA 2NCNA 1FRDA 4MGIE 2N9EB 4JL9A 1BXTA 1P7FA 2K8BA 3DVGX 2W55A 4KSKC 4XDDA 4YT0B 4BBNC 4GB9A 1XO3A 2LI5A 1NI2A 3QARA 4DHJB 4WWMA 4A9AA 3M95A 1WFYA 1WMHB 1ZOYB 2OOBB 4AP4C 2W3RA 4ZYNA 1NVID 5LNK1 2WYQA 2NPTA 1KFYB 2IGGA 3RMKC 3VH3B 2IPKD 4LJOB 5AZGA 2DAJA 1MVKA 3ZW3A 4A8XC 3BYTB 1WYWB 3TSSA 5LXHA 1KOTA 1R7SA 4HPLB 5JH5C 4HJGE 2ZJDA 2N1WA 5G5GA 1WWTA 1NDDA 1R4MB 4GU2A 3PSEB 3PHWB 2WXPA 3LXFA 5IKCM 2G9HD 3VTVA 2AQ3B 3UQBA 2WDRB 2L0TA 3W2DA 4H2AA 3ZNID 3JSVB 3EUB2 3HK0A 1UUPA 2G4SA 2DZJA 3CMMB 5BMGA 2WWZA 1ZXIA 4YSYB 2JPHA 4TQ0A 1EM7A 3TIXA 1ROEA 2ASQA 2JSVX 2EKIA 4JE3B 2GBKA 3ZNGC 1QOAA 2L7RA 1XCTL 5TR5A 1T0YA 1NENB 1VD2A 1ENFA 1KTKA 4KGRA 1FFUA 3AU4A 1TKGA 2W9NA 5D3IB 1WJ4A 2H89B 3DOWA 4G11A 2KDMA 1UBIA 2NMQA 3FKYA 1YIWA 1VLBA 2ZVOA 5IAAC 1C3TA 1F2RI 2MBEA 3VTWA 1GNUA 2KLCA 1UGJA 3QCAA 3BVMA 1ZXHA 3FC4A 2IDYA 2MLBA 3AN1A 2FUG1 3J9CA 4IOIE 1OQQA 2BYTA 3AXCA 2MBOA 5IN7A 2M8SA 4RNAA 1I4GA 4IM3A 2RR9A 4EZKA 2FAZA 2RDGA 1FRRA 2B3AA 1ZP0B 1UELA 2WS3B 4GXBA 5AZHA 2K3UA 5BO4B 1RRBA 1EF1A 2CHXA 4II2B 4J6IA 2M4NA 3L13A 1IUEA 3AE3B 4KIKB 4IDIA 4MM3A 2B76B 3NS1A 2V4LA 5HG2A 1F52A 5GMVA 1VRAB 4HEA1 2BTEA 4MGKE 1C76A 4W9EA 1H4RA 1YOVB 4ZRKA 1YJJA 2LGYA 4M02A 3D32A 2RPQA 3PVLA 3IHPC 2FCMA 3SHQA 3ETRA 1VJKA 1A70A 4HDOA 1P98A 3ZVVA 1VZ8A 2J52A 1CMXB 4XGAB 1GUAB 2ZW1A 2KOXA 1WXVA 3MTNB 3U7DA 1N60A 4WJNA 2MQJA 2Q5WD 4IKGA 2DYBA 1NYRA 1SE3A 2N0SB 4DWFA 3OAWA 2JRIB 3A9JA 3B08A 3VQIA 1JROA 4MJSB 1ESFA 2LUMA 2QIEB 1WX8A 2JYEA 5D3DA 3PRMB 1FXIA 4MACA 3AEGB 3BVGA 2RGFA 1TS3A 3L0WB 2KNBA 1J0GA 2KMAA 4RF0A 2JX5A 2D3BA 3VUYA 2I1JA 1T6BX 3BYYB 3VRBB 3PRZA 4LNNA 2V9HA 2C5LC 2FCSA 4AS1A 4KSLC 3Q3FA 1VZ7A 4ASWC 3S2AA 3U30A 2JUOA 2MP2B 4M8NA 1SE9A 2PE9A 4YTNB 1SE4A 2IJ0A 3DBRB 3QK0A 2KX0A 2MBHA 5HFYA 1L6UA 2KWUB 5BYQA 2KN4A 2DZKA 5CHFA 3IXSA 3HVZA 1SIJA 4L1BA 2JWZA 4GDKA 2O6VD 3ZDMC 2KXJA 4G0NB 5C1ZA 3K9PB 2CHZA 1X1MA 2W82A 1PGAA 5IO9A 3NS8A 3KLSX 3HIZA 1RFAA 3W1SA 3AI5A 1HQRD 1K51A 4ZRQA 2PW9A 2K8CA 2KDFB 3RNBC 1CJEA 1V5TA 1XD3B 3HM3A 4IUMB 3ECIA 1MHXA 4P1CC 3TMPB 2M0AA 4USAA 1QKZA 3Q14C 3PRPB 4DXGA 4ICUA 1I4PA 4MGZE 3VH4B 2BF8B 1JMLA 4B0MA 4REZA 2WXIA 3GZNI 4FULA 3WCQA 3VRAB 5L95C 2ZVNA 2FUHB 4KVGB 4BOZB 3P4PB 1QLBB 2N9KA 3SDLC 4HPPA 2KJ6A 2C7NB 3Q6BA 4W9LA 1N62A 2NPTB 1FPYA 4C56C 2NTTA 4W9HA 5BMIA 3UQAA 4BFRA 2I1KA 2KD0A 1JCKB 3RNCC 1LQBA 4AJWA 2ZPYA 2AQ2B 2Y5PA 3OWEB 2GMIC 5D6JB 3AE8B 3V3XA 1L5PA 2LJIA 4IWOA 4MSMB 1WX9A 1UGMA 3Q3NC 3AULA 1WZ3A 2FIDA 4AOFA 4LDTD 4HROA 2WDQB 3Q8BA 5EE3A 4O1NA 2IBIB 5G2NA 2MRPA 2EKEC 5J2RA 4E3CA 4KV2A 3WANA 2WXFA 1S1QB 2WXLA 1MG4A 2LGIA 2O6VA 1E5WA 2LXCA 2DZMA 2O2VA 1EWYC 1Y8RC 2UWQA 2JXTA 2WHIA 3FILB 1NBFC 2V3PA 1ZUD2 1ISNA 3PGEA 3P1MA 1V86A 1T3QA 1MJDA 4GLSC 3BWUD 2HJ1A 1F1HA 1JWSD 2VZKB 3U7ZA 1FXAA 1FCCC 2D5GA 4NAMA 2MBQA 2WXKA 3AE4B 1E9MA 3AH7A 3N1YC 1KLGD 1TS5A 4GOCA 3WAPA 4ZRIA 2DBYA 3HRDD 1V8CA 2KZRA 2XEWA 2AX5A 3HUIA 2AL3A 3CIRB 2DENB 2WU2B 2L3ZA 3AU5A 3M63B 4DQOC 4RCOA 1VDVA 5CX3A 2K39A 5D2MB 1WR6E 4FJZA 1L4DB 2A5UA 2L05A 4NJ7A 1RLFA 1EU4A 1KH0A 2LMCA 2BPSA 2UU7A 1SJHD 3AB5A 2YEPF 1LFDA 2ZCCA 4M0WB 2D2QA 3H7PB 2J4XA 3Q8EA 4NJ6A 1OQYA 2KAJA 3QQ8B 4BVUC 4MGYE 3EA6A 3L16A 3L10B 4LNIA 1KM7A 2E3TA 2LGDA 1FD6A 2KTRB 1L4ZB 1AARA 2WXMA 4EFOA 2MH7A 5IP4D 4K1RB 4BKTA 2BYFA 4L23A 5L83A 2IGHA 3MHZA 3EFUA 1L2NA 3KH0A 2C60A 1TJEA 4BZAA 2DAFA 1UBQA 1NYQA 1DOYA 2WNMA 4W9DA 4KKIA 4JWUC 1YMHE 2J0MA 3JYUA 3BINA 5FK9C 1ZKHA 3W1YA 1K50A 1E0ZA 1D6EC 5FR3A 2JRHA 1FNWA 2JVCA 1GC6A 3AEEB 1ZE3D 2BS2B 4YTMB 2V1YA 2N9XA 2FBWB 1YNTE 3MP9A 4C80A 1C4PA 3AE7B 1HEZE 1QZEA 3I3TB 4II3B 3ZJUA 1WM3A 4JQWC 3KUDB 4JPSA 4KKJA 1UWMA 3A33B 3TUOA 2INCC 2OJWA 2MW5A 4GDLA 1L7YA 3RYTA 1WGDA 2Z0DB 2CU1A 4G50A 1V9JA 3RCZA 1C9FA 2UYZB 3BY4B 3DQVA 2LRWA 2KQ7A 2WP9B 2CJNA 3N3KB 1YQBA 1K53A 1N5XA 3P63A 1TKYA 4Q2JA 5C23A 4BBNF 2DZIA 3TCAA 4HWIB 1OQRA 3KW5B 1D4BA 3MJ5A 3B0AA 1P9DU 2SEBD 4CHKA 2BWES 1YN4A 2V3SA 2K5PA 3PZ8A 1TT5B 3KWVA 4N58A 5EE9A 2K22A 3H6NA 3KVFB 1RM6C 3H7SA 2LXAA 2D3CA 3W5VB 1JWAD 4NY0A 1ZGUB 1PUTA 4JGHB 1HZ5A 3KYCD 2W54A 1HA5A 4WQMA 1YJIA 1YQ3B 2RDBC 1CZPA 2KVZA 3PV1A 1XQQA 3V61A 1XLNA 3KYDD 4W9CA 3W5UB 4X57B 4BAXA 4PS8A 2L0FA 1SB3C 4WAFA 2GRIA 4RM9A 2N7JA 2J0JA 2M56B 1P0RA 4W9JA 1WM2A 4M01A 1IBXA 3NUHB 3R8BA 1MFWA 1FNUA 2KMMA 3Q3JA 5AZFA 2XBBC 2BVCA 1LM8B 3H9DA 3T8MA 1L0VB 5T8IA 1I4XA 2TSSA 1R4MI 2M19A 1V97A 2INPE 1T0RC 5CHVC 4FADA 3BK1A 2HD5B 3I63C 1RAXA 1OFFA 4DHJD 3OJ3A 2CHWA 1M4VA 2BYEA 3HM6X 2Z8LA 2K6DB 2MA9B 1K52A 1HZ6A 2PLPA 1WYGA 2RDHA 2N9LA 2MBBB 1XLPA 4K7UA 3VTUA 4RF1A 4ANWA 2YLMA 2OHFA 1F2RC 4EZJA 2K9XA 3PZDA 3VR9B 2ZPNA 1ACCA 3AMZA 4IC7B 5AUKA 1V80A 1WGYA 3OLMD 1VZ6A 1Z2MA 1GJZA 4ZDVA 4A3PA 3A4SC 4YSXB 3NZSA 2ZCBA 2OJRA 3LJ3A 3SU8X 4IM2A 1QILA 1WGHA 3APFA 4IG7B 3TEXA 3NVVA 3ZJVA 1D3ZA 3AEDB 2RMMA 3MJWA 1GG3A 2HJ8A 2IYDB 1FCLA 2NBVB 3DBHI 2KWVB 4FHKA 2LVPA 2J42A 2I38A 2MJ3A 3QC8B 3ZXVA 3AV8A 1YJ1A 3PS6A 3M3JA 1Q1OA 4S17A 2GBMA 5D94A 4EUTA 3DBSA 3VUWA 4UDUC 1UF0A 2Y5CA 1SJED 3RN9C 1SGHA 3RT3B 3H1UA 1MHHE 1OEYA 4F1SA 1EF5A 4WWNA 2M1MA 3EECA 5E6NA 1TIFA 4DXFA 4MT5A 2W3SA 1JALA 2M17A 3NVZA 3IG3A 1J7AA 2KKCA 4CYEA 2AL6A 3T3NA 2PVOD 2IO3B 1JRPA 4CO7A 4A20A 2LHDA 2L8JA 3VFKA 1WMHA 4LK0M 4MELA 4KDIC 5GXGB 1E90A 1C1YB 4F8CB 5DCNA 3TEYA 3QAQA 1WF9A 5KHOA 4B0EA 1L0YB 4RGNA 5CTRC 1EWCA 1PYWD 3DWMA 4I6LB 3BIID 1TYGB 2J53A 4NAWB 2AYOB 2L32A 4NZLB 2V0GA 3AE1B 1FO4A 2CU3A 2KACA 4HXDA 2R2QA 3GZNB 4NQLB 1D5MC 4E71A 2BT6A 2LVQA 2DX5B 1XT9B 4LDTB 1R4NB 5J18A 4LNKA 1I4RA 1C4AA 4ZYSA 3GE8C 2LEKA 4MH8A 2WGSA 4YXDB 3JSVA 3UI3A 2HTHA 3A9KB 4US8A 1QT9A 3QA8A 1KRHA 2N1VA 2L76A 2KMCA 1WXQA 4RFBA 2KK8A 3PT2B 1P7EA 3IFWB 4K81A 4FLHA 4C4VB 2CKHB 3U52E 1N63A 3P4SB 2LRUA 2NBWB 3N1ZC 2K1FA 4ZOHC 4WWPA 4RH6A 5DPTA 1PGXA 4GMVA 1CK1A 5E6OA 4WAAA 4N6EB 4CQNA 3PLVA 3MC0B 1JWUD 1S3SG 1KJTA 1E8YA 2FCQA 4LTUA 4P6VF 1HE8A 4KZ0A 2ONQA 2D3GA 2GBRA 1UD7A 3NJTA 1VR9A 4WJPA 4DXAB 3TJPA 4TQ1A 2BKRB 3RNEC 1GPXA 4GIVA 4TSSA 2RPVA 3QWZB 2KDIA 3MFGA 3EC8A 4F7ZA 1EO6A 3NZUA 2L00B 4P16A 3WIMA 2XN9C 3TEZA 2BBCA 1WIAA 5AUIA 2PVGC 2N7DA 1FEHA 3N30A 2GLSA 1V5OA 4IWQA 2KFJA 2LVOA 3GE3C 1Q5WB 4A6QA 1UNSA 5TSSA 4KIKA 1C79A 3DHGC 2KTFA 3SFEB 1WX7A 1WJ6A 5D7GA 3EHVA 3KUCB 2JXXA 2DYOA 2KN5A 1XLOA 1WJUA 2MEKA 1TZ1A 2KT7A 2INDC 3PTFC 4WQOB 1GAQB 2MWSB 1I42A 2KC1A 3AE9B 4EKUA 1QF6A 1L6VA 1TZOA 2LUEA 3A1QA 1D5ZC 3JW0X 1IBXB 3A4RA 4FXCA 1L0XB 2BS4B 4FHJA 4PS7A 2QDFA 2WXOA 4WURA 2WXRA 3ZO5B 2WQYB 2HTME 4YL8A 4MJSA 3NOBA 4URKA 3R7QA 4W9FA 1PDXA 2MJEA 2BYVE 3DWGC 3P4RB 3P42A 4IM0A 1WI0A 2BWFA 4RGTA 4OZCA 5BYSA 3L54A 3CSFA 3SEBA 3V62A 3WALA 2PIAA 2WDVB 3I5JC 2M0XA 1WRIA 2HDEA 3O13A 3R2TA 4EE2A 1WXMA 1C4CA 3RI7C 2PTLA 3LB8C 1SF0A 1U4AA 1XLQA 2X38A 3B2GA 4DDGD 3ZXRA 3RFZB 4BKGA 2QJLA 1YQ4B 1I7HA 3L17A 4MM3B 4XWWA 1WJNA 3AE6B 4MDKE 1FXTB 2D3AA 2KWCA 2AQ1B 4HKZE 1IYFA 2EMTA 3X0WA 3WAOA 2ZZPB 2PE6B 5JZEB 3P2BA 3ZIMA 2JT4B 4ZRPA 1WR1A 2MP2A 3IBEA 3AEAB 4A3OA 1OTRB 1XCQL 2N7EA 2GBJA 2LGSA 2J0KA 2IO0B 4KGSA 2K6QA 5FKAC 1C78A 3Q8AA 1J7BA 4L2YA 3IAM1 1P3QU 4B9KA 2Y3AA 4RGOS 3M62B 5IA7A 1ZDVA 1E7VA 3T9LA 1WSPA 4XZ4A 4GN1A 3VR8B 1GOZA 3GOEA 2DNFA 3HHMA 1E8XA 3P4QB 2J7QB 5MPOA 1RFKA 2VZKD 1MPEA 1C77A 2NTSA 3KUZA 1N6ZA 3CSTA 3A9JB 2G3QB 2BQQA 2DYMA 3KWLA 1FMAD 1ET9A 3DBLI 3ZJTA 1OGWA 3MC9A 4JLCA 2CS4A 2IY1B 2K8HA 3RNAC 3VHTC 1JQ4A 1HTOA 1XEEA 2DWQA 3ZDTA 1YX6B 2JZ3B 5C2TB 3TBLD 3KQ4A 3LDZE 3QJZA 2EELA 2D07B 3NHEB 4R3DA 4C7YA 5E6JA 3ML8A 4YWGG 1NI3A 4M00A 2DHZA 3C0RB 3ZTCA 4HCPB 2R61A 2GBNA 4WIPA 5BMHA 4WJQA 1SSNA 1E7PB 2C7MB 4MH0E 2WXGA 4ITKA 4HVBA 3L08A 2PMVA 4LJPB 4OW0A 1WRDB 3FAHA 3E9SA 2QILA 1P1AA 3SD5A 4DHZB 4KDLB 2BW2A 2WDTB 1M94A 1WY8A 5AEKB 4OHJA 3TL5A 4ANUA 3GP7A 3BVZA 1JWBD 3V60A 3R3MA 2FE8A 3NY5A 4FJVB 4GDKB 1IPGA 5DPSA 4K3CA 3MC8A 2ZNVB 3U4EG 2INNE 2L52A 3QIJA 2IO1B 2WX1A 1WZ0A 1QOFA 3ZKJC 3ABVB 2WU5B 1E8WA 3Q8FA 1J19A 2MX2A 3IVFA 3N9YC 2C9WB 2KVRA 3UIOB 2R2OA 1T0SC 1IGDA 3FILA 1WE7A 2LASA 3N32A 4B95A 3GS2A 2D10A 1SE2A 4TV3A 2ZEQA 5HHDG 3BZDB 1JWMD 1JW9D 4QAYA 1SBBB 3DCGA 2IGDA 2KQSA 3V6CB 1DOXA 4PT5A 2LWPA 2Z59B 4K7SA 2MSED 3AE2B 4KGTA 2G45B 3WAMA 2KDBA 5EE1A 1E7UA 2XNAC 3ZNHB 5JXVA 2WXJA 5G55A 3H8HA 3DPDA 4W9GA 2KFKA 4ZHOA 1GB1A 4K3BA 2JWUA 1HTQA 3DBHB 4WJOA 3DHHC 3L4PA 1YX5B 1FFVA 3RULA 4P1BC 1N5WA 4WH4A 1TS4A 1FIQA 1GC7A 3ZRFA 2XK5A 4IW0A 1SIFA 4M0WA 4ZHPA 1DOIA 3H7PA 1MI0A 3ZLZA 2ZNVC 1J8CA 1STEA 4KZCA 1V1PA
chains in the Genus database with same CATH topology
4G3XB 2L76A 2KMCA 4AP4C 2KZRA 3QHTA 2XEWA 4ZYNA 2KK8A 2AL3A 2NPTA 2WYQA 3PT2B 2DENB 2L3ZA 3VH3B 4LJOB 3W1SC 3AU5A 2KTRA 3M63B 5AZGA 2LZ6A 2DAJA 4HJKA 3IFWB 1WXAA 2O6VB 4K81A 4FLHA 3ZW3A 3B1LX 2CKHB 2NS5A 2O2VB 5CX3A 1WYWB 2LD9A 4NQKE 5LXHA 1KOTA 4HPLB 2FCNA 2LRUA 2ZJDA 3U8ZA 2K39A 5D2MB 5JH5C 2N1WA 1WR6E 2NBWB 2K1FA 2AWTA 4FJZA 2JF5A 4AUQC 4WWPA 1NDDA 2A5UA 2L05A 4GU2A 2IO2B 3PSEB 3PHWB 4NJ7A 1RLFA 5DPTA 4GMVA 4W9IA 2BPSA 3VTVA 1LXDA 3UQBA 5E6OA 4WAAA 4W9KA 1LFDA 2GOWA 2ZCCA 4M0WB 2L0TA 2D2QA 3ZNID 3JSVB 3H7PB 3HK0A 2G4SA 2DZJA 3A1QB 3PLVA 3CMMB 2KDEB 4NJ6A 1OQYA 1S3SG 2WWZA 3RZWC 1KJTA 1E8YA 2FCQA 3QQ8B 2JPHA 4BVUC 1HE8A 1ZW7A 3PHXB 3VXWA 4KZ0A 4MGYE 2D3GA 2GBRA 4TQ0A 1UD7A 3APCA 3L10B 3L16A 4WJPA 4DXAB 3TJPA 3TIXA 4TQ1A 1KM7A 2LGDA 2ASQA 2BKRB 2YVCA 2KTRB 4IWPA 1V81A 4LCDE 1AARA 2G4DB 3QX1A 4GIVA 4EFOA 2GBKA 3ZNGC 4K1RB 3WA0A 2RD0A 2BYFA 4BKTA 2L7RA 2BGFA 5L83A 2QHOA 5TR5A 1T0YA 3EFUA 3O65B 1L2NA 3KH0A 1V49A 1VD2A 3QWZB 4ANVA 1I35A 5HKHA 2KDIA 2C60A 2DAFA 1UBQA 3EC8A 1EO6A 4F7ZA 3NZUA 3AU4A 1IP9A 2L00B 2RSUA 4W9DA 3WIMA 4ZRJA 2J0MA 2W9NA 3JYUA 1UH6A 3BINA 2PEAA 1WIAA 4PS3A 1ZKHA 3CF6E 1WJ4A 2N7DA 3DOWA 3W1YA 4G11A 3N30A 4IWQA 1V5OA 2HE7A 4OVVA 2KFJA 2JRHA 2JVCA 2LVOA 3ALBA 1Q5WB 1UBIA 1GC6A 1F9JA 4KIKA 1YIWA 2ZVOA 5IAAC 1C3TA 1JRUA 5JHBA 2MBEA 3VTWA 1GNUA 4EZLA 2V1YA 5CHWA 2N9XA 4E74A 2KLCA 3QCAA 2KTFA 1H8CA 1WX7A 1WJ6A 2LJ5A 2MLBA 3ZUNA 5D7GA 1QZEA 3EHVA 3I3TB 3KUCB 2JXXA 4II3B 4ICVA 2DYOA 1WM3A 3AXCA 2KN5A 4JQWC 1WJUA 2MBOA 3KUDB 1TZ1A 1MG8A 2M8SA 2KLGA 3A33B 2RR9A 3PTFC 3R66C 4IM3A 4WQOB 2FAZA 4EZKA 2MWSB 1I42A 2K25A 2KC1A 1TGZB 2PJHA 2B3AA 2MW5A 4GDLA 1L7YA 3RYTA 4EKUA 1WGDA 3DDCB 2LGXA 4HDQA 2Z0DB 2CU1A 2LUEA 4G50A 1UELA 3A1QA 1V9JA 4GXBA 5AZHA 2KANA 3RCZA 5BO4B 1RRBA 3JW0X 3A4RA 1EF1A 2CHXA 4M8MA 2UYZB 3BY4B 4II2B 1G6JA 3DQVA 1V6EA 2KQ7A 2LRWA 4J6IA 1VCBA 2M4NA 3L13A 3N3KB 1YQBA 3VDZA 4FHJA 4KIKB 4MM3A 2AEHA 4PS7A 2V4LA 4HCNB 2MCNB 5GMVA 4HPMB 4B6WA 4MGKE 1WGGA 5C23A 4BBNF 3ZO5B 2DZIA 4W9EA 2CR5A 4YL8A 1H4RA 3NOBA 4MJSA 3TCAA 4URKA 3R7QA 4W9FA 2BYVE 4HWIB 1PQSA 4ZRKA 4IM0A 1WI0A 3KW5B 2BWFA 5DPRA 3L54A 3CSFA 2LGYA 2KHWB 1K8RB 3B0AA 3V62A 1EUVB 3D32A 3WALA 1P9DU 4EEWA 3APDA 4DK5A 2RPQA 4CHKA 3PVLA 3IHPC 2BWES 2M0XA 2V3SA 2FCMA 4GDLB 3SHQA 3OJ4B 3H6NA 1WXMA 3KVFB 4HDOA 3H7SA 5DPWA 2LXAA 3DBRI 1P98A 4NY0A 1ZGUB 2FNJB 2KC2A 3ZVVA 1WGRA 1CMXB 3KYCD 4JGHB 1GUAB 3VUXA 1U4AA 2KOXA 1WXVA 4FJYA 3MTNB 3RUIB 3U7DA 4WJNA 2Z0EB 2A4ZA 4DDGD 4FA6A 2MQJA 4BKGA 3PREA 5LXIB 3L17A 1WJNA 4MDKE 1FXTB 2DYBA 1R4NI 2KWCA 1IYFA 4DWFA 3OAWA 4PYUA 2EMTA 2JRIB 3X0WA 1UZXB 3WAOA 2ZZPB 2PE6B 3A9JA 3PV1A 5JZEB 5KHQA 3B08A 3P2BA 3VQIA 1XQQA 4XC2A 4MJSB 3V61A 3ZIMA 5FR6A 4TKNA 2JT4B 3KYDD 4W9CA 1WR1A 1WX8A 4X57B 2MP2A 4PS8A 3IBEA 4A3OA 1OTRB 2L0FA 3PRMB 2GBJA 2N7EA 2KO3A 4RM9A 4BOSC 2J0JA 1P0RA 2RGFA 4W9JA 2J0KA 3L0WB 2IO0B 3VAWA 2K6QA 2KNBA 1J0GA 2KMAA 1WM2A 3V6EB 3VUYA 1V2YA 2I1JA 1P3QU 4B9KA 4BKSD 4DDID 3K9OB 3Q3JA 3PRZA 3UF8A 2REXA 3M62B 3DVNV 5IA7A 4FN2A 5AZFA 1E7VA 2XBBC 4I6PA 1LM8B 3H9DA 2NBUA 4HK2A 2C5LC 3T8MA 2FCSA 3T9LA 1TBEA 4XZ4A 4GN1A 4XX5A 3GOEA 5J17A 1R4MI 3HHMA 1E8XA 1WE6A 2J7QB 2N9PC 4KSLC 3Q3FA 3KUZA 5CHVC 3CSTA 3A9JB 4ASWC 4FADA 4EOYA 2G3QB 2HD5B 3S2AA 1RAXA 2DYMA 3U30A 4MEMA 3ZTDA 2JUOA 3PLUA 4DHJD 3VVWB 3OJ3A 2MP2B 2CHWA 3DBLI 4M8NA 2VRRB 1OGWA 1SE9A 4PYZA 2BYEA 4JLCA 2CS4A 2IY1B 2K8HA 2PE9A 1WH3A 3HM6X 3VHTC 4FBJB 3QK0A 3ML9A 3ZDTA 2KX0A 1YX6B 2JZ3B 2K6DB 2MA9B 2MBHA 4MSQB 3ONSA 4NNJB 1KLVA 2EMSA 2KWUB 4RMAA 3TBLD 2DZKA 5CHFA 3LDZE 3QJZA 2MBBB 4DHZE 2D07B 4K7UA 3VTUA 2JWZA 3NHEB 4ANWA 2YLMA 4GDKA 2O6VD 3DVGY 3JVZX 4AJYB 3ZDMC 2KXJA 4EZJA 4G0NB 5C1ZA 3K9PB 1A5RA 2CHZA 3ML8A 3PZDA 2ZPNA 3R7RA 2Y5BB 1X1MA 2DHZA 4NPNA 3C0RB 4IC7B 3ZTCA 4HCPB 3NS8A 1V80A 1WGYA 2GBNA 3OLMD 3HIZA 1RFAA 3W1SA 3AI5A 1Z2MA 1GJZA 4WJQA 4ZDVA 2K8CA 2KDFB 4A3PA 1XD3B 1V5TA 4HLEA 3A4SC 2C7MB 4MH0E 3NZSA 2ZCBA 2OJRA 3LJ3A 4HVBA 3L08A 2IZVB 3HM3A 4IUMB 4LJPB 4TUUA 3SU8X 4IM2A 3ECIA 1WGHA 3TMPB 1TTNA 1WRDB 2IY0B 2KX3A 3APFA 1BT0A 2KFKB 1P1AA 4IG7B 3SD5A 4DHZB 4KDLB 1D3ZA 3PRPB 3ZNZB 4ICUA 3MJWA 4MGZE 3VH4B 1GG3A 2BF8B 2HJ8A 2WDTB 1M94A 1WY8A 2IYDB 5AEKB 3TL5A 4ANUA 3UGBB 2NBVB 3DBHI 5E6PA 3R3MA 3NY5A 4FJVB 3V60A 2C7HA 4GDKB 1IPGA 2KWVB 5DPSA 4P7IA 3GZNI 4JIOU 2ZNVB 4FULA 4GSWA 2D11A 2BKFA 3ENEA 4FHKA 5JHAA 2LVPA 2XK5B 3QIJA 5L95C 4N9F4 2ZVNA 3QC8B 3ZRCA 2FUHB 3UINB 2WX0A 2IO1B 3PPAA 4I6NB 4KVGB 4BOZB 2WX1A 1WZ0A 1YJ1A 3PS6A 5EDSA 3M3JA 1Q1OA 4GGQA 3ZKJC 4DBGA 3SDLC 2KJ6A 2GBMA 5D94A 4EUTA 3DBSA 3VUWA 1E8WA 2C7NB 1E8ZA 4W9LA 1J19A 2MX2A 1WXSA 2NPTB 2PPHA 3IVFA 1YD8U 4BKSA 4NAWA 1SGHA 2C9WB 2KVRA 4W9HA 3UIOB 2R2OA 3RT3B 3H1UA 3UQAA 1OEYA 4BFRA 4F1SA 1EF5A 1OEYJ 1WE7A 2I1KA 2KD0A 2LASA 2M1MA 3EECA 3N32A 4WWNA 5E6NA 4B95A 3RZFA 1LQBA 1Q0WB 2D10A 2ZPYA 4AJWA 2NVUI 4AWJA 4TV3A 2M17A 2NR2A 2ZEQA 3IG3A 4CYEA 2KKCA 2AL6A 2GMIC 5D6JB 2JY6A 4OVUA 4IWOA 4RM8A 5LLIA 2JZZA 4MSMB 1WX9A 1UGMA 3DCGA 3X23A 3AULA 2KJHB 1WZ3A 2FIDA 2IO3B 2KQSA 4CO7A 4K7WA 3V6CB 4A20A 3MHSD 4AOFA 2L8JA 3A9KA 3VFKA 2LWPA 4LDTD 1WMHA 2Z59B 4K7SA 4MELA 4KDIC 3RD2A 2MSED 1E90A 2G45B 1C1YB 3WAMA 4ANXA 2FIFA 2KDBA 2IBIB 4F8CB 1E7UA 5DCNA 3QAQA 1WF9A 2MRPA 5G2NA 5KHOA 3DVNU 2EKEC 5J2RA 4E3CA 4KV2A 5CTRC 3WANA 1S1QB 3ZNHB 5G55A 3DPDA 4W9GA 3UIPB 2KFKA 4I6LB 2O6VA 1E5WA 2LXCA 2DZMA 2O2VA 4NAWB 2N4FA 2AYOB 1Y8RC 2UWQA 1Z5SB 2KJRA 1NBFC 4WWOA 1ISNA 2NCNA 3PGEA 1V86A 4MGIE 2N9EB 4HXDA 2R2QA 4WJOA 4JL9A 4NQLB 4E71A 1YX5B 2K8BA 3DVGX 3RULA 2LVQA 2DX5B 1XT9B 4LDTB 4KSKC 1GC7A 5J18A 4BBNC 2LI5A 4GB9A 2XK5A 1NI2A 2MBQA 4IW0A 1SIFA 3ZRFA 3JSVA 3QARA 3H7PA 3ZLZA 4DHJB 2HTHA 3A9KB 2ZNVC 1J8CA 4KZCA 3M95A 3QA8A 4GOCA 1WFYA 1WMHB 2N1VA 3WAPA 2OOBB 4ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G3X B;  2L76 A;  2KMC A;  4AP4 C;  2KZR A;  3QHT A;  2XEW A;  4ZYN A;  2KK8 A;  2AL3 A;  2NPT A;  2WYQ A;  3PT2 B;  2DEN B;  2L3Z A;  3VH3 B;  4LJO B;  3W1S C;  3AU5 A;  2KTR A;  3M63 B;  5AZG A;  2LZ6 A;  2DAJ A;  4HJK A;  3IFW B;  1WXA A;  2O6V B;  4K81 A;  4FLH A;  3ZW3 A;  3B1L X;  2CKH B;  2NS5 A;  2O2V B;  5CX3 A;  1WYW B;  2LD9 A;  4NQK E;  5LXH A;  1KOT A;  4HPL B;  2FCN A;  2LRU A;  2ZJD A;  3U8Z A;  2K39 A;  5D2M B;  5JH5 C;  2N1W A;  1WR6 E;  2NBW B;  2K1F A;  2AWT A;  4FJZ A;  2JF5 A;  4AUQ C;  4WWP A;  1NDD A;  2A5U A;  2L05 A;  4GU2 A;  2IO2 B;  3PSE B;  3PHW B;  4NJ7 A;  1RLF A;  5DPT A;  4GMV A;  4W9I A;  2BPS A;  3VTV A;  1LXD A;  3UQB A;  5E6O A;  4WAA A;  4W9K A;  1LFD A;  2GOW A;  2ZCC A;  4M0W B;  2L0T A;  2D2Q A;  3ZNI D;  3JSV B;  3H7P B;  3HK0 A;  2G4S A;  2DZJ A;  3A1Q B;  3PLV A;  3CMM B;  2KDE B;  4NJ6 A;  1OQY A;  1S3S G;  2WWZ A;  3RZW C;  1KJT A;  1E8Y A;  2FCQ A;  3QQ8 B;  2JPH A;  4BVU C;  1HE8 A;  1ZW7 A;  3PHX B;  3VXW A;  4KZ0 A;  4MGY E;  2D3G A;  2GBR A;  4TQ0 A;  1UD7 A;  3APC A;  3L10 B;  3L16 A;  4WJP A;  4DXA B;  3TJP A;  3TIX A;  4TQ1 A;  1KM7 A;  2LGD A;  2ASQ A;  2BKR B;  2YVC A;  2KTR B;  4IWP A;  1V81 A;  4LCD E;  1AAR A;  2G4D B;  3QX1 A;  4GIV A;  4EFO A;  2GBK A;  3ZNG C;  4K1R B;  3WA0 A;  2RD0 A;  2BYF A;  4BKT A;  2L7R A;  2BGF A;  5L83 A;  2QHO A;  5TR5 A;  1T0Y A;  3EFU A;  3O65 B;  1L2N A;  3KH0 A;  1V49 A;  1VD2 A;  3QWZ B;  4ANV A;  1I35 A;  5HKH A;  2KDI A;  2C60 A;  2DAF A;  1UBQ A;  3EC8 A;  1EO6 A;  4F7Z A;  3NZU A;  3AU4 A;  1IP9 A;  2L00 B;  2RSU A;  4W9D A;  3WIM A;  4ZRJ A;  2J0M A;  2W9N A;  3JYU A;  1UH6 A;  3BIN A;  2PEA A;  1WIA A;  4PS3 A;  1ZKH A;  3CF6 E;  1WJ4 A;  2N7D A;  3DOW A;  3W1Y A;  4G11 A;  3N30 A;  4IWQ A;  1V5O A;  2HE7 A;  4OVV A;  2KFJ A;  2JRH A;  2JVC A;  2LVO A;  3ALB A;  1Q5W B;  1UBI A;  1GC6 A;  1F9J A;  4KIK A;  1YIW A;  2ZVO A;  5IAA C;  1C3T A;  1JRU A;  5JHB A;  2MBE A;  3VTW A;  1GNU A;  4EZL A;  2V1Y A;  5CHW A;  2N9X A;  4E74 A;  2KLC A;  3QCA A;  2KTF A;  1H8C A;  1WX7 A;  1WJ6 A;  2LJ5 A;  2MLB A;  3ZUN A;  5D7G A;  1QZE A;  3EHV A;  3I3T B;  3KUC B;  2JXX A;  4II3 B;  4ICV A;  2DYO A;  1WM3 A;  3AXC A;  2KN5 A;  4JQW C;  1WJU A;  2MBO A;  3KUD B;  1TZ1 A;  1MG8 A;  2M8S A;  2KLG A;  3A33 B;  2RR9 A;  3PTF C;  3R66 C;  4IM3 A;  4WQO B;  2FAZ A;  4EZK A;  2MWS B;  1I42 A;  2K25 A;  2KC1 A;  1TGZ B;  2PJH A;  2B3A A;  2MW5 A;  4GDL A;  1L7Y A;  3RYT A;  4EKU A;  1WGD A;  3DDC B;  2LGX A;  4HDQ A;  2Z0D B;  2CU1 A;  2LUE A;  4G50 A;  1UEL A;  3A1Q A;  1V9J A;  4GXB A;  5AZH A;  2KAN A;  3RCZ A;  5BO4 B;  1RRB A;  3JW0 X;  3A4R A;  1EF1 A;  2CHX A;  4M8M A;  2UYZ B;  3BY4 B;  4II2 B;  1G6J A;  3DQV A;  1V6E A;  2KQ7 A;  2LRW A;  4J6I A;  1VCB A;  2M4N A;  3L13 A;  3N3K B;  1YQB A;  3VDZ A;  4FHJ A;  4KIK B;  4MM3 A;  2AEH A;  4PS7 A;  2V4L A;  4HCN B;  2MCN B;  5GMV A;  4HPM B;  4B6W A;  4MGK E;  1WGG A;  5C23 A;  4BBN F;  3ZO5 B;  2DZI A;  4W9E A;  2CR5 A;  4YL8 A;  1H4R A;  3NOB A;  4MJS A;  3TCA A;  4URK A;  3R7Q A;  4W9F A;  2BYV E;  4HWI B;  1PQS A;  4ZRK A;  4IM0 A;  1WI0 A;  3KW5 B;  2BWF A;  5DPR A;  3L54 A;  3CSF A;  2LGY A;  2KHW B;  1K8R B;  3B0A A;  3V62 A;  1EUV B;  3D32 A;  3WAL A;  1P9D U;  4EEW A;  3APD A;  4DK5 A;  2RPQ A;  4CHK A;  3PVL A;  3IHP C;  2BWE S;  2M0X A;  2V3S A;  2FCM A;  4GDL B;  3SHQ A;  3OJ4 B;  3H6N A;  1WXM A;  3KVF B;  4HDO A;  3H7S A;  5DPW A;  2LXA A;  3DBR I;  1P98 A;  4NY0 A;  1ZGU B;  2FNJ B;  2KC2 A;  3ZVV A;  1WGR A;  1CMX B;  3KYC D;  4JGH B;  1GUA B;  3VUX A;  1U4A A;  2KOX A;  1WXV A;  4FJY A;  3MTN B;  3RUI B;  3U7D A;  4WJN A;  2Z0E B;  2A4Z A;  4DDG D;  4FA6 A;  2MQJ A;  4BKG A;  3PRE A;  5LXI B;  3L17 A;  1WJN A;  4MDK E;  1FXT B;  2DYB A;  1R4N I;  2KWC A;  1IYF A;  4DWF A;  3OAW A;  4PYU A;  2EMT A;  2JRI B;  3X0W A;  1UZX B;  3WAO A;  2ZZP B;  2PE6 B;  3A9J A;  3PV1 A;  5JZE B;  5KHQ A;  3B08 A;  3P2B A;  3VQI A;  1XQQ A;  4XC2 A;  4MJS B;  3V61 A;  3ZIM A;  5FR6 A;  4TKN A;  2JT4 B;  3KYD D;  4W9C A;  1WR1 A;  1WX8 A;  4X57 B;  2MP2 A;  4PS8 A;  3IBE A;  4A3O A;  1OTR B;  2L0F A;  3PRM B;  2GBJ A;  2N7E A;  2KO3 A;  4RM9 A;  4BOS C;  2J0J A;  1P0R A;  2RGF A;  4W9J A;  2J0K A;  3L0W B;  2IO0 B;  3VAW A;  2K6Q A;  2KNB A;  1J0G A;  2KMA A;  1WM2 A;  3V6E B;  3VUY A;  1V2Y A;  2I1J A;  1P3Q U;  4B9K A;  4BKS D;  4DDI D;  3K9O B;  3Q3J A;  3PRZ A;  3UF8 A;  2REX A;  3M62 B;  3DVN V;  5IA7 A;  4FN2 A;  5AZF A;  1E7V A;  2XBB C;  4I6P A;  1LM8 B;  3H9D A;  2NBU A;  4HK2 A;  2C5L C;  3T8M A;  2FCS A;  3T9L A;  1TBE A;  4XZ4 A;  4GN1 A;  4XX5 A;  3GOE A;  5J17 A;  1R4M I;  3HHM A;  1E8X A;  1WE6 A;  2J7Q B;  2N9P C;  4KSL C;  3Q3F A;  3KUZ A;  5CHV C;  3CST A;  3A9J B;  4ASW C;  4FAD A;  4EOY A;  2G3Q B;  2HD5 B;  3S2A A;  1RAX A;  2DYM A;  3U30 A;  4MEM A;  3ZTD A;  2JUO A;  3PLU A;  4DHJ D;  3VVW B;  3OJ3 A;  2MP2 B;  2CHW A;  3DBL I;  4M8N A;  2VRR B;  1OGW A;  1SE9 A;  4PYZ A;  2BYE A;  4JLC A;  2CS4 A;  2IY1 B;  2K8H A;  2PE9 A;  1WH3 A;  3HM6 X;  3VHT C;  4FBJ B;  3QK0 A;  3ML9 A;  3ZDT A;  2KX0 A;  1YX6 B;  2JZ3 B;  2K6D B;  2MA9 B;  2MBH A;  4MSQ B;  3ONS A;  4NNJ B;  1KLV A;  2EMS A;  2KWU B;  4RMA A;  3TBL D;  2DZK A;  5CHF A;  3LDZ E;  3QJZ A;  2MBB B;  4DHZ E;  2D07 B;  4K7U A;  3VTU A;  2JWZ A;  3NHE B;  4ANW A;  2YLM A;  4GDK A;  2O6V D;  3DVG Y;  3JVZ X;  4AJY B;  3ZDM C;  2KXJ A;  4EZJ A;  4G0N B;  5C1Z A;  3K9P B;  1A5R A;  2CHZ A;  3ML8 A;  3PZD A;  2ZPN A;  3R7R A;  2Y5B B;  1X1M A;  2DHZ A;  4NPN A;  3C0R B;  4IC7 B;  3ZTC A;  4HCP B;  3NS8 A;  1V80 A;  1WGY A;  2GBN A;  3OLM D;  3HIZ A;  1RFA A;  3W1S A;  3AI5 A;  1Z2M A;  1GJZ A;  4WJQ A;  4ZDV A;  2K8C A;  2KDF B;  4A3P A;  1XD3 B;  1V5T A;  4HLE A;  3A4S C;  2C7M B;  4MH0 E;  3NZS A;  2ZCB A;  2OJR A;  3LJ3 A;  4HVB A;  3L08 A;  2IZV B;  3HM3 A;  4IUM B;  4LJP B;  4TUU A;  3SU8 X;  4IM2 A;  3ECI A;  1WGH A;  3TMP B;  1TTN A;  1WRD B;  2IY0 B;  2KX3 A;  3APF A;  1BT0 A;  2KFK B;  1P1A A;  4IG7 B;  3SD5 A;  4DHZ B;  4KDL B;  1D3Z A;  3PRP B;  3ZNZ B;  4ICU A;  3MJW A;  4MGZ E;  3VH4 B;  1GG3 A;  2BF8 B;  2HJ8 A;  2WDT B;  1M94 A;  1WY8 A;  2IYD B;  5AEK B;  3TL5 A;  4ANU A;  3UGB B;  2NBV B;  3DBH I;  5E6P A;  3R3M A;  3NY5 A;  4FJV B;  3V60 A;  2C7H A;  4GDK B;  1IPG A;  2KWV B;  5DPS A;  4P7I A;  3GZN I;  4JIO U;  2ZNV B;  4FUL A;  4GSW A;  2D11 A;  2BKF A;  3ENE A;  4FHK A;  5JHA A;  2LVP A;  2XK5 B;  3QIJ A;  5L95 C;  4N9F 4;  2ZVN A;  3QC8 B;  3ZRC A;  2FUH B;  3UIN B;  2WX0 A;  2IO1 B;  3PPA A;  4I6N B;  4KVG B;  4BOZ B;  2WX1 A;  1WZ0 A;  1YJ1 A;  3PS6 A;  5EDS A;  3M3J A;  1Q1O A;  4GGQ A;  3ZKJ C;  4DBG A;  3SDL C;  2KJ6 A;  2GBM A;  5D94 A;  4EUT A;  3DBS A;  3VUW A;  1E8W A;  2C7N B;  1E8Z A;  4W9L A;  1J19 A;  2MX2 A;  1WXS A;  2NPT B;  2PPH A;  3IVF A;  1YD8 U;  4BKS A;  4NAW A;  1SGH A;  2C9W B;  2KVR A;  4W9H A;  3UIO B;  2R2O A;  3RT3 B;  3H1U A;  3UQA A;  1OEY A;  4BFR A;  4F1S A;  1EF5 A;  1OEY J;  1WE7 A;  2I1K A;  2KD0 A;  2LAS A;  2M1M A;  3EEC A;  3N32 A;  4WWN A;  5E6N A;  4B95 A;  3RZF A;  1LQB A;  1Q0W B;  2D10 A;  2ZPY A;  4AJW A;  2NVU I;  4AWJ A;  4TV3 A;  2M17 A;  2NR2 A;  2ZEQ A;  3IG3 A;  4CYE A;  2KKC A;  2AL6 A;  2GMI C;  5D6J B;  2JY6 A;  4OVU A;  4IWO A;  4RM8 A;  5LLI A;  2JZZ A;  4MSM B;  1WX9 A;  1UGM A;  3DCG A;  3X23 A;  3AUL A;  2KJH B;  1WZ3 A;  2FID A;  2IO3 B;  2KQS A;  4CO7 A;  4K7W A;  3V6C B;  4A20 A;  3MHS D;  4AOF A;  2L8J A;  3A9K A;  3VFK A;  2LWP A;  4LDT D;  1WMH A;  2Z59 B;  4K7S A;  4MEL A;  4KDI C;  3RD2 A;  2MSE D;  1E90 A;  2G45 B;  1C1Y B;  3WAM A;  4ANX A;  2FIF A;  2KDB A;  2IBI B;  4F8C B;  1E7U A;  5DCN A;  3QAQ A;  1WF9 A;  2MRP A;  5G2N A;  5KHO A;  3DVN U;  2EKE C;  5J2R A;  4E3C A;  4KV2 A;  5CTR C;  3WAN A;  1S1Q B;  3ZNH B;  5G55 A;  3DPD A;  4W9G A;  3UIP B;  2KFK A;  4I6L B;  2O6V A;  1E5W A;  2LXC A;  2DZM A;  2O2V A;  4NAW B;  2N4F A;  2AYO B;  1Y8R C;  2UWQ A;  1Z5S B;  2KJR A;  1NBF C;  4WWO A;  1ISN A;  2NCN A;  3PGE A;  1V86 A;  4MGI E;  2N9E B;  4HXD A;  2R2Q A;  4WJO A;  4JL9 A;  4NQL B;  4E71 A;  1YX5 B;  2K8B A;  3DVG X;  3RUL A;  2LVQ A;  2DX5 B;  1XT9 B;  4LDT B;  4KSK C;  1GC7 A;  5J18 A;  4BBN C;  2LI5 A;  4GB9 A;  2XK5 A;  1NI2 A;  2MBQ A;  4IW0 A;  1SIF A;  3ZRF A;  3JSV A;  3QAR A;  3H7P A;  3ZLZ A;  4DHJ B;  2HTH A;  3A9K B;  2ZNV C;  1J8C A;  4KZC A;  3M95 A;  3QA8 A;  4GOC A;  1WFY A;  1WMH B;  2N1V A;  3WAP A;  2OOB B;  4ZRI A; 
#chains in the Genus database with same CATH topology
 1PGB A;  4G3X B;  3B2F A;  3QHT A;  3V05 A;  1D5X C;  2QC8 A;  3W1S C;  2KTR A;  3Q3O C;  1WGK A;  2LZ6 A;  4C7Z A;  4HJK A;  3IT6 B;  1WXA A;  1QQR A;  2O6V B;  3IT4 B;  3B1L X;  2NS5 A;  2O2V B;  2LD9 A;  4NQK E;  2FCN A;  3U8Z A;  4A90 A;  2AWT A;  2JF5 A;  4AUQ C;  3GB1 A;  2IO2 B;  1KF6 B;  1N61 A;  3Q69 A;  3Q3M C;  4W9I A;  1J7C A;  1LXD A;  4W9K A;  2GOW A;  3NVY A;  2ACZ B;  3A1Q B;  2KDE B;  3RZW C;  1QOB A;  1ZW7 A;  3PHX B;  3VXW A;  1ET6 A;  3APC A;  3NG0 A;  2KYW A;  2QCZ A;  2QSD A;  2YVC A;  4IWP A;  1V81 A;  4LCD E;  1F77 A;  2G4D B;  3QX1 A;  3WA0 A;  2RD0 A;  2BGF A;  2QHO A;  4D2K A;  2V3N A;  3O65 B;  5IOI A;  1V49 A;  4ANV A;  4C00 A;  1I35 A;  5HKH A;  2JQR B;  1T5X D;  4ACF A;  4HKQ A;  1IP9 A;  4OZB A;  2RSU A;  4ZRJ A;  1UH6 A;  2MJD A;  2PEA A;  4PS3 A;  3CF6 E;  2HE7 A;  4OVV A;  3W9C B;  3ALB A;  1PFD A;  2GB1 A;  1F9J A;  4XDC A;  4PK1 A;  1JRU A;  5JHB A;  1DGJ A;  1LO5 D;  4EZL A;  5CHW A;  4E74 A;  1H8C A;  2LJ5 A;  3ZUN A;  4ICV A;  3BK2 A;  1XXG A;  1NEK B;  1MG8 A;  2QEJ C;  3AEB B;  3DHI C;  2KLG A;  3R66 C;  1YN5 A;  2K25 A;  2K0P A;  2PJH A;  1TGZ B;  3RNG C;  2I2Y A;  3DDC B;  2LGX A;  4HDQ A;  4A55 A;  1TY0 A;  1E6E B;  2KAN A;  3EFC A;  4M8M A;  1TKE A;  2BB5 A;  1G6J A;  1V6E A;  4XYC A;  1AW7 A;  1VCB A;  1EU3 A;  3VDZ A;  2AEH A;  5H8Y E;  3I9V 1;  4HCN B;  2BB6 A;  5H92 C;  2WLB A;  2MCN B;  1B9R A;  4HPM B;  1UWX A;  4B6W A;  4JX1 C;  1WGG A;  2CR5 A;  4J3O D;  1I4H A;  1PQS A;  5DPR A;  2KHW B;  1K8R B;  1EUV B;  2KWD A;  4EEW A;  2WXN A;  3APD A;  4DK5 A;  1TS2 A;  3E56 A;  4GDL B;  3OJ4 B;  5DPW A;  3DBR I;  3EGR A;  3R2I A;  2LHE A;  2KC2 A;  2FNJ B;  1WGR A;  3PZ7 A;  3VUX A;  4FJY A;  3RUI B;  2Z0E B;  2A4Z A;  4FA6 A;  1CQV A;  3PRE A;  5LXI B;  2JYT A;  1R4N I;  4XWT A;  4PYU A;  1UZX B;  1E10 A;  5BYR A;  5KHQ A;  4XC2 A;  1TY2 A;  5FR6 A;  4TKN A;  2L83 A;  2YEP B;  3AM9 A;  3NVW A;  3NRZ A;  1GB4 A;  5HI1 A;  1I4Q A;  4BOS C;  4ARI A;  2KO3 A;  1Y56 A;  2CJO A;  3VAW A;  2SAK A;  2MHJ A;  3B9J A;  3V6E B;  4OVZ A;  1V2Y A;  5G5H A;  1T0Q C;  4BKS D;  4DDI D;  1RYJ A;  3K9O B;  3AEF B;  3UF8 A;  2REX A;  3DVN V;  4FN2 A;  4I6P A;  2NBU A;  4HK2 A;  2PKO A;  1TBE A;  4XX5 A;  5J17 A;  1AN8 A;  1WE6 A;  2JZP A;  2N9P C;  3ZYY X;  1AWD A;  3AE5 B;  3IAS 1;  4RGM A;  3C19 A;  5C3J B;  2OED A;  4JWS C;  2WXH A;  4EOY A;  4OZA A;  4MEM A;  3ZTD A;  3PLU A;  2VH2 A;  3VVW B;  3OG5 A;  2VRR B;  4YSZ B;  4PYZ A;  1V1O A;  1WH3 A;  4FBJ B;  3ML9 A;  4LNO A;  3URY A;  1SEB D;  4MSQ B;  3ONS A;  4NNJ B;  1KLV A;  3T3O A;  2EMS A;  4RMA A;  4HRS A;  4XE0 A;  4DHZ E;  4LNF A;  3JVZ X;  3DVG Y;  4AJY B;  1FM0 D;  1A5R A;  2X8X X;  2V4I B;  4NJC A;  3R7R A;  2Y5B B;  3N1X C;  1ZDX A;  4S0R A;  4NPN A;  5I4D A;  3LYY A;  1DYQ A;  2BS3 B;  2ON8 A;  4HLE A;  3RNF C;  2GI9 A;  1AYF A;  4YTP B;  2IZV B;  4TUU A;  3N20 C;  1TTN A;  2IY0 B;  2KX3 A;  2QMT A;  1BT0 A;  2KFK B;  2WXQ A;  1RWS A;  3TEW A;  3ZNZ B;  3AEC B;  1BML C;  3NZ3 A;  3UGB B;  5E6P A;  4KX6 B;  2C7H A;  2ZW0 A;  4P7I A;  2DLB A;  1ZPS A;  2G1E A;  1XF5 L;  3ZQ4 A;  4ARC A;  4JIO U;  4GSW A;  2D11 A;  2BKF A;  3ENE A;  5JHA A;  2XK5 B;  4N9F 4;  3ZRC A;  1YN3 A;  3UIN B;  2WX0 A;  3I57 A;  3PPA A;  4I6N B;  3SR6 A;  5EDS A;  2VH1 A;  4GGQ A;  4DBG A;  1HXY D;  3DBL B;  4LLG M;  1V1P B;  1E8Z A;  2LFI A;  1IGC A;  3CWI A;  2PPH A;  1WXS A;  1Q10 A;  4BKS A;  1YD8 U;  4NAW A;  2KQ4 X;  2JU6 X;  3PO0 A;  1OEY J;  4US9 A;  1SXT A;  3RZF A;  1Q0W B;  4N59 A;  2NVU I;  4AWJ A;  2NR2 A;  3RPF C;  2JY6 A;  3Q2A C;  4OVU A;  2ICI A;  3C8Y A;  4RM8 A;  1LGR A;  5LLI A;  2JZZ A;  5EE0 A;  3HVD A;  3X23 A;  1QOG A;  1BUI C;  2KJH B;  1F0Z A;  4K7W A;  3MHS D;  3A9K A;  3U2S C;  4AQ7 A;  3RD2 A;  2L1A A;  4ANX A;  2FIF A;  1FNV A;  3DVN U;  3SFD B;  3UIP B;  2E6X A;  1KLU D;  4C4V A;  3ZGZ A;  2N4F A;  1Z5S B;  2KJR A;  1B1Z A;  2H88 B;  4TMA B;  4WWO A;  3Q8C A;  2NCN A;  1FRD A;  4MGI E;  2N9E B;  4JL9 A;  1BXT A;  1P7F A;  2K8B A;  3DVG X;  2W55 A;  4KSK C;  4XDD A;  4YT0 B;  4BBN C;  4GB9 A;  1XO3 A;  2LI5 A;  1NI2 A;  3QAR A;  4DHJ B;  4WWM A;  4A9A A;  3M95 A;  1WFY A;  1WMH B;  1ZOY B;  2OOB B;  4AP4 C;  2W3R A;  4ZYN A;  1NVI D;  5LNK 1;  2WYQ A;  2NPT A;  1KFY B;  2IGG A;  3RMK C;  3VH3 B;  2IPK D;  4LJO B;  5AZG A;  2DAJ A;  1MVK A;  3ZW3 A;  4A8X C;  3BYT B;  1WYW B;  3TSS A;  5LXH A;  1KOT A;  1R7S A;  4HPL B;  5JH5 C;  4HJG E;  2ZJD A;  2N1W A;  5G5G A;  1WWT A;  1NDD A;  1R4M B;  4GU2 A;  3PSE B;  3PHW B;  2WXP A;  3LXF A;  5IKC M;  2G9H D;  3VTV A;  2AQ3 B;  3UQB A;  2WDR B;  2L0T A;  3W2D A;  4H2A A;  3ZNI D;  3JSV B;  3EUB 2;  3HK0 A;  1UUP A;  2G4S A;  2DZJ A;  3CMM B;  5BMG A;  2WWZ A;  1ZXI A;  4YSY B;  2JPH A;  4TQ0 A;  1EM7 A;  3TIX A;  1ROE A;  2ASQ A;  2JSV X;  2EKI A;  4JE3 B;  2GBK A;  3ZNG C;  1QOA A;  2L7R A;  1XCT L;  5TR5 A;  1T0Y A;  1NEN B;  1VD2 A;  1ENF A;  1KTK A;  4KGR A;  1FFU A;  3AU4 A;  1TKG A;  2W9N A;  5D3I B;  1WJ4 A;  2H89 B;  3DOW A;  4G11 A;  2KDM A;  1UBI A;  2NMQ A;  3FKY A;  1YIW A;  1VLB A;  2ZVO A;  5IAA C;  1C3T A;  1F2R I;  2MBE A;  3VTW A;  1GNU A;  2KLC A;  1UGJ A;  3QCA A;  3BVM A;  1ZXH A;  3FC4 A;  2IDY A;  2MLB A;  3AN1 A;  2FUG 1;  3J9C A;  4IOI E;  1OQQ A;  2BYT A;  3AXC A;  2MBO A;  5IN7 A;  2M8S A;  4RNA A;  1I4G A;  4IM3 A;  2RR9 A;  4EZK A;  2FAZ A;  2RDG A;  1FRR A;  2B3A A;  1ZP0 B;  1UEL A;  2WS3 B;  4GXB A;  5AZH A;  2K3U A;  5BO4 B;  1RRB A;  1EF1 A;  2CHX A;  4II2 B;  4J6I A;  2M4N A;  3L13 A;  1IUE A;  3AE3 B;  4KIK B;  4IDI A;  4MM3 A;  2B76 B;  3NS1 A;  2V4L A;  5HG2 A;  1F52 A;  5GMV A;  1VRA B;  4HEA 1;  2BTE A;  4MGK E;  1C76 A;  4W9E A;  1H4R A;  1YOV B;  4ZRK A;  1YJJ A;  2LGY A;  4M02 A;  3D32 A;  2RPQ A;  3PVL A;  3IHP C;  2FCM A;  3SHQ A;  3ETR A;  1VJK A;  1A70 A;  4HDO A;  1P98 A;  3ZVV A;  1VZ8 A;  2J52 A;  1CMX B;  4XGA B;  1GUA B;  2ZW1 A;  2KOX A;  1WXV A;  3MTN B;  3U7D A;  1N60 A;  4WJN A;  2MQJ A;  2Q5W D;  4IKG A;  2DYB A;  1NYR A;  1SE3 A;  2N0S B;  4DWF A;  3OAW A;  2JRI B;  3A9J A;  3B08 A;  3VQI A;  1JRO A;  4MJS B;  1ESF A;  2LUM A;  2QIE B;  1WX8 A;  2JYE A;  5D3D A;  3PRM B;  1FXI A;  4MAC A;  3AEG B;  3BVG A;  2RGF A;  1TS3 A;  3L0W B;  2KNB A;  1J0G A;  2KMA A;  4RF0 A;  2JX5 A;  2D3B A;  3VUY A;  2I1J A;  1T6B X;  3BYY B;  3VRB B;  3PRZ A;  4LNN A;  2V9H A;  2C5L C;  2FCS A;  4AS1 A;  4KSL C;  3Q3F A;  1VZ7 A;  4ASW C;  3S2A A;  3U30 A;  2JUO A;  2MP2 B;  4M8N A;  1SE9 A;  2PE9 A;  4YTN B;  1SE4 A;  2IJ0 A;  3DBR B;  3QK0 A;  2KX0 A;  2MBH A;  5HFY A;  1L6U A;  2KWU B;  5BYQ A;  2KN4 A;  2DZK A;  5CHF A;  3IXS A;  3HVZ A;  1SIJ A;  4L1B A;  2JWZ A;  4GDK A;  2O6V D;  3ZDM C;  2KXJ A;  4G0N B;  5C1Z A;  3K9P B;  2CHZ A;  1X1M A;  2W82 A;  1PGA A;  5IO9 A;  3NS8 A;  3KLS X;  3HIZ A;  1RFA A;  3W1S A;  3AI5 A;  1HQR D;  1K51 A;  4ZRQ A;  2PW9 A;  2K8C A;  2KDF B;  3RNB C;  1CJE A;  1V5T A;  1XD3 B;  3HM3 A;  4IUM B;  3ECI A;  1MHX A;  4P1C C;  3TMP B;  2M0A A;  4USA A;  1QKZ A;  3Q14 C;  3PRP B;  4DXG A;  4ICU A;  1I4P A;  4MGZ E;  3VH4 B;  2BF8 B;  1JML A;  4B0M A;  4REZ A;  2WXI A;  3GZN I;  4FUL A;  3WCQ A;  3VRA B;  5L95 C;  2ZVN A;  2FUH B;  4KVG B;  4BOZ B;  3P4P B;  1QLB B;  2N9K A;  3SDL C;  4HPP A;  2KJ6 A;  2C7N B;  3Q6B A;  4W9L A;  1N62 A;  2NPT B;  1FPY A;  4C56 C;  2NTT A;  4W9H A;  5BMI A;  3UQA A;  4BFR A;  2I1K A;  2KD0 A;  1JCK B;  3RNC C;  1LQB A;  4AJW A;  2ZPY A;  2AQ2 B;  2Y5P A;  3OWE B;  2GMI C;  5D6J B;  3AE8 B;  3V3X A;  1L5P A;  2LJI A;  4IWO A;  4MSM B;  1WX9 A;  1UGM A;  3Q3N C;  3AUL A;  1WZ3 A;  2FID A;  4AOF A;  4LDT D;  4HRO A;  2WDQ B;  3Q8B A;  5EE3 A;  4O1N A;  2IBI B;  5G2N A;  2MRP A;  2EKE C;  5J2R A;  4E3C A;  4KV2 A;  3WAN A;  2WXF A;  1S1Q B;  2WXL A;  1MG4 A;  2LGI A;  2O6V A;  1E5W A;  2LXC A;  2DZM A;  2O2V A;  1EWY C;  1Y8R C;  2UWQ A;  2JXT A;  2WHI A;  3FIL B;  1NBF C;  2V3P A;  1ZUD 2;  1ISN A;  3PGE A;  3P1M A;  1V86 A;  1T3Q A;  1MJD A;  4GLS C;  3BWU D;  2HJ1 A;  1F1H A;  1JWS D;  2VZK B;  3U7Z A;  1FXA A;  1FCC C;  2D5G A;  4NAM A;  2MBQ A;  2WXK A;  3AE4 B;  1E9M A;  3AH7 A;  3N1Y C;  1KLG D;  1TS5 A;  4GOC A;  3WAP A;  4ZRI A;  2DBY A;  3HRD D;  1V8C A;  2KZR A;  2XEW A;  2AX5 A;  3HUI A;  2AL3 A;  3CIR B;  2DEN B;  2WU2 B;  2L3Z A;  3AU5 A;  3M63 B;  4DQO C;  4RCO A;  1VDV A;  5CX3 A;  2K39 A;  5D2M B;  1WR6 E;  4FJZ A;  1L4D B;  2A5U A;  2L05 A;  4NJ7 A;  1RLF A;  1EU4 A;  1KH0 A;  2LMC A;  2BPS A;  2UU7 A;  1SJH D;  3AB5 A;  2YEP F;  1LFD A;  2ZCC A;  4M0W B;  2D2Q A;  3H7P B;  2J4X A;  3Q8E A;  4NJ6 A;  1OQY A;  2KAJ A;  3QQ8 B;  4BVU C;  4MGY E;  3EA6 A;  3L16 A;  3L10 B;  4LNI A;  1KM7 A;  2E3T A;  2LGD A;  1FD6 A;  2KTR B;  1L4Z B;  1AAR A;  2WXM A;  4EFO A;  2MH7 A;  5IP4 D;  4K1R B;  4BKT A;  2BYF A;  4L23 A;  5L83 A;  2IGH A;  3MHZ A;  3EFU A;  1L2N A;  3KH0 A;  2C60 A;  1TJE A;  4BZA A;  2DAF A;  1UBQ A;  1NYQ A;  1DOY A;  2WNM A;  4W9D A;  4KKI A;  4JWU C;  1YMH E;  2J0M A;  3JYU A;  3BIN A;  5FK9 C;  1ZKH A;  3W1Y A;  1K50 A;  1E0Z A;  1D6E C;  5FR3 A;  2JRH A;  1FNW A;  2JVC A;  1GC6 A;  3AEE B;  1ZE3 D;  2BS2 B;  4YTM B;  2V1Y A;  2N9X A;  2FBW B;  1YNT E;  3MP9 A;  4C80 A;  1C4P A;  3AE7 B;  1HEZ E;  1QZE A;  3I3T B;  4II3 B;  3ZJU A;  1WM3 A;  4JQW C;  3KUD B;  4JPS A;  4KKJ A;  1UWM A;  3A33 B;  3TUO A;  2INC C;  2OJW A;  2MW5 A;  4GDL A;  1L7Y A;  3RYT A;  1WGD A;  2Z0D B;  2CU1 A;  4G50 A;  1V9J A;  3RCZ A;  1C9F A;  2UYZ B;  3BY4 B;  3DQV A;  2LRW A;  2KQ7 A;  2WP9 B;  2CJN A;  3N3K B;  1YQB A;  1K53 A;  1N5X A;  3P63 A;  1TKY A;  4Q2J A;  5C23 A;  4BBN F;  2DZI A;  3TCA A;  4HWI B;  1OQR A;  3KW5 B;  1D4B A;  3MJ5 A;  3B0A A;  1P9D U;  2SEB D;  4CHK A;  2BWE S;  1YN4 A;  2V3S A;  2K5P A;  3PZ8 A;  1TT5 B;  3KWV A;  4N58 A;  5EE9 A;  2K22 A;  3H6N A;  3KVF B;  1RM6 C;  3H7S A;  2LXA A;  2D3C A;  3W5V B;  1JWA D;  4NY0 A;  1ZGU B;  1PUT A;  4JGH B;  1HZ5 A;  3KYC D;  2W54 A;  1HA5 A;  4WQM A;  1YJI A;  1YQ3 B;  2RDB C;  1CZP A;  2KVZ A;  3PV1 A;  1XQQ A;  3V61 A;  1XLN A;  3KYD D;  4W9C A;  3W5U B;  4X57 B;  4BAX A;  4PS8 A;  2L0F A;  1SB3 C;  4WAF A;  2GRI A;  4RM9 A;  2N7J A;  2J0J A;  2M56 B;  1P0R A;  4W9J A;  1WM2 A;  4M01 A;  1IBX A;  3NUH B;  3R8B A;  1MFW A;  1FNU A;  2KMM A;  3Q3J A;  5AZF A;  2XBB C;  2BVC A;  1LM8 B;  3H9D A;  3T8M A;  1L0V B;  5T8I A;  1I4X A;  2TSS A;  1R4M I;  2M19 A;  1V97 A;  2INP E;  1T0R C;  5CHV C;  4FAD A;  3BK1 A;  2HD5 B;  3I63 C;  1RAX A;  1OFF A;  4DHJ D;  3OJ3 A;  2CHW A;  1M4V A;  2BYE A;  3HM6 X;  2Z8L A;  2K6D B;  2MA9 B;  1K52 A;  1HZ6 A;  2PLP A;  1WYG A;  2RDH A;  2N9L A;  2MBB B;  1XLP A;  4K7U A;  3VTU A;  4RF1 A;  4ANW A;  2YLM A;  2OHF A;  1F2R C;  4EZJ A;  2K9X A;  3PZD A;  3VR9 B;  2ZPN A;  1ACC A;  3AMZ A;  4IC7 B;  5AUK A;  1V80 A;  1WGY A;  3OLM D;  1VZ6 A;  1Z2M A;  1GJZ A;  4ZDV A;  4A3P A;  3A4S C;  4YSX B;  3NZS A;  2ZCB A;  2OJR A;  3LJ3 A;  3SU8 X;  4IM2 A;  1QIL A;  1WGH A;  3APF A;  4IG7 B;  3TEX A;  3NVV A;  3ZJV A;  1D3Z A;  3AED B;  2RMM A;  3MJW A;  1GG3 A;  2HJ8 A;  2IYD B;  1FCL A;  2NBV B;  3DBH I;  2KWV B;  4FHK A;  2LVP A;  2J42 A;  2I38 A;  2MJ3 A;  3QC8 B;  3ZXV A;  3AV8 A;  1YJ1 A;  3PS6 A;  3M3J A;  1Q1O A;  4S17 A;  2GBM A;  5D94 A;  4EUT A;  3DBS A;  3VUW A;  4UDU C;  1UF0 A;  2Y5C A;  1SJE D;  3RN9 C;  1SGH A;  3RT3 B;  3H1U A;  1MHH E;  1OEY A;  4F1S A;  1EF5 A;  4WWN A;  2M1M A;  3EEC A;  5E6N A;  1TIF A;  4DXF A;  4MT5 A;  2W3S A;  1JAL A;  2M17 A;  3NVZ A;  3IG3 A;  1J7A A;  2KKC A;  4CYE A;  2AL6 A;  3T3N A;  2PVO D;  2IO3 B;  1JRP A;  4CO7 A;  4A20 A;  2LHD A;  2L8J A;  3VFK A;  1WMH A;  4LK0 M;  4MEL A;  4KDI C;  5GXG B;  1E90 A;  1C1Y B;  4F8C B;  5DCN A;  3TEY A;  3QAQ A;  1WF9 A;  5KHO A;  4B0E A;  1L0Y B;  4RGN A;  5CTR C;  1EWC A;  1PYW D;  3DWM A;  4I6L B;  3BII D;  1TYG B;  2J53 A;  4NAW B;  2AYO B;  2L32 A;  4NZL B;  2V0G A;  3AE1 B;  1FO4 A;  2CU3 A;  2KAC A;  4HXD A;  2R2Q A;  3GZN B;  4NQL B;  1D5M C;  4E71 A;  2BT6 A;  2LVQ A;  2DX5 B;  1XT9 B;  4LDT B;  1R4N B;  5J18 A;  4LNK A;  1I4R A;  1C4A A;  4ZYS A;  3GE8 C;  2LEK A;  4MH8 A;  2WGS A;  4YXD B;  3JSV A;  3UI3 A;  2HTH A;  3A9K B;  4US8 A;  1QT9 A;  3QA8 A;  1KRH A;  2N1V A;  2L76 A;  2KMC A;  1WXQ A;  4RFB A;  2KK8 A;  3PT2 B;  1P7E A;  3IFW B;  4K81 A;  4FLH A;  4C4V B;  2CKH B;  3U52 E;  1N63 A;  3P4S B;  2LRU A;  2NBW B;  3N1Z C;  2K1F A;  4ZOH C;  4WWP A;  4RH6 A;  5DPT A;  1PGX A;  4GMV A;  1CK1 A;  5E6O A;  4WAA A;  4N6E B;  4CQN A;  3PLV A;  3MC0 B;  1JWU D;  1S3S G;  1KJT A;  1E8Y A;  2FCQ A;  4LTU A;  4P6V F;  1HE8 A;  4KZ0 A;  2ONQ A;  2D3G A;  2GBR A;  1UD7 A;  3NJT A;  1VR9 A;  4WJP A;  4DXA B;  3TJP A;  4TQ1 A;  2BKR B;  3RNE C;  1GPX A;  4GIV A;  4TSS A;  2RPV A;  3QWZ B;  2KDI A;  3MFG A;  3EC8 A;  4F7Z A;  1EO6 A;  3NZU A;  2L00 B;  4P16 A;  3WIM A;  2XN9 C;  3TEZ A;  2BBC A;  1WIA A;  5AUI A;  2PVG C;  2N7D A;  1FEH A;  3N30 A;  2GLS A;  1V5O A;  4IWQ A;  2KFJ A;  2LVO A;  3GE3 C;  1Q5W B;  4A6Q A;  1UNS A;  5TSS A;  4KIK A;  1C79 A;  3DHG C;  2KTF A;  3SFE B;  1WX7 A;  1WJ6 A;  5D7G A;  3EHV A;  3KUC B;  2JXX A;  2DYO A;  2KN5 A;  1XLO A;  1WJU A;  2MEK A;  1TZ1 A;  2KT7 A;  2IND C;  3PTF C;  4WQO B;  1GAQ B;  2MWS B;  1I42 A;  2KC1 A;  3AE9 B;  4EKU A;  1QF6 A;  1L6V A;  1TZO A;  2LUE A;  3A1Q A;  1D5Z C;  3JW0 X;  1IBX B;  3A4R A;  4FXC A;  1L0X B;  2BS4 B;  4FHJ A;  4PS7 A;  2QDF A;  2WXO A;  4WUR A;  2WXR A;  3ZO5 B;  2WQY B;  2HTM E;  4YL8 A;  4MJS A;  3NOB A;  4URK A;  3R7Q A;  4W9F A;  1PDX A;  2MJE A;  2BYV E;  3DWG C;  3P4R B;  3P42 A;  4IM0 A;  1WI0 A;  2BWF A;  4RGT A;  4OZC A;  5BYS A;  3L54 A;  3CSF A;  3SEB A;  3V62 A;  3WAL A;  2PIA A;  2WDV B;  3I5J C;  2M0X A;  1WRI A;  2HDE A;  3O13 A;  3R2T A;  4EE2 A;  1WXM A;  1C4C A;  3RI7 C;  2PTL A;  3LB8 C;  1SF0 A;  1U4A A;  1XLQ A;  2X38 A;  3B2G A;  4DDG D;  3ZXR A;  3RFZ B;  4BKG A;  2QJL A;  1YQ4 B;  1I7H A;  3L17 A;  4MM3 B;  4XWW A;  1WJN A;  3AE6 B;  4MDK E;  1FXT B;  2D3A A;  2KWC A;  2AQ1 B;  4HKZ E;  1IYF A;  2EMT A;  3X0W A;  3WAO A;  2ZZP B;  2PE6 B;  5JZE B;  3P2B A;  3ZIM A;  2JT4 B;  4ZRP A;  1WR1 A;  2MP2 A;  3IBE A;  3AEA B;  4A3O A;  1OTR B;  1XCQ L;  2N7E A;  2GBJ A;  2LGS A;  2J0K A;  2IO0 B;  4KGS A;  2K6Q A;  5FKA C;  1C78 A;  3Q8A A;  1J7B A;  4L2Y A;  3IAM 1;  1P3Q U;  4B9K A;  2Y3A A;  4RGO S;  3M62 B;  5IA7 A;  1ZDV A;  1E7V A;  3T9L A;  1WSP A;  4XZ4 A;  4GN1 A;  3VR8 B;  1GOZ A;  3GOE A;  2DNF A;  3HHM A;  1E8X A;  3P4Q B;  2J7Q B;  5MPO A;  1RFK A;  2VZK D;  1MPE A;  1C77 A;  2NTS A;  3KUZ A;  1N6Z A;  3CST A;  3A9J B;  2G3Q B;  2BQQ A;  2DYM A;  3KWL A;  1FMA D;  1ET9 A;  3DBL I;  3ZJT A;  1OGW A;  3MC9 A;  4JLC A;  2CS4 A;  2IY1 B;  2K8H A;  3RNA C;  3VHT C;  1JQ4 A;  1HTO A;  1XEE A;  2DWQ A;  3ZDT A;  1YX6 B;  2JZ3 B;  5C2T B;  3TBL D;  3KQ4 A;  3LDZ E;  3QJZ A;  2EEL A;  2D07 B;  3NHE B;  4R3D A;  4C7Y A;  5E6J A;  3ML8 A;  4YWG G;  1NI3 A;  4M00 A;  2DHZ A;  3C0R B;  3ZTC A;  4HCP B;  2R61 A;  2GBN A;  4WIP A;  5BMH A;  4WJQ A;  1SSN A;  1E7P B;  2C7M B;  4MH0 E;  2WXG A;  4ITK A;  4HVB A;  3L08 A;  2PMV A;  4LJP B;  4OW0 A;  1WRD B;  3FAH A;  3E9S A;  2QIL A;  1P1A A;  3SD5 A;  4DHZ B;  4KDL B;  2BW2 A;  2WDT B;  1M94 A;  1WY8 A;  5AEK B;  4OHJ A;  3TL5 A;  4ANU A;  3GP7 A;  3BVZ A;  1JWB D;  3V60 A;  3R3M A;  2FE8 A;  3NY5 A;  4FJV B;  4GDK B;  1IPG A;  5DPS A;  4K3C A;  3MC8 A;  2ZNV B;  3U4E G;  2INN E;  2L52 A;  3QIJ A;  2IO1 B;  2WX1 A;  1WZ0 A;  1QOF A;  3ZKJ C;  3ABV B;  2WU5 B;  1E8W A;  3Q8F A;  1J19 A;  2MX2 A;  3IVF A;  3N9Y C;  2C9W B;  2KVR A;  3UIO B;  2R2O A;  1T0S C;  1IGD A;  3FIL A;  1WE7 A;  2LAS A;  3N32 A;  4B95 A;  3GS2 A;  2D10 A;  1SE2 A;  4TV3 A;  2ZEQ A;  5HHD G;  3BZD B;  1JWM D;  1JW9 D;  4QAY A;  1SBB B;  3DCG A;  2IGD A;  2KQS A;  3V6C B;  1DOX A;  4PT5 A;  2LWP A;  2Z59 B;  4K7S A;  2MSE D;  3AE2 B;  4KGT A;  2G45 B;  3WAM A;  2KDB A;  5EE1 A;  1E7U A;  2XNA C;  3ZNH B;  5JXV A;  2WXJ A;  5G55 A;  3H8H A;  3DPD A;  4W9G A;  2KFK A;  4ZHO A;  1GB1 A;  4K3B A;  2JWU A;  1HTQ A;  3DBH B;  4WJO A;  3DHH C;  3L4P A;  1YX5 B;  1FFV A;  3RUL A;  4P1B C;  1N5W A;  4WH4 A;  1TS4 A;  1FIQ A;  1GC7 A;  3ZRF A;  2XK5 A;  4IW0 A;  1SIF A;  4M0W A;  4ZHP A;  1DOI A;  3H7P A;  1MI0 A;  3ZLZ A;  2ZNV C;  1J8C A;  1STE A;  4KZC A;  1V1P A; 
#chains in the Genus database with same CATH homology
 4G3X B;  2L76 A;  2KMC A;  4AP4 C;  2KZR A;  3QHT A;  2XEW A;  4ZYN A;  2KK8 A;  2AL3 A;  2NPT A;  2WYQ A;  3PT2 B;  2DEN B;  2L3Z A;  3VH3 B;  4LJO B;  3W1S C;  3AU5 A;  2KTR A;  3M63 B;  5AZG A;  2LZ6 A;  2DAJ A;  4HJK A;  3IFW B;  1WXA A;  2O6V B;  4K81 A;  4FLH A;  3ZW3 A;  3B1L X;  2CKH B;  2NS5 A;  2O2V B;  5CX3 A;  1WYW B;  2LD9 A;  4NQK E;  5LXH A;  1KOT A;  4HPL B;  2FCN A;  2LRU A;  2ZJD A;  3U8Z A;  2K39 A;  5D2M B;  5JH5 C;  2N1W A;  1WR6 E;  2NBW B;  2K1F A;  2AWT A;  4FJZ A;  2JF5 A;  4AUQ C;  4WWP A;  1NDD A;  2A5U A;  2L05 A;  4GU2 A;  2IO2 B;  3PSE B;  3PHW B;  4NJ7 A;  1RLF A;  5DPT A;  4GMV A;  4W9I A;  2BPS A;  3VTV A;  1LXD A;  3UQB A;  5E6O A;  4WAA A;  4W9K A;  1LFD A;  2GOW A;  2ZCC A;  4M0W B;  2L0T A;  2D2Q A;  3ZNI D;  3JSV B;  3H7P B;  3HK0 A;  2G4S A;  2DZJ A;  3A1Q B;  3PLV A;  3CMM B;  2KDE B;  4NJ6 A;  1OQY A;  1S3S G;  2WWZ A;  3RZW C;  1KJT A;  1E8Y A;  2FCQ A;  3QQ8 B;  2JPH A;  4BVU C;  1HE8 A;  1ZW7 A;  3PHX B;  3VXW A;  4KZ0 A;  4MGY E;  2D3G A;  2GBR A;  4TQ0 A;  1UD7 A;  3APC A;  3L10 B;  3L16 A;  4WJP A;  4DXA B;  3TJP A;  3TIX A;  4TQ1 A;  1KM7 A;  2LGD A;  2ASQ A;  2BKR B;  2YVC A;  2KTR B;  4IWP A;  1V81 A;  4LCD E;  1AAR A;  2G4D B;  3QX1 A;  4GIV A;  4EFO A;  2GBK A;  3ZNG C;  4K1R B;  3WA0 A;  2RD0 A;  2BYF A;  4BKT A;  2L7R A;  2BGF A;  5L83 A;  2QHO A;  5TR5 A;  1T0Y A;  3EFU A;  3O65 B;  1L2N A;  3KH0 A;  1V49 A;  1VD2 A;  3QWZ B;  4ANV A;  1I35 A;  5HKH A;  2KDI A;  2C60 A;  2DAF A;  1UBQ A;  3EC8 A;  1EO6 A;  4F7Z A;  3NZU A;  3AU4 A;  1IP9 A;  2L00 B;  2RSU A;  4W9D A;  3WIM A;  4ZRJ A;  2J0M A;  2W9N A;  3JYU A;  1UH6 A;  3BIN A;  2PEA A;  1WIA A;  4PS3 A;  1ZKH A;  3CF6 E;  1WJ4 A;  2N7D A;  3DOW A;  3W1Y A;  4G11 A;  3N30 A;  4IWQ A;  1V5O A;  2HE7 A;  4OVV A;  2KFJ A;  2JRH A;  2JVC A;  2LVO A;  3ALB A;  1Q5W B;  1UBI A;  1GC6 A;  1F9J A;  4KIK A;  1YIW A;  2ZVO A;  5IAA C;  1C3T A;  1JRU A;  5JHB A;  2MBE A;  3VTW A;  1GNU A;  4EZL A;  2V1Y A;  5CHW A;  2N9X A;  4E74 A;  2KLC A;  3QCA A;  2KTF A;  1H8C A;  1WX7 A;  1WJ6 A;  2LJ5 A;  2MLB A;  3ZUN A;  5D7G A;  1QZE A;  3EHV A;  3I3T B;  3KUC B;  2JXX A;  4II3 B;  4ICV A;  2DYO A;  1WM3 A;  3AXC A;  2KN5 A;  4JQW C;  1WJU A;  2MBO A;  3KUD B;  1TZ1 A;  1MG8 A;  2M8S A;  2KLG A;  3A33 B;  2RR9 A;  3PTF C;  3R66 C;  4IM3 A;  4WQO B;  2FAZ A;  4EZK A;  2MWS B;  1I42 A;  2K25 A;  2KC1 A;  1TGZ B;  2PJH A;  2B3A A;  2MW5 A;  4GDL A;  1L7Y A;  3RYT A;  4EKU A;  1WGD A;  3DDC B;  2LGX A;  4HDQ A;  2Z0D B;  2CU1 A;  2LUE A;  4G50 A;  1UEL A;  3A1Q A;  1V9J A;  4GXB A;  5AZH A;  2KAN A;  3RCZ A;  5BO4 B;  1RRB A;  3JW0 X;  3A4R A;  1EF1 A;  2CHX A;  4M8M A;  2UYZ B;  3BY4 B;  4II2 B;  1G6J A;  3DQV A;  1V6E A;  2KQ7 A;  2LRW A;  4J6I A;  1VCB A;  2M4N A;  3L13 A;  3N3K B;  1YQB A;  3VDZ A;  4FHJ A;  4KIK B;  4MM3 A;  2AEH A;  4PS7 A;  2V4L A;  4HCN B;  2MCN B;  5GMV A;  4HPM B;  4B6W A;  4MGK E;  1WGG A;  5C23 A;  4BBN F;  3ZO5 B;  2DZI A;  4W9E A;  2CR5 A;  4YL8 A;  1H4R A;  3NOB A;  4MJS A;  3TCA A;  4URK A;  3R7Q A;  4W9F A;  2BYV E;  4HWI B;  1PQS A;  4ZRK A;  4IM0 A;  1WI0 A;  3KW5 B;  2BWF A;  5DPR A;  3L54 A;  3CSF A;  2LGY A;  2KHW B;  1K8R B;  3B0A A;  3V62 A;  1EUV B;  3D32 A;  3WAL A;  1P9D U;  4EEW A;  3APD A;  4DK5 A;  2RPQ A;  4CHK A;  3PVL A;  3IHP C;  2BWE S;  2M0X A;  2V3S A;  2FCM A;  4GDL B;  3SHQ A;  3OJ4 B;  3H6N A;  1WXM A;  3KVF B;  4HDO A;  3H7S A;  5DPW A;  2LXA A;  3DBR I;  1P98 A;  4NY0 A;  1ZGU B;  2FNJ B;  2KC2 A;  3ZVV A;  1WGR A;  1CMX B;  3KYC D;  4JGH B;  1GUA B;  3VUX A;  1U4A A;  2KOX A;  1WXV A;  4FJY A;  3MTN B;  3RUI B;  3U7D A;  4WJN A;  2Z0E B;  2A4Z A;  4DDG D;  4FA6 A;  2MQJ A;  4BKG A;  3PRE A;  5LXI B;  3L17 A;  1WJN A;  4MDK E;  1FXT B;  2DYB A;  1R4N I;  2KWC A;  1IYF A;  4DWF A;  3OAW A;  4PYU A;  2EMT A;  2JRI B;  3X0W A;  1UZX B;  3WAO A;  2ZZP B;  2PE6 B;  3A9J A;  3PV1 A;  5JZE B;  5KHQ A;  3B08 A;  3P2B A;  3VQI A;  1XQQ A;  4XC2 A;  4MJS B;  3V61 A;  3ZIM A;  5FR6 A;  4TKN A;  2JT4 B;  3KYD D;  4W9C A;  1WR1 A;  1WX8 A;  4X57 B;  2MP2 A;  4PS8 A;  3IBE A;  4A3O A;  1OTR B;  2L0F A;  3PRM B;  2GBJ A;  2N7E A;  2KO3 A;  4RM9 A;  4BOS C;  2J0J A;  1P0R A;  2RGF A;  4W9J A;  2J0K A;  3L0W B;  2IO0 B;  3VAW A;  2K6Q A;  2KNB A;  1J0G A;  2KMA A;  1WM2 A;  3V6E B;  3VUY A;  1V2Y A;  2I1J A;  1P3Q U;  4B9K A;  4BKS D;  4DDI D;  3K9O B;  3Q3J A;  3PRZ A;  3UF8 A;  2REX A;  3M62 B;  3DVN V;  5IA7 A;  4FN2 A;  5AZF A;  1E7V A;  2XBB C;  4I6P A;  1LM8 B;  3H9D A;  2NBU A;  4HK2 A;  2C5L C;  3T8M A;  2FCS A;  3T9L A;  1TBE A;  4XZ4 A;  4GN1 A;  4XX5 A;  3GOE A;  5J17 A;  1R4M I;  3HHM A;  1E8X A;  1WE6 A;  2J7Q B;  2N9P C;  4KSL C;  3Q3F A;  3KUZ A;  5CHV C;  3CST A;  3A9J B;  4ASW C;  4FAD A;  4EOY A;  2G3Q B;  2HD5 B;  3S2A A;  1RAX A;  2DYM A;  3U30 A;  4MEM A;  3ZTD A;  2JUO A;  3PLU A;  4DHJ D;  3VVW B;  3OJ3 A;  2MP2 B;  2CHW A;  3DBL I;  4M8N A;  2VRR B;  1OGW A;  1SE9 A;  4PYZ A;  2BYE A;  4JLC A;  2CS4 A;  2IY1 B;  2K8H A;  2PE9 A;  1WH3 A;  3HM6 X;  3VHT C;  4FBJ B;  3QK0 A;  3ML9 A;  3ZDT A;  2KX0 A;  1YX6 B;  2JZ3 B;  2K6D B;  2MA9 B;  2MBH A;  4MSQ B;  3ONS A;  4NNJ B;  1KLV A;  2EMS A;  2KWU B;  4RMA A;  3TBL D;  2DZK A;  5CHF A;  3LDZ E;  3QJZ A;  2MBB B;  4DHZ E;  2D07 B;  4K7U A;  3VTU A;  2JWZ A;  3NHE B;  4ANW A;  2YLM A;  4GDK A;  2O6V D;  3DVG Y;  3JVZ X;  4AJY B;  3ZDM C;  2KXJ A;  4EZJ A;  4G0N B;  5C1Z A;  3K9P B;  1A5R A;  2CHZ A;  3ML8 A;  3PZD A;  2ZPN A;  3R7R A;  2Y5B B;  1X1M A;  2DHZ A;  4NPN A;  3C0R B;  4IC7 B;  3ZTC A;  4HCP B;  3NS8 A;  1V80 A;  1WGY A;  2GBN A;  3OLM D;  3HIZ A;  1RFA A;  3W1S A;  3AI5 A;  1Z2M A;  1GJZ A;  4WJQ A;  4ZDV A;  2K8C A;  2KDF B;  4A3P A;  1XD3 B;  1V5T A;  4HLE A;  3A4S C;  2C7M B;  4MH0 E;  3NZS A;  2ZCB A;  2OJR A;  3LJ3 A;  4HVB A;  3L08 A;  2IZV B;  3HM3 A;  4IUM B;  4LJP B;  4TUU A;  3SU8 X;  4IM2 A;  3ECI A;  1WGH A;  3TMP B;  1TTN A;  1WRD B;  2IY0 B;  2KX3 A;  3APF A;  1BT0 A;  2KFK B;  1P1A A;  4IG7 B;  3SD5 A;  4DHZ B;  4KDL B;  1D3Z A;  3PRP B;  3ZNZ B;  4ICU A;  3MJW A;  4MGZ E;  3VH4 B;  1GG3 A;  2BF8 B;  2HJ8 A;  2WDT B;  1M94 A;  1WY8 A;  2IYD B;  5AEK B;  3TL5 A;  4ANU A;  3UGB B;  2NBV B;  3DBH I;  5E6P A;  3R3M A;  3NY5 A;  4FJV B;  3V60 A;  2C7H A;  4GDK B;  1IPG A;  2KWV B;  5DPS A;  4P7I A;  3GZN I;  4JIO U;  2ZNV B;  4FUL A;  4GSW A;  2D11 A;  2BKF A;  3ENE A;  4FHK A;  5JHA A;  2LVP A;  2XK5 B;  3QIJ A;  5L95 C;  4N9F 4;  2ZVN A;  3QC8 B;  3ZRC A;  2FUH B;  3UIN B;  2WX0 A;  2IO1 B;  3PPA A;  4I6N B;  4KVG B;  4BOZ B;  2WX1 A;  1WZ0 A;  1YJ1 A;  3PS6 A;  5EDS A;  3M3J A;  1Q1O A;  4GGQ A;  3ZKJ C;  4DBG A;  3SDL C;  2KJ6 A;  2GBM A;  5D94 A;  4EUT A;  3DBS A;  3VUW A;  1E8W A;  2C7N B;  1E8Z A;  4W9L A;  1J19 A;  2MX2 A;  1WXS A;  2NPT B;  2PPH A;  3IVF A;  1YD8 U;  4BKS A;  4NAW A;  1SGH A;  2C9W B;  2KVR A;  4W9H A;  3UIO B;  2R2O A;  3RT3 B;  3H1U A;  3UQA A;  1OEY A;  4BFR A;  4F1S A;  1EF5 A;  1OEY J;  1WE7 A;  2I1K A;  2KD0 A;  2LAS A;  2M1M A;  3EEC A;  3N32 A;  4WWN A;  5E6N A;  4B95 A;  3RZF A;  1LQB A;  1Q0W B;  2D10 A;  2ZPY A;  4AJW A;  2NVU I;  4AWJ A;  4TV3 A;  2M17 A;  2NR2 A;  2ZEQ A;  3IG3 A;  4CYE A;  2KKC A;  2AL6 A;  2GMI C;  5D6J B;  2JY6 A;  4OVU A;  4IWO A;  4RM8 A;  5LLI A;  2JZZ A;  4MSM B;  1WX9 A;  1UGM A;  3DCG A;  3X23 A;  3AUL A;  2KJH B;  1WZ3 A;  2FID A;  2IO3 B;  2KQS A;  4CO7 A;  4K7W A;  3V6C B;  4A20 A;  3MHS D;  4AOF A;  2L8J A;  3A9K A;  3VFK A;  2LWP A;  4LDT D;  1WMH A;  2Z59 B;  4K7S A;  4MEL A;  4KDI C;  3RD2 A;  2MSE D;  1E90 A;  2G45 B;  1C1Y B;  3WAM A;  4ANX A;  2FIF A;  2KDB A;  2IBI B;  4F8C B;  1E7U A;  5DCN A;  3QAQ A;  1WF9 A;  2MRP A;  5G2N A;  5KHO A;  3DVN U;  2EKE C;  5J2R A;  4E3C A;  4KV2 A;  5CTR C;  3WAN A;  1S1Q B;  3ZNH B;  5G55 A;  3DPD A;  4W9G A;  3UIP B;  2KFK A;  4I6L B;  2O6V A;  1E5W A;  2LXC A;  2DZM A;  2O2V A;  4NAW B;  2N4F A;  2AYO B;  1Y8R C;  2UWQ A;  1Z5S B;  2KJR A;  1NBF C;  4WWO A;  1ISN A;  2NCN A;  3PGE A;  1V86 A;  4MGI E;  2N9E B;  4HXD A;  2R2Q A;  4WJO A;  4JL9 A;  4NQL B;  4E71 A;  1YX5 B;  2K8B A;  3DVG X;  3RUL A;  2LVQ A;  2DX5 B;  1XT9 B;  4LDT B;  4KSK C;  1GC7 A;  5J18 A;  4BBN C;  2LI5 A;  4GB9 A;  2XK5 A;  1NI2 A;  2MBQ A;  4IW0 A;  1SIF A;  3ZRF A;  3JSV A;  3QAR A;  3H7P A;  3ZLZ A;  4DHJ B;  2HTH A;  3A9K B;  2ZNV C;  1J8C A;  4KZC A;  3M95 A;  3QA8 A;  4GOC A;  1WFY A;  1WMH B;  2N1V A;  3WAP A;  2OOB B;  4ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...