4AJYB

Von hippel-lindau protein-elonginb-elonginc complex, bound to hif1- alpha peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ajyB00
2BF8B 2GBKA 5J17A 3HM3A 2MA9B 3QA8A 4G11A 1H4RA 4EOYA 4AP4C 2ZCCA 3PRMB 2KZRA 2MP2A 2WWZA 4BBNC 4BOSC 2LXCA 2XK5B 1ZW7A 2N7DA 3C0RB 3UF8A 4HWIB 2AL3A 2FIFA 2XEWA 3NHEB 4CHKA 1WM2A 2DZMA 3I3TB 3OJ3A 2MLBA 4W9GA 1J8CA 2IO2B 3PHWB 4GSWA 3ZO5B 2JPHA 3M3JA 3ZDMC 2G3QB 4F7ZA 4IWOA 3BY4B 2GBMA 1YX5B 2KFKA 2PEAA 4GDLB 4HCNB 4BKSA 3RUIB 2YVCA 5CHWA 4ANXA 4WJPA 2NS5A 2BPSA 3PGEA 2IY0B 4MM3A 4OVVA 3WAPA 1UD7A 2VRRB 2MBOA 1EF5A 2REXA 3CSFA 3QC8B 4LDTB 1MG8A 3KW5B 1E7UA 3B08A 2JVCA 2AL6A 3DPDA 4ANWA 1OQYA 3EC8A 4IM0A 1J19A 3A9JA 1UZXB 3ZVVA 2ZNVC 4NQLB 4WWPA 4PYZA 2R2QA 1T0YA 4MSQB 5TR5A 1WGRA 2L0TA 2Z59B 3PZDA 4KV2A 3ENEA 1WXAA 1V5TA 3HM6X 1V81A 4MGKE 4PS8A 2KWCA 1GJZA 4KSLC 4MJSA 1WR1A 2MBBB 2KFJA 3A9KA 3PLVA 4NAWA 4DXAB 4EUTA 2LUEA 1WIAA 4NPNA 1JRUA 2O2VB 2M1MA 5E6OA 4EEWA 4HK2A 4BKGA 2CU1A 4URKA 2CHWA 3ZNHB 1L7YA 3ZNID 2ZPYA 2LZ6A 4I6NB 3WALA 4G3XB 2JUOA 3OJ4B 4IW0A 4W9EA 1Q1OA 1WGYA 3L08A 3LJ3A 3LDZE 3X23A 3ZTCA 4FADA 2XK5A 5DPWA 4DDID 2KDFB 2O6VA 4GOCA 1E8ZA 3ZNGC 2ZZPB 2MQJA 2HJ8A 3ONSA 5JH5C 3CF6E 2LI5A 3RT3B 2AYOB 2M17A 3VH3B 1BT0A 2N1WA 4IM3A 1IP9A 3ZUNA 3PRPB 4JGHB 4FN2A 2DENB 5G2NA 3VAWA 4ZDVA 4II2B 2MBQA 4AUQC 2DYOA 2Y5BB 4IG7B 3N3KB 3H7SA 3GOEA 1D3ZA 2KTRB 4OVUA 1L2NA 3QARA 4DDGD 4GDLA 1YQBA 5FR6A 2G4DB 1P3QU 4ICVA 3ECIA 2CR5A 2FNJB 2QHOA 2I1JA 1E8WA 2KKCA 2ZJDA 3VHTC 4IWPA 1WZ3A 2N9EB 1KJTA 4TQ1A 2DZJA 3H1UA 1WE6A 2NVUI 4NJ7A 3PHXB 4FLHA 1NBFC 3DVNV 2I1KA 1SE9A 2KXJA 4GXBA 4JLCA 4XZ4A 3QK0A 3KUCB 4KDIC 2LRUA 2KLCA 3TCAA 3QCAA 2D07B 2DAJA 3OLMD 5KHOA 4F8CB 5KHQA 2O2VA 1E8XA 3DCGA 2KC2A 3A33B 3TMPB 3N32A 2MRPA 1E90A 1P0RA 2RGFA 3ML8A 3DOWA 2BGFA 3APFA 2KTFA 5AEKB 4FJYA 3NY5A 4JQWC 3WIMA 3RD2A 5IAAC 4W9LA 5D94A 2D11A 4DWFA 3A1QB 4W9IA 1OEYA 2LGXA 4LCDE 1WYWB 3H7PB 3QX1A 4WJNA 4TQ0A 3L54A 2RD0A 2MBHA 4JL9A 1WFYA 3DBSA 1OGWA 2C7NB 4G50A 1GC6A 3UQBA 2BYEA 2PPHA 2HD5B 2GBNA 4WJQA 3S2AA 2LRWA 4FA6A 3VDZA 2FAZA 2O6VB 2J7QB 2K8BA 2KTRA 2EKEC 1C1YB 2KJRA 4MELA 4TUUA 2AEHA 4WJOA 2MX2A 2IO3B 3TIXA 3UIOB 2IYDB 1V80A 2G4SA 3KVFB 1FXTB 2LGDA 2K1FA 2N7EA 3M63B 1LQBA 1V9JA 4I6PA 5C23A 3VTUA 1E8YA 1NDDA 1HE8A 5AZGA 2J0KA 4K81A 5AZFA 2NBWB 3V6CB 1LM8B 4B95A 1WJ6A 5GMVA 2BWES 1V49A 2FUHB 4GGQA 3AXCA 4AJWA 5CHVC 2N9PC 4E74A 4EKUA 2R2OA 3TJPA 2PE6B 3QAQA 3WA0A 2Z0DB 3PREA 2KJ6A 2L7RA 3A4SC 2RR9A 3SU8X 1GNUA 4FHKA 4P7IA 2CHZA 4CO7A 3KUZA 2K6QA 2N4FA 3KYCD 3APDA 2G45B 4HLEA 1C3TA 4DHZE 1WJUA 4BKTA 5E6NA 4EZJA 4HCPB 3U8ZA 3WAMA 1WXVA 2KQSA 2CKHB 3TL5A 1WH3A 1WXMA 3UGBB 3A1QA 4YL8A 3KUDB 3H7PA 2UWQA 4ZYNA 1WRDB 3QQ8B 4W9HA 1Q5WB 2N1VA 4KZ0A 5C1ZA 3L10B 4PS7A 3SHQA 4A20A 1RAXA 4MGIE 2A5UA 2L3ZA 3B1LX 1KLVA 2MW5A 2Z0EB 3NOBA 2ASQA 3SD5A 3ZRFA 2KNBA 1TGZB 1UGMA 2KANA 2DHZA 2V3SA 4GU2A 3V6EB 4BFRA 4WAAA 1R4NI 2KC1A 4I6LB 4LDTD 4AWJA 2JF5A 2GMIC 1UBIA 2NBVB 2ZEQA 1WJNA 3ZLZA 4EZLA 2B3AA 1OEYJ 2GBJA 3RYTA 1F9JA 3NZUA 2KWVB 2XBBC 3W1SA 5DPTA 3AULA 2PJHA 3VXWA 2JRHA 2KOXA 3VUYA 4W9JA 4J6IA 4B9KA 3L16A 1XT9B 2IO1B 1OTRB 3A4RA 2ZVNA 3N30A 1GC7A 3X0WA 2J0JA 3PS6A 1Y8RC 2KDIA 3H9DA 5LXIB 4HDOA 4HVBA 2KX0A 3V62A 1TTNA 4GDKB 1PQSA 3IBEA 2RPQA 5L83A 2C9WB 2KN5A 1I35A 1V6EA 1WZ0A 5JHBA 4DHJB 5AZHA 1XQQA 5D7GA 3PSEB 3JYUA 3RCZA 1A5RA 1S1QB 2FCQA 2IZVB 4GB9A 3UINB 3DDCB 1YX6B 4XC2A 2IY1B 1G6JA 3PT2B 3ZKJC 2KDBA 4IUMB 4IC7B 1E5WA 4FHJA 4ZRJA 1WX8A 4AOFA 4EZKA 5DPSA 2OOBB 2DYMA 3R3MA 4E71A 5D6JB 2BKFA 1AARA 5G55A 1X1MA 3SDLC 1I42A 1GG3A 3K9PB 3JSVA 4HXDA 5DPRA 2HE7A 3UIPB 4ICUA 4TV3A 4ANVA 1WF9A 5EDSA 3V60A 2KQ7A 5CX3A 2M8SA 4KDLB 5HKHA 2M4NA 2KDEB 4HDQA 3DVNU 4HPLB 3ZW3A 3R7QA 1KM7A 2KMCA 3IFWB 2MSED 4BKSD 2HTHA 4NJ6A 4W9DA 2J0MA 4GMVA 1IPGA 2JZZA 3VUWA 3RZWC 4A3OA 4NQKE 4M0WB 2LVOA 3L17A 2MWSB 4FULA 4M8NA 3AU4A 5BO4B 3HHMA 2KO3A 4ANUA 4DHZB 3DBLI 2KMAA 3P2BA 1RRBA 3IVFA 4N9F4 1KOTA 2D3GA 3NZSA 4GDKA 3RULA 1P98A 3MTNB 4MEMA 1S3SG 3BINA 3PLUA 3AU5A 4HPMB 3DBRI 1LFDA 3AI5A 3M62B 2MBEA 3JW0X 1WMHB 1EO6A 2JT4B 2JRIB 2NBUA 3D32A 3O65B 1P1AA 2L8JA 4JIOU 2BYVE 2FCNA 3MJWA 4ZRKA 3PPAA 4WWOA 3JVZX 5LXHA 2RSUA 3ZTDA 2LGYA 3WAOA 3CMMB 3ZDTA 3PVLA 2A4ZA 2KVRA 1V86A 1WY8A 2FIDA 2ZCBA 4MSMB 4W9KA 2DX5B 2K8HA 3Q3FA 3OAWA 1NI2A 2KJHB 2O6VD 4LJOB 2C5LC 3VTVA 4K7UA 4W9CA 1WX7A 2JZ3B 1P9DU 3KH0A 3T8MA 4NY0A 4RM8A 4BOZB 5J18A 2L00B 2LWPA 2OJRA 3QIJA 3VTWA 4PS3A 4MH0E 4IM2A 2YLMA 1CMXB 1V2YA 3HK0A 4RM9A 4KVGB 2BYFA 3QHTA 4MGZE 2V1YA 3VQIA 2IO0B 1WX9A 4A3PA 1YD8U 3EECA 2BWFA 3RZFA 3JSVB 3K9OB 4DBGA 2KX3A 1QZEA 2BKRB 3H6NA 4HJKA 4FJZA 2JY6A 2MCNB 4IWQA 3DVGY 4NNJB 3V61A 2JWZA 3APCA 2FCMA 2LASA 4XX5A 2EMSA 3PRZA 1ZKHA 5D2MB 4K7SA 2D2QA 1SIFA 5CHFA 3VVWB 3KYDD 3MHSD 1TBEA 4GIVA 1EF1A 2EMTA 2WX1A 2KK8A 2LD9A 3VFKA 1Z5SB 3ML9A 2NR2A 2NPTB 2C60A 3DQVA 2CHXA 5IA7A 5CTRC 3ALBA 5J2RA 1WMHA 1U4AA 3W1YA 1Q0WB 3UQAA 1UH6A 3U30A 4MDKE 4MGYE 4WQOB 2N9XA 4K7WA 1WJ4A 1Z2MA 2GOWA 4B6WA 1TZ1A 4KSKC 4ASWC 2C7MB 2DZKA 2UYZB 4KIKB 2WX0A 4BBNF 1IYFA 1R4MI 1WM3A 3TBLD 2LXAA 3ZIMA 4X57B 3DBHI 3ZRCA 4AJYB 2LVPA 2MP2B 2JXXA 1WE7A 2K6DB 1XD3B 3DVGX 4FJVB 4K1RB 2DYBA 3W1SC 4EFOA 2L05A 3EFUA 3PTFC 5E6PA 4TKNA 2W9NA 4M8MA 4KZCA 4CYEA 3Q3JA 4E3CA 1RFAA 2FCSA 3VH4B 3U7DA 1WGHA 5L95C 1WGDA 2KD0A 3QJZA 2NCNA 4FBJB 2M0XA 5LLIA 3ZNZB 4GN1A 2ZNVB 1YIWA 1ISNA 3IHPC 1WR6E 1YJ1A 4WWNA 2CS4A 1H8CA 3R66C 1K8RB 3QWZB 4G0NB 2C7HA 1ZGUB 2KFKB 4LJPB 2WDTB 2KHWB 1VCBA 2ZPNA 1UBQA 4RMAA 1WGGA 2KWUB 5DCNA 4DK5A 1RLFA 4II3B 3NS8A 4PYUA 3CSTA 4DHJD 2GBRA 3VUXA 4W9FA 2WYQA 1J0GA 1M94A 3L0WB 1E7VA 3L13A 3A9JB 1SGHA 1WXSA 2ZVOA 2D10A 3WANA 2K25A 2NPTA 3PV1A 1WI0A 2L76A 4F1SA 3T9LA 3IG3A 3B0AA 2AWTA 1UELA 2DAFA 2DZIA 2PE9A 3HIZA 3GZNI 3EHVA 4MJSB 2IBIB 2LVQA 1EUVB 3R7RA 3A9KB 2LJ5A 4NAWB 5JZEB 2K39A 3M95A 5JHAA 4BVUC 2V4LA 2KLGA 1V5OA 4ZRIA 1LXDA 1VD2A 4KIKA 2K8CA 1GUAB 2L0FA
chains in the Genus database with same CATH superfamily
5J17A 2GBKA 1HTQA 3QA8A 2BT6A 4BBNC 2N7DA 3UF8A 3MHZA 4CHKA 1WM2A 4W9GA 4PT5A 2KWDA 2LEKA 2VH2A 3PHWB 4WAFA 2JPHA 4ZHPA 3M3JA 3SR6A 4US8A 1CJEA 2WXLA 2G3QB 4NJCA 4IWOA 3BY4B 4HCNB 5CHWA 1XXGA 4WJPA 4MM3A 3PZ8A 2REXA 2RMMA 3CSFA 4C7YA 4LDTB 1E7UA 3B08A 2JVCA 1OQYA 4QAYA 1ROEA 3P4SB 1JWMD 2L83A 4NQLB 4MSQB 2I2YA 1C78A 2Z59B 3PZDA 3ZXVA 1R4NB 3ENEA 1V5TA 4MGKE 1FM0D 3PLVA 4DXAB 1WIAA 2LMCA 4EEWA 5E6OA 1FO4A 4HK2A 2CU1A 1B9RA 1L7YA 3WALA 2JUOA 2Q5WD 3IAM1 2PIAA 3LDZE 4FADA 2HJ8A 2AYOB 2PTLA 2Y3AA 4IM3A 3ZUNA 1UGJA 4FN2A 1VZ7A 2Y5BB 1FCCC 2D3BA 1D3ZA 3N1YC 4OVUA 1I4XA 5JXVA 1DOXA 4GDLA 4YSXB 1ET9A 1YQ4B 1IUEA 1E8WA 2KVZA 2WXRA 2N9EB 3AV8A 1NENB 2V0GA 5HG2A 1KLGD 2IGDA 4YTNB 3H1UA 2NVUI 4NJ7A 3PHXB 2KN4A 1SE9A 2KXJA 4GXBA 4JLCA 1CK1A 3TCAA 2DAJA 4F8CB 5KHQA 1YN5A 1IBXB 2ON8A 3ML8A 1P0RA 2RGFA 2WXGA 3DOWA 2BGFA 2WP9B 1SJHD 4JQWC 3WIMA 3RD2A 5IAAC 2D11A 3A1QB 3H8HA 1OEYA 4RNAA 4WJNA 1GB4A 3AEDB 1WFYA 1LO5D 4G50A 3Q3NC 2HD5B 3S2AA 2LRWA 1QOGA 4TUUA 3SFDB 2KJRA 1PFDA 1JRPA 3LB8C 3HVDA 2INNE 1V9JA 4I6PA 4YT0B 5C23A 1HE8A 3ZJUA 5HI1A 2J0KA 4K81A 4B95A 2NBWB 3CIRB 5GMVA 1V49A 2BB5A 3BWUD 4AJWA 5CHVC 4E74A 1EU4A 2R2OA 4MACA 2PE6B 2INPE 2Z0DB 3PREA 4PK1A 3A4SC 4BAXA 3ZQ4A 3SU8X 4P7IA 2K6QA 3RNBC 1WJUA 4XE0A 2CJOA 4HCPB 1GAQB 3VR9B 3AE6B 1WXMA 4YL8A 5C1ZA 1Q5WB 1KFYB 4A20A 3SHQA 3B1LX 2Z0EB 3ZRFA 3BZDB 3U52E 1UGMA 2KANA 2DHZA 2V3SA 4GU2A 4WAAA 2QC8A 1RWSA 1I4PA 1PGXA 4A9AA 2JF5A 1UBIA 1WJNA 1L4DB 2KACA 1C4PA 1QOAA 2LGSA 1YN4A 1JW9D 2Y5CA 2MJDA 1D5XC 2XNAC 3EA6A 1FIQA 4XDCA 3IT4B 1GC7A 2J0JA 3V62A 2RDBC 2VH1A 2Z8LA 4GDKB 1UF0A 2C9WB 1SE3A 4H2AA 1V6EA 3P4QB 2X38A 5AZHA 2KT7A 3Q8AA 1HQRD 1KH0A 3TEZA 4N58A 4IC7B 2ICIA 2OJWA 5DPSA 5D6JB 4N6EB 1QKZA 3MP9A 3SDLC 1HTOA 2W3SA 1ZDXA 4LTUA 4ANVA 4R3DA 2H89B 3V60A 4KDLB 5HKHA 2KDEB 3HVZA 3ZW3A 3IFWB 2MSED 2HTHA 4W9DA 3W5UB 2JZZA 3VUWA 3FKYA 4A3OA 1K51A 4M0WB 4D2KA 1VJKA 4FULA 1SSNA 3Q3OC 3DBLI 5BMHA 3RULA 5H92C 3Q8EA 3PLUA 4JPSA 3AI5A 1EO6A 1NYRA 1DOIA 2BYVE 2HTME 2FCNA 4ZRKA 1YMHE 1KF6B 3IAS1 3JVZX 4YXDB 5LXHA 1AYFA 3CMMB 3ZDTA 2FIDA 4MSMB 2ZCBA 5AUKA 3FILA 3Q3FA 4ARIA 1NI2A 4K7UA 1WX7A 1GPXA 4YSYB 2LWPA 2L00B 3QIJA 2WU5B 4MH0E 3AEAB 4IM2A 5I4DA 3QHTA 3AE2B 1WX9A 1YD8U 4XDDA 3RZFA 3JSVB 4HEA1 4FJZA 3PZ7A 3W9CB 3DVGY 4NNJB 3V61A 3APCA 4XX5A 3PRZA 1ZKHA 3VVWB 2JX5A 1TBEA 4GIVA 2NR2A 2NPTB 2C60A 4AQ7A 2CHXA 5IA7A 1C79A 1UUPA 3W1YA 3UQAA 2QJLA 1UH6A 1KRHA 4B6WA 3GS2A 2SEBD 4ASWC 4RGTA 2KQ4X 4BBNF 3ZIMA 3HUIA 3ZRCA 1WE7A 3W1SC 2L05A 5E6PA 4TKNA 2W9NA 1YNTE 3Q3JA 4E3CA 1WGDA 3TEXA 2NCNA 2PW9A 5LLIA 4P6VF 4GN1A 1YIWA 4RF0A 3IHPC 1WR6E 1YJ1A 2BYTA 2CS4A 3R66C 3KQ4A 5FK9C 3R2IA 3B2GA 1TS2A 1EM7A 2ZPNA 4RMAA 4MM3B 2KWUB 2WDVB 4C4VA 1ZP0B 2G9HD 2INCC 3BVMA 2I38A 2WYQA 3MC8A 4RCOA 2RPVA 3L13A 3RN9C 2LGIA 2D10A 1QQRA 3IG3A 3IT6B 2DAFA 2DZIA 5EE3A 1NI3A 3GZNI 3N1XC 3LXFA 2IBIB 2QCZA 1EUVB 5JZEB 1DGJA 1ENFA 1L5PA 2BB6A 4RGMA 1V1PA 2MA9B 3PRMB 2KZRA 4BOSC 2LXCA 1ZW7A 3C0RB 2XEWA 3NHEB 1XLOA 2ONQA 2V4IB 1RM6C 2MLBA 2WXMA 1J8CA 1HEZE 1L0XB 2BQQA 4GSWA 3ZO5B 4IDIA 4GDLB 2YVCA 1XLQA 4OVVA 2VRRB 2MBOA 2GLSA 2JQRB 1P7FA 4P1BC 3EC8A 3GE3C 1J19A 4DXFA 3ZVVA 3I57A 2R2QA 1T0YA 1WRIA 1WXAA 3ABVB 3HM6X 2KWCA 2N9KA 4KSLC 2MBBB 4RFBA 3A9KA 4NAWA 2LUEA 4A8XC 3NS1A 2M1MA 1TIFA 1FXIA 5TSSA 3ZNHB 5AUIA 2LZ6A 1N6ZA 4G3XB 4W9EA 1WGYA 3X23A 2XK5A 4GOCA 3N9YC 2ZZPB 5JH5C 3ONSA 1YJIA 3RNGC 2D3CA 1E9MA 2WXQA 1IP9A 3Q14C 3PRPB 4ZRQA 2DYOA 2B76B 3KWVA 1VR9A 3N3KB 3GOEA 1L2NA 1ZXHA 1YQBA 2WXKA 4HKZE 1P3QU 3W2DA 1KTKA 2FNJB 2I1JA 1C4CA 2KKCA 1DOYA 3Q2AC 1WZ3A 4ZYSA 5EE1A 4FLHA 1NBFC 1FFUA 4M00A 3KUCB 3Q8BA 2V3NA 2KLCA 3QCAA 3RPFC 4ZOHC 2O2VA 1E8XA 2KC2A 3TMPB 5HHDG 3N32A 1E90A 1VRAB 1P7EA 1FEHA 3APFA 3GE8C 2KTFA 5AEKB 4NZLB 5BYSA 5D94A 4LCDE 3MJ5A 3L54A 1MFWA 3DBSA 5T8IA 2L1AA 1GC6A 2PPHA 3BK2A 3U7ZA 2O6VB 4ZHOA 2K8BA 3TIXA 1C1YB 3UIOB 2MX2A 1SEBD 2WDQB 5IO9A 5LNK1 1E8YA 1TY0A 3V6CB 4A6QA 1LM8B 1WJ6A 2JXTA 2FUHB 2NMQA 3LYYA 4HROA 3AXCA 3AE8B 3B9JA 3TJPA 3WA0A 1SE2A 1K53A 2L7RA 2RR9A 1GNUA 2CHZA 1FD6A 1C3TA 2N4FA 4BKTA 2DBYA 3U8ZA 2KQSA 1ET6A 1WH3A 4ZYNA 1WRDB 4W9HA 4KGSA 2ZW0A 1RAXA 2IGHA 4MGIE 3U2SC 1KLVA 4J3OD 2JSVX 3SD5A 1TGZB 3V6EB 1R4NI 4LDTD 3ZJTA 2ZEQA 4EZLA 2B3AA 5HFYA 1WSPA 2KWVB 1I4GA 3AMZA 3VUYA 3DBHB 1C4AA 2HJ1A 4W9JA 4B9KA 3A4RA 3N30A 1Y8RC 1ZXIA 3KLSX 4HDOA 1IGCA 1JMLA 1FRDA 1TTNA 2RPQA 2ZW1A 4NAMA 1WZ0A 5JHBA 2MHJA 2X8XX 4LLGM 2AQ2B 1T0SC 3PSEB 3RCZA 1A5RA 1S1QB 2IZVB 3UINB 1YX6B 2IY1B 1L6VA 3PT2B 3ZKJC 2KMMA 4ZRJA 2OOBB 1SBBB 3FILB 2BKFA 1VZ8A 1AARA 1PDXA 4TSSA 5G55A 1X1MA 5BMGA 1XCQL 3UIPB 4ICUA 3OG5A 5BMIA 5EDSA 5CX3A 1CZPA 3DVNU 3R7QA 4US9A 1KM7A 2FBWB 2KMCA 4ITKA 4BKSD 4NJ6A 4GMVA 3DBRB 4L1BA 4NQKE 4M8NA 2JWUA 3HHMA 4ANUA 4DHZB 4N9F4 4WWMA 4WIPA 3MFGA 4RGNA 3BINA 2W3RA 4Q2JA 4HPMB 3DBRI 2NBUA 2L8JA 3BVGA 1ZPSA 3PPAA 2AX5A 2RSUA 3OWEB 3NVWA 4GLSC 3PVLA 2A4ZA 1WY8A 4W9KA 2KJHB 1MJDA 3N20C 2JZ3B 3KH0A 3P42A 4RM8A 2OJRA 1FRRA 4MGZE 1DYQA 1IGDA 3Q6BA 2V9HA 3K9OB 4P1CC 2BKRB 4C4VB 2IPKD 2FCMA 5D2MB 4K7SA 2D2QA 2VZKB 4C56C 3KYDD 4LNOA 3WCQA 3BIID 3DQVA 4XWWA 5J2RA 2N9XA 4K7WA 3ZYYX 3ZJVA 3HRDD 1V1PB 4X57B 4A55A 1WXQA 1Y56A 1K50A 1UWMA 4HRSA 4CYEA 4M8MA 4KZCA 4JWUC 3U7DA 1WGHA 5L95C 2KD0A 2M0XA 2BVCA 3ZNZB 2KAJA 1I4RA 1YOVB 3GP7A 4RF1A 3BYYB 4G0NB 2HDEA 4LJPB 2WDTB 1N60A 5DCNA 4II3B 4YWGG 4PYUA 3NJTA 4LNNA 3VUXA 1J0GA 2MH7A 3IXSA 1WXSA 3WANA 1F77A 4RH6A 3TSSA 3B0AA 1QF6A 3DWMA 3RNFC 2LVQA 3A9KB 1RYJA 2LJIA 4NAWB 3RI7C 1F0ZA 3TEWA 2WXOA 2V4LA 2KLGA 1V5OA 4ZRIA 4JX1C 4KIKA 1T0QC 2K8CA 3HM3A 4EOYA 2ZCCA 2MP2A 4UDUC 4XWTA 2XK5B 1VZ6A 2M19A 2E6XA 2FIFA 3C19A 2DZMA 3ETRA 3I3TB 3DHHC 4OZCA 1MHXA 2K22A 2AQ3B 2OHFA 2IO2B 1TS5A 4C7ZA 4F7ZA 3AE3B 3RMKC 2KFKA 3AB5A 2PEAA 4OVZA 3RNEC 4BKSA 3RUIB 2WXNA 3WAPA 3PGEA 2IY0B 2QMTA 2IGGA 3KW5B 1EU3A 3Q69A 2AL6A 2WS3B 3A9JA 3UI3A 1I4QA 1AWDA 4PYZA 1WGRA 2L0TA 5C3JB 1V81A 4MJSA 2KFJA 4NPNA 2O2VB 4BKGA 1GB1A 5G5HA 5FKAC 1E0ZA 4RGOS 2ZPYA 3DWGC 2TSSA 4MH8A 1L0VB 1JROA 4IW0A 3LJ3A 4DDID 1E8ZA 2LI5A 3RT3B 2W54A 2M17A 3VH3B 1LGRA 2N1WA 1D5MC 1F52A 1E6EB 1PGBA 4JGHB 2EELA 4IG7B 2J53A 4ICVA 3ECIA 1C76A 2CR5A 3TUOA 2PVGC 2QHOA 1F1HA 2ZJDA 1BMLC 3PO0A 1ESFA 2DZJA 1WE6A 2I1KA 4XZ4A 2FE8A 1PGAA 3QK0A 2PMVA 2LRUA 1TY2A 3OLMD 5KHOA 2ACZB 3A33B 2MRPA 1B1ZA 3NY5A 4DWFA 4W9IA 2LGXA 4TQ0A 1WYWB 3QX1A 5BYRA 4JL9A 1JWSD 4USAA 3AE9B 2K3UA 3O13A 2DLBA 5H8YE 3RNAC 2FAZA 2J7QB 1T0RC 2KTRA 2EKEC 3Q8FA 3FC4A 3VR8B 3RNCC 2IO3B 3BYTB 3KVFB 2G4SA 1FXTB 4P16A 5EE0A 2K1FA 2PVOD 1TKGA 3VTUA 1PYWD 1N5WA 4C80A 2BWES 3V3XA 4GGQA 1I7HA 2N9PC 2WXJA 2WLBA 4EKUA 3QAQA 4REZA 2JU6X 4FHKA 3KUZA 4HLEA 3KYCD 4DHZE 1N5XA 4EZJA 2M56B 2CKHB 4M01A 5GXGB 3H7PA 2UWQA 3NG0A 3QQ8B 4KZ0A 1FNWA 2MW5A 4MT5A 5FR3A 1TZOA 2DWQA 3E56A 2KNBA 1GOZA 4BFRA 2KC1A 3R8BA 4AWJA 1L6UA 2GMIC 2NBVB 1D4BA 2K9XA 2GBJA 3RYTA 1F9JA 4YTMB 1TKYA 3I63C 3W1SA 5DPTA 2PJHA 1R4MB 3VXWA 2JRHA 4J6IA 3L16A 2ZVNA 2WHIA 2KDIA 3H9DA 5LXIB 4HVBA 3RFZB 5L83A 3AEGB 4WH4A 1SJED 4DHJB 1FCLA 1XQQA 2RDHA 2BS4B 4GB9A 1V97A 3DDCB 4XC2A 1G6JA 3BVZA 1BUIC 2KDBA 2LHEA 3B2FA 4B0EA 4EZKA 1L0YB 3P63A 3R3MA 2DYMA 4E71A 2WXIA 1NEKB 2YEPB 4IOIE 1I42A 3K9PB 3JSVA 4HXDA 2HE7A 2RDGA 1FFVA 1MPEA 2KQ7A 2M8SA 5MPOA 4HPLB 3GB1A 4KKIA 3V05A 2AQ1B 2J0MA 2CU3A 2LVOA 3L17A 2MWSB 1L4ZB 3T3NA 3AU4A 2QILA 2KMAA 3P2BA 3IVFA 1KOTA 1WWTA 3MTNB 1S3SG 1M4VA 3AU5A 2XN9C 1TYGB 2G1EA 3M62B 2MBEA 2JRIB 4HPPA 1P1AA 4TMAB 3EFCA 3MJWA 4S17A 1SIJA 4O1NA 4LNFA 4WWOA 2JYTA 3ZTDA 2LGYA 3AE7B 1JQ4A 2KVRA 2DX5B 2IDYA 3U4EG 3AEBB 1E10A 2O6VD 2C5LC 3VTVA 1P9DU 4ACFA 4BOZB 4JWSC 3VRAB 5J18A 3VTWA 1OFFA 1CMXB 1HXYD 2MJ3A 1XEEA 4RM9A 1T5XD 3VQIA 4KX6B 4A3PA 3AM9A 1V8CA 4DBGA 4HJKA 2MCNB 4IWQA 1V1OA 1E7PB 5CHFA 3MHSD 2EMTA 2WX1A 2KK8A 3VFKA 1J7CA 1Z5SB 3ML9A 1WMHA 1U4AA 1Q0WB 3L4PA 1WJ4A 1Z2MA 2C7MB 4K3CA 2DZKA 4KIKB 1IYFA 3TBLD 4JE3B 3DBHI 4AJYB 2INDC 4YTPB 2MP2B 2JXXA 3MC9A 2K6DB 3DVGX 2JYEA 2DYBA 3EFUA 3PTFC 2KYWA 3AN1A 2FCSA 3VH4B 3QJZA 3AEFB 5E6JA 2ZNVB 3NRZA 4WWNA 1K8RB 2C7HA 2KFKB 1KLUD 1QILA 2KHWB 2V3PA 1WGGA 4DK5A 4KGTA 1RLFA 1D6EC 3CSTA 4K3BA 1RFKA 2M0AA 1PUTA 4W9FA 4N59A 3L0WB 1YQ3B 3A9JB 1SGHA 1NVID 2FUG1 4F1SA 3T9LA 1UELA 3HIZA 4MJSB 2LJ5A 3KWLA 2K39A 3CWIA 3NZ3A 3AECB 3P4PB 2BF8B 2BS3B 4G11A 1H4RA 4AP4C 2NTSA 2WWZA 4WQMA 4DQOC 4HWIB 2AL3A 3AEEB 3OJ3A 2WNMA 2LHDA 1JWUD 3ZDMC 2EKIA 2GBMA 1YX5B 3E9SA 4ANXA 2NS5A 1UNSA 2BPSA 2N0SB 1UD7A 3N1ZC 1EF5A 3QC8B 1MG8A 1N61A 1SB3C 3DPDA 4B0MA 4ANWA 2N9LA 2OEDA 4IM0A 1UZXB 2ZNVC 1AW7A 4WWPA 5TR5A 4KV2A 1CQVA 4IKGA 4PS8A 1EWCA 1GJZA 2KDMA 1WR1A 4EUTA 2NTTA 4C00A 2GB1A 1JRUA 1N63A 4URKA 2CHWA 3EGRA 1Q10A 2J4XA 2L52A 3ZNID 2J52A 4I6NB 4AS1A 3OJ4B 1Q1OA 2GI9A 3L08A 5DPWA 3ZTCA 3AE1B 1ZOYB 2KDFB 2O6VA 1D5ZC 1ZE3D 3ZNGC 2MQJA 4L23A 3CF6E 2H88B 1BT0A 3NUHB 2DENB 3EUB2 5G2NA 3VAWA 4ZDVA 4II2B 2MBQA 4AUQC 3H7SA 2KTRB 2VZKD 1MVKA 2WDRB 3QARA 4DDGD 1QT9A 1T3QA 5FR6A 2G4DB 3VHTC 4IWPA 1KJTA 1TS4A 4TQ1A 2WGSA 1BXTA 1VLBA 3DVNV 2SAKA 4KDIC 1HA5A 3P4RB 4OHJA 2K0PA 2D07B 2LUMA 1TJEA 3DCGA 3Q3MC 3C8YA 1QOBA 4FJYA 2WXFA 4W9LA 3H7PB 2R61A 2MEKA 2RD0A 3DBLB 5D3IB 2MBHA 3DHIC 1OGWA 2C7NB 3UQBA 2BYEA 2GBNA 4WJQA 4FA6A 3VDZA 1XO3A 1WYGA 4MELA 4WJOA 2AEHA 2IYDB 1V80A 2LGDA 2N7EA 3M63B 2WXPA 1LQBA 2J42A 3ZGZA 1NDDA 2WQYB 1J7AA 5AZGA 1ZDVA 5AZFA 1N62A 2UU7A 1FXAA 1VDVA 1JWAD 1FNVA 2KJ6A 1F2RI 4CO7A 1IBXA 2WU2B 3APDA 2G45B 4ZRPA 3NVYA 5IOIA 5E6NA 2Y5PA 1WXVA 3WAMA 3TL5A 3AH7A 3UGBB 3A1QA 3KUDB 2N1VA 3L10B 4PS7A 2A5UA 2L3ZA 3W5VB 3NOBA 2ASQA 2DNFA 1OQQA 1FPYA 3P1MA 4I6LB 3ZLZA 1OEYJ 1ZUD2 2JZPA 1J7BA 3NZUA 2XBBC 5G5GA 3AULA 4LNKA 2D5GA 2KOXA 1XT9B 1T6BX 1OTRB 2IO1B 3X0WA 3PS6A 4XGAB 3R2TA 2KX0A 2LFIA 1PQSA 3IBEA 1A70A 2KN5A 3BK1A 1I35A 1MHHE 3ZXRA 4EE2A 2BBCA 5D7GA 3JYUA 1STEA 2FCQA 1JWBD 1F2RC 4IUMB 4YSZB 1E5WA 4FHJA 1WX8A 4AOFA 2QEJC 4WURA 1JALA 1R7SA 1HZ6A 4CQNA 1QLBB 4A90A 1GG3A 3TEYA 5DPRA 1SXTA 3AE4B 4ARCA 4TV3A 1WF9A 2W82A 1XF5L 3GZNB 1YJJA 2M4NA 4HDQA 3VRBB 1UWXA 1HZ5A 1XLPA 2YEPF 1IPGA 3RZWC 2BS2B 1NYQA 5BO4B 2KO3A 1TS3A 1RRBA 5IP4D 1C9FA 2GRIA 2D3GA 3NZSA 4GDKA 1P98A 4MEMA 3SFEB 4BZAA 1WGKA 1LFDA 2WXHA 1QOFA 1AN8A 3I9V1 3JW0X 1WMHB 2JT4B 3D32A 3O65B 2D3AA 1K52A 4JIOU 3WAOA 2QSDA 1V86A 1FMAD 2K8HA 1SF0A 3OAWA 4LJOB 4W9CA 3T8MA 5IN7A 4NY0A 4LNIA 3DHGC 3SEBA 4PS3A 2YLMA 2BW2A 1OQRA 1V2YA 2PLPA 3HK0A 4KVGB 2BYFA 2V1YA 3T3OA 2IO0B 4DXGA 3EECA 4LK0M 2BWFA 3AE5B 2PKOA 2KX3A 4OZBA 1QZEA 4M0WA 3H6NA 2JY6A 1MG4A 2CJNA 2W55A 3Q8CA 2JWZA 1C77A 2LASA 2EMSA 1SIFA 4FXCA 3NVVA 1EF1A 1EWYC 2LD9A 1JCKB 5CTRC 3ALBA 2IJ0A 5BYQA 2BTEA 3U30A 4MDKE 4MGYE 4WQOB 4HJGE 2GOWA 1TZ1A 4KSKC 2UYZB 2E3TA 4XYCA 5IKCM 2WX0A 1R4MI 1WM3A 2LXAA 3I5JC 2LVPA 1XD3B 4FJVB 4EFOA 4K1RB 4OZAA 2QIEB 2L32A 4M02A 1RFAA 4FBJB 4OW0A 1SE4A 1TKEA 1ISNA 2N7JA 1H8CA 2K5PA 1YN3A 3QWZB 4KKJA 1FNUA 3J9CA 1ZGUB 1VCBA 1XCTL 3URYA 1UBQA 4S0RA 2QDFA 1TT5B 3NS8A 4DHJD 4L2YA 2GBRA 4HKQA 3MC0B 1M94A 1MI0A 1E7VA 2ZVOA 4KGRA 2K25A 2NPTA 3PV1A 1I4HA 1WI0A 2L76A 5EE9A 5C2TB 1ACCA 5D3DA 2AWTA 2PE9A 2MJEA 3EHVA 3R7RA 3M95A 5JHAA 4BVUC 3FAHA 1LXDA 3NVZA 1VD2A 1XLNA 1GUAB 2L0FA
chains in the Genus database with same CATH topology
2BF8B 2GBKA 5J17A 3HM3A 2MA9B 3QA8A 4G11A 1H4RA 4EOYA 4AP4C 2ZCCA 3PRMB 2KZRA 2MP2A 2WWZA 4BBNC 4BOSC 2LXCA 2XK5B 1ZW7A 2N7DA 3C0RB 3UF8A 4HWIB 2AL3A 2FIFA 2XEWA 3NHEB 4CHKA 1WM2A 2DZMA 3I3TB 3OJ3A 2MLBA 4W9GA 1J8CA 2IO2B 3PHWB 4GSWA 3ZO5B 2JPHA 3M3JA 3ZDMC 2G3QB 4F7ZA 4IWOA 3BY4B 2GBMA 1YX5B 2KFKA 2PEAA 4GDLB 4HCNB 4BKSA 3RUIB 2YVCA 5CHWA 4ANXA 4WJPA 2NS5A 2BPSA 3PGEA 2IY0B 4MM3A 4OVVA 3WAPA 1UD7A 2VRRB 2MBOA 1EF5A 2REXA 3CSFA 3QC8B 4LDTB 1MG8A 3KW5B 1E7UA 3B08A 2JVCA 2AL6A 3DPDA 4ANWA 1OQYA 3EC8A 4IM0A 1J19A 3A9JA 1UZXB 3ZVVA 2ZNVC 4NQLB 4WWPA 4PYZA 2R2QA 1T0YA 4MSQB 5TR5A 1WGRA 2L0TA 2Z59B 3PZDA 4KV2A 3ENEA 1WXAA 1V5TA 3HM6X 1V81A 4MGKE 4PS8A 2KWCA 1GJZA 4KSLC 4MJSA 1WR1A 2MBBB 2KFJA 3A9KA 3PLVA 4NAWA 4DXAB 4EUTA 2LUEA 1WIAA 4NPNA 1JRUA 2O2VB 2M1MA 5E6OA 4EEWA 4HK2A 4BKGA 2CU1A 4URKA 2CHWA 3ZNHB 1L7YA 3ZNID 2ZPYA 2LZ6A 4I6NB 3WALA 4G3XB 2JUOA 3OJ4B 4IW0A 4W9EA 1Q1OA 1WGYA 3L08A 3LJ3A 3LDZE 3X23A 3ZTCA 4FADA 2XK5A 5DPWA 4DDID 2KDFB 2O6VA 4GOCA 1E8ZA 3ZNGC 2ZZPB 2MQJA 2HJ8A 3ONSA 5JH5C 3CF6E 2LI5A 3RT3B 2AYOB 2M17A 3VH3B 1BT0A 2N1WA 4IM3A 1IP9A 3ZUNA 3PRPB 4JGHB 4FN2A 2DENB 5G2NA 3VAWA 4ZDVA 4II2B 2MBQA 4AUQC 2DYOA 2Y5BB 4IG7B 3N3KB 3H7SA 3GOEA 1D3ZA 2KTRB 4OVUA 1L2NA 3QARA 4DDGD 4GDLA 1YQBA 5FR6A 2G4DB 1P3QU 4ICVA 3ECIA 2CR5A 2FNJB 2QHOA 2I1JA 1E8WA 2KKCA 2ZJDA 3VHTC 4IWPA 1WZ3A 2N9EB 1KJTA 4TQ1A 2DZJA 3H1UA 1WE6A 2NVUI 4NJ7A 3PHXB 4FLHA 1NBFC 3DVNV 2I1KA 1SE9A 2KXJA 4GXBA 4JLCA 4XZ4A 3QK0A 3KUCB 4KDIC 2LRUA 2KLCA 3TCAA 3QCAA 2D07B 2DAJA 3OLMD 5KHOA 4F8CB 5KHQA 2O2VA 1E8XA 3DCGA 2KC2A 3A33B 3TMPB 3N32A 2MRPA 1E90A 1P0RA 2RGFA 3ML8A 3DOWA 2BGFA 3APFA 2KTFA 5AEKB 4FJYA 3NY5A 4JQWC 3WIMA 3RD2A 5IAAC 4W9LA 5D94A 2D11A 4DWFA 3A1QB 4W9IA 1OEYA 2LGXA 4LCDE 1WYWB 3H7PB 3QX1A 4WJNA 4TQ0A 3L54A 2RD0A 2MBHA 4JL9A 1WFYA 3DBSA 1OGWA 2C7NB 4G50A 1GC6A 3UQBA 2BYEA 2PPHA 2HD5B 2GBNA 4WJQA 3S2AA 2LRWA 4FA6A 3VDZA 2FAZA 2O6VB 2J7QB 2K8BA 2KTRA 2EKEC 1C1YB 2KJRA 4MELA 4TUUA 2AEHA 4WJOA 2MX2A 2IO3B 3TIXA 3UIOB 2IYDB 1V80A 2G4SA 3KVFB 1FXTB 2LGDA 2K1FA 2N7EA 3M63B 1LQBA 1V9JA 4I6PA 5C23A 3VTUA 1E8YA 1NDDA 1HE8A 5AZGA 2J0KA 4K81A 5AZFA 2NBWB 3V6CB 1LM8B 4B95A 1WJ6A 5GMVA 2BWES 1V49A 2FUHB 4GGQA 3AXCA 4AJWA 5CHVC 2N9PC 4E74A 4EKUA 2R2OA 3TJPA 2PE6B 3QAQA 3WA0A 2Z0DB 3PREA 2KJ6A 2L7RA 3A4SC 2RR9A 3SU8X 1GNUA 4FHKA 4P7IA 2CHZA 4CO7A 3KUZA 2K6QA 2N4FA 3KYCD 3APDA 2G45B 4HLEA 1C3TA 4DHZE 1WJUA 4BKTA 5E6NA 4EZJA 4HCPB 3U8ZA 3WAMA 1WXVA 2KQSA 2CKHB 3TL5A 1WH3A 1WXMA 3UGBB 3A1QA 4YL8A 3KUDB 3H7PA 2UWQA 4ZYNA 1WRDB 3QQ8B 4W9HA 1Q5WB 2N1VA 4KZ0A 5C1ZA 3L10B 4PS7A 3SHQA 4A20A 1RAXA 4MGIE 2A5UA 2L3ZA 3B1LX 1KLVA 2MW5A 2Z0EB 3NOBA 2ASQA 3SD5A 3ZRFA 2KNBA 1TGZB 1UGMA 2KANA 2DHZA 2V3SA 4GU2A 3V6EB 4BFRA 4WAAA 1R4NI 2KC1A 4I6LB 4LDTD 4AWJA 2JF5A 2GMIC 1UBIA 2NBVB 2ZEQA 1WJNA 3ZLZA 4EZLA 2B3AA 1OEYJ 2GBJA 3RYTA 1F9JA 3NZUA 2KWVB 2XBBC 3W1SA 5DPTA 3AULA 2PJHA 3VXWA 2JRHA 2KOXA 3VUYA 4W9JA 4J6IA 4B9KA 3L16A 1XT9B 2IO1B 1OTRB 3A4RA 2ZVNA 3N30A 1GC7A 3X0WA 2J0JA 3PS6A 1Y8RC 2KDIA 3H9DA 5LXIB 4HDOA 4HVBA 2KX0A 3V62A 1TTNA 4GDKB 1PQSA 3IBEA 2RPQA 5L83A 2C9WB 2KN5A 1I35A 1V6EA 1WZ0A 5JHBA 4DHJB 5AZHA 1XQQA 5D7GA 3PSEB 3JYUA 3RCZA 1A5RA 1S1QB 2FCQA 2IZVB 4GB9A 3UINB 3DDCB 1YX6B 4XC2A 2IY1B 1G6JA 3PT2B 3ZKJC 2KDBA 4IUMB 4IC7B 1E5WA 4FHJA 4ZRJA 1WX8A 4AOFA 4EZKA 5DPSA 2OOBB 2DYMA 3R3MA 4E71A 5D6JB 2BKFA 1AARA 5G55A 1X1MA 3SDLC 1I42A 1GG3A 3K9PB 3JSVA 4HXDA 5DPRA 2HE7A 3UIPB 4ICUA 4TV3A 4ANVA 1WF9A 5EDSA 3V60A 2KQ7A 5CX3A 2M8SA 4KDLB 5HKHA 2M4NA 2KDEB 4HDQA 3DVNU 4HPLB 3ZW3A 3R7QA 1KM7A 2KMCA 3IFWB 2MSED 4BKSD 2HTHA 4NJ6A 4W9DA 2J0MA 4GMVA 1IPGA 2JZZA 3VUWA 3RZWC 4A3OA 4NQKE 4M0WB 2LVOA 3L17A 2MWSB 4FULA 4M8NA 3AU4A 5BO4B 3HHMA 2KO3A 4ANUA 4DHZB 3DBLI 2KMAA 3P2BA 1RRBA 3IVFA 4N9F4 1KOTA 2D3GA 3NZSA 4GDKA 3RULA 1P98A 3MTNB 4MEMA 1S3SG 3BINA 3PLUA 3AU5A 4HPMB 3DBRI 1LFDA 3AI5A 3M62B 2MBEA 3JW0X 1WMHB 1EO6A 2JT4B 2JRIB 2NBUA 3D32A 3O65B 1P1AA 2L8JA 4JIOU 2BYVE 2FCNA 3MJWA 4ZRKA 3PPAA 4WWOA 3JVZX 5LXHA 2RSUA 3ZTDA 2LGYA 3WAOA 3CMMB 3ZDTA 3PVLA 2A4ZA 2KVRA 1V86A 1WY8A 2FIDA 2ZCBA 4MSMB 4W9KA 2DX5B 2K8HA 3Q3FA 3OAWA 1NI2A 2KJHB 2O6VD 4LJOB 2C5LC 3VTVA 4K7UA 4W9CA 1WX7A 2JZ3B 1P9DU 3KH0A 3T8MA 4NY0A 4RM8A 4BOZB 5J18A 2L00B 2LWPA 2OJRA 3QIJA 3VTWA 4PS3A 4MH0E 4IM2A 2YLMA 1CMXB 1V2YA 3HK0A 4RM9A 4KVGB 2BYFA 3QHTA 4MGZE 2V1YA 3VQIA 2IO0B 1WX9A 4A3PA 1YD8U 3EECA 2BWFA 3RZFA 3JSVB 3K9OB 4DBGA 2KX3A 1QZEA 2BKRB 3H6NA 4HJKA 4FJZA 2JY6A 2MCNB 4IWQA 3DVGY 4NNJB 3V61A 2JWZA 3APCA 2FCMA 2LASA 4XX5A 2EMSA 3PRZA 1ZKHA 5D2MB 4K7SA 2D2QA 1SIFA 5CHFA 3VVWB 3KYDD 3MHSD 1TBEA 4GIVA 1EF1A 2EMTA 2WX1A 2KK8A 2LD9A 3VFKA 1Z5SB 3ML9A 2NR2A 2NPTB 2C60A 3DQVA 2CHXA 5IA7A 5CTRC 3ALBA 5J2RA 1WMHA 1U4AA 3W1YA 1Q0WB 3UQAA 1UH6A 3U30A 4MDKE 4MGYE 4WQOB 2N9XA 4K7WA 1WJ4A 1Z2MA 2GOWA 4B6WA 1TZ1A 4KSKC 4ASWC 2C7MB 2DZKA 2UYZB 4KIKB 2WX0A 4BBNF 1IYFA 1R4MI 1WM3A 3TBLD 2LXAA 3ZIMA 4X57B 3DBHI 3ZRCA 4AJYB 2LVPA 2MP2B 2JXXA 1WE7A 2K6DB 1XD3B 3DVGX 4FJVB 4K1RB 2DYBA 3W1SC 4EFOA 2L05A 3EFUA 3PTFC 5E6PA 4TKNA 2W9NA 4M8MA 4KZCA 4CYEA 3Q3JA 4E3CA 1RFAA 2FCSA 3VH4B 3U7DA 1WGHA 5L95C 1WGDA 2KD0A 3QJZA 2NCNA 4FBJB 2M0XA 5LLIA 3ZNZB 4GN1A 2ZNVB 1YIWA 1ISNA 3IHPC 1WR6E 1YJ1A 4WWNA 2CS4A 1H8CA 3R66C 1K8RB 3QWZB 4G0NB 2C7HA 1ZGUB 2KFKB 4LJPB 2WDTB 2KHWB 1VCBA 2ZPNA 1UBQA 4RMAA 1WGGA 2KWUB 5DCNA 4DK5A 1RLFA 4II3B 3NS8A 4PYUA 3CSTA 4DHJD 2GBRA 3VUXA 4W9FA 2WYQA 1J0GA 1M94A 3L0WB 1E7VA 3L13A 3A9JB 1SGHA 1WXSA 2ZVOA 2D10A 3WANA 2K25A 2NPTA 3PV1A 1WI0A 2L76A 4F1SA 3T9LA 3IG3A 3B0AA 2AWTA 1UELA 2DAFA 2DZIA 2PE9A 3HIZA 3GZNI 3EHVA 4MJSB 2IBIB 2LVQA 1EUVB 3R7RA 3A9KB 2LJ5A 4NAWB 5JZEB 2K39A 3M95A 5JHAA 4BVUC 2V4LA 2KLGA 1V5OA 4ZRIA 1LXDA 1VD2A 4KIKA 2K8CA 1GUAB 2L0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BF8 B;  2GBK A;  5J17 A;  3HM3 A;  2MA9 B;  3QA8 A;  4G11 A;  1H4R A;  4EOY A;  4AP4 C;  2ZCC A;  3PRM B;  2KZR A;  2MP2 A;  2WWZ A;  4BBN C;  4BOS C;  2LXC A;  2XK5 B;  1ZW7 A;  2N7D A;  3C0R B;  3UF8 A;  4HWI B;  2AL3 A;  2FIF A;  2XEW A;  3NHE B;  4CHK A;  1WM2 A;  2DZM A;  3I3T B;  3OJ3 A;  2MLB A;  4W9G A;  1J8C A;  2IO2 B;  3PHW B;  4GSW A;  3ZO5 B;  2JPH A;  3M3J A;  3ZDM C;  2G3Q B;  4F7Z A;  4IWO A;  3BY4 B;  2GBM A;  1YX5 B;  2KFK A;  2PEA A;  4GDL B;  4HCN B;  4BKS A;  3RUI B;  2YVC A;  5CHW A;  4ANX A;  4WJP A;  2NS5 A;  2BPS A;  3PGE A;  2IY0 B;  4MM3 A;  4OVV A;  3WAP A;  1UD7 A;  2VRR B;  2MBO A;  1EF5 A;  2REX A;  3CSF A;  3QC8 B;  4LDT B;  1MG8 A;  3KW5 B;  1E7U A;  3B08 A;  2JVC A;  2AL6 A;  3DPD A;  4ANW A;  1OQY A;  3EC8 A;  4IM0 A;  1J19 A;  3A9J A;  1UZX B;  3ZVV A;  2ZNV C;  4NQL B;  4WWP A;  4PYZ A;  2R2Q A;  1T0Y A;  4MSQ B;  5TR5 A;  1WGR A;  2L0T A;  2Z59 B;  3PZD A;  4KV2 A;  3ENE A;  1WXA A;  1V5T A;  3HM6 X;  1V81 A;  4MGK E;  4PS8 A;  2KWC A;  1GJZ A;  4KSL C;  4MJS A;  1WR1 A;  2MBB B;  2KFJ A;  3A9K A;  3PLV A;  4NAW A;  4DXA B;  4EUT A;  2LUE A;  1WIA A;  4NPN A;  1JRU A;  2O2V B;  2M1M A;  5E6O A;  4EEW A;  4HK2 A;  4BKG A;  2CU1 A;  4URK A;  2CHW A;  3ZNH B;  1L7Y A;  3ZNI D;  2ZPY A;  2LZ6 A;  4I6N B;  3WAL A;  4G3X B;  2JUO A;  3OJ4 B;  4IW0 A;  4W9E A;  1Q1O A;  1WGY A;  3L08 A;  3LJ3 A;  3LDZ E;  3X23 A;  3ZTC A;  4FAD A;  2XK5 A;  5DPW A;  4DDI D;  2KDF B;  2O6V A;  4GOC A;  1E8Z A;  3ZNG C;  2ZZP B;  2MQJ A;  2HJ8 A;  3ONS A;  5JH5 C;  3CF6 E;  2LI5 A;  3RT3 B;  2AYO B;  2M17 A;  3VH3 B;  1BT0 A;  2N1W A;  4IM3 A;  1IP9 A;  3ZUN A;  3PRP B;  4JGH B;  4FN2 A;  2DEN B;  5G2N A;  3VAW A;  4ZDV A;  4II2 B;  2MBQ A;  4AUQ C;  2DYO A;  2Y5B B;  4IG7 B;  3N3K B;  3H7S A;  3GOE A;  1D3Z A;  2KTR B;  4OVU A;  1L2N A;  3QAR A;  4DDG D;  4GDL A;  1YQB A;  5FR6 A;  2G4D B;  1P3Q U;  4ICV A;  3ECI A;  2CR5 A;  2FNJ B;  2QHO A;  2I1J A;  1E8W A;  2KKC A;  2ZJD A;  3VHT C;  4IWP A;  1WZ3 A;  2N9E B;  1KJT A;  4TQ1 A;  2DZJ A;  3H1U A;  1WE6 A;  2NVU I;  4NJ7 A;  3PHX B;  4FLH A;  1NBF C;  3DVN V;  2I1K A;  1SE9 A;  2KXJ A;  4GXB A;  4JLC A;  4XZ4 A;  3QK0 A;  3KUC B;  4KDI C;  2LRU A;  2KLC A;  3TCA A;  3QCA A;  2D07 B;  2DAJ A;  3OLM D;  5KHO A;  4F8C B;  5KHQ A;  2O2V A;  1E8X A;  3DCG A;  2KC2 A;  3A33 B;  3TMP B;  3N32 A;  2MRP A;  1E90 A;  1P0R A;  2RGF A;  3ML8 A;  3DOW A;  2BGF A;  3APF A;  2KTF A;  5AEK B;  4FJY A;  3NY5 A;  4JQW C;  3WIM A;  3RD2 A;  5IAA C;  4W9L A;  5D94 A;  2D11 A;  4DWF A;  3A1Q B;  4W9I A;  1OEY A;  2LGX A;  4LCD E;  1WYW B;  3H7P B;  3QX1 A;  4WJN A;  4TQ0 A;  3L54 A;  2RD0 A;  2MBH A;  4JL9 A;  1WFY A;  3DBS A;  1OGW A;  2C7N B;  4G50 A;  1GC6 A;  3UQB A;  2BYE A;  2PPH A;  2HD5 B;  2GBN A;  4WJQ A;  3S2A A;  2LRW A;  4FA6 A;  3VDZ A;  2FAZ A;  2O6V B;  2J7Q B;  2K8B A;  2KTR A;  2EKE C;  1C1Y B;  2KJR A;  4MEL A;  4TUU A;  2AEH A;  4WJO A;  2MX2 A;  2IO3 B;  3TIX A;  3UIO B;  2IYD B;  1V80 A;  2G4S A;  3KVF B;  1FXT B;  2LGD A;  2K1F A;  2N7E A;  3M63 B;  1LQB A;  1V9J A;  4I6P A;  5C23 A;  3VTU A;  1E8Y A;  1NDD A;  1HE8 A;  5AZG A;  2J0K A;  4K81 A;  5AZF A;  2NBW B;  3V6C B;  1LM8 B;  4B95 A;  1WJ6 A;  5GMV A;  2BWE S;  1V49 A;  2FUH B;  4GGQ A;  3AXC A;  4AJW A;  5CHV C;  2N9P C;  4E74 A;  4EKU A;  2R2O A;  3TJP A;  2PE6 B;  3QAQ A;  3WA0 A;  2Z0D B;  3PRE A;  2KJ6 A;  2L7R A;  3A4S C;  2RR9 A;  3SU8 X;  1GNU A;  4FHK A;  4P7I A;  2CHZ A;  4CO7 A;  3KUZ A;  2K6Q A;  2N4F A;  3KYC D;  3APD A;  2G45 B;  4HLE A;  1C3T A;  4DHZ E;  1WJU A;  4BKT A;  5E6N A;  4EZJ A;  4HCP B;  3U8Z A;  3WAM A;  1WXV A;  2KQS A;  2CKH B;  3TL5 A;  1WH3 A;  1WXM A;  3UGB B;  3A1Q A;  4YL8 A;  3KUD B;  3H7P A;  2UWQ A;  4ZYN A;  1WRD B;  3QQ8 B;  4W9H A;  1Q5W B;  2N1V A;  4KZ0 A;  5C1Z A;  3L10 B;  4PS7 A;  3SHQ A;  4A20 A;  1RAX A;  4MGI E;  2A5U A;  2L3Z A;  3B1L X;  1KLV A;  2MW5 A;  2Z0E B;  3NOB A;  2ASQ A;  3SD5 A;  3ZRF A;  2KNB A;  1TGZ B;  1UGM A;  2KAN A;  2DHZ A;  2V3S A;  4GU2 A;  3V6E B;  4BFR A;  4WAA A;  1R4N I;  2KC1 A;  4I6L B;  4LDT D;  4AWJ A;  2JF5 A;  2GMI C;  1UBI A;  2NBV B;  2ZEQ A;  1WJN A;  3ZLZ A;  4EZL A;  2B3A A;  1OEY J;  2GBJ A;  3RYT A;  1F9J A;  3NZU A;  2KWV B;  2XBB C;  3W1S A;  5DPT A;  3AUL A;  2PJH A;  3VXW A;  2JRH A;  2KOX A;  3VUY A;  4W9J A;  4J6I A;  4B9K A;  3L16 A;  1XT9 B;  2IO1 B;  1OTR B;  3A4R A;  2ZVN A;  3N30 A;  1GC7 A;  3X0W A;  2J0J A;  3PS6 A;  1Y8R C;  2KDI A;  3H9D A;  5LXI B;  4HDO A;  4HVB A;  2KX0 A;  3V62 A;  1TTN A;  4GDK B;  1PQS A;  3IBE A;  2RPQ A;  5L83 A;  2C9W B;  2KN5 A;  1I35 A;  1V6E A;  1WZ0 A;  5JHB A;  4DHJ B;  5AZH A;  1XQQ A;  5D7G A;  3PSE B;  3JYU A;  3RCZ A;  1A5R A;  1S1Q B;  2FCQ A;  2IZV B;  4GB9 A;  3UIN B;  3DDC B;  1YX6 B;  4XC2 A;  2IY1 B;  1G6J A;  3PT2 B;  3ZKJ C;  2KDB A;  4IUM B;  4IC7 B;  1E5W A;  4FHJ A;  4ZRJ A;  1WX8 A;  4AOF A;  4EZK A;  5DPS A;  2OOB B;  2DYM A;  3R3M A;  4E71 A;  5D6J B;  2BKF A;  1AAR A;  5G55 A;  1X1M A;  3SDL C;  1I42 A;  1GG3 A;  3K9P B;  3JSV A;  4HXD A;  5DPR A;  2HE7 A;  3UIP B;  4ICU A;  4TV3 A;  4ANV A;  1WF9 A;  5EDS A;  3V60 A;  2KQ7 A;  5CX3 A;  2M8S A;  4KDL B;  5HKH A;  2M4N A;  2KDE B;  4HDQ A;  3DVN U;  4HPL B;  3ZW3 A;  3R7Q A;  1KM7 A;  2KMC A;  3IFW B;  2MSE D;  4BKS D;  2HTH A;  4NJ6 A;  4W9D A;  2J0M A;  4GMV A;  1IPG A;  2JZZ A;  3VUW A;  3RZW C;  4A3O A;  4NQK E;  4M0W B;  2LVO A;  3L17 A;  2MWS B;  4FUL A;  4M8N A;  3AU4 A;  5BO4 B;  3HHM A;  2KO3 A;  4ANU A;  4DHZ B;  3DBL I;  2KMA A;  3P2B A;  1RRB A;  3IVF A;  4N9F 4;  1KOT A;  2D3G A;  3NZS A;  4GDK A;  3RUL A;  1P98 A;  3MTN B;  4MEM A;  1S3S G;  3BIN A;  3PLU A;  3AU5 A;  4HPM B;  3DBR I;  1LFD A;  3AI5 A;  3M62 B;  2MBE A;  3JW0 X;  1WMH B;  1EO6 A;  2JT4 B;  2JRI B;  2NBU A;  3D32 A;  3O65 B;  1P1A A;  2L8J A;  4JIO U;  2BYV E;  2FCN A;  3MJW A;  4ZRK A;  3PPA A;  4WWO A;  3JVZ X;  5LXH A;  2RSU A;  3ZTD A;  2LGY A;  3WAO A;  3CMM B;  3ZDT A;  3PVL A;  2A4Z A;  2KVR A;  1V86 A;  1WY8 A;  2FID A;  2ZCB A;  4MSM B;  4W9K A;  2DX5 B;  2K8H A;  3Q3F A;  3OAW A;  1NI2 A;  2KJH B;  2O6V D;  4LJO B;  2C5L C;  3VTV A;  4K7U A;  4W9C A;  1WX7 A;  2JZ3 B;  1P9D U;  3KH0 A;  3T8M A;  4NY0 A;  4RM8 A;  4BOZ B;  5J18 A;  2L00 B;  2LWP A;  2OJR A;  3QIJ A;  3VTW A;  4PS3 A;  4MH0 E;  4IM2 A;  2YLM A;  1CMX B;  1V2Y A;  3HK0 A;  4RM9 A;  4KVG B;  2BYF A;  3QHT A;  4MGZ E;  2V1Y A;  3VQI A;  2IO0 B;  1WX9 A;  4A3P A;  1YD8 U;  3EEC A;  2BWF A;  3RZF A;  3JSV B;  3K9O B;  4DBG A;  2KX3 A;  1QZE A;  2BKR B;  3H6N A;  4HJK A;  4FJZ A;  2JY6 A;  2MCN B;  4IWQ A;  3DVG Y;  4NNJ B;  3V61 A;  2JWZ A;  3APC A;  2FCM A;  2LAS A;  4XX5 A;  2EMS A;  3PRZ A;  1ZKH A;  5D2M B;  4K7S A;  2D2Q A;  1SIF A;  5CHF A;  3VVW B;  3KYD D;  3MHS D;  1TBE A;  4GIV A;  1EF1 A;  2EMT A;  2WX1 A;  2KK8 A;  2LD9 A;  3VFK A;  1Z5S B;  3ML9 A;  2NR2 A;  2NPT B;  2C60 A;  3DQV A;  2CHX A;  5IA7 A;  5CTR C;  3ALB A;  5J2R A;  1WMH A;  1U4A A;  3W1Y A;  1Q0W B;  3UQA A;  1UH6 A;  3U30 A;  4MDK E;  4MGY E;  4WQO B;  2N9X A;  4K7W A;  1WJ4 A;  1Z2M A;  2GOW A;  4B6W A;  1TZ1 A;  4KSK C;  4ASW C;  2C7M B;  2DZK A;  2UYZ B;  4KIK B;  2WX0 A;  4BBN F;  1IYF A;  1R4M I;  1WM3 A;  3TBL D;  2LXA A;  3ZIM A;  4X57 B;  3DBH I;  3ZRC A;  4AJY B;  2LVP A;  2MP2 B;  2JXX A;  1WE7 A;  2K6D B;  1XD3 B;  3DVG X;  4FJV B;  4K1R B;  2DYB A;  3W1S C;  4EFO A;  2L05 A;  3EFU A;  3PTF C;  5E6P A;  4TKN A;  2W9N A;  4M8M A;  4KZC A;  4CYE A;  3Q3J A;  4E3C A;  1RFA A;  2FCS A;  3VH4 B;  3U7D A;  1WGH A;  5L95 C;  1WGD A;  2KD0 A;  3QJZ A;  2NCN A;  4FBJ B;  2M0X A;  5LLI A;  3ZNZ B;  4GN1 A;  2ZNV B;  1YIW A;  1ISN A;  3IHP C;  1WR6 E;  1YJ1 A;  4WWN A;  2CS4 A;  1H8C A;  3R66 C;  1K8R B;  3QWZ B;  4G0N B;  2C7H A;  1ZGU B;  2KFK B;  4LJP B;  2WDT B;  2KHW B;  1VCB A;  2ZPN A;  1UBQ A;  4RMA A;  1WGG A;  2KWU B;  5DCN A;  4DK5 A;  1RLF A;  4II3 B;  3NS8 A;  4PYU A;  3CST A;  4DHJ D;  2GBR A;  3VUX A;  4W9F A;  2WYQ A;  1J0G A;  1M94 A;  3L0W B;  1E7V A;  3L13 A;  3A9J B;  1SGH A;  1WXS A;  2ZVO A;  2D10 A;  3WAN A;  2K25 A;  2NPT A;  3PV1 A;  1WI0 A;  2L76 A;  4F1S A;  3T9L A;  3IG3 A;  3B0A A;  2AWT A;  1UEL A;  2DAF A;  2DZI A;  2PE9 A;  3HIZ A;  3GZN I;  3EHV A;  4MJS B;  2IBI B;  2LVQ A;  1EUV B;  3R7R A;  3A9K B;  2LJ5 A;  4NAW B;  5JZE B;  2K39 A;  3M95 A;  5JHA A;  4BVU C;  2V4L A;  2KLG A;  1V5O A;  4ZRI A;  1LXD A;  1VD2 A;  4KIK A;  2K8C A;  1GUA B;  2L0F A; 
#chains in the Genus database with same CATH topology
 5J17 A;  2GBK A;  1HTQ A;  3QA8 A;  2BT6 A;  4BBN C;  2N7D A;  3UF8 A;  3MHZ A;  4CHK A;  1WM2 A;  4W9G A;  4PT5 A;  2KWD A;  2LEK A;  2VH2 A;  3PHW B;  4WAF A;  2JPH A;  4ZHP A;  3M3J A;  3SR6 A;  4US8 A;  1CJE A;  2WXL A;  2G3Q B;  4NJC A;  4IWO A;  3BY4 B;  4HCN B;  5CHW A;  1XXG A;  4WJP A;  4MM3 A;  3PZ8 A;  2REX A;  2RMM A;  3CSF A;  4C7Y A;  4LDT B;  1E7U A;  3B08 A;  2JVC A;  1OQY A;  4QAY A;  1ROE A;  3P4S B;  1JWM D;  2L83 A;  4NQL B;  4MSQ B;  2I2Y A;  1C78 A;  2Z59 B;  3PZD A;  3ZXV A;  1R4N B;  3ENE A;  1V5T A;  4MGK E;  1FM0 D;  3PLV A;  4DXA B;  1WIA A;  2LMC A;  4EEW A;  5E6O A;  1FO4 A;  4HK2 A;  2CU1 A;  1B9R A;  1L7Y A;  3WAL A;  2JUO A;  2Q5W D;  3IAM 1;  2PIA A;  3LDZ E;  4FAD A;  2HJ8 A;  2AYO B;  2PTL A;  2Y3A A;  4IM3 A;  3ZUN A;  1UGJ A;  4FN2 A;  1VZ7 A;  2Y5B B;  1FCC C;  2D3B A;  1D3Z A;  3N1Y C;  4OVU A;  1I4X A;  5JXV A;  1DOX A;  4GDL A;  4YSX B;  1ET9 A;  1YQ4 B;  1IUE A;  1E8W A;  2KVZ A;  2WXR A;  2N9E B;  3AV8 A;  1NEN B;  2V0G A;  5HG2 A;  1KLG D;  2IGD A;  4YTN B;  3H1U A;  2NVU I;  4NJ7 A;  3PHX B;  2KN4 A;  1SE9 A;  2KXJ A;  4GXB A;  4JLC A;  1CK1 A;  3TCA A;  2DAJ A;  4F8C B;  5KHQ A;  1YN5 A;  1IBX B;  2ON8 A;  3ML8 A;  1P0R A;  2RGF A;  2WXG A;  3DOW A;  2BGF A;  2WP9 B;  1SJH D;  4JQW C;  3WIM A;  3RD2 A;  5IAA C;  2D11 A;  3A1Q B;  3H8H A;  1OEY A;  4RNA A;  4WJN A;  1GB4 A;  3AED B;  1WFY A;  1LO5 D;  4G50 A;  3Q3N C;  2HD5 B;  3S2A A;  2LRW A;  1QOG A;  4TUU A;  3SFD B;  2KJR A;  1PFD A;  1JRP A;  3LB8 C;  3HVD A;  2INN E;  1V9J A;  4I6P A;  4YT0 B;  5C23 A;  1HE8 A;  3ZJU A;  5HI1 A;  2J0K A;  4K81 A;  4B95 A;  2NBW B;  3CIR B;  5GMV A;  1V49 A;  2BB5 A;  3BWU D;  4AJW A;  5CHV C;  4E74 A;  1EU4 A;  2R2O A;  4MAC A;  2PE6 B;  2INP E;  2Z0D B;  3PRE A;  4PK1 A;  3A4S C;  4BAX A;  3ZQ4 A;  3SU8 X;  4P7I A;  2K6Q A;  3RNB C;  1WJU A;  4XE0 A;  2CJO A;  4HCP B;  1GAQ B;  3VR9 B;  3AE6 B;  1WXM A;  4YL8 A;  5C1Z A;  1Q5W B;  1KFY B;  4A20 A;  3SHQ A;  3B1L X;  2Z0E B;  3ZRF A;  3BZD B;  3U52 E;  1UGM A;  2KAN A;  2DHZ A;  2V3S A;  4GU2 A;  4WAA A;  2QC8 A;  1RWS A;  1I4P A;  1PGX A;  4A9A A;  2JF5 A;  1UBI A;  1WJN A;  1L4D B;  2KAC A;  1C4P A;  1QOA A;  2LGS A;  1YN4 A;  1JW9 D;  2Y5C A;  2MJD A;  1D5X C;  2XNA C;  3EA6 A;  1FIQ A;  4XDC A;  3IT4 B;  1GC7 A;  2J0J A;  3V62 A;  2RDB C;  2VH1 A;  2Z8L A;  4GDK B;  1UF0 A;  2C9W B;  1SE3 A;  4H2A A;  1V6E A;  3P4Q B;  2X38 A;  5AZH A;  2KT7 A;  3Q8A A;  1HQR D;  1KH0 A;  3TEZ A;  4N58 A;  4IC7 B;  2ICI A;  2OJW A;  5DPS A;  5D6J B;  4N6E B;  1QKZ A;  3MP9 A;  3SDL C;  1HTO A;  2W3S A;  1ZDX A;  4LTU A;  4ANV A;  4R3D A;  2H89 B;  3V60 A;  4KDL B;  5HKH A;  2KDE B;  3HVZ A;  3ZW3 A;  3IFW B;  2MSE D;  2HTH A;  4W9D A;  3W5U B;  2JZZ A;  3VUW A;  3FKY A;  4A3O A;  1K51 A;  4M0W B;  4D2K A;  1VJK A;  4FUL A;  1SSN A;  3Q3O C;  3DBL I;  5BMH A;  3RUL A;  5H92 C;  3Q8E A;  3PLU A;  4JPS A;  3AI5 A;  1EO6 A;  1NYR A;  1DOI A;  2BYV E;  2HTM E;  2FCN A;  4ZRK A;  1YMH E;  1KF6 B;  3IAS 1;  3JVZ X;  4YXD B;  5LXH A;  1AYF A;  3CMM B;  3ZDT A;  2FID A;  4MSM B;  2ZCB A;  5AUK A;  3FIL A;  3Q3F A;  4ARI A;  1NI2 A;  4K7U A;  1WX7 A;  1GPX A;  4YSY B;  2LWP A;  2L00 B;  3QIJ A;  2WU5 B;  4MH0 E;  3AEA B;  4IM2 A;  5I4D A;  3QHT A;  3AE2 B;  1WX9 A;  1YD8 U;  4XDD A;  3RZF A;  3JSV B;  4HEA 1;  4FJZ A;  3PZ7 A;  3W9C B;  3DVG Y;  4NNJ B;  3V61 A;  3APC A;  4XX5 A;  3PRZ A;  1ZKH A;  3VVW B;  2JX5 A;  1TBE A;  4GIV A;  2NR2 A;  2NPT B;  2C60 A;  4AQ7 A;  2CHX A;  5IA7 A;  1C79 A;  1UUP A;  3W1Y A;  3UQA A;  2QJL A;  1UH6 A;  1KRH A;  4B6W A;  3GS2 A;  2SEB D;  4ASW C;  4RGT A;  2KQ4 X;  4BBN F;  3ZIM A;  3HUI A;  3ZRC A;  1WE7 A;  3W1S C;  2L05 A;  5E6P A;  4TKN A;  2W9N A;  1YNT E;  3Q3J A;  4E3C A;  1WGD A;  3TEX A;  2NCN A;  2PW9 A;  5LLI A;  4P6V F;  4GN1 A;  1YIW A;  4RF0 A;  3IHP C;  1WR6 E;  1YJ1 A;  2BYT A;  2CS4 A;  3R66 C;  3KQ4 A;  5FK9 C;  3R2I A;  3B2G A;  1TS2 A;  1EM7 A;  2ZPN A;  4RMA A;  4MM3 B;  2KWU B;  2WDV B;  4C4V A;  1ZP0 B;  2G9H D;  2INC C;  3BVM A;  2I38 A;  2WYQ A;  3MC8 A;  4RCO A;  2RPV A;  3L13 A;  3RN9 C;  2LGI A;  2D10 A;  1QQR A;  3IG3 A;  3IT6 B;  2DAF A;  2DZI A;  5EE3 A;  1NI3 A;  3GZN I;  3N1X C;  3LXF A;  2IBI B;  2QCZ A;  1EUV B;  5JZE B;  1DGJ A;  1ENF A;  1L5P A;  2BB6 A;  4RGM A;  1V1P A;  2MA9 B;  3PRM B;  2KZR A;  4BOS C;  2LXC A;  1ZW7 A;  3C0R B;  2XEW A;  3NHE B;  1XLO A;  2ONQ A;  2V4I B;  1RM6 C;  2MLB A;  2WXM A;  1J8C A;  1HEZ E;  1L0X B;  2BQQ A;  4GSW A;  3ZO5 B;  4IDI A;  4GDL B;  2YVC A;  1XLQ A;  4OVV A;  2VRR B;  2MBO A;  2GLS A;  2JQR B;  1P7F A;  4P1B C;  3EC8 A;  3GE3 C;  1J19 A;  4DXF A;  3ZVV A;  3I57 A;  2R2Q A;  1T0Y A;  1WRI A;  1WXA A;  3ABV B;  3HM6 X;  2KWC A;  2N9K A;  4KSL C;  2MBB B;  4RFB A;  3A9K A;  4NAW A;  2LUE A;  4A8X C;  3NS1 A;  2M1M A;  1TIF A;  1FXI A;  5TSS A;  3ZNH B;  5AUI A;  2LZ6 A;  1N6Z A;  4G3X B;  4W9E A;  1WGY A;  3X23 A;  2XK5 A;  4GOC A;  3N9Y C;  2ZZP B;  5JH5 C;  3ONS A;  1YJI A;  3RNG C;  2D3C A;  1E9M A;  2WXQ A;  1IP9 A;  3Q14 C;  3PRP B;  4ZRQ A;  2DYO A;  2B76 B;  3KWV A;  1VR9 A;  3N3K B;  3GOE A;  1L2N A;  1ZXH A;  1YQB A;  2WXK A;  4HKZ E;  1P3Q U;  3W2D A;  1KTK A;  2FNJ B;  2I1J A;  1C4C A;  2KKC A;  1DOY A;  3Q2A C;  1WZ3 A;  4ZYS A;  5EE1 A;  4FLH A;  1NBF C;  1FFU A;  4M00 A;  3KUC B;  3Q8B A;  2V3N A;  2KLC A;  3QCA A;  3RPF C;  4ZOH C;  2O2V A;  1E8X A;  2KC2 A;  3TMP B;  5HHD G;  3N32 A;  1E90 A;  1VRA B;  1P7E A;  1FEH A;  3APF A;  3GE8 C;  2KTF A;  5AEK B;  4NZL B;  5BYS A;  5D94 A;  4LCD E;  3MJ5 A;  3L54 A;  1MFW A;  3DBS A;  5T8I A;  2L1A A;  1GC6 A;  2PPH A;  3BK2 A;  3U7Z A;  2O6V B;  4ZHO A;  2K8B A;  3TIX A;  1C1Y B;  3UIO B;  2MX2 A;  1SEB D;  2WDQ B;  5IO9 A;  5LNK 1;  1E8Y A;  1TY0 A;  3V6C B;  4A6Q A;  1LM8 B;  1WJ6 A;  2JXT A;  2FUH B;  2NMQ A;  3LYY A;  4HRO A;  3AXC A;  3AE8 B;  3B9J A;  3TJP A;  3WA0 A;  1SE2 A;  1K53 A;  2L7R A;  2RR9 A;  1GNU A;  2CHZ A;  1FD6 A;  1C3T A;  2N4F A;  4BKT A;  2DBY A;  3U8Z A;  2KQS A;  1ET6 A;  1WH3 A;  4ZYN A;  1WRD B;  4W9H A;  4KGS A;  2ZW0 A;  1RAX A;  2IGH A;  4MGI E;  3U2S C;  1KLV A;  4J3O D;  2JSV X;  3SD5 A;  1TGZ B;  3V6E B;  1R4N I;  4LDT D;  3ZJT A;  2ZEQ A;  4EZL A;  2B3A A;  5HFY A;  1WSP A;  2KWV B;  1I4G A;  3AMZ A;  3VUY A;  3DBH B;  1C4A A;  2HJ1 A;  4W9J A;  4B9K A;  3A4R A;  3N30 A;  1Y8R C;  1ZXI A;  3KLS X;  4HDO A;  1IGC A;  1JML A;  1FRD A;  1TTN A;  2RPQ A;  2ZW1 A;  4NAM A;  1WZ0 A;  5JHB A;  2MHJ A;  2X8X X;  4LLG M;  2AQ2 B;  1T0S C;  3PSE B;  3RCZ A;  1A5R A;  1S1Q B;  2IZV B;  3UIN B;  1YX6 B;  2IY1 B;  1L6V A;  3PT2 B;  3ZKJ C;  2KMM A;  4ZRJ A;  2OOB B;  1SBB B;  3FIL B;  2BKF A;  1VZ8 A;  1AAR A;  1PDX A;  4TSS A;  5G55 A;  1X1M A;  5BMG A;  1XCQ L;  3UIP B;  4ICU A;  3OG5 A;  5BMI A;  5EDS A;  5CX3 A;  1CZP A;  3DVN U;  3R7Q A;  4US9 A;  1KM7 A;  2FBW B;  2KMC A;  4ITK A;  4BKS D;  4NJ6 A;  4GMV A;  3DBR B;  4L1B A;  4NQK E;  4M8N A;  2JWU A;  3HHM A;  4ANU A;  4DHZ B;  4N9F 4;  4WWM A;  4WIP A;  3MFG A;  4RGN A;  3BIN A;  2W3R A;  4Q2J A;  4HPM B;  3DBR I;  2NBU A;  2L8J A;  3BVG A;  1ZPS A;  3PPA A;  2AX5 A;  2RSU A;  3OWE B;  3NVW A;  4GLS C;  3PVL A;  2A4Z A;  1WY8 A;  4W9K A;  2KJH B;  1MJD A;  3N20 C;  2JZ3 B;  3KH0 A;  3P42 A;  4RM8 A;  2OJR A;  1FRR A;  4MGZ E;  1DYQ A;  1IGD A;  3Q6B A;  2V9H A;  3K9O B;  4P1C C;  2BKR B;  4C4V B;  2IPK D;  2FCM A;  5D2M B;  4K7S A;  2D2Q A;  2VZK B;  4C56 C;  3KYD D;  4LNO A;  3WCQ A;  3BII D;  3DQV A;  4XWW A;  5J2R A;  2N9X A;  4K7W A;  3ZYY X;  3ZJV A;  3HRD D;  1V1P B;  4X57 B;  4A55 A;  1WXQ A;  1Y56 A;  1K50 A;  1UWM A;  4HRS A;  4CYE A;  4M8M A;  4KZC A;  4JWU C;  3U7D A;  1WGH A;  5L95 C;  2KD0 A;  2M0X A;  2BVC A;  3ZNZ B;  2KAJ A;  1I4R A;  1YOV B;  3GP7 A;  4RF1 A;  3BYY B;  4G0N B;  2HDE A;  4LJP B;  2WDT B;  1N60 A;  5DCN A;  4II3 B;  4YWG G;  4PYU A;  3NJT A;  4LNN A;  3VUX A;  1J0G A;  2MH7 A;  3IXS A;  1WXS A;  3WAN A;  1F77 A;  4RH6 A;  3TSS A;  3B0A A;  1QF6 A;  3DWM A;  3RNF C;  2LVQ A;  3A9K B;  1RYJ A;  2LJI A;  4NAW B;  3RI7 C;  1F0Z A;  3TEW A;  2WXO A;  2V4L A;  2KLG A;  1V5O A;  4ZRI A;  4JX1 C;  4KIK A;  1T0Q C;  2K8C A;  3HM3 A;  4EOY A;  2ZCC A;  2MP2 A;  4UDU C;  4XWT A;  2XK5 B;  1VZ6 A;  2M19 A;  2E6X A;  2FIF A;  3C19 A;  2DZM A;  3ETR A;  3I3T B;  3DHH C;  4OZC A;  1MHX A;  2K22 A;  2AQ3 B;  2OHF A;  2IO2 B;  1TS5 A;  4C7Z A;  4F7Z A;  3AE3 B;  3RMK C;  2KFK A;  3AB5 A;  2PEA A;  4OVZ A;  3RNE C;  4BKS A;  3RUI B;  2WXN A;  3WAP A;  3PGE A;  2IY0 B;  2QMT A;  2IGG A;  3KW5 B;  1EU3 A;  3Q69 A;  2AL6 A;  2WS3 B;  3A9J A;  3UI3 A;  1I4Q A;  1AWD A;  4PYZ A;  1WGR A;  2L0T A;  5C3J B;  1V81 A;  4MJS A;  2KFJ A;  4NPN A;  2O2V B;  4BKG A;  1GB1 A;  5G5H A;  5FKA C;  1E0Z A;  4RGO S;  2ZPY A;  3DWG C;  2TSS A;  4MH8 A;  1L0V B;  1JRO A;  4IW0 A;  3LJ3 A;  4DDI D;  1E8Z A;  2LI5 A;  3RT3 B;  2W54 A;  2M17 A;  3VH3 B;  1LGR A;  2N1W A;  1D5M C;  1F52 A;  1E6E B;  1PGB A;  4JGH B;  2EEL A;  4IG7 B;  2J53 A;  4ICV A;  3ECI A;  1C76 A;  2CR5 A;  3TUO A;  2PVG C;  2QHO A;  1F1H A;  2ZJD A;  1BML C;  3PO0 A;  1ESF A;  2DZJ A;  1WE6 A;  2I1K A;  4XZ4 A;  2FE8 A;  1PGA A;  3QK0 A;  2PMV A;  2LRU A;  1TY2 A;  3OLM D;  5KHO A;  2ACZ B;  3A33 B;  2MRP A;  1B1Z A;  3NY5 A;  4DWF A;  4W9I A;  2LGX A;  4TQ0 A;  1WYW B;  3QX1 A;  5BYR A;  4JL9 A;  1JWS D;  4USA A;  3AE9 B;  2K3U A;  3O13 A;  2DLB A;  5H8Y E;  3RNA C;  2FAZ A;  2J7Q B;  1T0R C;  2KTR A;  2EKE C;  3Q8F A;  3FC4 A;  3VR8 B;  3RNC C;  2IO3 B;  3BYT B;  3KVF B;  2G4S A;  1FXT B;  4P16 A;  5EE0 A;  2K1F A;  2PVO D;  1TKG A;  3VTU A;  1PYW D;  1N5W A;  4C80 A;  2BWE S;  3V3X A;  4GGQ A;  1I7H A;  2N9P C;  2WXJ A;  2WLB A;  4EKU A;  3QAQ A;  4REZ A;  2JU6 X;  4FHK A;  3KUZ A;  4HLE A;  3KYC D;  4DHZ E;  1N5X A;  4EZJ A;  2M56 B;  2CKH B;  4M01 A;  5GXG B;  3H7P A;  2UWQ A;  3NG0 A;  3QQ8 B;  4KZ0 A;  1FNW A;  2MW5 A;  4MT5 A;  5FR3 A;  1TZO A;  2DWQ A;  3E56 A;  2KNB A;  1GOZ A;  4BFR A;  2KC1 A;  3R8B A;  4AWJ A;  1L6U A;  2GMI C;  2NBV B;  1D4B A;  2K9X A;  2GBJ A;  3RYT A;  1F9J A;  4YTM B;  1TKY A;  3I63 C;  3W1S A;  5DPT A;  2PJH A;  1R4M B;  3VXW A;  2JRH A;  4J6I A;  3L16 A;  2ZVN A;  2WHI A;  2KDI A;  3H9D A;  5LXI B;  4HVB A;  3RFZ B;  5L83 A;  3AEG B;  4WH4 A;  1SJE D;  4DHJ B;  1FCL A;  1XQQ A;  2RDH A;  2BS4 B;  4GB9 A;  1V97 A;  3DDC B;  4XC2 A;  1G6J A;  3BVZ A;  1BUI C;  2KDB A;  2LHE A;  3B2F A;  4B0E A;  4EZK A;  1L0Y B;  3P63 A;  3R3M A;  2DYM A;  4E71 A;  2WXI A;  1NEK B;  2YEP B;  4IOI E;  1I42 A;  3K9P B;  3JSV A;  4HXD A;  2HE7 A;  2RDG A;  1FFV A;  1MPE A;  2KQ7 A;  2M8S A;  5MPO A;  4HPL B;  3GB1 A;  4KKI A;  3V05 A;  2AQ1 B;  2J0M A;  2CU3 A;  2LVO A;  3L17 A;  2MWS B;  1L4Z B;  3T3N A;  3AU4 A;  2QIL A;  2KMA A;  3P2B A;  3IVF A;  1KOT A;  1WWT A;  3MTN B;  1S3S G;  1M4V A;  3AU5 A;  2XN9 C;  1TYG B;  2G1E A;  3M62 B;  2MBE A;  2JRI B;  4HPP A;  1P1A A;  4TMA B;  3EFC A;  3MJW A;  4S17 A;  1SIJ A;  4O1N A;  4LNF A;  4WWO A;  2JYT A;  3ZTD A;  2LGY A;  3AE7 B;  1JQ4 A;  2KVR A;  2DX5 B;  2IDY A;  3U4E G;  3AEB B;  1E10 A;  2O6V D;  2C5L C;  3VTV A;  1P9D U;  4ACF A;  4BOZ B;  4JWS C;  3VRA B;  5J18 A;  3VTW A;  1OFF A;  1CMX B;  1HXY D;  2MJ3 A;  1XEE A;  4RM9 A;  1T5X D;  3VQI A;  4KX6 B;  4A3P A;  3AM9 A;  1V8C A;  4DBG A;  4HJK A;  2MCN B;  4IWQ A;  1V1O A;  1E7P B;  5CHF A;  3MHS D;  2EMT A;  2WX1 A;  2KK8 A;  3VFK A;  1J7C A;  1Z5S B;  3ML9 A;  1WMH A;  1U4A A;  1Q0W B;  3L4P A;  1WJ4 A;  1Z2M A;  2C7M B;  4K3C A;  2DZK A;  4KIK B;  1IYF A;  3TBL D;  4JE3 B;  3DBH I;  4AJY B;  2IND C;  4YTP B;  2MP2 B;  2JXX A;  3MC9 A;  2K6D B;  3DVG X;  2JYE A;  2DYB A;  3EFU A;  3PTF C;  2KYW A;  3AN1 A;  2FCS A;  3VH4 B;  3QJZ A;  3AEF B;  5E6J A;  2ZNV B;  3NRZ A;  4WWN A;  1K8R B;  2C7H A;  2KFK B;  1KLU D;  1QIL A;  2KHW B;  2V3P A;  1WGG A;  4DK5 A;  4KGT A;  1RLF A;  1D6E C;  3CST A;  4K3B A;  1RFK A;  2M0A A;  1PUT A;  4W9F A;  4N59 A;  3L0W B;  1YQ3 B;  3A9J B;  1SGH A;  1NVI D;  2FUG 1;  4F1S A;  3T9L A;  1UEL A;  3HIZ A;  4MJS B;  2LJ5 A;  3KWL A;  2K39 A;  3CWI A;  3NZ3 A;  3AEC B;  3P4P B;  2BF8 B;  2BS3 B;  4G11 A;  1H4R A;  4AP4 C;  2NTS A;  2WWZ A;  4WQM A;  4DQO C;  4HWI B;  2AL3 A;  3AEE B;  3OJ3 A;  2WNM A;  2LHD A;  1JWU D;  3ZDM C;  2EKI A;  2GBM A;  1YX5 B;  3E9S A;  4ANX A;  2NS5 A;  1UNS A;  2BPS A;  2N0S B;  1UD7 A;  3N1Z C;  1EF5 A;  3QC8 B;  1MG8 A;  1N61 A;  1SB3 C;  3DPD A;  4B0M A;  4ANW A;  2N9L A;  2OED A;  4IM0 A;  1UZX B;  2ZNV C;  1AW7 A;  4WWP A;  5TR5 A;  4KV2 A;  1CQV A;  4IKG A;  4PS8 A;  1EWC A;  1GJZ A;  2KDM A;  1WR1 A;  4EUT A;  2NTT A;  4C00 A;  2GB1 A;  1JRU A;  1N63 A;  4URK A;  2CHW A;  3EGR A;  1Q10 A;  2J4X A;  2L52 A;  3ZNI D;  2J52 A;  4I6N B;  4AS1 A;  3OJ4 B;  1Q1O A;  2GI9 A;  3L08 A;  5DPW A;  3ZTC A;  3AE1 B;  1ZOY B;  2KDF B;  2O6V A;  1D5Z C;  1ZE3 D;  3ZNG C;  2MQJ A;  4L23 A;  3CF6 E;  2H88 B;  1BT0 A;  3NUH B;  2DEN B;  3EUB 2;  5G2N A;  3VAW A;  4ZDV A;  4II2 B;  2MBQ A;  4AUQ C;  3H7S A;  2KTR B;  2VZK D;  1MVK A;  2WDR B;  3QAR A;  4DDG D;  1QT9 A;  1T3Q A;  5FR6 A;  2G4D B;  3VHT C;  4IWP A;  1KJT A;  1TS4 A;  4TQ1 A;  2WGS A;  1BXT A;  1VLB A;  3DVN V;  2SAK A;  4KDI C;  1HA5 A;  3P4R B;  4OHJ A;  2K0P A;  2D07 B;  2LUM A;  1TJE A;  3DCG A;  3Q3M C;  3C8Y A;  1QOB A;  4FJY A;  2WXF A;  4W9L A;  3H7P B;  2R61 A;  2MEK A;  2RD0 A;  3DBL B;  5D3I B;  2MBH A;  3DHI C;  1OGW A;  2C7N B;  3UQB A;  2BYE A;  2GBN A;  4WJQ A;  4FA6 A;  3VDZ A;  1XO3 A;  1WYG A;  4MEL A;  4WJO A;  2AEH A;  2IYD B;  1V80 A;  2LGD A;  2N7E A;  3M63 B;  2WXP A;  1LQB A;  2J42 A;  3ZGZ A;  1NDD A;  2WQY B;  1J7A A;  5AZG A;  1ZDV A;  5AZF A;  1N62 A;  2UU7 A;  1FXA A;  1VDV A;  1JWA D;  1FNV A;  2KJ6 A;  1F2R I;  4CO7 A;  1IBX A;  2WU2 B;  3APD A;  2G45 B;  4ZRP A;  3NVY A;  5IOI A;  5E6N A;  2Y5P A;  1WXV A;  3WAM A;  3TL5 A;  3AH7 A;  3UGB B;  3A1Q A;  3KUD B;  2N1V A;  3L10 B;  4PS7 A;  2A5U A;  2L3Z A;  3W5V B;  3NOB A;  2ASQ A;  2DNF A;  1OQQ A;  1FPY A;  3P1M A;  4I6L B;  3ZLZ A;  1OEY J;  1ZUD 2;  2JZP A;  1J7B A;  3NZU A;  2XBB C;  5G5G A;  3AUL A;  4LNK A;  2D5G A;  2KOX A;  1XT9 B;  1T6B X;  1OTR B;  2IO1 B;  3X0W A;  3PS6 A;  4XGA B;  3R2T A;  2KX0 A;  2LFI A;  1PQS A;  3IBE A;  1A70 A;  2KN5 A;  3BK1 A;  1I35 A;  1MHH E;  3ZXR A;  4EE2 A;  2BBC A;  5D7G A;  3JYU A;  1STE A;  2FCQ A;  1JWB D;  1F2R C;  4IUM B;  4YSZ B;  1E5W A;  4FHJ A;  1WX8 A;  4AOF A;  2QEJ C;  4WUR A;  1JAL A;  1R7S A;  1HZ6 A;  4CQN A;  1QLB B;  4A90 A;  1GG3 A;  3TEY A;  5DPR A;  1SXT A;  3AE4 B;  4ARC A;  4TV3 A;  1WF9 A;  2W82 A;  1XF5 L;  3GZN B;  1YJJ A;  2M4N A;  4HDQ A;  3VRB B;  1UWX A;  1HZ5 A;  1XLP A;  2YEP F;  1IPG A;  3RZW C;  2BS2 B;  1NYQ A;  5BO4 B;  2KO3 A;  1TS3 A;  1RRB A;  5IP4 D;  1C9F A;  2GRI A;  2D3G A;  3NZS A;  4GDK A;  1P98 A;  4MEM A;  3SFE B;  4BZA A;  1WGK A;  1LFD A;  2WXH A;  1QOF A;  1AN8 A;  3I9V 1;  3JW0 X;  1WMH B;  2JT4 B;  3D32 A;  3O65 B;  2D3A A;  1K52 A;  4JIO U;  3WAO A;  2QSD A;  1V86 A;  1FMA D;  2K8H A;  1SF0 A;  3OAW A;  4LJO B;  4W9C A;  3T8M A;  5IN7 A;  4NY0 A;  4LNI A;  3DHG C;  3SEB A;  4PS3 A;  2YLM A;  2BW2 A;  1OQR A;  1V2Y A;  2PLP A;  3HK0 A;  4KVG B;  2BYF A;  2V1Y A;  3T3O A;  2IO0 B;  4DXG A;  3EEC A;  4LK0 M;  2BWF A;  3AE5 B;  2PKO A;  2KX3 A;  4OZB A;  1QZE A;  4M0W A;  3H6N A;  2JY6 A;  1MG4 A;  2CJN A;  2W55 A;  3Q8C A;  2JWZ A;  1C77 A;  2LAS A;  2EMS A;  1SIF A;  4FXC A;  3NVV A;  1EF1 A;  1EWY C;  2LD9 A;  1JCK B;  5CTR C;  3ALB A;  2IJ0 A;  5BYQ A;  2BTE A;  3U30 A;  4MDK E;  4MGY E;  4WQO B;  4HJG E;  2GOW A;  1TZ1 A;  4KSK C;  2UYZ B;  2E3T A;  4XYC A;  5IKC M;  2WX0 A;  1R4M I;  1WM3 A;  2LXA A;  3I5J C;  2LVP A;  1XD3 B;  4FJV B;  4EFO A;  4K1R B;  4OZA A;  2QIE B;  2L32 A;  4M02 A;  1RFA A;  4FBJ B;  4OW0 A;  1SE4 A;  1TKE A;  1ISN A;  2N7J A;  1H8C A;  2K5P A;  1YN3 A;  3QWZ B;  4KKJ A;  1FNU A;  3J9C A;  1ZGU B;  1VCB A;  1XCT L;  3URY A;  1UBQ A;  4S0R A;  2QDF A;  1TT5 B;  3NS8 A;  4DHJ D;  4L2Y A;  2GBR A;  4HKQ A;  3MC0 B;  1M94 A;  1MI0 A;  1E7V A;  2ZVO A;  4KGR A;  2K25 A;  2NPT A;  3PV1 A;  1I4H A;  1WI0 A;  2L76 A;  5EE9 A;  5C2T B;  1ACC A;  5D3D A;  2AWT A;  2PE9 A;  2MJE A;  3EHV A;  3R7R A;  3M95 A;  5JHA A;  4BVU C;  3FAH A;  1LXD A;  3NVZ A;  1VD2 A;  1XLN A;  1GUA B;  2L0F A; 
#chains in the Genus database with same CATH homology
 2BF8 B;  2GBK A;  5J17 A;  3HM3 A;  2MA9 B;  3QA8 A;  4G11 A;  1H4R A;  4EOY A;  4AP4 C;  2ZCC A;  3PRM B;  2KZR A;  2MP2 A;  2WWZ A;  4BBN C;  4BOS C;  2LXC A;  2XK5 B;  1ZW7 A;  2N7D A;  3C0R B;  3UF8 A;  4HWI B;  2AL3 A;  2FIF A;  2XEW A;  3NHE B;  4CHK A;  1WM2 A;  2DZM A;  3I3T B;  3OJ3 A;  2MLB A;  4W9G A;  1J8C A;  2IO2 B;  3PHW B;  4GSW A;  3ZO5 B;  2JPH A;  3M3J A;  3ZDM C;  2G3Q B;  4F7Z A;  4IWO A;  3BY4 B;  2GBM A;  1YX5 B;  2KFK A;  2PEA A;  4GDL B;  4HCN B;  4BKS A;  3RUI B;  2YVC A;  5CHW A;  4ANX A;  4WJP A;  2NS5 A;  2BPS A;  3PGE A;  2IY0 B;  4MM3 A;  4OVV A;  3WAP A;  1UD7 A;  2VRR B;  2MBO A;  1EF5 A;  2REX A;  3CSF A;  3QC8 B;  4LDT B;  1MG8 A;  3KW5 B;  1E7U A;  3B08 A;  2JVC A;  2AL6 A;  3DPD A;  4ANW A;  1OQY A;  3EC8 A;  4IM0 A;  1J19 A;  3A9J A;  1UZX B;  3ZVV A;  2ZNV C;  4NQL B;  4WWP A;  4PYZ A;  2R2Q A;  1T0Y A;  4MSQ B;  5TR5 A;  1WGR A;  2L0T A;  2Z59 B;  3PZD A;  4KV2 A;  3ENE A;  1WXA A;  1V5T A;  3HM6 X;  1V81 A;  4MGK E;  4PS8 A;  2KWC A;  1GJZ A;  4KSL C;  4MJS A;  1WR1 A;  2MBB B;  2KFJ A;  3A9K A;  3PLV A;  4NAW A;  4DXA B;  4EUT A;  2LUE A;  1WIA A;  4NPN A;  1JRU A;  2O2V B;  2M1M A;  5E6O A;  4EEW A;  4HK2 A;  4BKG A;  2CU1 A;  4URK A;  2CHW A;  3ZNH B;  1L7Y A;  3ZNI D;  2ZPY A;  2LZ6 A;  4I6N B;  3WAL A;  4G3X B;  2JUO A;  3OJ4 B;  4IW0 A;  4W9E A;  1Q1O A;  1WGY A;  3L08 A;  3LJ3 A;  3LDZ E;  3X23 A;  3ZTC A;  4FAD A;  2XK5 A;  5DPW A;  4DDI D;  2KDF B;  2O6V A;  4GOC A;  1E8Z A;  3ZNG C;  2ZZP B;  2MQJ A;  2HJ8 A;  3ONS A;  5JH5 C;  3CF6 E;  2LI5 A;  3RT3 B;  2AYO B;  2M17 A;  3VH3 B;  1BT0 A;  2N1W A;  4IM3 A;  1IP9 A;  3ZUN A;  3PRP B;  4JGH B;  4FN2 A;  2DEN B;  5G2N A;  3VAW A;  4ZDV A;  4II2 B;  2MBQ A;  4AUQ C;  2DYO A;  2Y5B B;  4IG7 B;  3N3K B;  3H7S A;  3GOE A;  1D3Z A;  2KTR B;  4OVU A;  1L2N A;  3QAR A;  4DDG D;  4GDL A;  1YQB A;  5FR6 A;  2G4D B;  1P3Q U;  4ICV A;  3ECI A;  2CR5 A;  2FNJ B;  2QHO A;  2I1J A;  1E8W A;  2KKC A;  2ZJD A;  3VHT C;  4IWP A;  1WZ3 A;  2N9E B;  1KJT A;  4TQ1 A;  2DZJ A;  3H1U A;  1WE6 A;  2NVU I;  4NJ7 A;  3PHX B;  4FLH A;  1NBF C;  3DVN V;  2I1K A;  1SE9 A;  2KXJ A;  4GXB A;  4JLC A;  4XZ4 A;  3QK0 A;  3KUC B;  4KDI C;  2LRU A;  2KLC A;  3TCA A;  3QCA A;  2D07 B;  2DAJ A;  3OLM D;  5KHO A;  4F8C B;  5KHQ A;  2O2V A;  1E8X A;  3DCG A;  2KC2 A;  3A33 B;  3TMP B;  3N32 A;  2MRP A;  1E90 A;  1P0R A;  2RGF A;  3ML8 A;  3DOW A;  2BGF A;  3APF A;  2KTF A;  5AEK B;  4FJY A;  3NY5 A;  4JQW C;  3WIM A;  3RD2 A;  5IAA C;  4W9L A;  5D94 A;  2D11 A;  4DWF A;  3A1Q B;  4W9I A;  1OEY A;  2LGX A;  4LCD E;  1WYW B;  3H7P B;  3QX1 A;  4WJN A;  4TQ0 A;  3L54 A;  2RD0 A;  2MBH A;  4JL9 A;  1WFY A;  3DBS A;  1OGW A;  2C7N B;  4G50 A;  1GC6 A;  3UQB A;  2BYE A;  2PPH A;  2HD5 B;  2GBN A;  4WJQ A;  3S2A A;  2LRW A;  4FA6 A;  3VDZ A;  2FAZ A;  2O6V B;  2J7Q B;  2K8B A;  2KTR A;  2EKE C;  1C1Y B;  2KJR A;  4MEL A;  4TUU A;  2AEH A;  4WJO A;  2MX2 A;  2IO3 B;  3TIX A;  3UIO B;  2IYD B;  1V80 A;  2G4S A;  3KVF B;  1FXT B;  2LGD A;  2K1F A;  2N7E A;  3M63 B;  1LQB A;  1V9J A;  4I6P A;  5C23 A;  3VTU A;  1E8Y A;  1NDD A;  1HE8 A;  5AZG A;  2J0K A;  4K81 A;  5AZF A;  2NBW B;  3V6C B;  1LM8 B;  4B95 A;  1WJ6 A;  5GMV A;  2BWE S;  1V49 A;  2FUH B;  4GGQ A;  3AXC A;  4AJW A;  5CHV C;  2N9P C;  4E74 A;  4EKU A;  2R2O A;  3TJP A;  2PE6 B;  3QAQ A;  3WA0 A;  2Z0D B;  3PRE A;  2KJ6 A;  2L7R A;  3A4S C;  2RR9 A;  3SU8 X;  1GNU A;  4FHK A;  4P7I A;  2CHZ A;  4CO7 A;  3KUZ A;  2K6Q A;  2N4F A;  3KYC D;  3APD A;  2G45 B;  4HLE A;  1C3T A;  4DHZ E;  1WJU A;  4BKT A;  5E6N A;  4EZJ A;  4HCP B;  3U8Z A;  3WAM A;  1WXV A;  2KQS A;  2CKH B;  3TL5 A;  1WH3 A;  1WXM A;  3UGB B;  3A1Q A;  4YL8 A;  3KUD B;  3H7P A;  2UWQ A;  4ZYN A;  1WRD B;  3QQ8 B;  4W9H A;  1Q5W B;  2N1V A;  4KZ0 A;  5C1Z A;  3L10 B;  4PS7 A;  3SHQ A;  4A20 A;  1RAX A;  4MGI E;  2A5U A;  2L3Z A;  3B1L X;  1KLV A;  2MW5 A;  2Z0E B;  3NOB A;  2ASQ A;  3SD5 A;  3ZRF A;  2KNB A;  1TGZ B;  1UGM A;  2KAN A;  2DHZ A;  2V3S A;  4GU2 A;  3V6E B;  4BFR A;  4WAA A;  1R4N I;  2KC1 A;  4I6L B;  4LDT D;  4AWJ A;  2JF5 A;  2GMI C;  1UBI A;  2NBV B;  2ZEQ A;  1WJN A;  3ZLZ A;  4EZL A;  2B3A A;  1OEY J;  2GBJ A;  3RYT A;  1F9J A;  3NZU A;  2KWV B;  2XBB C;  3W1S A;  5DPT A;  3AUL A;  2PJH A;  3VXW A;  2JRH A;  2KOX A;  3VUY A;  4W9J A;  4J6I A;  4B9K A;  3L16 A;  1XT9 B;  2IO1 B;  1OTR B;  3A4R A;  2ZVN A;  3N30 A;  1GC7 A;  3X0W A;  2J0J A;  3PS6 A;  1Y8R C;  2KDI A;  3H9D A;  5LXI B;  4HDO A;  4HVB A;  2KX0 A;  3V62 A;  1TTN A;  4GDK B;  1PQS A;  3IBE A;  2RPQ A;  5L83 A;  2C9W B;  2KN5 A;  1I35 A;  1V6E A;  1WZ0 A;  5JHB A;  4DHJ B;  5AZH A;  1XQQ A;  5D7G A;  3PSE B;  3JYU A;  3RCZ A;  1A5R A;  1S1Q B;  2FCQ A;  2IZV B;  4GB9 A;  3UIN B;  3DDC B;  1YX6 B;  4XC2 A;  2IY1 B;  1G6J A;  3PT2 B;  3ZKJ C;  2KDB A;  4IUM B;  4IC7 B;  1E5W A;  4FHJ A;  4ZRJ A;  1WX8 A;  4AOF A;  4EZK A;  5DPS A;  2OOB B;  2DYM A;  3R3M A;  4E71 A;  5D6J B;  2BKF A;  1AAR A;  5G55 A;  1X1M A;  3SDL C;  1I42 A;  1GG3 A;  3K9P B;  3JSV A;  4HXD A;  5DPR A;  2HE7 A;  3UIP B;  4ICU A;  4TV3 A;  4ANV A;  1WF9 A;  5EDS A;  3V60 A;  2KQ7 A;  5CX3 A;  2M8S A;  4KDL B;  5HKH A;  2M4N A;  2KDE B;  4HDQ A;  3DVN U;  4HPL B;  3ZW3 A;  3R7Q A;  1KM7 A;  2KMC A;  3IFW B;  2MSE D;  4BKS D;  2HTH A;  4NJ6 A;  4W9D A;  2J0M A;  4GMV A;  1IPG A;  2JZZ A;  3VUW A;  3RZW C;  4A3O A;  4NQK E;  4M0W B;  2LVO A;  3L17 A;  2MWS B;  4FUL A;  4M8N A;  3AU4 A;  5BO4 B;  3HHM A;  2KO3 A;  4ANU A;  4DHZ B;  3DBL I;  2KMA A;  3P2B A;  1RRB A;  3IVF A;  4N9F 4;  1KOT A;  2D3G A;  3NZS A;  4GDK A;  3RUL A;  1P98 A;  3MTN B;  4MEM A;  1S3S G;  3BIN A;  3PLU A;  3AU5 A;  4HPM B;  3DBR I;  1LFD A;  3AI5 A;  3M62 B;  2MBE A;  3JW0 X;  1WMH B;  1EO6 A;  2JT4 B;  2JRI B;  2NBU A;  3D32 A;  3O65 B;  1P1A A;  2L8J A;  4JIO U;  2BYV E;  2FCN A;  3MJW A;  4ZRK A;  3PPA A;  4WWO A;  3JVZ X;  5LXH A;  2RSU A;  3ZTD A;  2LGY A;  3WAO A;  3CMM B;  3ZDT A;  3PVL A;  2A4Z A;  2KVR A;  1V86 A;  1WY8 A;  2FID A;  2ZCB A;  4MSM B;  4W9K A;  2DX5 B;  2K8H A;  3Q3F A;  3OAW A;  1NI2 A;  2KJH B;  2O6V D;  4LJO B;  2C5L C;  3VTV A;  4K7U A;  4W9C A;  1WX7 A;  2JZ3 B;  1P9D U;  3KH0 A;  3T8M A;  4NY0 A;  4RM8 A;  4BOZ B;  5J18 A;  2L00 B;  2LWP A;  2OJR A;  3QIJ A;  3VTW A;  4PS3 A;  4MH0 E;  4IM2 A;  2YLM A;  1CMX B;  1V2Y A;  3HK0 A;  4RM9 A;  4KVG B;  2BYF A;  3QHT A;  4MGZ E;  2V1Y A;  3VQI A;  2IO0 B;  1WX9 A;  4A3P A;  1YD8 U;  3EEC A;  2BWF A;  3RZF A;  3JSV B;  3K9O B;  4DBG A;  2KX3 A;  1QZE A;  2BKR B;  3H6N A;  4HJK A;  4FJZ A;  2JY6 A;  2MCN B;  4IWQ A;  3DVG Y;  4NNJ B;  3V61 A;  2JWZ A;  3APC A;  2FCM A;  2LAS A;  4XX5 A;  2EMS A;  3PRZ A;  1ZKH A;  5D2M B;  4K7S A;  2D2Q A;  1SIF A;  5CHF A;  3VVW B;  3KYD D;  3MHS D;  1TBE A;  4GIV A;  1EF1 A;  2EMT A;  2WX1 A;  2KK8 A;  2LD9 A;  3VFK A;  1Z5S B;  3ML9 A;  2NR2 A;  2NPT B;  2C60 A;  3DQV A;  2CHX A;  5IA7 A;  5CTR C;  3ALB A;  5J2R A;  1WMH A;  1U4A A;  3W1Y A;  1Q0W B;  3UQA A;  1UH6 A;  3U30 A;  4MDK E;  4MGY E;  4WQO B;  2N9X A;  4K7W A;  1WJ4 A;  1Z2M A;  2GOW A;  4B6W A;  1TZ1 A;  4KSK C;  4ASW C;  2C7M B;  2DZK A;  2UYZ B;  4KIK B;  2WX0 A;  4BBN F;  1IYF A;  1R4M I;  1WM3 A;  3TBL D;  2LXA A;  3ZIM A;  4X57 B;  3DBH I;  3ZRC A;  4AJY B;  2LVP A;  2MP2 B;  2JXX A;  1WE7 A;  2K6D B;  1XD3 B;  3DVG X;  4FJV B;  4K1R B;  2DYB A;  3W1S C;  4EFO A;  2L05 A;  3EFU A;  3PTF C;  5E6P A;  4TKN A;  2W9N A;  4M8M A;  4KZC A;  4CYE A;  3Q3J A;  4E3C A;  1RFA A;  2FCS A;  3VH4 B;  3U7D A;  1WGH A;  5L95 C;  1WGD A;  2KD0 A;  3QJZ A;  2NCN A;  4FBJ B;  2M0X A;  5LLI A;  3ZNZ B;  4GN1 A;  2ZNV B;  1YIW A;  1ISN A;  3IHP C;  1WR6 E;  1YJ1 A;  4WWN A;  2CS4 A;  1H8C A;  3R66 C;  1K8R B;  3QWZ B;  4G0N B;  2C7H A;  1ZGU B;  2KFK B;  4LJP B;  2WDT B;  2KHW B;  1VCB A;  2ZPN A;  1UBQ A;  4RMA A;  1WGG A;  2KWU B;  5DCN A;  4DK5 A;  1RLF A;  4II3 B;  3NS8 A;  4PYU A;  3CST A;  4DHJ D;  2GBR A;  3VUX A;  4W9F A;  2WYQ A;  1J0G A;  1M94 A;  3L0W B;  1E7V A;  3L13 A;  3A9J B;  1SGH A;  1WXS A;  2ZVO A;  2D10 A;  3WAN A;  2K25 A;  2NPT A;  3PV1 A;  1WI0 A;  2L76 A;  4F1S A;  3T9L A;  3IG3 A;  3B0A A;  2AWT A;  1UEL A;  2DAF A;  2DZI A;  2PE9 A;  3HIZ A;  3GZN I;  3EHV A;  4MJS B;  2IBI B;  2LVQ A;  1EUV B;  3R7R A;  3A9K B;  2LJ5 A;  4NAW B;  5JZE B;  2K39 A;  3M95 A;  5JHA A;  4BVU C;  2V4L A;  2KLG A;  1V5O A;  4ZRI A;  1LXD A;  1VD2 A;  4KIK A;  2K8C A;  1GUA B;  2L0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...