4AJYB

Von hippel-lindau protein-elonginb-elonginc complex, bound to hif1- alpha peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ajyB00
4DHJB 3KUZA 1WX8A 4CYEA 4AUQC 3U30A 1S3SG 3APDA 4ANUA 2K8HA 4TQ1A 4W9DA 2BYFA 3X0WA 4A3OA 4HLEA 5AZGA 4GDLA 4PYZA 2NBUA 2NS5A 3NHEB 4BFRA 4DHJD 2RGFA 3UQAA 2KC2A 3BINA 3VUWA 1TGZB 3GZNI 1NI2A 3ZKJC 4NPNA 4BKTA 3QX1A 3A1QA 3NOBA 2KDFB 4W9GA 2L0FA 3M3JA 4B9KA 3APCA 4BKGA 4DDID 5J17A 5J18A 4J6IA 3DCGA 3IVFA 2WX0A 3HM3A 3VXWA 2L3ZA 1WJ4A 1RFAA 3Q3JA 5JHBA 4AWJA 3DPDA 2BPSA 2KDEB 3JSVA 2N7EA 2PE9A 3KUDB 3QK0A 4GSWA 2YLMA 3GOEA 1S1QB 2A4ZA 1P98A 4ZRKA 2ASQA 3HIZA 2JF5A 3S2AA 4FBJB 3PSEB 2MCNB 5CHFA 3ZDTA 1T0YA 2O2VB 4DDGD 4BKSA 3QHTA 5D94A 3ZTDA 3L08A 4W9IA 4IWPA 1G6JA 1J19A 3ALBA 5D7GA 4MGYE 4JQWC 4DXAB 3ZVVA 3U7DA 1IPGA 4ZDVA 4GN1A 2NCNA 3ZNZB 2KJ6A 3ZRFA 1WXAA 2K1FA 3NZUA 1OQYA 2DAJA 2N4FA 2BKFA 3B0AA 1GG3A 4GDKB 4IWQA 2KMCA 4WJNA 3VUXA 5IA7A 2N9EB 3WAOA 5C1ZA 2A5UA 1WXMA 3V6CB 4DK5A 4P7IA 1V80A 3C0RB 3RZFA 4W9KA 5AEKB 2V3SA 2FCQA 3CF6E 1WR6E 3ZNHB 2MP2B 3PVLA 4ANXA 4F7ZA 4NAWB 3A9JA 4FA6A 3HM6X 3OJ4B 4MSMB 3SU8X 2KK8A 4HK2A 3AU4A 4BOZB 4XC2A 1UD7A 3DVGY 3H9DA 4LCDE 4HXDA 2LGXA 4GOCA 4TKNA 3A4SC 4BVUC 2O6VA 1P0RA 2EMTA 3EFUA 1R4NI 4ANVA 1LM8B 2G4SA 3B1LX 1E8YA 4CHKA 1V5TA 4HCNB 2JT4B 3VH3B 2LJ5A 2WX1A 3QC8B 2XK5B 3TIXA 1D3ZA 2N7DA 2M8SA 4F8CB 5JZEB 3UQBA 2C7NB 5HKHA 2CHWA 2J0JA 2KX0A 2FIFA 2KX3A 3JYUA 4W9JA 2N1VA 2BWES 3L54A 4AJWA 1Q0WB 3K9PB 2KHWB 5FR6A 4X57B 1H8CA 1WGDA 2KWUB 3VVWB 4IG7B 1YQBA 1GC7A 3AXCA 2JUOA 3TJPA 2AWTA 2GBMA 1RLFA 1EO6A 5GMVA 1WJNA 3RULA 4G0NB 2J0MA 3KUCB 4MEMA 1WM3A 3VH4B 3R3MA 1A5RA 1WM2A 4NQLB 4F1SA 4DHZE 4W9CA 1TZ1A 3VTUA 1IYFA 3TBLD 4JLCA 2UWQA 4YL8A 3UF8A 1VD2A 4WJPA 5J2RA 2AL3A 3V61A 4EZKA 5DPWA 3IG3A 3WAMA 2FNJB 4GDKA 2LVQA 2N9XA 2EKEC 1TTNA 2KVRA 3JW0X 1ZKHA 4BBNC 4E71A 3AU5A 4KV2A 4HDQA 2WDTB 2MWSB 4E74A 1E8ZA 2XEWA 4RM8A 2K25A 5AZHA 2UYZB 4HPMB 3R7RA 3CSTA 4KIKB 2KKCA 1SGHA 3ML8A 2NR2A 3I3TB 2LXCA 1ZGUB 2FCMA 4G11A 1WMHA 4EZLA 1SE9A 4EEWA 2DYBA 2C7MB 2KTRB 1WGHA 2NPTB 3L16A 3QWZB 4I6NB 2LRUA 1V5OA 2L0TA 4KIKA 4LDTB 1WFYA 2MBOA 2FUHB 2LWPA 2PE6B 4ICVA 1JRUA 2WWZA 1K8RB 2ZNVC 3JSVB 4KDIC 4LJOB 2J0KA 4PS8A 5G55A 2KMAA 2N9PC 1LFDA 2G4DB 3UIOB 4FHJA 2HTHA 3MHSD 3B08A 4GB9A 4NAWA 5DPRA 2LD9A 2D07B 2LASA 2MLBA 3VDZA 4MJSB 4AJYB 2GMIC 2OJRA 4TV3A 5DPTA 5CX3A 2NPTA 4TQ0A 4NJ6A 2GBKA 4K7SA 2IY0B 4XZ4A 3EHVA 2C5LC 3IFWB 2MBQA 3BY4B 4WJQA 1E5WA 2IBIB 4EZJA 2M4NA 2WYQA 2L00B 3DBRI 3PLVA 3QA8A 4MM3A 2KWCA 1UZXB 4JGHB 2XK5A 2JRIB 3DVGX 2CKHB 4KDLB 3W1SA 3V62A 2V1YA 3PREA 3RUIB 1KLVA 2KZRA 1WMHB 3ECIA 2FIDA 2GBNA 2Z0EB 3KW5B 3QIJA 4MGZE 4WWOA 4MELA 1WIAA 1WYWB 5LLIA 4FN2A 3K9OB 2D11A 1SIFA 2DZMA 2DHZA 3CSFA 1RRBA 1WGRA 2FAZA 3TMPB 4GMVA 4FHKA 2G3QB 1R4MI 2RPQA 3PPAA 1GNUA 3ZDMC 4A20A 1I35A 3OLMD 1RAXA 4FLHA 4FADA 2D2QA 2BKRB 1E7VA 2KC1A 1L7YA 2BYVE 2MP2A 3RCZA 3ONSA 3VFKA 2KD0A 3PTFC 3UIPB 1HE8A 2O6VB 5L95C 4II3B 5C23A 2J7QB 3N30A 3U8ZA 3VAWA 1OGWA 3EECA 5CTRC 3PHXB 4BKSD 1EUVB 2D3GA 5TR5A 4MGKE 2D10A 4B6WA 2ZPYA 2ZEQA 1WXSA 3H7SA 4MSQB 2KWVB 4FJYA 1L2NA 3LJ3A 1P9DU 2R2QA 4EKUA 2CS4A 2O6VD 4PS7A 3KYCD 3D32A 2NVUI 2I1JA 2LGYA 3DBLI 5E6OA 2HD5B 5L83A 4FJVB 4AP4C 2DYMA 1WE7A 2O2VA 3T9LA 4KSKC 4OVUA 2L8JA 2MA9B 2REXA 1U4AA 2GBJA 1WR1A 3H6NA 4WWNA 1V6EA 4WAAA 1J0GA 1MG8A 4IM3A 1OEYA 3L0WB 1V9JA 3MJWA 3TCAA 2ZNVB 1Z2MA 2W9NA 1WI0A 2N1WA 1GC6A 2IO2B 2KOXA 3W1YA 3RZWC 2MRPA 4BBNF 2MQJA 2LGDA 1E8WA 2I1KA 3ZRCA 4GU2A 3WA0A 1Q1OA 3LDZE 4MJSA 2IO1B 1V86A 4LDTD 3PGEA 4ZRIA 2KN5A 4DHZB 5DCNA 3RYTA 4GDLB 2K8CA 4URKA 3ZIMA 2MBHA 5E6NA 2Z0DB 3VTWA 1WY8A 1C3TA 1WGGA 3V60A 1KM7A 2CU1A 5D6JB 4A3PA 2KTRA 2NBVB 3ZW3A 3ENEA 3P2BA 3TL5A 3VUYA 1V49A 5LXIB 2LI5A 3NS8A 2HE7A 4HDOA 3M63B 4NNJB 2FCSA 4AOFA 2JZZA 2PPHA 4XX5A 1VCBA 3N32A 1E7UA 2KDBA 1YX6B 2C9WB 1UBIA 3IHPC 1X1MA 3DVNV 2K8BA 3QQ8B 1TBEA 3X23A 3UGBB 2BYEA 2GOWA 4G50A 3RT3B 2DX5B 1UGMA 3SD5A 3ZTCA 2BF8B 2ZCBA 3CMMB 3L10B 2KLCA 4HWIB 2PJHA 1XD3B 4DWFA 3OAWA 3ZNGC 3ZNID 3PZDA 1WX7A 4FULA 3DBHI 3A9JB 4KSLC 1CMXB 4I6LB 4N9F4 3A1QB 4DBGA 4HPLB 2G45B 2IO3B 1WJ6A 1LQBA 1F9JA 1WXVA 2DYOA 4W9LA 3HHMA 1V2YA 3L17A 5KHOA 2KQSA 4M8MA 1E90A 4NQKE 4JL9A 2KLGA 5JHAA 2DZJA 1UH6A 3DQVA 3JVZX 2ZJDA 2IO0B 4ICUA 3N3KB 3NZSA 3DDCB 2KDIA 2Z59B 2MW5A 2JRHA 2IY1B 2QHOA 3V6EB 4GGQA 3UINB 1YX5B 2KFKA 2CHXA 4JIOU 4IUMB 2KQ7A 4OVVA 4K7WA 1XQQA 3VQIA 2GBRA 4KZ0A 4HCPB 3R7QA 1WRDB 3DVNU 2KJRA 2KO3A 2Y5BB 4IWOA 1ISNA 3A4RA 3O65B 2CHZA 3ML9A 5DPSA 1Z5SB 3PRZA 3M95A 4PYUA 1WE6A 4W9FA 2LXAA 2M17A 1NDDA 3VTVA 3AI5A 4M8NA 2JVCA 5D2MB 3PLUA 2R2OA 2DZIA 3H7PB 2DAFA 3QCAA 4IW0A 4W9EA 1J8CA 3SDLC 5EDSA 3A9KA 4G3XB 2ZVOA 1C1YB 4EOYA 2KANA 2JY6A 4IM2A 3EC8A 3T8MA 2AEHA 2LVOA 2ZVNA 2LUEA 2KXJA 1NBFC 2DENB 2BGFA 4IM0A 2C7HA 3PV1A 4ASWC 1FXTB 3W1SC 5CHVC 2ZZPB 3ZO5B 4BOSC 4K81A 5CHWA 1KJTA 2ZCCA 2LVPA 4K1RB 2MX2A 4E3CA 3DOWA 2L05A 2L7RA 2LRWA 3QJZA 3PHWB 3ZUNA 2C60A 3WIMA 2NBWB 1GUAB 2EMSA 2RR9A 3H1UA 3A33B 2JXXA 2DZKA 3M62B 1WX9A 3L13A 3PT2B 2L76A 3PS6A 1YJ1A 4IC7B 4MH0E 1YIWA 2IYDB 3MTNB 1H4RA 2KNBA 3KYDD 4I6PA 1V81A 2OOBB 2CR5A 2K6QA 4FJZA 3A9KB 4GIVA 3WALA 2AL6A 4WWPA 4MDKE 5AZFA 3SHQA 4KZCA 1ZW7A 3IBEA 3WANA 1IP9A 4WJOA 1WZ0A 4CO7A 2KFJA 1WZ3A 1Q5WB 2K39A 2KFKB 5G2NA 3WAPA 2KJHB 4II2B 1EF1A 3R66C 4EUTA 3RD2A 2XBBC 2LZ6A 2JPHA 2B3AA 2JZ3B 1WH3A 3ZLZA 2K6DB 4RMAA 3PRPB 4B95A 3Q3FA 4HVBA 5JH5C 4LJPB 4TUUA 1E8XA 4RM9A 1I42A 3KH0A 1PQSA 1GJZA 3QARA 1YD8U 5IAAC 2MBEA 2RSUA 2KTFA 2BWFA 5BO4B 4NJ7A 1KOTA 3HK0A 4KVGB 2AYOB 2M0XA 1LXDA 4GXBA 1P3QU 4MGIE 1P1AA 4NY0A 2RD0A 5LXHA 4EFOA 3KVFB 2MBBB 1WF9A 2ZPNA 1EF5A 1M94A 4ZRJA 4WQOB 4M0WB 1UBQA 2PEAA 5E6PA 4ANWA 3APFA 3PRMB 1OTRB 4PS3A 3OJ3A 3H7PA 2M1MA 1XT9B 2VRRB 2V4LA 5KHQA 1BT0A 2JWZA 1AARA 4HJKA 2MSED 4K7UA 3NY5A 1Y8RC 3VHTC 1QZEA 2YVCA 1OEYJ 1UELA 2HJ8A 2IZVB 1WGYA 1WJUA 2FCNA 3QAQA 4ZYNA 3DBSA 4W9HA 3AULA
chains in the Genus database with same CATH superfamily
1WX8A 2NMQA 1NI3A 4CYEA 3MC0B 1ESFA 2PVOD 2BYFA 3FILB 4N6EB 5AZGA 3DHHC 2NS5A 2K22A 3NHEB 2MHJA 3GZNI 1F77A 2WQYB 5J17A 2WX0A 3VXWA 2LJIA 1T0RC 2KDEB 2KVZA 3QK0A 3GOEA 1P98A 2ASQA 3HIZA 2JF5A 4FBJB 3N1ZC 3P4PB 4DDGD 4BKSA 4C4VB 3ZTDA 1IBXB 1ACCA 3ALBA 3GP7A 5D7GA 4MGYE 1C9FA 1ZXIA 1XLNA 4ZDVA 4GN1A 1I4RA 2DAJA 2N4FA 4XGAB 2BKFA 2BB5A 3B0AA 1GG3A 4IWQA 3LXFA 3RMKC 1TKEA 1ET9A 5IA7A 1Q10A 5C1ZA 3V6CB 3H8HA 4DK5A 4P7IA 1KTKA 1WR6E 1IGCA 2MP2B 3PVLA 1OFFA 4NAWB 2OJWA 3HM6X 4MSMB 1N5XA 4XC2A 1TS4A 4LCDE 1VDVA 2K3UA 4BVUC 2EMTA 3EFUA 3EA6A 1R4NI 2G4SA 2INNE 3B1LX 4RCOA 4AS1A 3VH3B 3QC8B 2XK5B 1D3ZA 2HDEA 2M8SA 4F8CB 4US8A 3UQBA 2C7NB 3E9SA 5HKHA 1N6ZA 1PDXA 4XWWA 3NVWA 2N1VA 3N1YC 3L54A 2KT7A 3V3XA 1Q0WB 3Q8BA 3URYA 1H8CA 1XEEA 1GC7A 1NEKB 1QOFA 2JUOA 1EO6A 5GMVA 3MP9A 4NQLB 4F1SA 3VRAB 2Y5CA 3VTUA 1TZ1A 3TBLD 1ZDVA 3UF8A 4JE3B 1VD2A 4WJPA 1UF0A 4NZLB 2AL3A 4EZKA 3IG3A 3WAMA 2FNJB 2ICIA 1TTNA 2KVRA 3JW0X 3AU5A 2WNMA 2WDTB 4S0RA 4ARCA 2XEWA 4HPMB 3R7RA 2GB1A 1SGHA 3ML8A 4Q2JA 4FXCA 4EEWA 2DYBA 2C7MB 1JWUD 2NPTB 2PMVA 2MBOA 2LWPA 4KDIC 2WWZA 3JSVB 4LJOB 4MM3B 2J53A 3V05A 2HTHA 4NAWA 4GB9A 2LASA 1N61A 2VZKB 3VDZA 1RM6C 4AJYB 4TV3A 4TQ0A 2X38A 1FPYA 1TKYA 4K7SA 4XZ4A 3IFWB 2IBIB 3TEXA 2WYQA 2L00B 2V0GA 1UZXB 2JRIB 3V62A 1XCQL 4RGNA 3R2TA 4C4VA 4MGZE 1C4PA 2FUG1 4WWOA 5IKCM 1VZ7A 5FKAC 4FN2A 1XLPA 3AEEB 3KWLA 4A20A 2LFIA 3AM9A 3OLMD 4FLHA 1TY0A 2BKRB 2O6VB 4II3B 2J7QB 4YTPB 3PHXB 1EUVB 2DNFA 5TR5A 2BB6A 2ZPYA 1WXSA 3RFZB 4RGMA 4XYCA 3AEAB 4PS7A 3D32A 2CJNA 2RDGA 1YNTE 4AP4C 2DYMA 1WE7A 2REXA 2GBJA 1DOXA 4IM3A 1OEYA 4WH4A 3L0WB 3TEZA 3TCAA 3MC9A 1Z2MA 1FEHA 2IO2B 2LGDA 4ZHOA 1K51A 2K9XA 4MJSA 4NAMA 4LDTD 1SEBD 1V1PB 3RYTA 4H2AA 4URKA 3ZYYX 2QC8A 1C3TA 3V60A 1V1OA 4A3PA 2VZKD 3J9CA 2NBVB 3ZW3A 4DQOC 5LXIB 1OQRA 2AQ2B 3AE9B 4DXFA 4HPPA 3P4RB 4AOFA 2K0PA 1D4BA 1YX6B 2C9WB 1UBIA 3T3OA 3DVNV 3QQ8B 2DX5B 2PKOA 1EWYC 2WXNA 1UGMA 3Q2AC 3BIID 2W82A 4KKIA 3L10B 3E56A 4USAA 4FULA 1CMXB 3RN9C 4MT5A 4HPLB 1VZ8A 1AN8A 2B76B 1WJ6A 3NRZA 2QJLA 1PGXA 1GB4A 1QOGA 2DZJA 3HUIA 3JVZX 2PW9A 2Z59B 2MW5A 2JRHA 2IY1B 2QHOA 2I2YA 4GGQA 1YX5B 2CHXA 4IUMB 1SXTA 1FNWA 1XQQA 2ACZB 2GBRA 1WRDB 3DVNU 3NZ3A 2WXHA 4IWOA 1ISNA 1CQVA 3PRZA 3M95A 4PYUA 3VTVA 3AI5A 5D2MB 3PLUA 2R2OA 3MC8A 4W9EA 1FRRA 4YWGG 1C1YB 4EOYA 2JY6A 4IM2A 4HKQA 4EE2A 1ZOYB 1ZE3D 2MH7A 2NTTA 2H88B 2E3TA 3W1SC 3ZO5B 4BOSC 1KJTA 3VRBB 2LVPA 4E3CA 2L05A 2L7RA 2C60A 1FFUA 1HTQA 3A33B 3PS6A 2DZKA 3M62B 4IC7B 4P6VF 2L76A 4UDUC 2N9KA 3MTNB 2JU6X 5MPOA 1V81A 3A9KB 2QDFA 1E9MA 4GIVA 5AZFA 4A9AA 3AH7A 1FMAD 1WZ0A 1RFKA 1Q5WB 3RNCC 4II2B 1JWSD 3LB8C 2LZ6A 2IJ0A 3MJ5A 5JH5C 4LJPB 1E8XA 1YD8U 3Q8AA 2MBEA 2RSUA 1SJHD 1FNUA 5BO4B 3ZJUA 4AQ7A 2AX5A 4KX6B 1DGJA 4MGIE 4YSYB 2QSDA 3TEWA 2MBBB 2W54A 1NVID 4ZRPA 1L0XB 3APFA 3PRMB 1CJEA 4PS3A 2M1MA 2VRRB 1FXAA 1TYGB 1NYRA 1ZUD2 1BT0A 2MSED 3VHTC 4O1NA 4PT5A 2WU2B 3QAQA 1L0YB 3AULA 2CJOA 2WGSA 1I7HA 3C19A 3X0WA 2LMCA 4GDLA 4PYZA 2NBUA 1JMLA 2RGFA 2BBCA 3UQAA 3BINA 1WRIA 4IDIA 4M01A 1TGZB 2KDFB 2L0FA 2INDC 4DDID 4BAXA 1QF6A 4J6IA 3IVFA 4C56C 1L4ZB 3JSVA 2PE9A 4GSWA 1L0VB 2A4ZA 4ZRKA 4J3OD 1I4HA 5CHFA 3ZDTA 1T0YA 2O2VB 4IKGA 1KLGD 1BMLC 1TS2A 2PIAA 3Q6BA 2GRIA 3BYYB 1IPGA 2NCNA 3UI3A 1MVKA 2XNAC 5JXVA 1OQYA 1J7AA 3RNFC 5H8YE 3DHIC 3VUXA 2IDYA 3OG5A 1WXMA 4LK0M 4W9KA 2V3SA 3CF6E 3ZNHB 1TIFA 4ANXA 3A9JA 3DHGC 3P63A 3SU8X 2KK8A 2Y3AA 4HK2A 1EWCA 1L6VA 2N7JA 4GOCA 3PO0A 1LGRA 2BS3B 1KF6B 1YQ4B 1TY2A 3W9CB 2JT4B 2LJ5A 3TIXA 1TS5A 3HVZA 3AEGB 2CHWA 2J0JA 2KX0A 4ZYSA 1FFVA 3K9PB 2D3AA 3GE8C 2KWUB 3VVWB 3AXCA 2BT6A 1K50A 2GBMA 1WJNA 3RULA 1E7PB 1MJDA 3R2IA 4ZOHC 3R3MA 1A5RA 4W9CA 1IYFA 5HHDG 2K5PA 2UWQA 3MHZA 1C78A 2EKEC 4RNAA 2LGIA 4E71A 1JALA 4KV2A 4HDQA 3IAM1 3TUOA 4E74A 2K25A 2UYZB 3CSTA 4KIKB 2KKCA 1IBXA 1ZGUB 4G11A 5E6JA 1SE9A 4US9A 2KTRB 2IPKD 1SBBB 1C76A 3QWZB 4KIKA 2RMMA 1T0QC 2FUHB 3P1MA 1K8RB 5G55A 3UIOB 1LFDA 2L52A 4FHJA 1T5XD 5DPRA 2LD9A 3AE6B 2MLBA 2GMIC 2OJRA 5DPTA 1J7CA 3W5VB 1MHHE 3EHVA 2C5LC 2MBQA 2YEPB 1E5WA 1VJKA 4EZJA 3DBRI 1D6EC 3QA8A 4MM3A 2KWCA 3DVGX 3W1SA 2KACA 1E6EB 2V1YA 3ECIA 2GBNA 3QIJA 1Y56A 3K9OB 2DZMA 2FAZA 2G3QB 1GNUA 3ZDMC 1I35A 3FC4A 4REZA 1L7YA 4P1CC 4QAYA 3VFKA 3L4PA 3AV8A 2BVCA 3UIPB 1V97A 5C23A 1I4QA 1OGWA 5CTRC 4B6WA 3H7SA 2ZEQA 3LJ3A 5H92C 2R2QA 2CS4A 4XDDA 3TEYA 2HD5B 5L83A 4FJVB 1FD6A 1AWDA 1K52A 3T9LA 2MA9B 1V6EA 1HA5A 4WAAA 1MG8A 1F2RC 1V9JA 2ZNVB 1GAQB 3EGRA 1GC6A 2I38A 2KOXA 3W1YA 4BBNF 2MQJA 5HFYA 2DBYA 3LDZE 3B2GA 1HZ5A 3ETRA 3N20C 2MBHA 1BUIC 3KWVA 5E6NA 2Z0DB 1WGGA 1KM7A 2CU1A 1F1HA 2ZW1A 2LI5A 1JWBD 2HE7A 3MFGA 2QILA 2WXGA 1IUEA 2JZZA 4XX5A 1E7UA 2KDBA 3PZ8A 2LGSA 3ZXRA 2MJ3A 1TBEA 3UGBB 3AE1B 3RT3B 2J4XA 1SF0A 3U52E 4HWIB 2PJHA 1XD3B 1TS3A 1FCCC 3PZDA 1WX7A 4KSLC 2DWQA 4I6LB 4N9F4 4OW0A 5FK9C 1IGDA 1LQBA 3P42A 1GOZA 3BYTB 4M8MA 1E90A 3N9YC 4JL9A 2KLGA 5JHAA 4KGTA 2ZJDA 1GPXA 4ICUA 3DDCB 3V6EB 2OHFA 1FRDA 5HG2A 4KZ0A 2PVGC 3FAHA 5EE3A 2Y5BB 3OWEB 2JZPA 2WXIA 3AE4B 3DBRB 4JX1C 1PFDA 4N59A 3I5JC 2N9LA 2WU5B 2DZIA 3VR8B 1J8CA 1L5PA 3A9KA 2KANA 3R8BA 3EC8A 3T8MA 2LVOA 2ZVNA 2KXJA 4LNFA 2DENB 5IN7A 3HVDA 4ASWC 3DWGC 4C7YA 3I57A 4K1RB 4ARIA 1GB1A 3DOWA 3ZUNA 3AECB 3WIMA 2NBWB 1GUAB 3U2SC 3EFCA 3PT2B 1WX9A 1YJ1A 2KNBA 3P4SB 4FJZA 4WWPA 3SHQA 4KZCA 1ZW7A 4MH8A 4P16A 1IP9A 4WJOA 4CO7A 2KFJA 5G2NA 1EF1A 1E0ZA 1KFYB 4RMAA 3PRPB 3Q3FA 3IT6B 4RM9A 1PUTA 1I42A 1PQSA 4YT0B 1EM7A 5IAAC 3BK2A 1AYFA 1JWMD 4NJ7A 1KOTA 3B9JA 1P3QU 1P1AA 4N58A 1UGJA 4EFOA 1QLBB 1EF5A 3IAS1 1ZDXA 4YTMB 4ZRJA 1XLQA 1ZPSA 1MFWA 4WQOB 4M0WB 2HTME 3AB5A 1OTRB 3H7PA 5BMHA 4TSSA 2LUMA 4P1BC 4K7UA 4HJKA 2EKIA 4BZAA 3PZ7A 2WDVB 1WJUA 1YQ3B 1R7SA 4ZYNA 1KRHA 1ZP0B 4DHJB 3KUZA 3Q8FA 4AUQC 1S3SG 1B1ZA 4KKJA 4HLEA 2QCZA 2LEKA 4WAFA 2KC2A 2WLBA 1NI2A 3ZKJC 2WXPA 4BKTA 3QX1A 1V8CA 3NOBA 5J18A 2L3ZA 1KLUD 1WJ4A 1RFAA 3Q3JA 4M00A 4AWJA 5JHBA 2N7EA 1VZ6A 3C8YA 3KUDB 5BMGA 2YLMA 1S1QB 3S2AA 3Q14C 4XWTA 2MCNB 3L08A 1J19A 2BS2B 2BYTA 4JQWC 4DXAB 3ZVVA 3U7DA 2KJ6A 2W3RA 5IO9A 5I4DA 4WJNA 2N9EB 3WAOA 4K3CA 3C0RB 3RZFA 4DXGA 1PGAA 4GLSC 3ZQ4A 1QILA 2JQRB 2WS3B 3AU4A 2IGHA 1UNSA 1UD7A 2LGXA 4TKNA 1STEA 2O6VA 2KMMA 2NTSA 4RF0A 2LHEA 3NVVA 1MG4A 1E8YA 2X8XX 3AMZA 4HKZE 3N1XC 2N7DA 2JYTA 3Q3MC 1MPEA 1ENFA 2GLSA 3JYUA 1SE3A 2BWES 2KWDA 3BK1A 1WGDA 4IG7B 3TJPA 2AWTA 1RLFA 2WXRA 1PGBA 4G0NB 1B9RA 3VH4B 1WM2A 3FKYA 2JX5A 4YL8A 1QQRA 5J2RA 4XDCA 1YJJA 5DPWA 4GDKA 2LVQA 4NJCA 4BBNC 1EU4A 4LNNA 1D5ZC 2FCMA 1WMHA 4WQMA 2L32A 4EZLA 3NVZA 4A6QA 4LDTB 2LRUA 2L0TA 3ZXVA 2PE6B 4ICVA 1JRUA 2ZNVC 4JWUC 4PS8A 2KMAA 1YN5A 2N9PC 3B08A 2G9HD 2V9HA 2AQ3B 1C77A 1C4CA 1VRAB 2IGDA 2NPTA 5CX3A 5EE1A 2BS4B 2GBKA 2IY0B 4WJQA 3BY4B 3LYYA 4ACFA 2M19A 2M4NA 2D3BA 1QOAA 4LLGM 4JGHB 2AQ1B 1K53A 3NJTA 1KLVA 2FIDA 2Z0EB 2KN4A 2V4IB 1WIAA 2CU3A 2D11A 1SIFA 3CSFA 1RRBA 4GMVA 3SEBA 2RPQA 3T3NA 2D2QA 5C3JB 3RCZA 1E7VA 1SE4A 2BYVE 3ONSA 3PTFC 1HE8A 5L95C 1YJIA 3RNAC 3U8ZA 3EECA 4OVZA 4BKSD 2D3GA 1JW9D 4YXDB 2WXJA 4FJYA 2WXOA 4EKUA 3ZJVA 3KYCD 5D3DA 2NVUI 1N63A 2I1JA 2LGYA 4IOIE 2HJ1A 3U7ZA 2O2VA 1MHXA 1U4AA 3DBHB 1WR1A 2WXFA 1WI0A 2N1WA 2WXLA 4M02A 2MRPA 1F0ZA 1E8WA 2I1KA 1YMHE 3ZRCA 5LNK1 1UWMA 4JWSC 3WA0A 4M0WA 2IO1B 4ZRIA 2KN5A 5BYSA 2Z8LA 1F2RI 5DCNA 4GDLB 1JROA 2K8CA 3ZIMA 2SEBD 4WURA 1TZOA 1WY8A 3WCQA 1HXYD 2KTRA 2VH1A 3P2BA 1QOBA 3NS8A 2M56B 3M63B 4NNJB 1VCBA 3Q3NC 2KAJA 2W55A 2Q5WD 2BYEA 2GOWA 3SD5A 2BF8B 2ZCBA 3ZJTA 1L4DB 2PTLA 4YSZB 1EU3A 4DWFA 3OAWA 1JWAD 3ZNID 3HRDD 1OQQA 1SSNA 3BZDB 2W3SA 3A1QB 4DBGA 2G45B 2WDQB 1LO5D 3DBLB 3SFEB 2DYOA 4W9LA 1V2YA 5KHOA 2KQSA 3BWUD 4WIPA 3NZSA 2KDIA 1MI0A 3AN1A 1XF5L 3UINB 3AE7B 4JIOU 4ZHPA 3ZGZA 2KQ7A 4OVVA 3AE8B 4HCPB 3R7QA 3A4RA 2CHZA 5DPSA 4RH6A 1WE6A 2LXAA 1NDDA 2DAFA 3QCAA 4IW0A 3SDLC 5EDSA 4K3BA 3I63C 4G3XB 2D5GA 2ZVOA 2AEHA 2LUEA 2ZW0A 2BGFA 2C7HA 5CHVC 2ZZPB 4YTNB 1ROEA 4LNKA 2DLBA 2MX2A 2KDMA 3PHWB 2WHIA 2RR9A 2R61A 3H1UA 4A8XC 3L13A 2IYDB 1H4RA 1JQ4A 3KYDD 4I6PA 2CR5A 3WANA 3BVMA 1WZ3A 3WAPA 2WDRB 2XBBC 1XLOA 2K6DB 1HZ6A 1J7BA 2OEDA 4B95A 5BYQA 4TUUA 3KH0A 1GJZA 2QMTA 1DOIA 3AEBB 2JYEA 4OHJA 2M0XA 2N0SB 1HEZE 1P7FA 4GXBA 4NY0A 2H89B 2RD0A 5LXHA 4HJGE 3P4QB 1M94A 1TJEA 2J42A 1JCKB 2PEAA 5E6PA 1XT9B 1R4NB 2V4LA 5KHQA 5EE0A 4PK1A 1AARA 1Y8RC 1QZEA 2YEPF 2YVCA 1OEYJ 1UELA 4A90A 1QKZA 2FCNA 5G5GA 2L1AA 3DBSA 4W9HA 4OZCA 4LNOA 3U30A 4RGOS 3APDA 4ANUA 2K8HA 4TQ1A 4W9DA 4A3OA 4BFRA 2MJDA 1ET6A 4DHJD 3VUWA 2E6XA 2BW2A 4NPNA 3A1QA 4W9GA 3VR9B 3M3JA 4B9KA 3APCA 4BKGA 5AUKA 3DCGA 3HM3A 2BTEA 1WXQA 3DPDA 2BPSA 4S17A 1QT9A 1D5MC 1WGKA 3BVZA 1SB3C 3Q3OC 1YN4A 3AE5B 3PSEB 2WP9B 3QHTA 5D94A 3AE3B 4IWPA 4W9IA 1G6JA 2KQ4X 2JXTA 1WWTA 3ZNZB 3ZRFA 1WXAA 1FCLA 2K1FA 3NZUA 3SFDB 4GDKB 2KMCA 2GI9A 5TSSA 2A5UA 3AEFB 1V80A 3KLSX 3RNBC 5AEKB 1N60A 2FCQA 2V3PA 3KQ4A 4F7ZA 1NENB 3RNEC 4FA6A 3OJ4B 1FNVA 4LNIA 3B2FA 4BOZB 3DVGY 3H9DA 4HXDA 3A4SC 1N62A 1P0RA 4ANVA 1LM8B 3GS2A 3RNGC 4CHKA 1V5TA 1KH0A 4HCNB 2WX1A 2ONQA 4YSXB 5JZEB 2INCC 2FIFA 2KX3A 3NS1A 4W9JA 4AJWA 1I4GA 2KHWB 5FR6A 4X57B 2RDHA 1YQBA 1XO3A 3AEDB 4ITKA 2QEJC 1P7EA 1TKGA 2BQQA 2J0MA 3KUCB 4MEMA 1WM3A 4DHZE 4JLCA 3U4EG 3V61A 1TT5B 2N9XA 5C2TB 1ZKHA 1XXGA 2MWSB 2WXQA 1E8ZA 4RM8A 5AZHA 4B0EA 3GE3C 2Y5PA 2XN9C 5EE9A 2NR2A 3I3TB 2LXCA 3NVYA 4C80A 1FM0D 1WGHA 4I6NB 3L16A 1V5OA 2UU7A 1WFYA 4XE0A 1I4XA 3NG0A 2J0KA 3RI7C 2G4DB 1SE2A 5HI1A 3MHSD 2INPE 2D07B 4MJSB 3GZNB 2TSSA 1VR9A 4NJ6A 1HQRD 3DWMA 1XCTL 5BYRA 2WXMA 3PLVA 4TMAB 2XK5A 4R3DA 2CKHB 4KDLB 3PREA 3RUIB 1C4AA 2KZRA 1WMHB 3KW5B 2WXKA 4MELA 1WYWB 5LLIA 2LHDA 4OZBA 2DHZA 1WGRA 4HRSA 1JRPA 3TMPB 4FHKA 1R4MI 3PPAA 1RAXA 4FADA 2KC1A 2MP2A 4L23A 2KD0A 4C00A 2M0AA 3N30A 3VAWA 4MGKE 2D10A 3RPFC 4MSQB 2KWVB 1L2NA 2IGGA 5FR3A 1P9DU 1T3QA 2O6VD 3DBLI 5AUIA 5E6OA 4LTUA 1WYGA 3GB1A 4L1BA 5G5HA 4KSKC 4OVUA 2L8JA 3H6NA 4WWNA 1J0GA 3Q69A 3IXSA 2J52A 3MJWA 3TSSA 2W9NA 1BXTA 3RZWC 4GU2A 1Q1OA 2QIEB 1N5WA 1V86A 3PGEA 4HEA1 4DHZB 5BMIA 1D5XC 4HROA 4RFBA 3VTWA 3I9V1 5D6JB 4A55A 3ENEA 3TL5A 3VUYA 1V49A 4HDOA 2FCSA 2PPHA 3N32A 1L6UA 2RPVA 3IHPC 1X1MA 2EELA 2K8BA 3X23A 4G50A 1DOYA 2D3CA 3ZTCA 3CMMB 4KGRA 5GXGB 2KLCA 1ZXHA 3CIRB 3ZNGC 2MEKA 3DBHI 1M4VA 3A9JB 1DYQA 2IO3B 4ZRQA 1F9JA 1VLBA 1WXVA 2JWUA 4L2YA 3HHMA 4C7ZA 3L17A 4NQKE 1FIQA 1UH6A 1C79A 3DQVA 2IO0B 3N3KB 4B0MA 2KFKA 4K7WA 3VQIA 1RYJA 2KJRA 3W5UB 1SJED 2KO3A 1UWXA 1FXIA 1RWSA 3O65B 3ML9A 4RF1A 1Z5SB 3Q8EA 3O13A 4W9FA 2M17A 4M8NA 2JVCA 2FE8A 3H7PB 4KGSA 1A70A 1SIJA 4MACA 2PLPA 3W2DA 5IOIA 1CZPA 1NBFC 1WSPA 4IM0A 3PV1A 2ON8A 1FXTB 2VH2A 2SAKA 4K81A 5CHWA 2KYWA 2ZCCA 3QJZA 2LRWA 2EMSA 3AE2B 2JXXA 1T0SC 4MH0E 1YIWA 2V3NA 1AW7A 1E10A 2OOBB 2K6QA 5T8IA 3ABVB 3WALA 4CQNA 2AL6A 4RGTA 3IBEA 2K39A 2KFKB 2KJHB 3R66C 5D3IB 1I4PA 4EUTA 3RD2A 2JPHA 1NYQA 2B3AA 2JZ3B 1WH3A 3ZLZA 3CWIA 4JPSA 1YOVB 4HVBA 3FILA 3QARA 2L83A 2KTFA 2BWFA 1YN3A 3HK0A 1PYWD 4KVGB 2AYOB 1LXDA 3KVFB 1WF9A 2ZPNA 4OZAA 3EUB2 1V1PA 3IT4B 3Q8CA 1UBQA 4ANWA 2MJEA 3OJ3A 3SR6A 2RDBC 1F52A 3NUHB 1T6BX 4D2KA 1R4MB 2JWZA 2JSVX 1FO4A 1UUPA 3NY5A 2HJ8A 1WGYA 2IZVB 3BVGA 2G1EA 4WWMA 5IP4D 2FBWB 4MDKE 1HTOA 1CK1A
chains in the Genus database with same CATH topology
4DHJB 3KUZA 1WX8A 4CYEA 4AUQC 3U30A 1S3SG 3APDA 4ANUA 2K8HA 4TQ1A 4W9DA 2BYFA 3X0WA 4A3OA 4HLEA 5AZGA 4GDLA 4PYZA 2NBUA 2NS5A 3NHEB 4BFRA 4DHJD 2RGFA 3UQAA 2KC2A 3BINA 3VUWA 1TGZB 3GZNI 1NI2A 3ZKJC 4NPNA 4BKTA 3QX1A 3A1QA 3NOBA 2KDFB 4W9GA 2L0FA 3M3JA 4B9KA 3APCA 4BKGA 4DDID 5J17A 5J18A 4J6IA 3DCGA 3IVFA 2WX0A 3HM3A 3VXWA 2L3ZA 1WJ4A 1RFAA 3Q3JA 5JHBA 4AWJA 3DPDA 2BPSA 2KDEB 3JSVA 2N7EA 2PE9A 3KUDB 3QK0A 4GSWA 2YLMA 3GOEA 1S1QB 2A4ZA 1P98A 4ZRKA 2ASQA 3HIZA 2JF5A 3S2AA 4FBJB 3PSEB 2MCNB 5CHFA 3ZDTA 1T0YA 2O2VB 4DDGD 4BKSA 3QHTA 5D94A 3ZTDA 3L08A 4W9IA 4IWPA 1G6JA 1J19A 3ALBA 5D7GA 4MGYE 4JQWC 4DXAB 3ZVVA 3U7DA 1IPGA 4ZDVA 4GN1A 2NCNA 3ZNZB 2KJ6A 3ZRFA 1WXAA 2K1FA 3NZUA 1OQYA 2DAJA 2N4FA 2BKFA 3B0AA 1GG3A 4GDKB 4IWQA 2KMCA 4WJNA 3VUXA 5IA7A 2N9EB 3WAOA 5C1ZA 2A5UA 1WXMA 3V6CB 4DK5A 4P7IA 1V80A 3C0RB 3RZFA 4W9KA 5AEKB 2V3SA 2FCQA 3CF6E 1WR6E 3ZNHB 2MP2B 3PVLA 4ANXA 4F7ZA 4NAWB 3A9JA 4FA6A 3HM6X 3OJ4B 4MSMB 3SU8X 2KK8A 4HK2A 3AU4A 4BOZB 4XC2A 1UD7A 3DVGY 3H9DA 4LCDE 4HXDA 2LGXA 4GOCA 4TKNA 3A4SC 4BVUC 2O6VA 1P0RA 2EMTA 3EFUA 1R4NI 4ANVA 1LM8B 2G4SA 3B1LX 1E8YA 4CHKA 1V5TA 4HCNB 2JT4B 3VH3B 2LJ5A 2WX1A 3QC8B 2XK5B 3TIXA 1D3ZA 2N7DA 2M8SA 4F8CB 5JZEB 3UQBA 2C7NB 5HKHA 2CHWA 2J0JA 2KX0A 2FIFA 2KX3A 3JYUA 4W9JA 2N1VA 2BWES 3L54A 4AJWA 1Q0WB 3K9PB 2KHWB 5FR6A 4X57B 1H8CA 1WGDA 2KWUB 3VVWB 4IG7B 1YQBA 1GC7A 3AXCA 2JUOA 3TJPA 2AWTA 2GBMA 1RLFA 1EO6A 5GMVA 1WJNA 3RULA 4G0NB 2J0MA 3KUCB 4MEMA 1WM3A 3VH4B 3R3MA 1A5RA 1WM2A 4NQLB 4F1SA 4DHZE 4W9CA 1TZ1A 3VTUA 1IYFA 3TBLD 4JLCA 2UWQA 4YL8A 3UF8A 1VD2A 4WJPA 5J2RA 2AL3A 3V61A 4EZKA 5DPWA 3IG3A 3WAMA 2FNJB 4GDKA 2LVQA 2N9XA 2EKEC 1TTNA 2KVRA 3JW0X 1ZKHA 4BBNC 4E71A 3AU5A 4KV2A 4HDQA 2WDTB 2MWSB 4E74A 1E8ZA 2XEWA 4RM8A 2K25A 5AZHA 2UYZB 4HPMB 3R7RA 3CSTA 4KIKB 2KKCA 1SGHA 3ML8A 2NR2A 3I3TB 2LXCA 1ZGUB 2FCMA 4G11A 1WMHA 4EZLA 1SE9A 4EEWA 2DYBA 2C7MB 2KTRB 1WGHA 2NPTB 3L16A 3QWZB 4I6NB 2LRUA 1V5OA 2L0TA 4KIKA 4LDTB 1WFYA 2MBOA 2FUHB 2LWPA 2PE6B 4ICVA 1JRUA 2WWZA 1K8RB 2ZNVC 3JSVB 4KDIC 4LJOB 2J0KA 4PS8A 5G55A 2KMAA 2N9PC 1LFDA 2G4DB 3UIOB 4FHJA 2HTHA 3MHSD 3B08A 4GB9A 4NAWA 5DPRA 2LD9A 2D07B 2LASA 2MLBA 3VDZA 4MJSB 4AJYB 2GMIC 2OJRA 4TV3A 5DPTA 5CX3A 2NPTA 4TQ0A 4NJ6A 2GBKA 4K7SA 2IY0B 4XZ4A 3EHVA 2C5LC 3IFWB 2MBQA 3BY4B 4WJQA 1E5WA 2IBIB 4EZJA 2M4NA 2WYQA 2L00B 3DBRI 3PLVA 3QA8A 4MM3A 2KWCA 1UZXB 4JGHB 2XK5A 2JRIB 3DVGX 2CKHB 4KDLB 3W1SA 3V62A 2V1YA 3PREA 3RUIB 1KLVA 2KZRA 1WMHB 3ECIA 2FIDA 2GBNA 2Z0EB 3KW5B 3QIJA 4MGZE 4WWOA 4MELA 1WIAA 1WYWB 5LLIA 4FN2A 3K9OB 2D11A 1SIFA 2DZMA 2DHZA 3CSFA 1RRBA 1WGRA 2FAZA 3TMPB 4GMVA 4FHKA 2G3QB 1R4MI 2RPQA 3PPAA 1GNUA 3ZDMC 4A20A 1I35A 3OLMD 1RAXA 4FLHA 4FADA 2D2QA 2BKRB 1E7VA 2KC1A 1L7YA 2BYVE 2MP2A 3RCZA 3ONSA 3VFKA 2KD0A 3PTFC 3UIPB 1HE8A 2O6VB 5L95C 4II3B 5C23A 2J7QB 3N30A 3U8ZA 3VAWA 1OGWA 3EECA 5CTRC 3PHXB 4BKSD 1EUVB 2D3GA 5TR5A 4MGKE 2D10A 4B6WA 2ZPYA 2ZEQA 1WXSA 3H7SA 4MSQB 2KWVB 4FJYA 1L2NA 3LJ3A 1P9DU 2R2QA 4EKUA 2CS4A 2O6VD 4PS7A 3KYCD 3D32A 2NVUI 2I1JA 2LGYA 3DBLI 5E6OA 2HD5B 5L83A 4FJVB 4AP4C 2DYMA 1WE7A 2O2VA 3T9LA 4KSKC 4OVUA 2L8JA 2MA9B 2REXA 1U4AA 2GBJA 1WR1A 3H6NA 4WWNA 1V6EA 4WAAA 1J0GA 1MG8A 4IM3A 1OEYA 3L0WB 1V9JA 3MJWA 3TCAA 2ZNVB 1Z2MA 2W9NA 1WI0A 2N1WA 1GC6A 2IO2B 2KOXA 3W1YA 3RZWC 2MRPA 4BBNF 2MQJA 2LGDA 1E8WA 2I1KA 3ZRCA 4GU2A 3WA0A 1Q1OA 3LDZE 4MJSA 2IO1B 1V86A 4LDTD 3PGEA 4ZRIA 2KN5A 4DHZB 5DCNA 3RYTA 4GDLB 2K8CA 4URKA 3ZIMA 2MBHA 5E6NA 2Z0DB 3VTWA 1WY8A 1C3TA 1WGGA 3V60A 1KM7A 2CU1A 5D6JB 4A3PA 2KTRA 2NBVB 3ZW3A 3ENEA 3P2BA 3TL5A 3VUYA 1V49A 5LXIB 2LI5A 3NS8A 2HE7A 4HDOA 3M63B 4NNJB 2FCSA 4AOFA 2JZZA 2PPHA 4XX5A 1VCBA 3N32A 1E7UA 2KDBA 1YX6B 2C9WB 1UBIA 3IHPC 1X1MA 3DVNV 2K8BA 3QQ8B 1TBEA 3X23A 3UGBB 2BYEA 2GOWA 4G50A 3RT3B 2DX5B 1UGMA 3SD5A 3ZTCA 2BF8B 2ZCBA 3CMMB 3L10B 2KLCA 4HWIB 2PJHA 1XD3B 4DWFA 3OAWA 3ZNGC 3ZNID 3PZDA 1WX7A 4FULA 3DBHI 3A9JB 4KSLC 1CMXB 4I6LB 4N9F4 3A1QB 4DBGA 4HPLB 2G45B 2IO3B 1WJ6A 1LQBA 1F9JA 1WXVA 2DYOA 4W9LA 3HHMA 1V2YA 3L17A 5KHOA 2KQSA 4M8MA 1E90A 4NQKE 4JL9A 2KLGA 5JHAA 2DZJA 1UH6A 3DQVA 3JVZX 2ZJDA 2IO0B 4ICUA 3N3KB 3NZSA 3DDCB 2KDIA 2Z59B 2MW5A 2JRHA 2IY1B 2QHOA 3V6EB 4GGQA 3UINB 1YX5B 2KFKA 2CHXA 4JIOU 4IUMB 2KQ7A 4OVVA 4K7WA 1XQQA 3VQIA 2GBRA 4KZ0A 4HCPB 3R7QA 1WRDB 3DVNU 2KJRA 2KO3A 2Y5BB 4IWOA 1ISNA 3A4RA 3O65B 2CHZA 3ML9A 5DPSA 1Z5SB 3PRZA 3M95A 4PYUA 1WE6A 4W9FA 2LXAA 2M17A 1NDDA 3VTVA 3AI5A 4M8NA 2JVCA 5D2MB 3PLUA 2R2OA 2DZIA 3H7PB 2DAFA 3QCAA 4IW0A 4W9EA 1J8CA 3SDLC 5EDSA 3A9KA 4G3XB 2ZVOA 1C1YB 4EOYA 2KANA 2JY6A 4IM2A 3EC8A 3T8MA 2AEHA 2LVOA 2ZVNA 2LUEA 2KXJA 1NBFC 2DENB 2BGFA 4IM0A 2C7HA 3PV1A 4ASWC 1FXTB 3W1SC 5CHVC 2ZZPB 3ZO5B 4BOSC 4K81A 5CHWA 1KJTA 2ZCCA 2LVPA 4K1RB 2MX2A 4E3CA 3DOWA 2L05A 2L7RA 2LRWA 3QJZA 3PHWB 3ZUNA 2C60A 3WIMA 2NBWB 1GUAB 2EMSA 2RR9A 3H1UA 3A33B 2JXXA 2DZKA 3M62B 1WX9A 3L13A 3PT2B 2L76A 3PS6A 1YJ1A 4IC7B 4MH0E 1YIWA 2IYDB 3MTNB 1H4RA 2KNBA 3KYDD 4I6PA 1V81A 2OOBB 2CR5A 2K6QA 4FJZA 3A9KB 4GIVA 3WALA 2AL6A 4WWPA 4MDKE 5AZFA 3SHQA 4KZCA 1ZW7A 3IBEA 3WANA 1IP9A 4WJOA 1WZ0A 4CO7A 2KFJA 1WZ3A 1Q5WB 2K39A 2KFKB 5G2NA 3WAPA 2KJHB 4II2B 1EF1A 3R66C 4EUTA 3RD2A 2XBBC 2LZ6A 2JPHA 2B3AA 2JZ3B 1WH3A 3ZLZA 2K6DB 4RMAA 3PRPB 4B95A 3Q3FA 4HVBA 5JH5C 4LJPB 4TUUA 1E8XA 4RM9A 1I42A 3KH0A 1PQSA 1GJZA 3QARA 1YD8U 5IAAC 2MBEA 2RSUA 2KTFA 2BWFA 5BO4B 4NJ7A 1KOTA 3HK0A 4KVGB 2AYOB 2M0XA 1LXDA 4GXBA 1P3QU 4MGIE 1P1AA 4NY0A 2RD0A 5LXHA 4EFOA 3KVFB 2MBBB 1WF9A 2ZPNA 1EF5A 1M94A 4ZRJA 4WQOB 4M0WB 1UBQA 2PEAA 5E6PA 4ANWA 3APFA 3PRMB 1OTRB 4PS3A 3OJ3A 3H7PA 2M1MA 1XT9B 2VRRB 2V4LA 5KHQA 1BT0A 2JWZA 1AARA 4HJKA 2MSED 4K7UA 3NY5A 1Y8RC 3VHTC 1QZEA 2YVCA 1OEYJ 1UELA 2HJ8A 2IZVB 1WGYA 1WJUA 2FCNA 3QAQA 4ZYNA 3DBSA 4W9HA 3AULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DHJ B;  3KUZ A;  1WX8 A;  4CYE A;  4AUQ C;  3U30 A;  1S3S G;  3APD A;  4ANU A;  2K8H A;  4TQ1 A;  4W9D A;  2BYF A;  3X0W A;  4A3O A;  4HLE A;  5AZG A;  4GDL A;  4PYZ A;  2NBU A;  2NS5 A;  3NHE B;  4BFR A;  4DHJ D;  2RGF A;  3UQA A;  2KC2 A;  3BIN A;  3VUW A;  1TGZ B;  3GZN I;  1NI2 A;  3ZKJ C;  4NPN A;  4BKT A;  3QX1 A;  3A1Q A;  3NOB A;  2KDF B;  4W9G A;  2L0F A;  3M3J A;  4B9K A;  3APC A;  4BKG A;  4DDI D;  5J17 A;  5J18 A;  4J6I A;  3DCG A;  3IVF A;  2WX0 A;  3HM3 A;  3VXW A;  2L3Z A;  1WJ4 A;  1RFA A;  3Q3J A;  5JHB A;  4AWJ A;  3DPD A;  2BPS A;  2KDE B;  3JSV A;  2N7E A;  2PE9 A;  3KUD B;  3QK0 A;  4GSW A;  2YLM A;  3GOE A;  1S1Q B;  2A4Z A;  1P98 A;  4ZRK A;  2ASQ A;  3HIZ A;  2JF5 A;  3S2A A;  4FBJ B;  3PSE B;  2MCN B;  5CHF A;  3ZDT A;  1T0Y A;  2O2V B;  4DDG D;  4BKS A;  3QHT A;  5D94 A;  3ZTD A;  3L08 A;  4W9I A;  4IWP A;  1G6J A;  1J19 A;  3ALB A;  5D7G A;  4MGY E;  4JQW C;  4DXA B;  3ZVV A;  3U7D A;  1IPG A;  4ZDV A;  4GN1 A;  2NCN A;  3ZNZ B;  2KJ6 A;  3ZRF A;  1WXA A;  2K1F A;  3NZU A;  1OQY A;  2DAJ A;  2N4F A;  2BKF A;  3B0A A;  1GG3 A;  4GDK B;  4IWQ A;  2KMC A;  4WJN A;  3VUX A;  5IA7 A;  2N9E B;  3WAO A;  5C1Z A;  2A5U A;  1WXM A;  3V6C B;  4DK5 A;  4P7I A;  1V80 A;  3C0R B;  3RZF A;  4W9K A;  5AEK B;  2V3S A;  2FCQ A;  3CF6 E;  1WR6 E;  3ZNH B;  2MP2 B;  3PVL A;  4ANX A;  4F7Z A;  4NAW B;  3A9J A;  4FA6 A;  3HM6 X;  3OJ4 B;  4MSM B;  3SU8 X;  2KK8 A;  4HK2 A;  3AU4 A;  4BOZ B;  4XC2 A;  1UD7 A;  3DVG Y;  3H9D A;  4LCD E;  4HXD A;  2LGX A;  4GOC A;  4TKN A;  3A4S C;  4BVU C;  2O6V A;  1P0R A;  2EMT A;  3EFU A;  1R4N I;  4ANV A;  1LM8 B;  2G4S A;  3B1L X;  1E8Y A;  4CHK A;  1V5T A;  4HCN B;  2JT4 B;  3VH3 B;  2LJ5 A;  2WX1 A;  3QC8 B;  2XK5 B;  3TIX A;  1D3Z A;  2N7D A;  2M8S A;  4F8C B;  5JZE B;  3UQB A;  2C7N B;  5HKH A;  2CHW A;  2J0J A;  2KX0 A;  2FIF A;  2KX3 A;  3JYU A;  4W9J A;  2N1V A;  2BWE S;  3L54 A;  4AJW A;  1Q0W B;  3K9P B;  2KHW B;  5FR6 A;  4X57 B;  1H8C A;  1WGD A;  2KWU B;  3VVW B;  4IG7 B;  1YQB A;  1GC7 A;  3AXC A;  2JUO A;  3TJP A;  2AWT A;  2GBM A;  1RLF A;  1EO6 A;  5GMV A;  1WJN A;  3RUL A;  4G0N B;  2J0M A;  3KUC B;  4MEM A;  1WM3 A;  3VH4 B;  3R3M A;  1A5R A;  1WM2 A;  4NQL B;  4F1S A;  4DHZ E;  4W9C A;  1TZ1 A;  3VTU A;  1IYF A;  3TBL D;  4JLC A;  2UWQ A;  4YL8 A;  3UF8 A;  1VD2 A;  4WJP A;  5J2R A;  2AL3 A;  3V61 A;  4EZK A;  5DPW A;  3IG3 A;  3WAM A;  2FNJ B;  4GDK A;  2LVQ A;  2N9X A;  2EKE C;  1TTN A;  2KVR A;  3JW0 X;  1ZKH A;  4BBN C;  4E71 A;  3AU5 A;  4KV2 A;  4HDQ A;  2WDT B;  2MWS B;  4E74 A;  1E8Z A;  2XEW A;  4RM8 A;  2K25 A;  5AZH A;  2UYZ B;  4HPM B;  3R7R A;  3CST A;  4KIK B;  2KKC A;  1SGH A;  3ML8 A;  2NR2 A;  3I3T B;  2LXC A;  1ZGU B;  2FCM A;  4G11 A;  1WMH A;  4EZL A;  1SE9 A;  4EEW A;  2DYB A;  2C7M B;  2KTR B;  1WGH A;  2NPT B;  3L16 A;  3QWZ B;  4I6N B;  2LRU A;  1V5O A;  2L0T A;  4KIK A;  4LDT B;  1WFY A;  2MBO A;  2FUH B;  2LWP A;  2PE6 B;  4ICV A;  1JRU A;  2WWZ A;  1K8R B;  2ZNV C;  3JSV B;  4KDI C;  4LJO B;  2J0K A;  4PS8 A;  5G55 A;  2KMA A;  2N9P C;  1LFD A;  2G4D B;  3UIO B;  4FHJ A;  2HTH A;  3MHS D;  3B08 A;  4GB9 A;  4NAW A;  5DPR A;  2LD9 A;  2D07 B;  2LAS A;  2MLB A;  3VDZ A;  4MJS B;  4AJY B;  2GMI C;  2OJR A;  4TV3 A;  5DPT A;  5CX3 A;  2NPT A;  4TQ0 A;  4NJ6 A;  2GBK A;  4K7S A;  2IY0 B;  4XZ4 A;  3EHV A;  2C5L C;  3IFW B;  2MBQ A;  3BY4 B;  4WJQ A;  1E5W A;  2IBI B;  4EZJ A;  2M4N A;  2WYQ A;  2L00 B;  3DBR I;  3PLV A;  3QA8 A;  4MM3 A;  2KWC A;  1UZX B;  4JGH B;  2XK5 A;  2JRI B;  3DVG X;  2CKH B;  4KDL B;  3W1S A;  3V62 A;  2V1Y A;  3PRE A;  3RUI B;  1KLV A;  2KZR A;  1WMH B;  3ECI A;  2FID A;  2GBN A;  2Z0E B;  3KW5 B;  3QIJ A;  4MGZ E;  4WWO A;  4MEL A;  1WIA A;  1WYW B;  5LLI A;  4FN2 A;  3K9O B;  2D11 A;  1SIF A;  2DZM A;  2DHZ A;  3CSF A;  1RRB A;  1WGR A;  2FAZ A;  3TMP B;  4GMV A;  4FHK A;  2G3Q B;  1R4M I;  2RPQ A;  3PPA A;  1GNU A;  3ZDM C;  4A20 A;  1I35 A;  3OLM D;  1RAX A;  4FLH A;  4FAD A;  2D2Q A;  2BKR B;  1E7V A;  2KC1 A;  1L7Y A;  2BYV E;  2MP2 A;  3RCZ A;  3ONS A;  3VFK A;  2KD0 A;  3PTF C;  3UIP B;  1HE8 A;  2O6V B;  5L95 C;  4II3 B;  5C23 A;  2J7Q B;  3N30 A;  3U8Z A;  3VAW A;  1OGW A;  3EEC A;  5CTR C;  3PHX B;  4BKS D;  1EUV B;  2D3G A;  5TR5 A;  4MGK E;  2D10 A;  4B6W A;  2ZPY A;  2ZEQ A;  1WXS A;  3H7S A;  4MSQ B;  2KWV B;  4FJY A;  1L2N A;  3LJ3 A;  1P9D U;  2R2Q A;  4EKU A;  2CS4 A;  2O6V D;  4PS7 A;  3KYC D;  3D32 A;  2NVU I;  2I1J A;  2LGY A;  3DBL I;  5E6O A;  2HD5 B;  5L83 A;  4FJV B;  4AP4 C;  2DYM A;  1WE7 A;  2O2V A;  3T9L A;  4KSK C;  4OVU A;  2L8J A;  2MA9 B;  2REX A;  1U4A A;  2GBJ A;  1WR1 A;  3H6N A;  4WWN A;  1V6E A;  4WAA A;  1J0G A;  1MG8 A;  4IM3 A;  1OEY A;  3L0W B;  1V9J A;  3MJW A;  3TCA A;  2ZNV B;  1Z2M A;  2W9N A;  1WI0 A;  2N1W A;  1GC6 A;  2IO2 B;  2KOX A;  3W1Y A;  3RZW C;  2MRP A;  4BBN F;  2MQJ A;  2LGD A;  1E8W A;  2I1K A;  3ZRC A;  4GU2 A;  3WA0 A;  1Q1O A;  3LDZ E;  4MJS A;  2IO1 B;  1V86 A;  4LDT D;  3PGE A;  4ZRI A;  2KN5 A;  4DHZ B;  5DCN A;  3RYT A;  4GDL B;  2K8C A;  4URK A;  3ZIM A;  2MBH A;  5E6N A;  2Z0D B;  3VTW A;  1WY8 A;  1C3T A;  1WGG A;  3V60 A;  1KM7 A;  2CU1 A;  5D6J B;  4A3P A;  2KTR A;  2NBV B;  3ZW3 A;  3ENE A;  3P2B A;  3TL5 A;  3VUY A;  1V49 A;  5LXI B;  2LI5 A;  3NS8 A;  2HE7 A;  4HDO A;  3M63 B;  4NNJ B;  2FCS A;  4AOF A;  2JZZ A;  2PPH A;  4XX5 A;  1VCB A;  3N32 A;  1E7U A;  2KDB A;  1YX6 B;  2C9W B;  1UBI A;  3IHP C;  1X1M A;  3DVN V;  2K8B A;  3QQ8 B;  1TBE A;  3X23 A;  3UGB B;  2BYE A;  2GOW A;  4G50 A;  3RT3 B;  2DX5 B;  1UGM A;  3SD5 A;  3ZTC A;  2BF8 B;  2ZCB A;  3CMM B;  3L10 B;  2KLC A;  4HWI B;  2PJH A;  1XD3 B;  4DWF A;  3OAW A;  3ZNG C;  3ZNI D;  3PZD A;  1WX7 A;  4FUL A;  3DBH I;  3A9J B;  4KSL C;  1CMX B;  4I6L B;  4N9F 4;  3A1Q B;  4DBG A;  4HPL B;  2G45 B;  2IO3 B;  1WJ6 A;  1LQB A;  1F9J A;  1WXV A;  2DYO A;  4W9L A;  3HHM A;  1V2Y A;  3L17 A;  5KHO A;  2KQS A;  4M8M A;  1E90 A;  4NQK E;  4JL9 A;  2KLG A;  5JHA A;  2DZJ A;  1UH6 A;  3DQV A;  3JVZ X;  2ZJD A;  2IO0 B;  4ICU A;  3N3K B;  3NZS A;  3DDC B;  2KDI A;  2Z59 B;  2MW5 A;  2JRH A;  2IY1 B;  2QHO A;  3V6E B;  4GGQ A;  3UIN B;  1YX5 B;  2KFK A;  2CHX A;  4JIO U;  4IUM B;  2KQ7 A;  4OVV A;  4K7W A;  1XQQ A;  3VQI A;  2GBR A;  4KZ0 A;  4HCP B;  3R7Q A;  1WRD B;  3DVN U;  2KJR A;  2KO3 A;  2Y5B B;  4IWO A;  1ISN A;  3A4R A;  3O65 B;  2CHZ A;  3ML9 A;  5DPS A;  1Z5S B;  3PRZ A;  3M95 A;  4PYU A;  1WE6 A;  4W9F A;  2LXA A;  2M17 A;  1NDD A;  3VTV A;  3AI5 A;  4M8N A;  2JVC A;  5D2M B;  3PLU A;  2R2O A;  2DZI A;  3H7P B;  2DAF A;  3QCA A;  4IW0 A;  4W9E A;  1J8C A;  3SDL C;  5EDS A;  3A9K A;  4G3X B;  2ZVO A;  1C1Y B;  4EOY A;  2KAN A;  2JY6 A;  4IM2 A;  3EC8 A;  3T8M A;  2AEH A;  2LVO A;  2ZVN A;  2LUE A;  2KXJ A;  1NBF C;  2DEN B;  2BGF A;  4IM0 A;  2C7H A;  3PV1 A;  4ASW C;  1FXT B;  3W1S C;  5CHV C;  2ZZP B;  3ZO5 B;  4BOS C;  4K81 A;  5CHW A;  1KJT A;  2ZCC A;  2LVP A;  4K1R B;  2MX2 A;  4E3C A;  3DOW A;  2L05 A;  2L7R A;  2LRW A;  3QJZ A;  3PHW B;  3ZUN A;  2C60 A;  3WIM A;  2NBW B;  1GUA B;  2EMS A;  2RR9 A;  3H1U A;  3A33 B;  2JXX A;  2DZK A;  3M62 B;  1WX9 A;  3L13 A;  3PT2 B;  2L76 A;  3PS6 A;  1YJ1 A;  4IC7 B;  4MH0 E;  1YIW A;  2IYD B;  3MTN B;  1H4R A;  2KNB A;  3KYD D;  4I6P A;  1V81 A;  2OOB B;  2CR5 A;  2K6Q A;  4FJZ A;  3A9K B;  4GIV A;  3WAL A;  2AL6 A;  4WWP A;  4MDK E;  5AZF A;  3SHQ A;  4KZC A;  1ZW7 A;  3IBE A;  3WAN A;  1IP9 A;  4WJO A;  1WZ0 A;  4CO7 A;  2KFJ A;  1WZ3 A;  1Q5W B;  2K39 A;  2KFK B;  5G2N A;  3WAP A;  2KJH B;  4II2 B;  1EF1 A;  3R66 C;  4EUT A;  3RD2 A;  2XBB C;  2LZ6 A;  2JPH A;  2B3A A;  2JZ3 B;  1WH3 A;  3ZLZ A;  2K6D B;  4RMA A;  3PRP B;  4B95 A;  3Q3F A;  4HVB A;  5JH5 C;  4LJP B;  4TUU A;  1E8X A;  4RM9 A;  1I42 A;  3KH0 A;  1PQS A;  1GJZ A;  3QAR A;  1YD8 U;  5IAA C;  2MBE A;  2RSU A;  2KTF A;  2BWF A;  5BO4 B;  4NJ7 A;  1KOT A;  3HK0 A;  4KVG B;  2AYO B;  2M0X A;  1LXD A;  4GXB A;  1P3Q U;  4MGI E;  1P1A A;  4NY0 A;  2RD0 A;  5LXH A;  4EFO A;  3KVF B;  2MBB B;  1WF9 A;  2ZPN A;  1EF5 A;  1M94 A;  4ZRJ A;  4WQO B;  4M0W B;  1UBQ A;  2PEA A;  5E6P A;  4ANW A;  3APF A;  3PRM B;  1OTR B;  4PS3 A;  3OJ3 A;  3H7P A;  2M1M A;  1XT9 B;  2VRR B;  2V4L A;  5KHQ A;  1BT0 A;  2JWZ A;  1AAR A;  4HJK A;  2MSE D;  4K7U A;  3NY5 A;  1Y8R C;  3VHT C;  1QZE A;  2YVC A;  1OEY J;  1UEL A;  2HJ8 A;  2IZV B;  1WGY A;  1WJU A;  2FCN A;  3QAQ A;  4ZYN A;  3DBS A;  4W9H A;  3AUL A; 
#chains in the Genus database with same CATH topology
 1WX8 A;  2NMQ A;  1NI3 A;  4CYE A;  3MC0 B;  1ESF A;  2PVO D;  2BYF A;  3FIL B;  4N6E B;  5AZG A;  3DHH C;  2NS5 A;  2K22 A;  3NHE B;  2MHJ A;  3GZN I;  1F77 A;  2WQY B;  5J17 A;  2WX0 A;  3VXW A;  2LJI A;  1T0R C;  2KDE B;  2KVZ A;  3QK0 A;  3GOE A;  1P98 A;  2ASQ A;  3HIZ A;  2JF5 A;  4FBJ B;  3N1Z C;  3P4P B;  4DDG D;  4BKS A;  4C4V B;  3ZTD A;  1IBX B;  1ACC A;  3ALB A;  3GP7 A;  5D7G A;  4MGY E;  1C9F A;  1ZXI A;  1XLN A;  4ZDV A;  4GN1 A;  1I4R A;  2DAJ A;  2N4F A;  4XGA B;  2BKF A;  2BB5 A;  3B0A A;  1GG3 A;  4IWQ A;  3LXF A;  3RMK C;  1TKE A;  1ET9 A;  5IA7 A;  1Q10 A;  5C1Z A;  3V6C B;  3H8H A;  4DK5 A;  4P7I A;  1KTK A;  1WR6 E;  1IGC A;  2MP2 B;  3PVL A;  1OFF A;  4NAW B;  2OJW A;  3HM6 X;  4MSM B;  1N5X A;  4XC2 A;  1TS4 A;  4LCD E;  1VDV A;  2K3U A;  4BVU C;  2EMT A;  3EFU A;  3EA6 A;  1R4N I;  2G4S A;  2INN E;  3B1L X;  4RCO A;  4AS1 A;  3VH3 B;  3QC8 B;  2XK5 B;  1D3Z A;  2HDE A;  2M8S A;  4F8C B;  4US8 A;  3UQB A;  2C7N B;  3E9S A;  5HKH A;  1N6Z A;  1PDX A;  4XWW A;  3NVW A;  2N1V A;  3N1Y C;  3L54 A;  2KT7 A;  3V3X A;  1Q0W B;  3Q8B A;  3URY A;  1H8C A;  1XEE A;  1GC7 A;  1NEK B;  1QOF A;  2JUO A;  1EO6 A;  5GMV A;  3MP9 A;  4NQL B;  4F1S A;  3VRA B;  2Y5C A;  3VTU A;  1TZ1 A;  3TBL D;  1ZDV A;  3UF8 A;  4JE3 B;  1VD2 A;  4WJP A;  1UF0 A;  4NZL B;  2AL3 A;  4EZK A;  3IG3 A;  3WAM A;  2FNJ B;  2ICI A;  1TTN A;  2KVR A;  3JW0 X;  3AU5 A;  2WNM A;  2WDT B;  4S0R A;  4ARC A;  2XEW A;  4HPM B;  3R7R A;  2GB1 A;  1SGH A;  3ML8 A;  4Q2J A;  4FXC A;  4EEW A;  2DYB A;  2C7M B;  1JWU D;  2NPT B;  2PMV A;  2MBO A;  2LWP A;  4KDI C;  2WWZ A;  3JSV B;  4LJO B;  4MM3 B;  2J53 A;  3V05 A;  2HTH A;  4NAW A;  4GB9 A;  2LAS A;  1N61 A;  2VZK B;  3VDZ A;  1RM6 C;  4AJY B;  4TV3 A;  4TQ0 A;  2X38 A;  1FPY A;  1TKY A;  4K7S A;  4XZ4 A;  3IFW B;  2IBI B;  3TEX A;  2WYQ A;  2L00 B;  2V0G A;  1UZX B;  2JRI B;  3V62 A;  1XCQ L;  4RGN A;  3R2T A;  4C4V A;  4MGZ E;  1C4P A;  2FUG 1;  4WWO A;  5IKC M;  1VZ7 A;  5FKA C;  4FN2 A;  1XLP A;  3AEE B;  3KWL A;  4A20 A;  2LFI A;  3AM9 A;  3OLM D;  4FLH A;  1TY0 A;  2BKR B;  2O6V B;  4II3 B;  2J7Q B;  4YTP B;  3PHX B;  1EUV B;  2DNF A;  5TR5 A;  2BB6 A;  2ZPY A;  1WXS A;  3RFZ B;  4RGM A;  4XYC A;  3AEA B;  4PS7 A;  3D32 A;  2CJN A;  2RDG A;  1YNT E;  4AP4 C;  2DYM A;  1WE7 A;  2REX A;  2GBJ A;  1DOX A;  4IM3 A;  1OEY A;  4WH4 A;  3L0W B;  3TEZ A;  3TCA A;  3MC9 A;  1Z2M A;  1FEH A;  2IO2 B;  2LGD A;  4ZHO A;  1K51 A;  2K9X A;  4MJS A;  4NAM A;  4LDT D;  1SEB D;  1V1P B;  3RYT A;  4H2A A;  4URK A;  3ZYY X;  2QC8 A;  1C3T A;  3V60 A;  1V1O A;  4A3P A;  2VZK D;  3J9C A;  2NBV B;  3ZW3 A;  4DQO C;  5LXI B;  1OQR A;  2AQ2 B;  3AE9 B;  4DXF A;  4HPP A;  3P4R B;  4AOF A;  2K0P A;  1D4B A;  1YX6 B;  2C9W B;  1UBI A;  3T3O A;  3DVN V;  3QQ8 B;  2DX5 B;  2PKO A;  1EWY C;  2WXN A;  1UGM A;  3Q2A C;  3BII D;  2W82 A;  4KKI A;  3L10 B;  3E56 A;  4USA A;  4FUL A;  1CMX B;  3RN9 C;  4MT5 A;  4HPL B;  1VZ8 A;  1AN8 A;  2B76 B;  1WJ6 A;  3NRZ A;  2QJL A;  1PGX A;  1GB4 A;  1QOG A;  2DZJ A;  3HUI A;  3JVZ X;  2PW9 A;  2Z59 B;  2MW5 A;  2JRH A;  2IY1 B;  2QHO A;  2I2Y A;  4GGQ A;  1YX5 B;  2CHX A;  4IUM B;  1SXT A;  1FNW A;  1XQQ A;  2ACZ B;  2GBR A;  1WRD B;  3DVN U;  3NZ3 A;  2WXH A;  4IWO A;  1ISN A;  1CQV A;  3PRZ A;  3M95 A;  4PYU A;  3VTV A;  3AI5 A;  5D2M B;  3PLU A;  2R2O A;  3MC8 A;  4W9E A;  1FRR A;  4YWG G;  1C1Y B;  4EOY A;  2JY6 A;  4IM2 A;  4HKQ A;  4EE2 A;  1ZOY B;  1ZE3 D;  2MH7 A;  2NTT A;  2H88 B;  2E3T A;  3W1S C;  3ZO5 B;  4BOS C;  1KJT A;  3VRB B;  2LVP A;  4E3C A;  2L05 A;  2L7R A;  2C60 A;  1FFU A;  1HTQ A;  3A33 B;  3PS6 A;  2DZK A;  3M62 B;  4IC7 B;  4P6V F;  2L76 A;  4UDU C;  2N9K A;  3MTN B;  2JU6 X;  5MPO A;  1V81 A;  3A9K B;  2QDF A;  1E9M A;  4GIV A;  5AZF A;  4A9A A;  3AH7 A;  1FMA D;  1WZ0 A;  1RFK A;  1Q5W B;  3RNC C;  4II2 B;  1JWS D;  3LB8 C;  2LZ6 A;  2IJ0 A;  3MJ5 A;  5JH5 C;  4LJP B;  1E8X A;  1YD8 U;  3Q8A A;  2MBE A;  2RSU A;  1SJH D;  1FNU A;  5BO4 B;  3ZJU A;  4AQ7 A;  2AX5 A;  4KX6 B;  1DGJ A;  4MGI E;  4YSY B;  2QSD A;  3TEW A;  2MBB B;  2W54 A;  1NVI D;  4ZRP A;  1L0X B;  3APF A;  3PRM B;  1CJE A;  4PS3 A;  2M1M A;  2VRR B;  1FXA A;  1TYG B;  1NYR A;  1ZUD 2;  1BT0 A;  2MSE D;  3VHT C;  4O1N A;  4PT5 A;  2WU2 B;  3QAQ A;  1L0Y B;  3AUL A;  2CJO A;  2WGS A;  1I7H A;  3C19 A;  3X0W A;  2LMC A;  4GDL A;  4PYZ A;  2NBU A;  1JML A;  2RGF A;  2BBC A;  3UQA A;  3BIN A;  1WRI A;  4IDI A;  4M01 A;  1TGZ B;  2KDF B;  2L0F A;  2IND C;  4DDI D;  4BAX A;  1QF6 A;  4J6I A;  3IVF A;  4C56 C;  1L4Z B;  3JSV A;  2PE9 A;  4GSW A;  1L0V B;  2A4Z A;  4ZRK A;  4J3O D;  1I4H A;  5CHF A;  3ZDT A;  1T0Y A;  2O2V B;  4IKG A;  1KLG D;  1BML C;  1TS2 A;  2PIA A;  3Q6B A;  2GRI A;  3BYY B;  1IPG A;  2NCN A;  3UI3 A;  1MVK A;  2XNA C;  5JXV A;  1OQY A;  1J7A A;  3RNF C;  5H8Y E;  3DHI C;  3VUX A;  2IDY A;  3OG5 A;  1WXM A;  4LK0 M;  4W9K A;  2V3S A;  3CF6 E;  3ZNH B;  1TIF A;  4ANX A;  3A9J A;  3DHG C;  3P63 A;  3SU8 X;  2KK8 A;  2Y3A A;  4HK2 A;  1EWC A;  1L6V A;  2N7J A;  4GOC A;  3PO0 A;  1LGR A;  2BS3 B;  1KF6 B;  1YQ4 B;  1TY2 A;  3W9C B;  2JT4 B;  2LJ5 A;  3TIX A;  1TS5 A;  3HVZ A;  3AEG B;  2CHW A;  2J0J A;  2KX0 A;  4ZYS A;  1FFV A;  3K9P B;  2D3A A;  3GE8 C;  2KWU B;  3VVW B;  3AXC A;  2BT6 A;  1K50 A;  2GBM A;  1WJN A;  3RUL A;  1E7P B;  1MJD A;  3R2I A;  4ZOH C;  3R3M A;  1A5R A;  4W9C A;  1IYF A;  5HHD G;  2K5P A;  2UWQ A;  3MHZ A;  1C78 A;  2EKE C;  4RNA A;  2LGI A;  4E71 A;  1JAL A;  4KV2 A;  4HDQ A;  3IAM 1;  3TUO A;  4E74 A;  2K25 A;  2UYZ B;  3CST A;  4KIK B;  2KKC A;  1IBX A;  1ZGU B;  4G11 A;  5E6J A;  1SE9 A;  4US9 A;  2KTR B;  2IPK D;  1SBB B;  1C76 A;  3QWZ B;  4KIK A;  2RMM A;  1T0Q C;  2FUH B;  3P1M A;  1K8R B;  5G55 A;  3UIO B;  1LFD A;  2L52 A;  4FHJ A;  1T5X D;  5DPR A;  2LD9 A;  3AE6 B;  2MLB A;  2GMI C;  2OJR A;  5DPT A;  1J7C A;  3W5V B;  1MHH E;  3EHV A;  2C5L C;  2MBQ A;  2YEP B;  1E5W A;  1VJK A;  4EZJ A;  3DBR I;  1D6E C;  3QA8 A;  4MM3 A;  2KWC A;  3DVG X;  3W1S A;  2KAC A;  1E6E B;  2V1Y A;  3ECI A;  2GBN A;  3QIJ A;  1Y56 A;  3K9O B;  2DZM A;  2FAZ A;  2G3Q B;  1GNU A;  3ZDM C;  1I35 A;  3FC4 A;  4REZ A;  1L7Y A;  4P1C C;  4QAY A;  3VFK A;  3L4P A;  3AV8 A;  2BVC A;  3UIP B;  1V97 A;  5C23 A;  1I4Q A;  1OGW A;  5CTR C;  4B6W A;  3H7S A;  2ZEQ A;  3LJ3 A;  5H92 C;  2R2Q A;  2CS4 A;  4XDD A;  3TEY A;  2HD5 B;  5L83 A;  4FJV B;  1FD6 A;  1AWD A;  1K52 A;  3T9L A;  2MA9 B;  1V6E A;  1HA5 A;  4WAA A;  1MG8 A;  1F2R C;  1V9J A;  2ZNV B;  1GAQ B;  3EGR A;  1GC6 A;  2I38 A;  2KOX A;  3W1Y A;  4BBN F;  2MQJ A;  5HFY A;  2DBY A;  3LDZ E;  3B2G A;  1HZ5 A;  3ETR A;  3N20 C;  2MBH A;  1BUI C;  3KWV A;  5E6N A;  2Z0D B;  1WGG A;  1KM7 A;  2CU1 A;  1F1H A;  2ZW1 A;  2LI5 A;  1JWB D;  2HE7 A;  3MFG A;  2QIL A;  2WXG A;  1IUE A;  2JZZ A;  4XX5 A;  1E7U A;  2KDB A;  3PZ8 A;  2LGS A;  3ZXR A;  2MJ3 A;  1TBE A;  3UGB B;  3AE1 B;  3RT3 B;  2J4X A;  1SF0 A;  3U52 E;  4HWI B;  2PJH A;  1XD3 B;  1TS3 A;  1FCC C;  3PZD A;  1WX7 A;  4KSL C;  2DWQ A;  4I6L B;  4N9F 4;  4OW0 A;  5FK9 C;  1IGD A;  1LQB A;  3P42 A;  1GOZ A;  3BYT B;  4M8M A;  1E90 A;  3N9Y C;  4JL9 A;  2KLG A;  5JHA A;  4KGT A;  2ZJD A;  1GPX A;  4ICU A;  3DDC B;  3V6E B;  2OHF A;  1FRD A;  5HG2 A;  4KZ0 A;  2PVG C;  3FAH A;  5EE3 A;  2Y5B B;  3OWE B;  2JZP A;  2WXI A;  3AE4 B;  3DBR B;  4JX1 C;  1PFD A;  4N59 A;  3I5J C;  2N9L A;  2WU5 B;  2DZI A;  3VR8 B;  1J8C A;  1L5P A;  3A9K A;  2KAN A;  3R8B A;  3EC8 A;  3T8M A;  2LVO A;  2ZVN A;  2KXJ A;  4LNF A;  2DEN B;  5IN7 A;  3HVD A;  4ASW C;  3DWG C;  4C7Y A;  3I57 A;  4K1R B;  4ARI A;  1GB1 A;  3DOW A;  3ZUN A;  3AEC B;  3WIM A;  2NBW B;  1GUA B;  3U2S C;  3EFC A;  3PT2 B;  1WX9 A;  1YJ1 A;  2KNB A;  3P4S B;  4FJZ A;  4WWP A;  3SHQ A;  4KZC A;  1ZW7 A;  4MH8 A;  4P16 A;  1IP9 A;  4WJO A;  4CO7 A;  2KFJ A;  5G2N A;  1EF1 A;  1E0Z A;  1KFY B;  4RMA A;  3PRP B;  3Q3F A;  3IT6 B;  4RM9 A;  1PUT A;  1I42 A;  1PQS A;  4YT0 B;  1EM7 A;  5IAA C;  3BK2 A;  1AYF A;  1JWM D;  4NJ7 A;  1KOT A;  3B9J A;  1P3Q U;  1P1A A;  4N58 A;  1UGJ A;  4EFO A;  1QLB B;  1EF5 A;  3IAS 1;  1ZDX A;  4YTM B;  4ZRJ A;  1XLQ A;  1ZPS A;  1MFW A;  4WQO B;  4M0W B;  2HTM E;  3AB5 A;  1OTR B;  3H7P A;  5BMH A;  4TSS A;  2LUM A;  4P1B C;  4K7U A;  4HJK A;  2EKI A;  4BZA A;  3PZ7 A;  2WDV B;  1WJU A;  1YQ3 B;  1R7S A;  4ZYN A;  1KRH A;  1ZP0 B;  4DHJ B;  3KUZ A;  3Q8F A;  4AUQ C;  1S3S G;  1B1Z A;  4KKJ A;  4HLE A;  2QCZ A;  2LEK A;  4WAF A;  2KC2 A;  2WLB A;  1NI2 A;  3ZKJ C;  2WXP A;  4BKT A;  3QX1 A;  1V8C A;  3NOB A;  5J18 A;  2L3Z A;  1KLU D;  1WJ4 A;  1RFA A;  3Q3J A;  4M00 A;  4AWJ A;  5JHB A;  2N7E A;  1VZ6 A;  3C8Y A;  3KUD B;  5BMG A;  2YLM A;  1S1Q B;  3S2A A;  3Q14 C;  4XWT A;  2MCN B;  3L08 A;  1J19 A;  2BS2 B;  2BYT A;  4JQW C;  4DXA B;  3ZVV A;  3U7D A;  2KJ6 A;  2W3R A;  5IO9 A;  5I4D A;  4WJN A;  2N9E B;  3WAO A;  4K3C A;  3C0R B;  3RZF A;  4DXG A;  1PGA A;  4GLS C;  3ZQ4 A;  1QIL A;  2JQR B;  2WS3 B;  3AU4 A;  2IGH A;  1UNS A;  1UD7 A;  2LGX A;  4TKN A;  1STE A;  2O6V A;  2KMM A;  2NTS A;  4RF0 A;  2LHE A;  3NVV A;  1MG4 A;  1E8Y A;  2X8X X;  3AMZ A;  4HKZ E;  3N1X C;  2N7D A;  2JYT A;  3Q3M C;  1MPE A;  1ENF A;  2GLS A;  3JYU A;  1SE3 A;  2BWE S;  2KWD A;  3BK1 A;  1WGD A;  4IG7 B;  3TJP A;  2AWT A;  1RLF A;  2WXR A;  1PGB A;  4G0N B;  1B9R A;  3VH4 B;  1WM2 A;  3FKY A;  2JX5 A;  4YL8 A;  1QQR A;  5J2R A;  4XDC A;  1YJJ A;  5DPW A;  4GDK A;  2LVQ A;  4NJC A;  4BBN C;  1EU4 A;  4LNN A;  1D5Z C;  2FCM A;  1WMH A;  4WQM A;  2L32 A;  4EZL A;  3NVZ A;  4A6Q A;  4LDT B;  2LRU A;  2L0T A;  3ZXV A;  2PE6 B;  4ICV A;  1JRU A;  2ZNV C;  4JWU C;  4PS8 A;  2KMA A;  1YN5 A;  2N9P C;  3B08 A;  2G9H D;  2V9H A;  2AQ3 B;  1C77 A;  1C4C A;  1VRA B;  2IGD A;  2NPT A;  5CX3 A;  5EE1 A;  2BS4 B;  2GBK A;  2IY0 B;  4WJQ A;  3BY4 B;  3LYY A;  4ACF A;  2M19 A;  2M4N A;  2D3B A;  1QOA A;  4LLG M;  4JGH B;  2AQ1 B;  1K53 A;  3NJT A;  1KLV A;  2FID A;  2Z0E B;  2KN4 A;  2V4I B;  1WIA A;  2CU3 A;  2D11 A;  1SIF A;  3CSF A;  1RRB A;  4GMV A;  3SEB A;  2RPQ A;  3T3N A;  2D2Q A;  5C3J B;  3RCZ A;  1E7V A;  1SE4 A;  2BYV E;  3ONS A;  3PTF C;  1HE8 A;  5L95 C;  1YJI A;  3RNA C;  3U8Z A;  3EEC A;  4OVZ A;  4BKS D;  2D3G A;  1JW9 D;  4YXD B;  2WXJ A;  4FJY A;  2WXO A;  4EKU A;  3ZJV A;  3KYC D;  5D3D A;  2NVU I;  1N63 A;  2I1J A;  2LGY A;  4IOI E;  2HJ1 A;  3U7Z A;  2O2V A;  1MHX A;  1U4A A;  3DBH B;  1WR1 A;  2WXF A;  1WI0 A;  2N1W A;  2WXL A;  4M02 A;  2MRP A;  1F0Z A;  1E8W A;  2I1K A;  1YMH E;  3ZRC A;  5LNK 1;  1UWM A;  4JWS C;  3WA0 A;  4M0W A;  2IO1 B;  4ZRI A;  2KN5 A;  5BYS A;  2Z8L A;  1F2R I;  5DCN A;  4GDL B;  1JRO A;  2K8C A;  3ZIM A;  2SEB D;  4WUR A;  1TZO A;  1WY8 A;  3WCQ A;  1HXY D;  2KTR A;  2VH1 A;  3P2B A;  1QOB A;  3NS8 A;  2M56 B;  3M63 B;  4NNJ B;  1VCB A;  3Q3N C;  2KAJ A;  2W55 A;  2Q5W D;  2BYE A;  2GOW A;  3SD5 A;  2BF8 B;  2ZCB A;  3ZJT A;  1L4D B;  2PTL A;  4YSZ B;  1EU3 A;  4DWF A;  3OAW A;  1JWA D;  3ZNI D;  3HRD D;  1OQQ A;  1SSN A;  3BZD B;  2W3S A;  3A1Q B;  4DBG A;  2G45 B;  2WDQ B;  1LO5 D;  3DBL B;  3SFE B;  2DYO A;  4W9L A;  1V2Y A;  5KHO A;  2KQS A;  3BWU D;  4WIP A;  3NZS A;  2KDI A;  1MI0 A;  3AN1 A;  1XF5 L;  3UIN B;  3AE7 B;  4JIO U;  4ZHP A;  3ZGZ A;  2KQ7 A;  4OVV A;  3AE8 B;  4HCP B;  3R7Q A;  3A4R A;  2CHZ A;  5DPS A;  4RH6 A;  1WE6 A;  2LXA A;  1NDD A;  2DAF A;  3QCA A;  4IW0 A;  3SDL C;  5EDS A;  4K3B A;  3I63 C;  4G3X B;  2D5G A;  2ZVO A;  2AEH A;  2LUE A;  2ZW0 A;  2BGF A;  2C7H A;  5CHV C;  2ZZP B;  4YTN B;  1ROE A;  4LNK A;  2DLB A;  2MX2 A;  2KDM A;  3PHW B;  2WHI A;  2RR9 A;  2R61 A;  3H1U A;  4A8X C;  3L13 A;  2IYD B;  1H4R A;  1JQ4 A;  3KYD D;  4I6P A;  2CR5 A;  3WAN A;  3BVM A;  1WZ3 A;  3WAP A;  2WDR B;  2XBB C;  1XLO A;  2K6D B;  1HZ6 A;  1J7B A;  2OED A;  4B95 A;  5BYQ A;  4TUU A;  3KH0 A;  1GJZ A;  2QMT A;  1DOI A;  3AEB B;  2JYE A;  4OHJ A;  2M0X A;  2N0S B;  1HEZ E;  1P7F A;  4GXB A;  4NY0 A;  2H89 B;  2RD0 A;  5LXH A;  4HJG E;  3P4Q B;  1M94 A;  1TJE A;  2J42 A;  1JCK B;  2PEA A;  5E6P A;  1XT9 B;  1R4N B;  2V4L A;  5KHQ A;  5EE0 A;  4PK1 A;  1AAR A;  1Y8R C;  1QZE A;  2YEP F;  2YVC A;  1OEY J;  1UEL A;  4A90 A;  1QKZ A;  2FCN A;  5G5G A;  2L1A A;  3DBS A;  4W9H A;  4OZC A;  4LNO A;  3U30 A;  4RGO S;  3APD A;  4ANU A;  2K8H A;  4TQ1 A;  4W9D A;  4A3O A;  4BFR A;  2MJD A;  1ET6 A;  4DHJ D;  3VUW A;  2E6X A;  2BW2 A;  4NPN A;  3A1Q A;  4W9G A;  3VR9 B;  3M3J A;  4B9K A;  3APC A;  4BKG A;  5AUK A;  3DCG A;  3HM3 A;  2BTE A;  1WXQ A;  3DPD A;  2BPS A;  4S17 A;  1QT9 A;  1D5M C;  1WGK A;  3BVZ A;  1SB3 C;  3Q3O C;  1YN4 A;  3AE5 B;  3PSE B;  2WP9 B;  3QHT A;  5D94 A;  3AE3 B;  4IWP A;  4W9I A;  1G6J A;  2KQ4 X;  2JXT A;  1WWT A;  3ZNZ B;  3ZRF A;  1WXA A;  1FCL A;  2K1F A;  3NZU A;  3SFD B;  4GDK B;  2KMC A;  2GI9 A;  5TSS A;  2A5U A;  3AEF B;  1V80 A;  3KLS X;  3RNB C;  5AEK B;  1N60 A;  2FCQ A;  2V3P A;  3KQ4 A;  4F7Z A;  1NEN B;  3RNE C;  4FA6 A;  3OJ4 B;  1FNV A;  4LNI A;  3B2F A;  4BOZ B;  3DVG Y;  3H9D A;  4HXD A;  3A4S C;  1N62 A;  1P0R A;  4ANV A;  1LM8 B;  3GS2 A;  3RNG C;  4CHK A;  1V5T A;  1KH0 A;  4HCN B;  2WX1 A;  2ONQ A;  4YSX B;  5JZE B;  2INC C;  2FIF A;  2KX3 A;  3NS1 A;  4W9J A;  4AJW A;  1I4G A;  2KHW B;  5FR6 A;  4X57 B;  2RDH A;  1YQB A;  1XO3 A;  3AED B;  4ITK A;  2QEJ C;  1P7E A;  1TKG A;  2BQQ A;  2J0M A;  3KUC B;  4MEM A;  1WM3 A;  4DHZ E;  4JLC A;  3U4E G;  3V61 A;  1TT5 B;  2N9X A;  5C2T B;  1ZKH A;  1XXG A;  2MWS B;  2WXQ A;  1E8Z A;  4RM8 A;  5AZH A;  4B0E A;  3GE3 C;  2Y5P A;  2XN9 C;  5EE9 A;  2NR2 A;  3I3T B;  2LXC A;  3NVY A;  4C80 A;  1FM0 D;  1WGH A;  4I6N B;  3L16 A;  1V5O A;  2UU7 A;  1WFY A;  4XE0 A;  1I4X A;  3NG0 A;  2J0K A;  3RI7 C;  2G4D B;  1SE2 A;  5HI1 A;  3MHS D;  2INP E;  2D07 B;  4MJS B;  3GZN B;  2TSS A;  1VR9 A;  4NJ6 A;  1HQR D;  3DWM A;  1XCT L;  5BYR A;  2WXM A;  3PLV A;  4TMA B;  2XK5 A;  4R3D A;  2CKH B;  4KDL B;  3PRE A;  3RUI B;  1C4A A;  2KZR A;  1WMH B;  3KW5 B;  2WXK A;  4MEL A;  1WYW B;  5LLI A;  2LHD A;  4OZB A;  2DHZ A;  1WGR A;  4HRS A;  1JRP A;  3TMP B;  4FHK A;  1R4M I;  3PPA A;  1RAX A;  4FAD A;  2KC1 A;  2MP2 A;  4L23 A;  2KD0 A;  4C00 A;  2M0A A;  3N30 A;  3VAW A;  4MGK E;  2D10 A;  3RPF C;  4MSQ B;  2KWV B;  1L2N A;  2IGG A;  5FR3 A;  1P9D U;  1T3Q A;  2O6V D;  3DBL I;  5AUI A;  5E6O A;  4LTU A;  1WYG A;  3GB1 A;  4L1B A;  5G5H A;  4KSK C;  4OVU A;  2L8J A;  3H6N A;  4WWN A;  1J0G A;  3Q69 A;  3IXS A;  2J52 A;  3MJW A;  3TSS A;  2W9N A;  1BXT A;  3RZW C;  4GU2 A;  1Q1O A;  2QIE B;  1N5W A;  1V86 A;  3PGE A;  4HEA 1;  4DHZ B;  5BMI A;  1D5X C;  4HRO A;  4RFB A;  3VTW A;  3I9V 1;  5D6J B;  4A55 A;  3ENE A;  3TL5 A;  3VUY A;  1V49 A;  4HDO A;  2FCS A;  2PPH A;  3N32 A;  1L6U A;  2RPV A;  3IHP C;  1X1M A;  2EEL A;  2K8B A;  3X23 A;  4G50 A;  1DOY A;  2D3C A;  3ZTC A;  3CMM B;  4KGR A;  5GXG B;  2KLC A;  1ZXH A;  3CIR B;  3ZNG C;  2MEK A;  3DBH I;  1M4V A;  3A9J B;  1DYQ A;  2IO3 B;  4ZRQ A;  1F9J A;  1VLB A;  1WXV A;  2JWU A;  4L2Y A;  3HHM A;  4C7Z A;  3L17 A;  4NQK E;  1FIQ A;  1UH6 A;  1C79 A;  3DQV A;  2IO0 B;  3N3K B;  4B0M A;  2KFK A;  4K7W A;  3VQI A;  1RYJ A;  2KJR A;  3W5U B;  1SJE D;  2KO3 A;  1UWX A;  1FXI A;  1RWS A;  3O65 B;  3ML9 A;  4RF1 A;  1Z5S B;  3Q8E A;  3O13 A;  4W9F A;  2M17 A;  4M8N A;  2JVC A;  2FE8 A;  3H7P B;  4KGS A;  1A70 A;  1SIJ A;  4MAC A;  2PLP A;  3W2D A;  5IOI A;  1CZP A;  1NBF C;  1WSP A;  4IM0 A;  3PV1 A;  2ON8 A;  1FXT B;  2VH2 A;  2SAK A;  4K81 A;  5CHW A;  2KYW A;  2ZCC A;  3QJZ A;  2LRW A;  2EMS A;  3AE2 B;  2JXX A;  1T0S C;  4MH0 E;  1YIW A;  2V3N A;  1AW7 A;  1E10 A;  2OOB B;  2K6Q A;  5T8I A;  3ABV B;  3WAL A;  4CQN A;  2AL6 A;  4RGT A;  3IBE A;  2K39 A;  2KFK B;  2KJH B;  3R66 C;  5D3I B;  1I4P A;  4EUT A;  3RD2 A;  2JPH A;  1NYQ A;  2B3A A;  2JZ3 B;  1WH3 A;  3ZLZ A;  3CWI A;  4JPS A;  1YOV B;  4HVB A;  3FIL A;  3QAR A;  2L83 A;  2KTF A;  2BWF A;  1YN3 A;  3HK0 A;  1PYW D;  4KVG B;  2AYO B;  1LXD A;  3KVF B;  1WF9 A;  2ZPN A;  4OZA A;  3EUB 2;  1V1P A;  3IT4 B;  3Q8C A;  1UBQ A;  4ANW A;  2MJE A;  3OJ3 A;  3SR6 A;  2RDB C;  1F52 A;  3NUH B;  1T6B X;  4D2K A;  1R4M B;  2JWZ A;  2JSV X;  1FO4 A;  1UUP A;  3NY5 A;  2HJ8 A;  1WGY A;  2IZV B;  3BVG A;  2G1E A;  4WWM A;  5IP4 D;  2FBW B;  4MDK E;  1HTO A;  1CK1 A; 
#chains in the Genus database with same CATH homology
 4DHJ B;  3KUZ A;  1WX8 A;  4CYE A;  4AUQ C;  3U30 A;  1S3S G;  3APD A;  4ANU A;  2K8H A;  4TQ1 A;  4W9D A;  2BYF A;  3X0W A;  4A3O A;  4HLE A;  5AZG A;  4GDL A;  4PYZ A;  2NBU A;  2NS5 A;  3NHE B;  4BFR A;  4DHJ D;  2RGF A;  3UQA A;  2KC2 A;  3BIN A;  3VUW A;  1TGZ B;  3GZN I;  1NI2 A;  3ZKJ C;  4NPN A;  4BKT A;  3QX1 A;  3A1Q A;  3NOB A;  2KDF B;  4W9G A;  2L0F A;  3M3J A;  4B9K A;  3APC A;  4BKG A;  4DDI D;  5J17 A;  5J18 A;  4J6I A;  3DCG A;  3IVF A;  2WX0 A;  3HM3 A;  3VXW A;  2L3Z A;  1WJ4 A;  1RFA A;  3Q3J A;  5JHB A;  4AWJ A;  3DPD A;  2BPS A;  2KDE B;  3JSV A;  2N7E A;  2PE9 A;  3KUD B;  3QK0 A;  4GSW A;  2YLM A;  3GOE A;  1S1Q B;  2A4Z A;  1P98 A;  4ZRK A;  2ASQ A;  3HIZ A;  2JF5 A;  3S2A A;  4FBJ B;  3PSE B;  2MCN B;  5CHF A;  3ZDT A;  1T0Y A;  2O2V B;  4DDG D;  4BKS A;  3QHT A;  5D94 A;  3ZTD A;  3L08 A;  4W9I A;  4IWP A;  1G6J A;  1J19 A;  3ALB A;  5D7G A;  4MGY E;  4JQW C;  4DXA B;  3ZVV A;  3U7D A;  1IPG A;  4ZDV A;  4GN1 A;  2NCN A;  3ZNZ B;  2KJ6 A;  3ZRF A;  1WXA A;  2K1F A;  3NZU A;  1OQY A;  2DAJ A;  2N4F A;  2BKF A;  3B0A A;  1GG3 A;  4GDK B;  4IWQ A;  2KMC A;  4WJN A;  3VUX A;  5IA7 A;  2N9E B;  3WAO A;  5C1Z A;  2A5U A;  1WXM A;  3V6C B;  4DK5 A;  4P7I A;  1V80 A;  3C0R B;  3RZF A;  4W9K A;  5AEK B;  2V3S A;  2FCQ A;  3CF6 E;  1WR6 E;  3ZNH B;  2MP2 B;  3PVL A;  4ANX A;  4F7Z A;  4NAW B;  3A9J A;  4FA6 A;  3HM6 X;  3OJ4 B;  4MSM B;  3SU8 X;  2KK8 A;  4HK2 A;  3AU4 A;  4BOZ B;  4XC2 A;  1UD7 A;  3DVG Y;  3H9D A;  4LCD E;  4HXD A;  2LGX A;  4GOC A;  4TKN A;  3A4S C;  4BVU C;  2O6V A;  1P0R A;  2EMT A;  3EFU A;  1R4N I;  4ANV A;  1LM8 B;  2G4S A;  3B1L X;  1E8Y A;  4CHK A;  1V5T A;  4HCN B;  2JT4 B;  3VH3 B;  2LJ5 A;  2WX1 A;  3QC8 B;  2XK5 B;  3TIX A;  1D3Z A;  2N7D A;  2M8S A;  4F8C B;  5JZE B;  3UQB A;  2C7N B;  5HKH A;  2CHW A;  2J0J A;  2KX0 A;  2FIF A;  2KX3 A;  3JYU A;  4W9J A;  2N1V A;  2BWE S;  3L54 A;  4AJW A;  1Q0W B;  3K9P B;  2KHW B;  5FR6 A;  4X57 B;  1H8C A;  1WGD A;  2KWU B;  3VVW B;  4IG7 B;  1YQB A;  1GC7 A;  3AXC A;  2JUO A;  3TJP A;  2AWT A;  2GBM A;  1RLF A;  1EO6 A;  5GMV A;  1WJN A;  3RUL A;  4G0N B;  2J0M A;  3KUC B;  4MEM A;  1WM3 A;  3VH4 B;  3R3M A;  1A5R A;  1WM2 A;  4NQL B;  4F1S A;  4DHZ E;  4W9C A;  1TZ1 A;  3VTU A;  1IYF A;  3TBL D;  4JLC A;  2UWQ A;  4YL8 A;  3UF8 A;  1VD2 A;  4WJP A;  5J2R A;  2AL3 A;  3V61 A;  4EZK A;  5DPW A;  3IG3 A;  3WAM A;  2FNJ B;  4GDK A;  2LVQ A;  2N9X A;  2EKE C;  1TTN A;  2KVR A;  3JW0 X;  1ZKH A;  4BBN C;  4E71 A;  3AU5 A;  4KV2 A;  4HDQ A;  2WDT B;  2MWS B;  4E74 A;  1E8Z A;  2XEW A;  4RM8 A;  2K25 A;  5AZH A;  2UYZ B;  4HPM B;  3R7R A;  3CST A;  4KIK B;  2KKC A;  1SGH A;  3ML8 A;  2NR2 A;  3I3T B;  2LXC A;  1ZGU B;  2FCM A;  4G11 A;  1WMH A;  4EZL A;  1SE9 A;  4EEW A;  2DYB A;  2C7M B;  2KTR B;  1WGH A;  2NPT B;  3L16 A;  3QWZ B;  4I6N B;  2LRU A;  1V5O A;  2L0T A;  4KIK A;  4LDT B;  1WFY A;  2MBO A;  2FUH B;  2LWP A;  2PE6 B;  4ICV A;  1JRU A;  2WWZ A;  1K8R B;  2ZNV C;  3JSV B;  4KDI C;  4LJO B;  2J0K A;  4PS8 A;  5G55 A;  2KMA A;  2N9P C;  1LFD A;  2G4D B;  3UIO B;  4FHJ A;  2HTH A;  3MHS D;  3B08 A;  4GB9 A;  4NAW A;  5DPR A;  2LD9 A;  2D07 B;  2LAS A;  2MLB A;  3VDZ A;  4MJS B;  4AJY B;  2GMI C;  2OJR A;  4TV3 A;  5DPT A;  5CX3 A;  2NPT A;  4TQ0 A;  4NJ6 A;  2GBK A;  4K7S A;  2IY0 B;  4XZ4 A;  3EHV A;  2C5L C;  3IFW B;  2MBQ A;  3BY4 B;  4WJQ A;  1E5W A;  2IBI B;  4EZJ A;  2M4N A;  2WYQ A;  2L00 B;  3DBR I;  3PLV A;  3QA8 A;  4MM3 A;  2KWC A;  1UZX B;  4JGH B;  2XK5 A;  2JRI B;  3DVG X;  2CKH B;  4KDL B;  3W1S A;  3V62 A;  2V1Y A;  3PRE A;  3RUI B;  1KLV A;  2KZR A;  1WMH B;  3ECI A;  2FID A;  2GBN A;  2Z0E B;  3KW5 B;  3QIJ A;  4MGZ E;  4WWO A;  4MEL A;  1WIA A;  1WYW B;  5LLI A;  4FN2 A;  3K9O B;  2D11 A;  1SIF A;  2DZM A;  2DHZ A;  3CSF A;  1RRB A;  1WGR A;  2FAZ A;  3TMP B;  4GMV A;  4FHK A;  2G3Q B;  1R4M I;  2RPQ A;  3PPA A;  1GNU A;  3ZDM C;  4A20 A;  1I35 A;  3OLM D;  1RAX A;  4FLH A;  4FAD A;  2D2Q A;  2BKR B;  1E7V A;  2KC1 A;  1L7Y A;  2BYV E;  2MP2 A;  3RCZ A;  3ONS A;  3VFK A;  2KD0 A;  3PTF C;  3UIP B;  1HE8 A;  2O6V B;  5L95 C;  4II3 B;  5C23 A;  2J7Q B;  3N30 A;  3U8Z A;  3VAW A;  1OGW A;  3EEC A;  5CTR C;  3PHX B;  4BKS D;  1EUV B;  2D3G A;  5TR5 A;  4MGK E;  2D10 A;  4B6W A;  2ZPY A;  2ZEQ A;  1WXS A;  3H7S A;  4MSQ B;  2KWV B;  4FJY A;  1L2N A;  3LJ3 A;  1P9D U;  2R2Q A;  4EKU A;  2CS4 A;  2O6V D;  4PS7 A;  3KYC D;  3D32 A;  2NVU I;  2I1J A;  2LGY A;  3DBL I;  5E6O A;  2HD5 B;  5L83 A;  4FJV B;  4AP4 C;  2DYM A;  1WE7 A;  2O2V A;  3T9L A;  4KSK C;  4OVU A;  2L8J A;  2MA9 B;  2REX A;  1U4A A;  2GBJ A;  1WR1 A;  3H6N A;  4WWN A;  1V6E A;  4WAA A;  1J0G A;  1MG8 A;  4IM3 A;  1OEY A;  3L0W B;  1V9J A;  3MJW A;  3TCA A;  2ZNV B;  1Z2M A;  2W9N A;  1WI0 A;  2N1W A;  1GC6 A;  2IO2 B;  2KOX A;  3W1Y A;  3RZW C;  2MRP A;  4BBN F;  2MQJ A;  2LGD A;  1E8W A;  2I1K A;  3ZRC A;  4GU2 A;  3WA0 A;  1Q1O A;  3LDZ E;  4MJS A;  2IO1 B;  1V86 A;  4LDT D;  3PGE A;  4ZRI A;  2KN5 A;  4DHZ B;  5DCN A;  3RYT A;  4GDL B;  2K8C A;  4URK A;  3ZIM A;  2MBH A;  5E6N A;  2Z0D B;  3VTW A;  1WY8 A;  1C3T A;  1WGG A;  3V60 A;  1KM7 A;  2CU1 A;  5D6J B;  4A3P A;  2KTR A;  2NBV B;  3ZW3 A;  3ENE A;  3P2B A;  3TL5 A;  3VUY A;  1V49 A;  5LXI B;  2LI5 A;  3NS8 A;  2HE7 A;  4HDO A;  3M63 B;  4NNJ B;  2FCS A;  4AOF A;  2JZZ A;  2PPH A;  4XX5 A;  1VCB A;  3N32 A;  1E7U A;  2KDB A;  1YX6 B;  2C9W B;  1UBI A;  3IHP C;  1X1M A;  3DVN V;  2K8B A;  3QQ8 B;  1TBE A;  3X23 A;  3UGB B;  2BYE A;  2GOW A;  4G50 A;  3RT3 B;  2DX5 B;  1UGM A;  3SD5 A;  3ZTC A;  2BF8 B;  2ZCB A;  3CMM B;  3L10 B;  2KLC A;  4HWI B;  2PJH A;  1XD3 B;  4DWF A;  3OAW A;  3ZNG C;  3ZNI D;  3PZD A;  1WX7 A;  4FUL A;  3DBH I;  3A9J B;  4KSL C;  1CMX B;  4I6L B;  4N9F 4;  3A1Q B;  4DBG A;  4HPL B;  2G45 B;  2IO3 B;  1WJ6 A;  1LQB A;  1F9J A;  1WXV A;  2DYO A;  4W9L A;  3HHM A;  1V2Y A;  3L17 A;  5KHO A;  2KQS A;  4M8M A;  1E90 A;  4NQK E;  4JL9 A;  2KLG A;  5JHA A;  2DZJ A;  1UH6 A;  3DQV A;  3JVZ X;  2ZJD A;  2IO0 B;  4ICU A;  3N3K B;  3NZS A;  3DDC B;  2KDI A;  2Z59 B;  2MW5 A;  2JRH A;  2IY1 B;  2QHO A;  3V6E B;  4GGQ A;  3UIN B;  1YX5 B;  2KFK A;  2CHX A;  4JIO U;  4IUM B;  2KQ7 A;  4OVV A;  4K7W A;  1XQQ A;  3VQI A;  2GBR A;  4KZ0 A;  4HCP B;  3R7Q A;  1WRD B;  3DVN U;  2KJR A;  2KO3 A;  2Y5B B;  4IWO A;  1ISN A;  3A4R A;  3O65 B;  2CHZ A;  3ML9 A;  5DPS A;  1Z5S B;  3PRZ A;  3M95 A;  4PYU A;  1WE6 A;  4W9F A;  2LXA A;  2M17 A;  1NDD A;  3VTV A;  3AI5 A;  4M8N A;  2JVC A;  5D2M B;  3PLU A;  2R2O A;  2DZI A;  3H7P B;  2DAF A;  3QCA A;  4IW0 A;  4W9E A;  1J8C A;  3SDL C;  5EDS A;  3A9K A;  4G3X B;  2ZVO A;  1C1Y B;  4EOY A;  2KAN A;  2JY6 A;  4IM2 A;  3EC8 A;  3T8M A;  2AEH A;  2LVO A;  2ZVN A;  2LUE A;  2KXJ A;  1NBF C;  2DEN B;  2BGF A;  4IM0 A;  2C7H A;  3PV1 A;  4ASW C;  1FXT B;  3W1S C;  5CHV C;  2ZZP B;  3ZO5 B;  4BOS C;  4K81 A;  5CHW A;  1KJT A;  2ZCC A;  2LVP A;  4K1R B;  2MX2 A;  4E3C A;  3DOW A;  2L05 A;  2L7R A;  2LRW A;  3QJZ A;  3PHW B;  3ZUN A;  2C60 A;  3WIM A;  2NBW B;  1GUA B;  2EMS A;  2RR9 A;  3H1U A;  3A33 B;  2JXX A;  2DZK A;  3M62 B;  1WX9 A;  3L13 A;  3PT2 B;  2L76 A;  3PS6 A;  1YJ1 A;  4IC7 B;  4MH0 E;  1YIW A;  2IYD B;  3MTN B;  1H4R A;  2KNB A;  3KYD D;  4I6P A;  1V81 A;  2OOB B;  2CR5 A;  2K6Q A;  4FJZ A;  3A9K B;  4GIV A;  3WAL A;  2AL6 A;  4WWP A;  4MDK E;  5AZF A;  3SHQ A;  4KZC A;  1ZW7 A;  3IBE A;  3WAN A;  1IP9 A;  4WJO A;  1WZ0 A;  4CO7 A;  2KFJ A;  1WZ3 A;  1Q5W B;  2K39 A;  2KFK B;  5G2N A;  3WAP A;  2KJH B;  4II2 B;  1EF1 A;  3R66 C;  4EUT A;  3RD2 A;  2XBB C;  2LZ6 A;  2JPH A;  2B3A A;  2JZ3 B;  1WH3 A;  3ZLZ A;  2K6D B;  4RMA A;  3PRP B;  4B95 A;  3Q3F A;  4HVB A;  5JH5 C;  4LJP B;  4TUU A;  1E8X A;  4RM9 A;  1I42 A;  3KH0 A;  1PQS A;  1GJZ A;  3QAR A;  1YD8 U;  5IAA C;  2MBE A;  2RSU A;  2KTF A;  2BWF A;  5BO4 B;  4NJ7 A;  1KOT A;  3HK0 A;  4KVG B;  2AYO B;  2M0X A;  1LXD A;  4GXB A;  1P3Q U;  4MGI E;  1P1A A;  4NY0 A;  2RD0 A;  5LXH A;  4EFO A;  3KVF B;  2MBB B;  1WF9 A;  2ZPN A;  1EF5 A;  1M94 A;  4ZRJ A;  4WQO B;  4M0W B;  1UBQ A;  2PEA A;  5E6P A;  4ANW A;  3APF A;  3PRM B;  1OTR B;  4PS3 A;  3OJ3 A;  3H7P A;  2M1M A;  1XT9 B;  2VRR B;  2V4L A;  5KHQ A;  1BT0 A;  2JWZ A;  1AAR A;  4HJK A;  2MSE D;  4K7U A;  3NY5 A;  1Y8R C;  3VHT C;  1QZE A;  2YVC A;  1OEY J;  1UEL A;  2HJ8 A;  2IZV B;  1WGY A;  1WJU A;  2FCN A;  3QAQ A;  4ZYN A;  3DBS A;  4W9H A;  3AUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...