4AJYB

Von hippel-lindau protein-elonginb-elonginc complex, bound to hif1- alpha peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
molecule tags Transcription
source organism Homo sapiens
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ajyB00
5E6PA 1LQBA 5DPSA 4EEWA 2KFKB 4GGQA 3DQVA 3ZRFA 3QWZB 2D07B 1K8RB 2W9NA 3K9OB 3HK0A 4WJQA 4GDLA 2K1FA 4W9CA 2JPHA 2HD5B 5IAAC 2KDFB 5EDSA 3VH4B 4E3CA 1U4AA 3IVFA 2Z0DB 4NY0A 4MSMB 3ENEA 5IA7A 5AZHA 2IY1B 2DYBA 2MSED 3M62B 4PYUA 2OOBB 3PHXB 4JQWC 4FHJA 2JZZA 3L54A 3H1UA 2CHZA 1RLFA 4WJPA 3VUXA 4EOYA 2EKEC 3ZO5B 1WX7A 1YIWA 1UELA 2DAFA 3H7PA 4IW0A 3PRPB 4ANUA 4DDGD 1S1QB 5AZFA 3QCAA 3B0AA 2KDIA 2WYQA 4NNJB 4PS7A 2KFJA 3DPDA 2L05A 2KXJA 2YLMA 2UYZB 1UBIA 2AEHA 2NCNA 1BT0A 3M63B 1QZEA 4FJVB 2ZPYA 2KD0A 2BKFA 2MW5A 3KYCD 3U30A 1R4NI 3JVZX 4AJYB 2MP2A 2V4LA 3ALBA 4GIVA 4M0WB 4OVVA 4WJNA 4HJKA 2K25A 3ONSA 3SHQA 5AEKB 2L0FA 3L17A 3NZSA 4HDOA 4AWJA 3AU5A 2V1YA 3L10B 2WX0A 2ZCBA 4MELA 1L7YA 4BBNF 2K39A 3DDCB 4BKTA 4II2B 4FHKA 4HPMB 2IY0B 4MGZE 1WXVA 1Q1OA 3RUIB 3VTWA 3WALA 1P0RA 3M3JA 4DHZB 2DYMA 2ZPNA 3RCZA 4YL8A 2Z0EB 2K6DB 2KLCA 1Z5SB 2DX5B 1WMHA 1OQYA 2RD0A 2DYOA 2D11A 2DHZA 4EFOA 2M0XA 4M8MA 4M8NA 1GC6A 2FCSA 2MBEA 2MWSB 3A4SC 3PTFC 4IWOA 4HK2A 3NOBA 1PQSA 4NQLB 1UZXB 3KUZA 3PPAA 2A4ZA 4MGIE 4IM0A 2DENB 3QIJA 1E7UA 5KHQA 2L7RA 2KWUB 3DBLI 4GU2A 3QX1A 4W9IA 1GUAB 4HDQA 4BKSA 2ZJDA 3T9LA 3ZNZB 2KTRA 3HHMA 3MHSD 2LRUA 1X1MA 5CX3A 3T8MA 1Q5WB 3ZLZA 3ZNHB 3QA8A 4NAWB 3H7PB 2I1KA 4XZ4A 1WF9A 4W9EA 2RPQA 3JSVB 5DCNA 4BOZB 4GOCA 4JGHB 1P98A 1Z2MA 3DBRI 3VAWA 1M94A 2FAZA 2M1MA 2IZVB 3L16A 2FNJB 5CHWA 1V80A 2GBJA 4W9DA 2KMAA 4AJWA 2JUOA 2N7EA 4FBJB 1C3TA 1OGWA 3OJ3A 4KVGB 3SU8X 1IYFA 4AUQC 3LJ3A 3W1SA 3PGEA 1EF5A 2ZNVB 2KJRA 2MP2B 2N9XA 1KM7A 1WRDB 4GDKA 3VTVA 2FCNA 4F8CB 4FA6A 5DPTA 3MTNB 3A9KB 4URKA 2MLBA 2PE9A 1V81A 3WAOA 2NPTA 3TJPA 4NJ7A 1IPGA 2GBMA 4ANVA 5J2RA 4TQ1A 2CR5A 3H6NA 4RM8A 4MDKE 3WANA 5C1ZA 2WWZA 3L08A 1WMHB 2YVCA 4IM2A 1EF1A 3W1SC 2BKRB 1NI2A 1WX8A 3RZWC 4CHKA 3ECIA 3C0RB 4JL9A 2MA9B 4ZYNA 3V61A 3M95A 4HXDA 1RRBA 4GB9A 1SIFA 2KX0A 3V62A 5JHAA 3N3KB 2NVUI 4MSQB 1GC7A 2KTRB 3Q3FA 3VDZA 3BY4B 3IBEA 2MBQA 3TCAA 2MBOA 2GBRA 4FJZA 4I6NB 2KX3A 2MBHA 2ZCCA 4JIOU 3QQ8B 4HCPB 3WA0A 4DHJB 4EZLA 3A1QA 1H8CA 1EO6A 3R3MA 2XBBC 1WZ0A 4W9GA 4ICUA 2JY6A 4W9FA 4MEMA 3R66C 1MG8A 4WAAA 4IG7B 4MJSA 4DDID 4A3PA 4XC2A 4X57B 1WR6E 3VFKA 4BOSC 2M4NA 4HCNB 1WR1A 3UQAA 2J0JA 3IFWB 2LGXA 4HPLB 2JF5A 3ZTCA 4KDLB 3TBLD 4GDKB 3UINB 2MQJA 2PJHA 4PYZA 3KUCB 5BO4B 4ZDVA 4W9KA 2O6VA 5JZEB 1SGHA 2XK5A 3NHEB 2VRRB 2LXAA 3ZTDA 2BWFA 2MCNB 1V9JA 1UH6A 5DPWA 4P7IA 1V5OA 4E74A 4I6LB 3KUDB 4ZRIA 4JLCA 5LLIA 2FIFA 5CTRC 3VVWB 2ZZPB 5E6NA 4AOFA 2NS5A 1Y8RC 2LVOA 3PRZA 3UGBB 2KQ7A 5G55A 4E71A 2NR2A 1WFYA 3AI5A 4ANWA 2C5LC 5JH5C 4PS8A 1XT9B 4TKNA 1WGDA 1V86A 4B6WA 5L83A 4EUTA 2KNBA 4IUMB 2FIDA 4DK5A 2NBUA 2JVCA 4K7WA 2NBWB 2CU1A 4DXAB 1F9JA 2OJRA 3PREA 3RYTA 3PV1A 1UD7A 1GG3A 4GDLB 2LGYA 3V60A 3ZIMA 2HJ8A 3PLUA 1HE8A 4BBNC 4LDTB 1GNUA 2O2VA 3DVNU 1J0GA 2PEAA 2J0KA 2BF8B 5D94A 3PRMB 1UGMA 2KC1A 4KZ0A 1WE6A 3TMPB 1J19A 2DZMA 2DZKA 3QAQA 3A9JA 4FULA 1XD3B 2JRIB 2RSUA 3APFA 3CMMB 3O65B 1YJ1A 2KHWB 3D32A 2KK8A 1RFAA 2ZVOA 2ZEQA 3VTUA 1WX9A 2A5UA 4ZRKA 4CYEA 3ZKJC 4G50A 4XX5A 4B95A 2AYOB 4BFRA 2N4FA 4I6PA 4GSWA 2KN5A 3CF6E 4IM3A 3TIXA 3PT2B 2PE6B 1E5WA 2BYFA 3N32A 5J17A 3JYUA 3RZFA 2KWVB 1WI0A 3DBSA 3ZDMC 3QK0A 3LDZE 4IC7B 3V6EB 3ZNGC 4W9HA 5CHVC 2KZRA 4KDIC 3QC8B 3V6CB 3DBHI 3HM6X 2AL3A 3IHPC 2L0TA 4NJ6A 3WIMA 2CS4A 1V49A 1J8CA 3R7RA 3NY5A 1OTRB 3VUYA 3DVNV 5C23A 4K7UA 1ISNA 3S2AA 2MBBB 3HIZA 1E90A 2KLGA 1LFDA 3A33B 3UIPB 2N9PC 2LZ6A 4GXBA 4N9F4 5AZGA 2BGFA 3U8ZA 3VH3B 4G0NB 5HKHA 3PS6A 1WXAA 3OAWA 1WM3A 4MH0E 2G45B 2GBNA 4WJOA 3APCA 5JHBA 2EMTA 2KJHB 4LJOB 4A20A 2L76A 4DHJD 3PVLA 3DOWA 1JRUA 2CHXA 2J7QB 2N1WA 3R7QA 3ZDTA 5KHOA 4HVBA 1G6JA 2CKHB 2HTHA 2D3GA 2R2QA 3RT3B 5D7GA 1KOTA 2Z59B 4MGKE 3W1YA 1AARA 1TGZB 2K8BA 3TL5A 4ASWC 1P9DU 4B9KA 3UIOB 4ICVA 4OVUA 4IWPA 1E8WA 2LVQA 4MGYE 3CSTA 1YQBA 4KV2A 4DHZE 3MJWA 1WGHA 2C7NB 1WZ3A 2N9EB 1Q0WB 1OEYA 1TTNA 3KH0A 2AL6A 3N30A 3ZVVA 1WJ6A 2LXCA 2GMIC 2CHWA 5G2NA 2KJ6A 1C1YB 2G3QB 2KOXA 2IO0B 4FN2A 3L13A 3AXCA 3ML8A 3ZW3A 1P1AA 1D3ZA 2UWQA 5DPRA 4TUUA 1KJTA 1VCBA 1YX6B 4KIKA 3KVFB 3ML9A 2JXXA 3BINA 4KZCA 2REXA 1CMXB 4HWIB 3WAPA 4AP4C 3QARA 2LVPA 3NS8A 2Y5BB 2DAJA 1I42A 3PSEB 3K9PB 2NPTB 1YX5B 2G4SA 3X0WA 1XQQA 2FUHB 3H9DA 1WE7A 2IO3B 2L00B 4LJPB 2KVRA 4NAWA 1E7VA 1WM2A 2K6QA 2KTFA 4G3XB 4NQKE 2B3AA 4DWFA 2BYVE 4MM3A 4KSKC 2M8SA 3JSVA 2I1JA 1VD2A 3OJ4B 2EMSA 3PHWB 1NDDA 1WJ4A 3UQBA 1WJNA 3DCGA 2IBIB 2LUEA 3ZNID 1E8XA 4EZKA 4LDTD 1WYWB 4WQOB 2GBKA 5E6OA 5TR5A 3GZNI 3SD5A 3H7SA 2C9WB 3GOEA 4WWNA 2FCMA 2DZJA 2KWCA 1RAXA 4TV3A 3CSFA 2ZVNA 4W9LA 5L95C 3DVGX 2ASQA 2N7DA 3PZDA 2LWPA 1LM8B 2MRPA 3I3TB 3OLMD 1I35A 2BWES 2LASA 2IYDB 5D2MB 3A9KA 1ZKHA 1WGYA 3RD2A 3A1QB 4BVUC 2BYEA 2BPSA 3EHVA 2O6VD 1WXSA 3X23A 1LXDA 3NZUA 3APDA 4MJSB 4EZJA 2LI5A 1IP9A 2IO2B 2M17A 4TQ0A 3P2BA 4W9JA 4RM9A 2FCQA 2J0MA 1V6EA 4KSLC 3Q3JA 4DBGA 1ZGUB 2KANA 2D2QA 3EC8A 4KIKB 1WIAA 2G4DB 2ZNVC 4ANXA 4CO7A 3L0WB 2O6VB 2JRHA 2XK5B 3HM3A 3B1LX 1E8YA 1H4RA 1WY8A 2KFKA 3EECA 4NPNA 2NBVB 3A4RA 3UF8A 4GMVA 2QHOA 5GMVA 4K1RB 1NBFC 2RR9A 2HE7A 4HLEA 1ZW7A 2AWTA 2JWZA 2WDTB 2LGDA 1WXMA 1TZ1A 1WH3A 1V5TA 4J6IA 4ZRJA 3U7DA 4LCDE 3IG3A 4GN1A 1A5RA 1L2NA 1OEYJ 2C7MB 1WJUA 1R4MI 3QHTA 3QJZA 4RMAA 2K8CA 3DVGY 2WX1A 2D10A 2LJ5A 4BKGA 2R2OA 4F1SA 4EKUA 2JZ3B 4II3B 3ZUNA 4IWQA 4BKSD 1WGGA 4K7SA 2C7HA 1EUVB 2PPHA 2KMCA 3SDLC 1P3QU 2IO1B 4F7ZA 2RGFA 5D6JB 3RULA 3VHTC 2KDEB 1TBEA 2KQSA 1UBQA 2MX2A 1GJZA 3KW5B 1KLVA 2KKCA 4PS3A 5CHFA 1YD8U 2V3SA 1S3SG 1WGRA 3VXWA 5LXHA 4FJYA 4FLHA 2GOWA 2JT4B 2O2VB 3EFUA 3B08A 5FR6A 5LXIB 1FXTB 3VQIA 3PLVA 2K8HA 2L8JA 4A3OA 1SE9A 5J18A 3A9JB 3KYDD 4WWOA 4WWPA 1T0YA 3VUWA 2LD9A 2LRWA 1V2YA 3AULA 3JW0X 2XEWA 4FADA 4K81A 2KC2A 2KDBA 3WAMA 4G11A 3ZRCA 1E8ZA 2N1VA 2L3ZA 2C60A 2DZIA 3AU4A 2KO3A
chains in the Genus database with same CATH superfamily
5DPSA 2KFKB 1VRAB 4GDLA 4MACA 3VH4B 3IVFA 5G5HA 2AQ1B 3ZJTA 3ENEA 2MSED 3H1UA 2CHZA 1WX7A 3H7PA 4DDGD 4ANUA 1S1QB 3N1YC 3RMKC 3QCAA 2WYQA 3BWUD 4YTMB 1C9FA 4ZOHC 3I9V1 1TYGB 2NCNA 1BT0A 2QEJC 2ZPYA 4USAA 2KD0A 4YSXB 1MJDA 4M0WB 2J42A 3ONSA 3SHQA 4KGRA 3NVYA 3L10B 2V1YA 4MELA 2WX0A 2ZCBA 3BVZA 4BBNF 3DDCB 3AN1A 2IY0B 3VTWA 3AE6B 1EWYC 2K6DB 1C77A 2KLCA 3TEYA 4A8XC 2D11A 4M8MA 1D5ZC 2KT7A 3NOBA 1PQSA 2DLBA 2E3TA 4NQLB 1UZXB 3KWLA 2A4ZA 2J53A 3W5UB 3Q3NC 4RNAA 1ET6A 1ZUD2 2KTRA 1N5XA 4CQNA 2LRUA 1X1MA 3ZNHB 3QA8A 3SFEB 1I4RA 4IDIA 1T0SC 4JGHB 4TSSA 1P98A 3BZDB 1MVKA 3L16A 2NTSA 5CHWA 1V80A 2KMAA 1T3QA 2N7EA 4LK0M 3SU8X 4KVGB 1PGXA 4AUQC 1UUPA 2PW9A 2MP2B 2N9XA 5BYRA 4GDKA 3EGRA 3VTVA 4F8CB 2VH1A 3MTNB 1FFVA 2GI9A 3WAOA 1FM0D 2NPTA 1N61A 4NJ7A 1HXYD 1IPGA 2D3AA 4MDKE 3WANA 3L08A 2YVCA 5BMGA 1V97A 2WU2B 1TKGA 1DGJA 1WSPA 3ECIA 4REZA 3HUIA 3V61A 4HXDA 2MEKA 1C76A 1SIFA 3BVGA 4MSQB 2BB6A 3U52E 2MBHA 4DHJB 1D5XC 3R3MA 2XBBC 5C2TB 1M4VA 4S0RA 4ICUA 1HA5A 4W9FA 4ZRQA 2WXNA 4WAAA 3IAS1 4IG7B 4X57B 1WR6E 2G1EA 2M4NA 4HCNB 3UQAA 1QF6A 3IFWB 4HPLB 4IOIE 4C56C 1QOGA 2MQJA 2PJHA 3KUCB 2L83A 1IUEA 2W3SA 4OHJA 5DPWA 1V5OA 2JZPA 2FIFA 4JWUC 2KN4A 2W82A 2ZZPB 5E6NA 4E71A 2LVOA 2KQ7A 2WXPA 1KTKA 1WFYA 2C5LC 4PS8A 5L83A 2V9HA 4EUTA 2FIDA 1AN8A 2NBUA 1K52A 2NBWB 1SJHD 2EKIA 3ZXVA 4GDLB 2LGYA 3ZIMA 3BK2A 3C8YA 4BBNC 3AE9B 1SBBB 2MH7A 4LDTB 3DVNU 3Q69A 3TMPB 2DZKA 2JRIB 3CMMB 3D32A 2ZVOA 2A5UA 4CYEA 5EE1A 4LNKA 4B95A 1GB4A 3PT2B 3VRBB 2HTME 3RZFA 1I4XA 3DBSA 3ZDMC 3V6EB 5T8IA 1XO3A 2KZRA 2MJDA 3V6CB 1IGDA 4NJ6A 3ZGZA 1OTRB 3N1XC 2L52A 3B2FA 4H2AA 1PFDA 1NYQA 2LZ6A 4N9F4 3PS6A 1XF5L 2GBNA 1PYWD 4LJOB 2J7QB 3ZDTA 3R7QA 2HTHA 1SE3A 1KOTA 3W1YA 1XLQA 2K8BA 4JX1C 4OVUA 2FE8A 3SR6A 3CSTA 1YQBA 4KV2A 4DHZE 3MJWA 4C00A 1OEYA 4AS1A 2KJ6A 1C1YB 2G3QB 2LGSA 2KOXA 3AXCA 1UWXA 2UWQA 4DQOC 3URYA 1VCBA 3KVFB 2JXXA 4KZCA 4C7ZA 3I63C 1JWSD 3WAPA 1TY0A 1D5MC 4ITKA 2Y5BB 3PSEB 3K9PB 3N20C 2NPTB 3O13A 1Y56A 2LGIA 3X0WA 2L00B 2QDFA 1WM2A 2KTFA 1QOFA 4KSKC 2I1JA 3PHWB 1A70A 2WDVB 2BS3B 3ZNID 1WYWB 5E6OA 1AYFA 3GZNI 2FUG1 5AUIA 3B9JA 4TV3A 1FNUA 1ZE3D 4A6QA 2MRPA 3OLMD 1I35A 2LASA 3W9CB 3A9KA 3MHZA 1TY2A 4XWTA 3RD2A 2BYEA 3T3OA 2QILA 1L4ZB 3GS2A 1JROA 2M17A 4W9JA 4RM9A 2INNE 3NG0A 1WIAA 1F52A 4NZLB 2ZNVC 4ANXA 3AEDB 2KFKA 4NPNA 3UF8A 2QCZA 5GMVA 2QHOA 4M02A 1NBFC 2HE7A 4HLEA 3VRAB 2AWTA 1SE2A 1HEZE 1WXMA 4MM3B 3U7DA 1A5RA 2C7MB 1R4MI 1YN3A 2D10A 1MI0A 2R2OA 4LTUA 4II3B 2C7HA 3KLSX 2N9KA 2IO1B 4F7ZA 2RGFA 2K22A 2RDBC 1SE4A 1KLVA 5LXHA 3PZ7A 1C4PA 5FR6A 2IJ0A 1FXTB 3VQIA 2KVZA 5J18A 1F0ZA 2EELA 3ZJVA 1V2YA 3AULA 3AB5A 4FADA 4JE3B 4G11A 2N1VA 1YQ4B 2JQRB 2DNFA 1XXGA 5E6PA 1LQBA 3ZRFA 3QWZB 2D07B 3SFDB 2K0PA 2PKOA 2WLBA 2HD5B 2CJNA 1ESFA 1UWMA 4E3CA 1WRIA 2WXHA 3NVVA 4JQWC 3VUXA 4FHJA 3AEBB 2EKEC 1YIWA 4P16A 3AV8A 2I38A 3PRPB 5AZFA 3B0AA 1IGCA 2TSSA 2L05A 1Q10A 1ZOYB 2KXJA 3TEZA 2UYZB 3MP9A 2RDHA 1TT5B 3JVZX 4AJYB 2MP2A 2V4LA 2I2YA 4OVVA 4HJKA 2K25A 2WXIA 3L17A 3ZYYX 4HDOA 3FKYA 4HKZE 1L7YA 3IT6B 2K39A 5BYSA 1JRPA 1XLNA 2MJ3A 4BKTA 1E10A 4FHKA 4HPMB 2JSVX 1Q1OA 3RUIB 4HKQA 1P0RA 5JXVA 4XWWA 2DYMA 3RCZA 4YL8A 1RYJA 4L23A 2DYOA 4M8NA 2FCSA 4HK2A 3PPAA 2DENB 3QIJA 1E7UA 2LFIA 5LNK1 2L7RA 4C80A 3P42A 3QX1A 4W9IA 1T5XD 4BKSA 2ZJDA 3ZNZB 3HHMA 3ZLZA 4JPSA 4OZCA 1T6BX 1WF9A 4W9EA 5DCNA 1IBXB 1FNWA 4BOZB 1TKEA 3AEAB 3DBRI 3H8HA 1EU3A 1C3TA 1SB3C 4FBJB 1OGWA 1FCCC 3E9SA 2JX5A 4FA6A 3A9KB 2MLBA 1VZ8A 2GBMA 4ANVA 1YJIA 4WIPA 2WWZA 2JXTA 3Q8BA 3HRDD 1WMHB 1L0YB 4L2YA 4IM2A 1EF1A 3W1SC 1XCTL 3RZWC 1NVID 1QQRA 4JL9A 4YTNB 4ZYNA 1CQVA 1SF0A 5JHAA 1TJEA 1ZPSA 1GC7A 3Q3FA 3NVWA 2RPVA 1HZ5A 3HVZA 2MBQA 3IBEA 4IKGA 2MBOA 3TCAA 4I6NB 2KX3A 4OW0A 5G5GA 1C79A 4HCPB 1H8CA 4EZLA 4GLSC 2M56B 4RF0A 1WZ0A 4W9GA 2INPE 2K3UA 3R66C 1NI3A 2PIAA 4MJSA 1KLUD 3VFKA 4S17A 4BOSC 2J0JA 4RF1A 2JF5A 1C4CA 2QIEB 5BO4B 4ZDVA 4ARIA 5AUKA 1P7FA 1JCKB 2HDEA 1UH6A 5I4DA 4P7IA 4I6LB 4ZRIA 4JLCA 5H8YE 2PVOD 3LYYA 2GRIA 2NS5A 4LLGM 1CJEA 4RFBA 1QOBA 4TKNA 1WGDA 1V86A 3AE5B 2KNBA 3I57A 1F9JA 1D4BA 1B1ZA 3PREA 5HG2A 3RYTA 2K9XA 1SJED 4YWGG 1HE8A 1PUTA 1MHHE 4KX6B 1GNUA 2PEAA 2J0KA 2X38A 1UGMA 1WE6A 1J19A 4FULA 2ICIA 2RDGA 1ZDXA 1XLPA 3DHIC 3O65B 2KHWB 3VTUA 2KK8A 2ZEQA 3U7ZA 2D5GA 4XX5A 3P4QB 1MG4A 2WXKA 4I6PA 1TS4A 4GSWA 2KN5A 5C3JB 4IM3A 1TIFA 2BBCA 3EFCA 3BK1A 3GP7A 2LMCA 3N32A 3JYUA 2KWVB 1WI0A 4W9HA 2X8XX 1YQ3B 2W55A 3QC8B 3HM6X 3WIMA 2CS4A 3VUYA 4PK1A 1E90A 2N9PC 4GXBA 2BGFA 3VH3B 1WM3A 2G45B 2IGGA 2EMTA 2L76A 1FRDA 3PVLA 4DHJD 1JRUA 2CHXA 2N1WA 1G6JA 2D3GA 2Z59B 4P1CC 4ASWC 3Q8CA 1P9DU 2C7NB 1V1PB 1WZ3A 2N9EB 3N30A 1N63A 2LXCA 1ET9A 1T0RC 2GMIC 4ZRPA 2IO0B 4AQ7A 3ZW3A 1P1AA 3LB8C 4TUUA 1KJTA 1YX6B 1KFYB 2REXA 1CMXB 3V3XA 2WGSA 4YT0B 1XQQA 2INDC 2IO3B 4LJPB 4NAWA 2K6QA 1LGRA 4MM3A 5E6JA 3TEXA 3AH7A 3NUHB 2WHIA 4EZKA 4LDTD 4WQOB 1L6VA 3U4EG 2GBKA 1F2RC 2ZW0A 4WWNA 1RAXA 3CSFA 2ZVNA 5FKAC 2JYEA 1PGAA 2LWPA 1LM8B 3I3TB 1QT9A 4BAXA 5IO9A 3NZ3A 3P63A 2MJEA 2BPSA 2RMMA 3AE4B 4A90A 4MJSB 1J7BA 4TQ0A 4N6EB 2FCQA 2J0MA 3Q3JA 1D6EC 1ZGUB 2KANA 4KIKB 3TSSA 1RWSA 2G4DB 4CO7A 4LNNA 1YMHE 2JRHA 3HM3A 3B1LX 3EECA 3A4RA 4K1RB 3P1MA 1N60A 2RR9A 3RFZB 2WDTB 2LGDA 4ZRJA 1WH3A 1ACCA 4XE0A 4GN1A 3QJZA 1R7SA 4RMAA 2WX1A 3Q8AA 4BKGA 3OWEB 3ZUNA 2WXMA 1WGGA 4K7SA 1EUVB 3AE1B 2KMCA 3SDLC 3RULA 1TBEA 1UBQA 1FFUA 3Q2AC 2G9HD 3KW5B 5MPOA 4LNIA 1S3SG 3VXWA 4FJYA 5LXIB 3EFUA 3B08A 3PLVA 3AE3B 4MT5A 4WWOA 2VH2A 1WGKA 2LD9A 2LRWA 4ZHOA 4NJCA 4HROA 4NAMA 3JW0X 2XEWA 1E9MA 2FBWB 4K81A 2KDBA 3VR8B 3AECB 3ZRCA 2XN9C 3AU4A 2BW2A 3KQ4A 3DQVA 4Q2JA 2W9NA 4N59A 4C4VB 3K9OB 2YEPB 4LNFA 3HK0A 2K1FA 4W9CA 2JPHA 4KKIA 1UGJA 5EDSA 4RGNA 4M00A 2PVGC 1U4AA 2Z0DB 4NY0A 5IA7A 5AZHA 2IY1B 3M62B 4PYUA 2OOBB 3PHXB 4XGAB 2K5PA 2JZZA 4EOYA 3VR9B 3ZO5B 3W2DA 1I4QA 2KQ4X 4IW0A 2H88B 2KDIA 1IBXA 2QMTA 2W3RA 2NTTA 3DPDA 1UBIA 3M63B 4FJVB 2BKFA 4RGMA 3AM9A 1OQRA 5AEKB 1FRRA 5IOIA 3AU5A 4II2B 1ZP0B 2WU5B 4MGZE 1WXVA 3M3JA 2ZPNA 2Z0EB 1Z5SB 2DX5B 1WMHA 1OQYA 2RD0A 2DHZA 4EFOA 2M0XA 3NS1A 2MBEA 2MWSB 3A4SC 1JMLA 4OVZA 1R4NB 3KUZA 4IM0A 3BYTB 4GU2A 1GUAB 1QLBB 5EE9A 4L1BA 5CX3A 3T8MA 4NAWB 2I1KA 4B0MA 3GE3C 2RPQA 1SXTA 2WP9B 2V3NA 4GOCA 1KLGD 3BIID 1M94A 3DHHC 2FAZA 2M1MA 2IDYA 2IZVB 1N6ZA 2FNJB 2IPKD 4PT5A 2QC8A 2GBJA 1WYGA 3LJ3A 3PGEA 3DBLB 2KJRA 1WRDB 1UNSA 5DPTA 4URKA 1V81A 1XCQL 3TJPA 4XDCA 4KKJA 3TUOA 3H6NA 2WXOA 5C1ZA 2L32A 1ZDVA 1L6UA 2LHEA 5IN7A 4ARCA 1WX8A 3C0RB 2MA9B 3M95A 1RRBA 2KX0A 3V62A 3OG5A 4K3CA 2GBRA 4JIOU 2ZCCA 2BYTA 3QQ8B 1MFWA 3A1QA 1V8CA 3P4PB 2L1AA 1HTQA 1VLBA 1MG8A 4DDID 1YN4A 4XC2A 4A3PA 3DWGC 2LGXA 3IT4B 3RNCC 1C4AA 4KDLB 1E0ZA 4RGTA 1J7AA 2Y5PA 4W9KA 2O6VA 2Z8LA 5JZEB 1SGHA 2XK5A 2VRRB 2LXAA 1CZPA 2ONQA 3KUDB 5LLIA 1F2RI 3GB1A 5CTRC 3VVWB 3T3NA 1Y8RC 3NJTA 3FC4A 3AI5A 5JH5C 2BB5A 2V4IB 3FAHA 1GB1A 3MJ5A 4IUMB 4DK5A 1VZ6A 2JVCA 4DXAB 2OJRA 3PV1A 1UD7A 1AW7A 3AMZA 1HZ6A 3FILB 1J7CA 2HJ8A 1YN5A 2VZKB 4P6VF 3IXSA 2O2VA 2JU6X 2XNAC 2KC1A 2DZMA 3QAQA 3A9JA 1XD3B 3APFA 2CJOA 2LHDA 3N1ZC 1V1PA 2GB1A 1YJ1A 1RFAA 3GZNB 3MC0B 2N4FA 4MH8A 3CIRB 3TIXA 1E6EB 2LEKA 1SSNA 4D2KA 2PE6B 1E5WA 2LUMA 5J17A 1AWDA 2WDRB 2D3BA 1ROEA 4KDIC 2AL3A 1RM6C 1V49A 3R7RA 2KDMA 3DVNV 4K7UA 1ISNA 1L5PA 2MBBB 1DOXA 3GE8C 1LFDA 3UIPB 1N5WA 1OFFA 5GXGB 1TS3A 5AZGA 4WAFA 4M01A 1WXAA 4MH0E 3APCA 3PO0A 2KJHB 4A20A 2PTLA 4US9A 5KHOA 3DBHB 3RT3B 5D7GA 1TGZB 3TL5A 4B9KA 1E8WA 1DYQA 2LVQA 3N9YC 3BVMA 3ABVB 1SEBD 1Q0WB 2AL6A 1WJ6A 4FN2A 2WXRA 1JW9D 4BZAA 5DPRA 4XDDA 4KIKA 3BINA 4LNOA 1K51A 4A9AA 4HWIB 4YXDB 1QOAA 4AP4C 1MHXA 2BQQA 1PGBA 1YX5B 2G4SA 3Q3MC 2BVCA 2FUHB 1MPEA 2QJLA 2AQ3B 4G3XB 4DWFA 2M8SA 3JSVA 3OJ4B 1WJ4A 3UQBA 1WJNA 2N0SB 1FNVA 1I4HA 5EE0A 2LUEA 5TR5A 1TS2A 2C9WB 2WXJA 2FCMA 2KWCA 1ENFA 4W9LA 3UI3A 3DVGX 3EA6A 2N7DA 3PZDA 1L4DB 2BWES 2IYDB 1WGYA 3Q8EA 2UU7A 3A1QB 3EHVA 2O6VD 3X23A 3NZUA 1GOZA 3MC8A 1DOIA 4EZJA 2R61A 3RNEC 2IO2B 3P2BA 4DBGA 2D2QA 5BMHA 3EC8A 1YJJA 3HVDA 1FO4A 2O6VB 2XK5B 2SEBD 1E8YA 1WY8A 2SAKA 2NMQA 2WXGA 1KRHA 4GMVA 4C4VA 2JWZA 1TZ1A 1OEYJ 1WJUA 3QHTA 2ACZB 4F1SA 4EKUA 2JZ3B 4IWQA 4BKSD 2PPHA 3BYYB 1FD6A 1EU4A 3VHTC 2M0AA 2KDEB 3AE2B 1GJZA 2J52A 2KKCA 5CHFA 2V3SA 2GOWA 2O2VB 2KMMA 2INCC 2K8HA 3DWMA 2L8JA 4A3OA 1SE9A 3DBRB 3A9JB 4WWPA 3U2SC 3VUWA 2IGDA 1QKZA 1NENB 2BS4B 1I7HA 5BYQA 5HFYA 1YNTE 1I4GA 3NRZA 2DZIA 2WDQB 2KO3A 4EEWA 2KYWA 4GGQA 4WWMA 3Q6BA 1K8RB 2Q5WD 4WJQA 5IAAC 2KDFB 3RNAC 5IKCM 1EM7A 1HQRD 4MSMB 3ZJUA 5TSSA 2DYBA 2KAJA 2Y5CA 3L54A 1GPXA 1RLFA 4WJPA 2KACA 3NVZA 4ZHPA 1UELA 2DAFA 4N58A 4YSYB 2B76B 4NNJB 3LXFA 4PS7A 2KFJA 5D3DA 2YLMA 2GLSA 4WQMA 2AEHA 2HJ1A 1SIJA 4RH6A 3W5VB 1QZEA 1FXIA 2BTEA 2MW5A 2Y3AA 3KYCD 3U30A 1R4NI 5HHDG 3ALBA 4GIVA 4WJNA 2L0FA 3NZSA 4KGTA 4AWJA 4WH4A 1DOYA 3AEEB 5FR3A 3WALA 1FMAD 4DHZB 1EWCA 1GAQB 4A55A 1I4PA 4FXCA 1GC6A 4OZBA 3PTFC 4IWOA 4MGIE 1UF0A 5KHQA 4C7YA 1KF6B 2KWUB 3DBLI 4HDQA 4XYCA 3T9LA 3MHSD 1Q5WB 4TMAB 3H7PB 4XZ4A 4QAYA 1BXTA 3JSVB 4O1NA 5FK9C 1Z2MA 3VAWA 4DXGA 2WS3B 4ZYSA 2AQ2B 1XLOA 3ZQ4A 3AE8B 1FIQA 4AJWA 4W9DA 2JUOA 3OJ3A 1IYFA 2JWUA 5EE3A 1E7PB 3W1SA 1EF5A 2ZNVB 1KM7A 2FCNA 3IAM1 2YEPF 2PE9A 5J2RA 2OJWA 4TQ1A 2CR5A 4RM8A 2M19A 4RCOA 4US8A 1TS5A 1VZ7A 2BKRB 1NI2A 4CHKA 1B9RA 4HJGE 4GB9A 3RNBC 3N3KB 2NVUI 2KTRB 3VDZA 3RN9C 3BY4B 3FILA 4FJZA 1XEEA 3WA0A 1EO6A 1L0XB 2OEDA 1NYRA 2JY6A 4MEMA 3R8BA 1VDVA 5IP4D 2WNMA 4RGOS 1WR1A 3EUB2 3ZTCA 3TBLD 4GDKB 3UINB 4PYZA 2MHJA 3NHEB 5BMIA 3ZTDA 2WXLA 2BWFA 2MCNB 1V9JA 2ZW1A 4E74A 2WXFA 2OHFA 2BS2B 4AOFA 3KWVA 3PRZA 3UGBB 5G55A 2NR2A 4ANWA 5H92C 1XT9B 4B6WA 2LJIA 2IGHA 3ZXRA 1WXQA 4K3BA 4K7WA 3WCQA 2CU1A 1GG3A 3V60A 4HEA1 3PLUA 1JWAD 3B2GA 1J0GA 2DWQA 2BF8B 5D94A 3L4PA 3PRMB 4KZ0A 2RSUA 4UDUC 1C78A 1WX9A 4ZRKA 3ZKJC 4DXFA 3RNFC 4G50A 2AYOB 4BFRA 3CF6E 3DHGC 1RFKA 4HPPA 3Q3OC 2BYFA 1FPYA 4ACFA 3QK0A 3LDZE 4IC7B 3ZNGC 5CHVC 3DBHI 3CWIA 3IHPC 2L0TA 4OZAA 1BMLC 1LO5D 5D3IB 1J8CA 1ZXIA 1QILA 3NY5A 4KGSA 3Q8FA 5C23A 3S2AA 3HIZA 2BT6A 3V05A 2KLGA 3A33B 2V3PA 3Q14C 2D3CA 1K53A 3U8ZA 5HKHA 3OAWA 4WJOA 5JHBA 3DOWA 4HVBA 2W54A 1JWUD 2CKHB 2V0GA 2R2QA 4HRSA 2JYTA 4MGKE 1AARA 2DBYA 3UIOB 4ICVA 4IWPA 4M0WA 4MGYE 1YOVB 1WGHA 3C19A 3I5JC 1TTNA 3ZVVA 3KH0A 1WWTA 1VJKA 1F77A 2CHWA 2KWDA 1F1HA 5G2NA 1STEA 2CU3A 3L13A 3ML8A 1TKYA 1D3ZA 4YSZB 3AE7B 1VR9A 3ML9A 4WURA 1HTOA 4EE2A 3PZ8A 3QARA 2LVPA 3NS8A 3MFGA 2WXQA 2DAJA 1T0QC 1I42A 3AEFB 3P4SB 1CK1A 3H9DA 1WE7A 1KH0A 2KVRA 1E7VA 4NQKE 2B3AA 2BYVE 1V1OA 2PLPA 1FXAA 2N9LA 1VD2A 2EMSA 1NDDA 2E6XA 3R2TA 3E56A 2VZKD 3DCGA 2IBIB 1K50A 2J4XA 1E8XA 3SEBA 1JALA 3SD5A 3H7SA 3GOEA 2DZJA 5L95C 2ASQA 1FCLA 1BUIC 5D2MB 2ON8A 1ZKHA 4BVUC 1WXSA 1N62A 1LXDA 3APDA 1OQQA 2LI5A 1IP9A 4R3DA 1V6EA 4KSLC 1ZXHA 3RNGC 4YTPB 3TEWA 3L0WB 1FEHA 1H4RA 3ETRA 4JWSC 2QSDA 1L0VB 2NBVB 1TZOA 3AEGB 1ZW7A 3R2IA 4J6IA 1V5TA 4LCDE 3IG3A 5HI1A 1L2NA 2K8CA 3DVGY 2LJ5A 1JWMD 2H89B 3RPFC 3P4RB 3RI7C 1P3QU 1PDXA 5D6JB 2KQSA 2MX2A 1JQ4A 1JWBD 1P7EA 4P1BC 1NEKB 4PS3A 2PMVA 1YD8U 1WGRA 2N7JA 4J3OD 4FLHA 2JT4B 3J9CA 1R4MB 3KYDD 1T0YA 4B0EA 2KC2A 2WQYB 3WAMA 1E8ZA 2L3ZA 2C60A 2AX5A 3MC9A 4G0NB
chains in the Genus database with same CATH topology
5E6PA 1LQBA 5DPSA 4EEWA 2KFKB 4GGQA 3DQVA 3ZRFA 3QWZB 2D07B 1K8RB 2W9NA 3K9OB 3HK0A 4WJQA 4GDLA 2K1FA 4W9CA 2JPHA 2HD5B 5IAAC 2KDFB 5EDSA 3VH4B 4E3CA 1U4AA 3IVFA 2Z0DB 4NY0A 4MSMB 3ENEA 5IA7A 5AZHA 2IY1B 2DYBA 2MSED 3M62B 4PYUA 2OOBB 3PHXB 4JQWC 4FHJA 2JZZA 3L54A 3H1UA 2CHZA 1RLFA 4WJPA 3VUXA 4EOYA 2EKEC 3ZO5B 1WX7A 1YIWA 1UELA 2DAFA 3H7PA 4IW0A 3PRPB 4ANUA 4DDGD 1S1QB 5AZFA 3QCAA 3B0AA 2KDIA 2WYQA 4NNJB 4PS7A 2KFJA 3DPDA 2L05A 2KXJA 2YLMA 2UYZB 1UBIA 2AEHA 2NCNA 1BT0A 3M63B 1QZEA 4FJVB 2ZPYA 2KD0A 2BKFA 2MW5A 3KYCD 3U30A 1R4NI 3JVZX 4AJYB 2MP2A 2V4LA 3ALBA 4GIVA 4M0WB 4OVVA 4WJNA 4HJKA 2K25A 3ONSA 3SHQA 5AEKB 2L0FA 3L17A 3NZSA 4HDOA 4AWJA 3AU5A 2V1YA 3L10B 2WX0A 2ZCBA 4MELA 1L7YA 4BBNF 2K39A 3DDCB 4BKTA 4II2B 4FHKA 4HPMB 2IY0B 4MGZE 1WXVA 1Q1OA 3RUIB 3VTWA 3WALA 1P0RA 3M3JA 4DHZB 2DYMA 2ZPNA 3RCZA 4YL8A 2Z0EB 2K6DB 2KLCA 1Z5SB 2DX5B 1WMHA 1OQYA 2RD0A 2DYOA 2D11A 2DHZA 4EFOA 2M0XA 4M8MA 4M8NA 1GC6A 2FCSA 2MBEA 2MWSB 3A4SC 3PTFC 4IWOA 4HK2A 3NOBA 1PQSA 4NQLB 1UZXB 3KUZA 3PPAA 2A4ZA 4MGIE 4IM0A 2DENB 3QIJA 1E7UA 5KHQA 2L7RA 2KWUB 3DBLI 4GU2A 3QX1A 4W9IA 1GUAB 4HDQA 4BKSA 2ZJDA 3T9LA 3ZNZB 2KTRA 3HHMA 3MHSD 2LRUA 1X1MA 5CX3A 3T8MA 1Q5WB 3ZLZA 3ZNHB 3QA8A 4NAWB 3H7PB 2I1KA 4XZ4A 1WF9A 4W9EA 2RPQA 3JSVB 5DCNA 4BOZB 4GOCA 4JGHB 1P98A 1Z2MA 3DBRI 3VAWA 1M94A 2FAZA 2M1MA 2IZVB 3L16A 2FNJB 5CHWA 1V80A 2GBJA 4W9DA 2KMAA 4AJWA 2JUOA 2N7EA 4FBJB 1C3TA 1OGWA 3OJ3A 4KVGB 3SU8X 1IYFA 4AUQC 3LJ3A 3W1SA 3PGEA 1EF5A 2ZNVB 2KJRA 2MP2B 2N9XA 1KM7A 1WRDB 4GDKA 3VTVA 2FCNA 4F8CB 4FA6A 5DPTA 3MTNB 3A9KB 4URKA 2MLBA 2PE9A 1V81A 3WAOA 2NPTA 3TJPA 4NJ7A 1IPGA 2GBMA 4ANVA 5J2RA 4TQ1A 2CR5A 3H6NA 4RM8A 4MDKE 3WANA 5C1ZA 2WWZA 3L08A 1WMHB 2YVCA 4IM2A 1EF1A 3W1SC 2BKRB 1NI2A 1WX8A 3RZWC 4CHKA 3ECIA 3C0RB 4JL9A 2MA9B 4ZYNA 3V61A 3M95A 4HXDA 1RRBA 4GB9A 1SIFA 2KX0A 3V62A 5JHAA 3N3KB 2NVUI 4MSQB 1GC7A 2KTRB 3Q3FA 3VDZA 3BY4B 3IBEA 2MBQA 3TCAA 2MBOA 2GBRA 4FJZA 4I6NB 2KX3A 2MBHA 2ZCCA 4JIOU 3QQ8B 4HCPB 3WA0A 4DHJB 4EZLA 3A1QA 1H8CA 1EO6A 3R3MA 2XBBC 1WZ0A 4W9GA 4ICUA 2JY6A 4W9FA 4MEMA 3R66C 1MG8A 4WAAA 4IG7B 4MJSA 4DDID 4A3PA 4XC2A 4X57B 1WR6E 3VFKA 4BOSC 2M4NA 4HCNB 1WR1A 3UQAA 2J0JA 3IFWB 2LGXA 4HPLB 2JF5A 3ZTCA 4KDLB 3TBLD 4GDKB 3UINB 2MQJA 2PJHA 4PYZA 3KUCB 5BO4B 4ZDVA 4W9KA 2O6VA 5JZEB 1SGHA 2XK5A 3NHEB 2VRRB 2LXAA 3ZTDA 2BWFA 2MCNB 1V9JA 1UH6A 5DPWA 4P7IA 1V5OA 4E74A 4I6LB 3KUDB 4ZRIA 4JLCA 5LLIA 2FIFA 5CTRC 3VVWB 2ZZPB 5E6NA 4AOFA 2NS5A 1Y8RC 2LVOA 3PRZA 3UGBB 2KQ7A 5G55A 4E71A 2NR2A 1WFYA 3AI5A 4ANWA 2C5LC 5JH5C 4PS8A 1XT9B 4TKNA 1WGDA 1V86A 4B6WA 5L83A 4EUTA 2KNBA 4IUMB 2FIDA 4DK5A 2NBUA 2JVCA 4K7WA 2NBWB 2CU1A 4DXAB 1F9JA 2OJRA 3PREA 3RYTA 3PV1A 1UD7A 1GG3A 4GDLB 2LGYA 3V60A 3ZIMA 2HJ8A 3PLUA 1HE8A 4BBNC 4LDTB 1GNUA 2O2VA 3DVNU 1J0GA 2PEAA 2J0KA 2BF8B 5D94A 3PRMB 1UGMA 2KC1A 4KZ0A 1WE6A 3TMPB 1J19A 2DZMA 2DZKA 3QAQA 3A9JA 4FULA 1XD3B 2JRIB 2RSUA 3APFA 3CMMB 3O65B 1YJ1A 2KHWB 3D32A 2KK8A 1RFAA 2ZVOA 2ZEQA 3VTUA 1WX9A 2A5UA 4ZRKA 4CYEA 3ZKJC 4G50A 4XX5A 4B95A 2AYOB 4BFRA 2N4FA 4I6PA 4GSWA 2KN5A 3CF6E 4IM3A 3TIXA 3PT2B 2PE6B 1E5WA 2BYFA 3N32A 5J17A 3JYUA 3RZFA 2KWVB 1WI0A 3DBSA 3ZDMC 3QK0A 3LDZE 4IC7B 3V6EB 3ZNGC 4W9HA 5CHVC 2KZRA 4KDIC 3QC8B 3V6CB 3DBHI 3HM6X 2AL3A 3IHPC 2L0TA 4NJ6A 3WIMA 2CS4A 1V49A 1J8CA 3R7RA 3NY5A 1OTRB 3VUYA 3DVNV 5C23A 4K7UA 1ISNA 3S2AA 2MBBB 3HIZA 1E90A 2KLGA 1LFDA 3A33B 3UIPB 2N9PC 2LZ6A 4GXBA 4N9F4 5AZGA 2BGFA 3U8ZA 3VH3B 4G0NB 5HKHA 3PS6A 1WXAA 3OAWA 1WM3A 4MH0E 2G45B 2GBNA 4WJOA 3APCA 5JHBA 2EMTA 2KJHB 4LJOB 4A20A 2L76A 4DHJD 3PVLA 3DOWA 1JRUA 2CHXA 2J7QB 2N1WA 3R7QA 3ZDTA 5KHOA 4HVBA 1G6JA 2CKHB 2HTHA 2D3GA 2R2QA 3RT3B 5D7GA 1KOTA 2Z59B 4MGKE 3W1YA 1AARA 1TGZB 2K8BA 3TL5A 4ASWC 1P9DU 4B9KA 3UIOB 4ICVA 4OVUA 4IWPA 1E8WA 2LVQA 4MGYE 3CSTA 1YQBA 4KV2A 4DHZE 3MJWA 1WGHA 2C7NB 1WZ3A 2N9EB 1Q0WB 1OEYA 1TTNA 3KH0A 2AL6A 3N30A 3ZVVA 1WJ6A 2LXCA 2GMIC 2CHWA 5G2NA 2KJ6A 1C1YB 2G3QB 2KOXA 2IO0B 4FN2A 3L13A 3AXCA 3ML8A 3ZW3A 1P1AA 1D3ZA 2UWQA 5DPRA 4TUUA 1KJTA 1VCBA 1YX6B 4KIKA 3KVFB 3ML9A 2JXXA 3BINA 4KZCA 2REXA 1CMXB 4HWIB 3WAPA 4AP4C 3QARA 2LVPA 3NS8A 2Y5BB 2DAJA 1I42A 3PSEB 3K9PB 2NPTB 1YX5B 2G4SA 3X0WA 1XQQA 2FUHB 3H9DA 1WE7A 2IO3B 2L00B 4LJPB 2KVRA 4NAWA 1E7VA 1WM2A 2K6QA 2KTFA 4G3XB 4NQKE 2B3AA 4DWFA 2BYVE 4MM3A 4KSKC 2M8SA 3JSVA 2I1JA 1VD2A 3OJ4B 2EMSA 3PHWB 1NDDA 1WJ4A 3UQBA 1WJNA 3DCGA 2IBIB 2LUEA 3ZNID 1E8XA 4EZKA 4LDTD 1WYWB 4WQOB 2GBKA 5E6OA 5TR5A 3GZNI 3SD5A 3H7SA 2C9WB 3GOEA 4WWNA 2FCMA 2DZJA 2KWCA 1RAXA 4TV3A 3CSFA 2ZVNA 4W9LA 5L95C 3DVGX 2ASQA 2N7DA 3PZDA 2LWPA 1LM8B 2MRPA 3I3TB 3OLMD 1I35A 2BWES 2LASA 2IYDB 5D2MB 3A9KA 1ZKHA 1WGYA 3RD2A 3A1QB 4BVUC 2BYEA 2BPSA 3EHVA 2O6VD 1WXSA 3X23A 1LXDA 3NZUA 3APDA 4MJSB 4EZJA 2LI5A 1IP9A 2IO2B 2M17A 4TQ0A 3P2BA 4W9JA 4RM9A 2FCQA 2J0MA 1V6EA 4KSLC 3Q3JA 4DBGA 1ZGUB 2KANA 2D2QA 3EC8A 4KIKB 1WIAA 2G4DB 2ZNVC 4ANXA 4CO7A 3L0WB 2O6VB 2JRHA 2XK5B 3HM3A 3B1LX 1E8YA 1H4RA 1WY8A 2KFKA 3EECA 4NPNA 2NBVB 3A4RA 3UF8A 4GMVA 2QHOA 5GMVA 4K1RB 1NBFC 2RR9A 2HE7A 4HLEA 1ZW7A 2AWTA 2JWZA 2WDTB 2LGDA 1WXMA 1TZ1A 1WH3A 1V5TA 4J6IA 4ZRJA 3U7DA 4LCDE 3IG3A 4GN1A 1A5RA 1L2NA 1OEYJ 2C7MB 1WJUA 1R4MI 3QHTA 3QJZA 4RMAA 2K8CA 3DVGY 2WX1A 2D10A 2LJ5A 4BKGA 2R2OA 4F1SA 4EKUA 2JZ3B 4II3B 3ZUNA 4IWQA 4BKSD 1WGGA 4K7SA 2C7HA 1EUVB 2PPHA 2KMCA 3SDLC 1P3QU 2IO1B 4F7ZA 2RGFA 5D6JB 3RULA 3VHTC 2KDEB 1TBEA 2KQSA 1UBQA 2MX2A 1GJZA 3KW5B 1KLVA 2KKCA 4PS3A 5CHFA 1YD8U 2V3SA 1S3SG 1WGRA 3VXWA 5LXHA 4FJYA 4FLHA 2GOWA 2JT4B 2O2VB 3EFUA 3B08A 5FR6A 5LXIB 1FXTB 3VQIA 3PLVA 2K8HA 2L8JA 4A3OA 1SE9A 5J18A 3A9JB 3KYDD 4WWOA 4WWPA 1T0YA 3VUWA 2LD9A 2LRWA 1V2YA 3AULA 3JW0X 2XEWA 4FADA 4K81A 2KC2A 2KDBA 3WAMA 4G11A 3ZRCA 1E8ZA 2N1VA 2L3ZA 2C60A 2DZIA 3AU4A 2KO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6P A;  1LQB A;  5DPS A;  4EEW A;  2KFK B;  4GGQ A;  3DQV A;  3ZRF A;  3QWZ B;  2D07 B;  1K8R B;  2W9N A;  3K9O B;  3HK0 A;  4WJQ A;  4GDL A;  2K1F A;  4W9C A;  2JPH A;  2HD5 B;  5IAA C;  2KDF B;  5EDS A;  3VH4 B;  4E3C A;  1U4A A;  3IVF A;  2Z0D B;  4NY0 A;  4MSM B;  3ENE A;  5IA7 A;  5AZH A;  2IY1 B;  2DYB A;  2MSE D;  3M62 B;  4PYU A;  2OOB B;  3PHX B;  4JQW C;  4FHJ A;  2JZZ A;  3L54 A;  3H1U A;  2CHZ A;  1RLF A;  4WJP A;  3VUX A;  4EOY A;  2EKE C;  3ZO5 B;  1WX7 A;  1YIW A;  1UEL A;  2DAF A;  3H7P A;  4IW0 A;  3PRP B;  4ANU A;  4DDG D;  1S1Q B;  5AZF A;  3QCA A;  3B0A A;  2KDI A;  2WYQ A;  4NNJ B;  4PS7 A;  2KFJ A;  3DPD A;  2L05 A;  2KXJ A;  2YLM A;  2UYZ B;  1UBI A;  2AEH A;  2NCN A;  1BT0 A;  3M63 B;  1QZE A;  4FJV B;  2ZPY A;  2KD0 A;  2BKF A;  2MW5 A;  3KYC D;  3U30 A;  1R4N I;  3JVZ X;  4AJY B;  2MP2 A;  2V4L A;  3ALB A;  4GIV A;  4M0W B;  4OVV A;  4WJN A;  4HJK A;  2K25 A;  3ONS A;  3SHQ A;  5AEK B;  2L0F A;  3L17 A;  3NZS A;  4HDO A;  4AWJ A;  3AU5 A;  2V1Y A;  3L10 B;  2WX0 A;  2ZCB A;  4MEL A;  1L7Y A;  4BBN F;  2K39 A;  3DDC B;  4BKT A;  4II2 B;  4FHK A;  4HPM B;  2IY0 B;  4MGZ E;  1WXV A;  1Q1O A;  3RUI B;  3VTW A;  3WAL A;  1P0R A;  3M3J A;  4DHZ B;  2DYM A;  2ZPN A;  3RCZ A;  4YL8 A;  2Z0E B;  2K6D B;  2KLC A;  1Z5S B;  2DX5 B;  1WMH A;  1OQY A;  2RD0 A;  2DYO A;  2D11 A;  2DHZ A;  4EFO A;  2M0X A;  4M8M A;  4M8N A;  1GC6 A;  2FCS A;  2MBE A;  2MWS B;  3A4S C;  3PTF C;  4IWO A;  4HK2 A;  3NOB A;  1PQS A;  4NQL B;  1UZX B;  3KUZ A;  3PPA A;  2A4Z A;  4MGI E;  4IM0 A;  2DEN B;  3QIJ A;  1E7U A;  5KHQ A;  2L7R A;  2KWU B;  3DBL I;  4GU2 A;  3QX1 A;  4W9I A;  1GUA B;  4HDQ A;  4BKS A;  2ZJD A;  3T9L A;  3ZNZ B;  2KTR A;  3HHM A;  3MHS D;  2LRU A;  1X1M A;  5CX3 A;  3T8M A;  1Q5W B;  3ZLZ A;  3ZNH B;  3QA8 A;  4NAW B;  3H7P B;  2I1K A;  4XZ4 A;  1WF9 A;  4W9E A;  2RPQ A;  3JSV B;  5DCN A;  4BOZ B;  4GOC A;  4JGH B;  1P98 A;  1Z2M A;  3DBR I;  3VAW A;  1M94 A;  2FAZ A;  2M1M A;  2IZV B;  3L16 A;  2FNJ B;  5CHW A;  1V80 A;  2GBJ A;  4W9D A;  2KMA A;  4AJW A;  2JUO A;  2N7E A;  4FBJ B;  1C3T A;  1OGW A;  3OJ3 A;  4KVG B;  3SU8 X;  1IYF A;  4AUQ C;  3LJ3 A;  3W1S A;  3PGE A;  1EF5 A;  2ZNV B;  2KJR A;  2MP2 B;  2N9X A;  1KM7 A;  1WRD B;  4GDK A;  3VTV A;  2FCN A;  4F8C B;  4FA6 A;  5DPT A;  3MTN B;  3A9K B;  4URK A;  2MLB A;  2PE9 A;  1V81 A;  3WAO A;  2NPT A;  3TJP A;  4NJ7 A;  1IPG A;  2GBM A;  4ANV A;  5J2R A;  4TQ1 A;  2CR5 A;  3H6N A;  4RM8 A;  4MDK E;  3WAN A;  5C1Z A;  2WWZ A;  3L08 A;  1WMH B;  2YVC A;  4IM2 A;  1EF1 A;  3W1S C;  2BKR B;  1NI2 A;  1WX8 A;  3RZW C;  4CHK A;  3ECI A;  3C0R B;  4JL9 A;  2MA9 B;  4ZYN A;  3V61 A;  3M95 A;  4HXD A;  1RRB A;  4GB9 A;  1SIF A;  2KX0 A;  3V62 A;  5JHA A;  3N3K B;  2NVU I;  4MSQ B;  1GC7 A;  2KTR B;  3Q3F A;  3VDZ A;  3BY4 B;  3IBE A;  2MBQ A;  3TCA A;  2MBO A;  2GBR A;  4FJZ A;  4I6N B;  2KX3 A;  2MBH A;  2ZCC A;  4JIO U;  3QQ8 B;  4HCP B;  3WA0 A;  4DHJ B;  4EZL A;  3A1Q A;  1H8C A;  1EO6 A;  3R3M A;  2XBB C;  1WZ0 A;  4W9G A;  4ICU A;  2JY6 A;  4W9F A;  4MEM A;  3R66 C;  1MG8 A;  4WAA A;  4IG7 B;  4MJS A;  4DDI D;  4A3P A;  4XC2 A;  4X57 B;  1WR6 E;  3VFK A;  4BOS C;  2M4N A;  4HCN B;  1WR1 A;  3UQA A;  2J0J A;  3IFW B;  2LGX A;  4HPL B;  2JF5 A;  3ZTC A;  4KDL B;  3TBL D;  4GDK B;  3UIN B;  2MQJ A;  2PJH A;  4PYZ A;  3KUC B;  5BO4 B;  4ZDV A;  4W9K A;  2O6V A;  5JZE B;  1SGH A;  2XK5 A;  3NHE B;  2VRR B;  2LXA A;  3ZTD A;  2BWF A;  2MCN B;  1V9J A;  1UH6 A;  5DPW A;  4P7I A;  1V5O A;  4E74 A;  4I6L B;  3KUD B;  4ZRI A;  4JLC A;  5LLI A;  2FIF A;  5CTR C;  3VVW B;  2ZZP B;  5E6N A;  4AOF A;  2NS5 A;  1Y8R C;  2LVO A;  3PRZ A;  3UGB B;  2KQ7 A;  5G55 A;  4E71 A;  2NR2 A;  1WFY A;  3AI5 A;  4ANW A;  2C5L C;  5JH5 C;  4PS8 A;  1XT9 B;  4TKN A;  1WGD A;  1V86 A;  4B6W A;  5L83 A;  4EUT A;  2KNB A;  4IUM B;  2FID A;  4DK5 A;  2NBU A;  2JVC A;  4K7W A;  2NBW B;  2CU1 A;  4DXA B;  1F9J A;  2OJR A;  3PRE A;  3RYT A;  3PV1 A;  1UD7 A;  1GG3 A;  4GDL B;  2LGY A;  3V60 A;  3ZIM A;  2HJ8 A;  3PLU A;  1HE8 A;  4BBN C;  4LDT B;  1GNU A;  2O2V A;  3DVN U;  1J0G A;  2PEA A;  2J0K A;  2BF8 B;  5D94 A;  3PRM B;  1UGM A;  2KC1 A;  4KZ0 A;  1WE6 A;  3TMP B;  1J19 A;  2DZM A;  2DZK A;  3QAQ A;  3A9J A;  4FUL A;  1XD3 B;  2JRI B;  2RSU A;  3APF A;  3CMM B;  3O65 B;  1YJ1 A;  2KHW B;  3D32 A;  2KK8 A;  1RFA A;  2ZVO A;  2ZEQ A;  3VTU A;  1WX9 A;  2A5U A;  4ZRK A;  4CYE A;  3ZKJ C;  4G50 A;  4XX5 A;  4B95 A;  2AYO B;  4BFR A;  2N4F A;  4I6P A;  4GSW A;  2KN5 A;  3CF6 E;  4IM3 A;  3TIX A;  3PT2 B;  2PE6 B;  1E5W A;  2BYF A;  3N32 A;  5J17 A;  3JYU A;  3RZF A;  2KWV B;  1WI0 A;  3DBS A;  3ZDM C;  3QK0 A;  3LDZ E;  4IC7 B;  3V6E B;  3ZNG C;  4W9H A;  5CHV C;  2KZR A;  4KDI C;  3QC8 B;  3V6C B;  3DBH I;  3HM6 X;  2AL3 A;  3IHP C;  2L0T A;  4NJ6 A;  3WIM A;  2CS4 A;  1V49 A;  1J8C A;  3R7R A;  3NY5 A;  1OTR B;  3VUY A;  3DVN V;  5C23 A;  4K7U A;  1ISN A;  3S2A A;  2MBB B;  3HIZ A;  1E90 A;  2KLG A;  1LFD A;  3A33 B;  3UIP B;  2N9P C;  2LZ6 A;  4GXB A;  4N9F 4;  5AZG A;  2BGF A;  3U8Z A;  3VH3 B;  4G0N B;  5HKH A;  3PS6 A;  1WXA A;  3OAW A;  1WM3 A;  4MH0 E;  2G45 B;  2GBN A;  4WJO A;  3APC A;  5JHB A;  2EMT A;  2KJH B;  4LJO B;  4A20 A;  2L76 A;  4DHJ D;  3PVL A;  3DOW A;  1JRU A;  2CHX A;  2J7Q B;  2N1W A;  3R7Q A;  3ZDT A;  5KHO A;  4HVB A;  1G6J A;  2CKH B;  2HTH A;  2D3G A;  2R2Q A;  3RT3 B;  5D7G A;  1KOT A;  2Z59 B;  4MGK E;  3W1Y A;  1AAR A;  1TGZ B;  2K8B A;  3TL5 A;  4ASW C;  1P9D U;  4B9K A;  3UIO B;  4ICV A;  4OVU A;  4IWP A;  1E8W A;  2LVQ A;  4MGY E;  3CST A;  1YQB A;  4KV2 A;  4DHZ E;  3MJW A;  1WGH A;  2C7N B;  1WZ3 A;  2N9E B;  1Q0W B;  1OEY A;  1TTN A;  3KH0 A;  2AL6 A;  3N30 A;  3ZVV A;  1WJ6 A;  2LXC A;  2GMI C;  2CHW A;  5G2N A;  2KJ6 A;  1C1Y B;  2G3Q B;  2KOX A;  2IO0 B;  4FN2 A;  3L13 A;  3AXC A;  3ML8 A;  3ZW3 A;  1P1A A;  1D3Z A;  2UWQ A;  5DPR A;  4TUU A;  1KJT A;  1VCB A;  1YX6 B;  4KIK A;  3KVF B;  3ML9 A;  2JXX A;  3BIN A;  4KZC A;  2REX A;  1CMX B;  4HWI B;  3WAP A;  4AP4 C;  3QAR A;  2LVP A;  3NS8 A;  2Y5B B;  2DAJ A;  1I42 A;  3PSE B;  3K9P B;  2NPT B;  1YX5 B;  2G4S A;  3X0W A;  1XQQ A;  2FUH B;  3H9D A;  1WE7 A;  2IO3 B;  2L00 B;  4LJP B;  2KVR A;  4NAW A;  1E7V A;  1WM2 A;  2K6Q A;  2KTF A;  4G3X B;  4NQK E;  2B3A A;  4DWF A;  2BYV E;  4MM3 A;  4KSK C;  2M8S A;  3JSV A;  2I1J A;  1VD2 A;  3OJ4 B;  2EMS A;  3PHW B;  1NDD A;  1WJ4 A;  3UQB A;  1WJN A;  3DCG A;  2IBI B;  2LUE A;  3ZNI D;  1E8X A;  4EZK A;  4LDT D;  1WYW B;  4WQO B;  2GBK A;  5E6O A;  5TR5 A;  3GZN I;  3SD5 A;  3H7S A;  2C9W B;  3GOE A;  4WWN A;  2FCM A;  2DZJ A;  2KWC A;  1RAX A;  4TV3 A;  3CSF A;  2ZVN A;  4W9L A;  5L95 C;  3DVG X;  2ASQ A;  2N7D A;  3PZD A;  2LWP A;  1LM8 B;  2MRP A;  3I3T B;  3OLM D;  1I35 A;  2BWE S;  2LAS A;  2IYD B;  5D2M B;  3A9K A;  1ZKH A;  1WGY A;  3RD2 A;  3A1Q B;  4BVU C;  2BYE A;  2BPS A;  3EHV A;  2O6V D;  1WXS A;  3X23 A;  1LXD A;  3NZU A;  3APD A;  4MJS B;  4EZJ A;  2LI5 A;  1IP9 A;  2IO2 B;  2M17 A;  4TQ0 A;  3P2B A;  4W9J A;  4RM9 A;  2FCQ A;  2J0M A;  1V6E A;  4KSL C;  3Q3J A;  4DBG A;  1ZGU B;  2KAN A;  2D2Q A;  3EC8 A;  4KIK B;  1WIA A;  2G4D B;  2ZNV C;  4ANX A;  4CO7 A;  3L0W B;  2O6V B;  2JRH A;  2XK5 B;  3HM3 A;  3B1L X;  1E8Y A;  1H4R A;  1WY8 A;  2KFK A;  3EEC A;  4NPN A;  2NBV B;  3A4R A;  3UF8 A;  4GMV A;  2QHO A;  5GMV A;  4K1R B;  1NBF C;  2RR9 A;  2HE7 A;  4HLE A;  1ZW7 A;  2AWT A;  2JWZ A;  2WDT B;  2LGD A;  1WXM A;  1TZ1 A;  1WH3 A;  1V5T A;  4J6I A;  4ZRJ A;  3U7D A;  4LCD E;  3IG3 A;  4GN1 A;  1A5R A;  1L2N A;  1OEY J;  2C7M B;  1WJU A;  1R4M I;  3QHT A;  3QJZ A;  4RMA A;  2K8C A;  3DVG Y;  2WX1 A;  2D10 A;  2LJ5 A;  4BKG A;  2R2O A;  4F1S A;  4EKU A;  2JZ3 B;  4II3 B;  3ZUN A;  4IWQ A;  4BKS D;  1WGG A;  4K7S A;  2C7H A;  1EUV B;  2PPH A;  2KMC A;  3SDL C;  1P3Q U;  2IO1 B;  4F7Z A;  2RGF A;  5D6J B;  3RUL A;  3VHT C;  2KDE B;  1TBE A;  2KQS A;  1UBQ A;  2MX2 A;  1GJZ A;  3KW5 B;  1KLV A;  2KKC A;  4PS3 A;  5CHF A;  1YD8 U;  2V3S A;  1S3S G;  1WGR A;  3VXW A;  5LXH A;  4FJY A;  4FLH A;  2GOW A;  2JT4 B;  2O2V B;  3EFU A;  3B08 A;  5FR6 A;  5LXI B;  1FXT B;  3VQI A;  3PLV A;  2K8H A;  2L8J A;  4A3O A;  1SE9 A;  5J18 A;  3A9J B;  3KYD D;  4WWO A;  4WWP A;  1T0Y A;  3VUW A;  2LD9 A;  2LRW A;  1V2Y A;  3AUL A;  3JW0 X;  2XEW A;  4FAD A;  4K81 A;  2KC2 A;  2KDB A;  3WAM A;  4G11 A;  3ZRC A;  1E8Z A;  2N1V A;  2L3Z A;  2C60 A;  2DZI A;  3AU4 A;  2KO3 A; 
#chains in the Genus database with same CATH topology
 5DPS A;  2KFK B;  1VRA B;  4GDL A;  4MAC A;  3VH4 B;  3IVF A;  5G5H A;  2AQ1 B;  3ZJT A;  3ENE A;  2MSE D;  3H1U A;  2CHZ A;  1WX7 A;  3H7P A;  4DDG D;  4ANU A;  1S1Q B;  3N1Y C;  3RMK C;  3QCA A;  2WYQ A;  3BWU D;  4YTM B;  1C9F A;  4ZOH C;  3I9V 1;  1TYG B;  2NCN A;  1BT0 A;  2QEJ C;  2ZPY A;  4USA A;  2KD0 A;  4YSX B;  1MJD A;  4M0W B;  2J42 A;  3ONS A;  3SHQ A;  4KGR A;  3NVY A;  3L10 B;  2V1Y A;  4MEL A;  2WX0 A;  2ZCB A;  3BVZ A;  4BBN F;  3DDC B;  3AN1 A;  2IY0 B;  3VTW A;  3AE6 B;  1EWY C;  2K6D B;  1C77 A;  2KLC A;  3TEY A;  4A8X C;  2D11 A;  4M8M A;  1D5Z C;  2KT7 A;  3NOB A;  1PQS A;  2DLB A;  2E3T A;  4NQL B;  1UZX B;  3KWL A;  2A4Z A;  2J53 A;  3W5U B;  3Q3N C;  4RNA A;  1ET6 A;  1ZUD 2;  2KTR A;  1N5X A;  4CQN A;  2LRU A;  1X1M A;  3ZNH B;  3QA8 A;  3SFE B;  1I4R A;  4IDI A;  1T0S C;  4JGH B;  4TSS A;  1P98 A;  3BZD B;  1MVK A;  3L16 A;  2NTS A;  5CHW A;  1V80 A;  2KMA A;  1T3Q A;  2N7E A;  4LK0 M;  3SU8 X;  4KVG B;  1PGX A;  4AUQ C;  1UUP A;  2PW9 A;  2MP2 B;  2N9X A;  5BYR A;  4GDK A;  3EGR A;  3VTV A;  4F8C B;  2VH1 A;  3MTN B;  1FFV A;  2GI9 A;  3WAO A;  1FM0 D;  2NPT A;  1N61 A;  4NJ7 A;  1HXY D;  1IPG A;  2D3A A;  4MDK E;  3WAN A;  3L08 A;  2YVC A;  5BMG A;  1V97 A;  2WU2 B;  1TKG A;  1DGJ A;  1WSP A;  3ECI A;  4REZ A;  3HUI A;  3V61 A;  4HXD A;  2MEK A;  1C76 A;  1SIF A;  3BVG A;  4MSQ B;  2BB6 A;  3U52 E;  2MBH A;  4DHJ B;  1D5X C;  3R3M A;  2XBB C;  5C2T B;  1M4V A;  4S0R A;  4ICU A;  1HA5 A;  4W9F A;  4ZRQ A;  2WXN A;  4WAA A;  3IAS 1;  4IG7 B;  4X57 B;  1WR6 E;  2G1E A;  2M4N A;  4HCN B;  3UQA A;  1QF6 A;  3IFW B;  4HPL B;  4IOI E;  4C56 C;  1QOG A;  2MQJ A;  2PJH A;  3KUC B;  2L83 A;  1IUE A;  2W3S A;  4OHJ A;  5DPW A;  1V5O A;  2JZP A;  2FIF A;  4JWU C;  2KN4 A;  2W82 A;  2ZZP B;  5E6N A;  4E71 A;  2LVO A;  2KQ7 A;  2WXP A;  1KTK A;  1WFY A;  2C5L C;  4PS8 A;  5L83 A;  2V9H A;  4EUT A;  2FID A;  1AN8 A;  2NBU A;  1K52 A;  2NBW B;  1SJH D;  2EKI A;  3ZXV A;  4GDL B;  2LGY A;  3ZIM A;  3BK2 A;  3C8Y A;  4BBN C;  3AE9 B;  1SBB B;  2MH7 A;  4LDT B;  3DVN U;  3Q69 A;  3TMP B;  2DZK A;  2JRI B;  3CMM B;  3D32 A;  2ZVO A;  2A5U A;  4CYE A;  5EE1 A;  4LNK A;  4B95 A;  1GB4 A;  3PT2 B;  3VRB B;  2HTM E;  3RZF A;  1I4X A;  3DBS A;  3ZDM C;  3V6E B;  5T8I A;  1XO3 A;  2KZR A;  2MJD A;  3V6C B;  1IGD A;  4NJ6 A;  3ZGZ A;  1OTR B;  3N1X C;  2L52 A;  3B2F A;  4H2A A;  1PFD A;  1NYQ A;  2LZ6 A;  4N9F 4;  3PS6 A;  1XF5 L;  2GBN A;  1PYW D;  4LJO B;  2J7Q B;  3ZDT A;  3R7Q A;  2HTH A;  1SE3 A;  1KOT A;  3W1Y A;  1XLQ A;  2K8B A;  4JX1 C;  4OVU A;  2FE8 A;  3SR6 A;  3CST A;  1YQB A;  4KV2 A;  4DHZ E;  3MJW A;  4C00 A;  1OEY A;  4AS1 A;  2KJ6 A;  1C1Y B;  2G3Q B;  2LGS A;  2KOX A;  3AXC A;  1UWX A;  2UWQ A;  4DQO C;  3URY A;  1VCB A;  3KVF B;  2JXX A;  4KZC A;  4C7Z A;  3I63 C;  1JWS D;  3WAP A;  1TY0 A;  1D5M C;  4ITK A;  2Y5B B;  3PSE B;  3K9P B;  3N20 C;  2NPT B;  3O13 A;  1Y56 A;  2LGI A;  3X0W A;  2L00 B;  2QDF A;  1WM2 A;  2KTF A;  1QOF A;  4KSK C;  2I1J A;  3PHW B;  1A70 A;  2WDV B;  2BS3 B;  3ZNI D;  1WYW B;  5E6O A;  1AYF A;  3GZN I;  2FUG 1;  5AUI A;  3B9J A;  4TV3 A;  1FNU A;  1ZE3 D;  4A6Q A;  2MRP A;  3OLM D;  1I35 A;  2LAS A;  3W9C B;  3A9K A;  3MHZ A;  1TY2 A;  4XWT A;  3RD2 A;  2BYE A;  3T3O A;  2QIL A;  1L4Z B;  3GS2 A;  1JRO A;  2M17 A;  4W9J A;  4RM9 A;  2INN E;  3NG0 A;  1WIA A;  1F52 A;  4NZL B;  2ZNV C;  4ANX A;  3AED B;  2KFK A;  4NPN A;  3UF8 A;  2QCZ A;  5GMV A;  2QHO A;  4M02 A;  1NBF C;  2HE7 A;  4HLE A;  3VRA B;  2AWT A;  1SE2 A;  1HEZ E;  1WXM A;  4MM3 B;  3U7D A;  1A5R A;  2C7M B;  1R4M I;  1YN3 A;  2D10 A;  1MI0 A;  2R2O A;  4LTU A;  4II3 B;  2C7H A;  3KLS X;  2N9K A;  2IO1 B;  4F7Z A;  2RGF A;  2K22 A;  2RDB C;  1SE4 A;  1KLV A;  5LXH A;  3PZ7 A;  1C4P A;  5FR6 A;  2IJ0 A;  1FXT B;  3VQI A;  2KVZ A;  5J18 A;  1F0Z A;  2EEL A;  3ZJV A;  1V2Y A;  3AUL A;  3AB5 A;  4FAD A;  4JE3 B;  4G11 A;  2N1V A;  1YQ4 B;  2JQR B;  2DNF A;  1XXG A;  5E6P A;  1LQB A;  3ZRF A;  3QWZ B;  2D07 B;  3SFD B;  2K0P A;  2PKO A;  2WLB A;  2HD5 B;  2CJN A;  1ESF A;  1UWM A;  4E3C A;  1WRI A;  2WXH A;  3NVV A;  4JQW C;  3VUX A;  4FHJ A;  3AEB B;  2EKE C;  1YIW A;  4P16 A;  3AV8 A;  2I38 A;  3PRP B;  5AZF A;  3B0A A;  1IGC A;  2TSS A;  2L05 A;  1Q10 A;  1ZOY B;  2KXJ A;  3TEZ A;  2UYZ B;  3MP9 A;  2RDH A;  1TT5 B;  3JVZ X;  4AJY B;  2MP2 A;  2V4L A;  2I2Y A;  4OVV A;  4HJK A;  2K25 A;  2WXI A;  3L17 A;  3ZYY X;  4HDO A;  3FKY A;  4HKZ E;  1L7Y A;  3IT6 B;  2K39 A;  5BYS A;  1JRP A;  1XLN A;  2MJ3 A;  4BKT A;  1E10 A;  4FHK A;  4HPM B;  2JSV X;  1Q1O A;  3RUI B;  4HKQ A;  1P0R A;  5JXV A;  4XWW A;  2DYM A;  3RCZ A;  4YL8 A;  1RYJ A;  4L23 A;  2DYO A;  4M8N A;  2FCS A;  4HK2 A;  3PPA A;  2DEN B;  3QIJ A;  1E7U A;  2LFI A;  5LNK 1;  2L7R A;  4C80 A;  3P42 A;  3QX1 A;  4W9I A;  1T5X D;  4BKS A;  2ZJD A;  3ZNZ B;  3HHM A;  3ZLZ A;  4JPS A;  4OZC A;  1T6B X;  1WF9 A;  4W9E A;  5DCN A;  1IBX B;  1FNW A;  4BOZ B;  1TKE A;  3AEA B;  3DBR I;  3H8H A;  1EU3 A;  1C3T A;  1SB3 C;  4FBJ B;  1OGW A;  1FCC C;  3E9S A;  2JX5 A;  4FA6 A;  3A9K B;  2MLB A;  1VZ8 A;  2GBM A;  4ANV A;  1YJI A;  4WIP A;  2WWZ A;  2JXT A;  3Q8B A;  3HRD D;  1WMH B;  1L0Y B;  4L2Y A;  4IM2 A;  1EF1 A;  3W1S C;  1XCT L;  3RZW C;  1NVI D;  1QQR A;  4JL9 A;  4YTN B;  4ZYN A;  1CQV A;  1SF0 A;  5JHA A;  1TJE A;  1ZPS A;  1GC7 A;  3Q3F A;  3NVW A;  2RPV A;  1HZ5 A;  3HVZ A;  2MBQ A;  3IBE A;  4IKG A;  2MBO A;  3TCA A;  4I6N B;  2KX3 A;  4OW0 A;  5G5G A;  1C79 A;  4HCP B;  1H8C A;  4EZL A;  4GLS C;  2M56 B;  4RF0 A;  1WZ0 A;  4W9G A;  2INP E;  2K3U A;  3R66 C;  1NI3 A;  2PIA A;  4MJS A;  1KLU D;  3VFK A;  4S17 A;  4BOS C;  2J0J A;  4RF1 A;  2JF5 A;  1C4C A;  2QIE B;  5BO4 B;  4ZDV A;  4ARI A;  5AUK A;  1P7F A;  1JCK B;  2HDE A;  1UH6 A;  5I4D A;  4P7I A;  4I6L B;  4ZRI A;  4JLC A;  5H8Y E;  2PVO D;  3LYY A;  2GRI A;  2NS5 A;  4LLG M;  1CJE A;  4RFB A;  1QOB A;  4TKN A;  1WGD A;  1V86 A;  3AE5 B;  2KNB A;  3I57 A;  1F9J A;  1D4B A;  1B1Z A;  3PRE A;  5HG2 A;  3RYT A;  2K9X A;  1SJE D;  4YWG G;  1HE8 A;  1PUT A;  1MHH E;  4KX6 B;  1GNU A;  2PEA A;  2J0K A;  2X38 A;  1UGM A;  1WE6 A;  1J19 A;  4FUL A;  2ICI A;  2RDG A;  1ZDX A;  1XLP A;  3DHI C;  3O65 B;  2KHW B;  3VTU A;  2KK8 A;  2ZEQ A;  3U7Z A;  2D5G A;  4XX5 A;  3P4Q B;  1MG4 A;  2WXK A;  4I6P A;  1TS4 A;  4GSW A;  2KN5 A;  5C3J B;  4IM3 A;  1TIF A;  2BBC A;  3EFC A;  3BK1 A;  3GP7 A;  2LMC A;  3N32 A;  3JYU A;  2KWV B;  1WI0 A;  4W9H A;  2X8X X;  1YQ3 B;  2W55 A;  3QC8 B;  3HM6 X;  3WIM A;  2CS4 A;  3VUY A;  4PK1 A;  1E90 A;  2N9P C;  4GXB A;  2BGF A;  3VH3 B;  1WM3 A;  2G45 B;  2IGG A;  2EMT A;  2L76 A;  1FRD A;  3PVL A;  4DHJ D;  1JRU A;  2CHX A;  2N1W A;  1G6J A;  2D3G A;  2Z59 B;  4P1C C;  4ASW C;  3Q8C A;  1P9D U;  2C7N B;  1V1P B;  1WZ3 A;  2N9E B;  3N30 A;  1N63 A;  2LXC A;  1ET9 A;  1T0R C;  2GMI C;  4ZRP A;  2IO0 B;  4AQ7 A;  3ZW3 A;  1P1A A;  3LB8 C;  4TUU A;  1KJT A;  1YX6 B;  1KFY B;  2REX A;  1CMX B;  3V3X A;  2WGS A;  4YT0 B;  1XQQ A;  2IND C;  2IO3 B;  4LJP B;  4NAW A;  2K6Q A;  1LGR A;  4MM3 A;  5E6J A;  3TEX A;  3AH7 A;  3NUH B;  2WHI A;  4EZK A;  4LDT D;  4WQO B;  1L6V A;  3U4E G;  2GBK A;  1F2R C;  2ZW0 A;  4WWN A;  1RAX A;  3CSF A;  2ZVN A;  5FKA C;  2JYE A;  1PGA A;  2LWP A;  1LM8 B;  3I3T B;  1QT9 A;  4BAX A;  5IO9 A;  3NZ3 A;  3P63 A;  2MJE A;  2BPS A;  2RMM A;  3AE4 B;  4A90 A;  4MJS B;  1J7B A;  4TQ0 A;  4N6E B;  2FCQ A;  2J0M A;  3Q3J A;  1D6E C;  1ZGU B;  2KAN A;  4KIK B;  3TSS A;  1RWS A;  2G4D B;  4CO7 A;  4LNN A;  1YMH E;  2JRH A;  3HM3 A;  3B1L X;  3EEC A;  3A4R A;  4K1R B;  3P1M A;  1N60 A;  2RR9 A;  3RFZ B;  2WDT B;  2LGD A;  4ZRJ A;  1WH3 A;  1ACC A;  4XE0 A;  4GN1 A;  3QJZ A;  1R7S A;  4RMA A;  2WX1 A;  3Q8A A;  4BKG A;  3OWE B;  3ZUN A;  2WXM A;  1WGG A;  4K7S A;  1EUV B;  3AE1 B;  2KMC A;  3SDL C;  3RUL A;  1TBE A;  1UBQ A;  1FFU A;  3Q2A C;  2G9H D;  3KW5 B;  5MPO A;  4LNI A;  1S3S G;  3VXW A;  4FJY A;  5LXI B;  3EFU A;  3B08 A;  3PLV A;  3AE3 B;  4MT5 A;  4WWO A;  2VH2 A;  1WGK A;  2LD9 A;  2LRW A;  4ZHO A;  4NJC A;  4HRO A;  4NAM A;  3JW0 X;  2XEW A;  1E9M A;  2FBW B;  4K81 A;  2KDB A;  3VR8 B;  3AEC B;  3ZRC A;  2XN9 C;  3AU4 A;  2BW2 A;  3KQ4 A;  3DQV A;  4Q2J A;  2W9N A;  4N59 A;  4C4V B;  3K9O B;  2YEP B;  4LNF A;  3HK0 A;  2K1F A;  4W9C A;  2JPH A;  4KKI A;  1UGJ A;  5EDS A;  4RGN A;  4M00 A;  2PVG C;  1U4A A;  2Z0D B;  4NY0 A;  5IA7 A;  5AZH A;  2IY1 B;  3M62 B;  4PYU A;  2OOB B;  3PHX B;  4XGA B;  2K5P A;  2JZZ A;  4EOY A;  3VR9 B;  3ZO5 B;  3W2D A;  1I4Q A;  2KQ4 X;  4IW0 A;  2H88 B;  2KDI A;  1IBX A;  2QMT A;  2W3R A;  2NTT A;  3DPD A;  1UBI A;  3M63 B;  4FJV B;  2BKF A;  4RGM A;  3AM9 A;  1OQR A;  5AEK B;  1FRR A;  5IOI A;  3AU5 A;  4II2 B;  1ZP0 B;  2WU5 B;  4MGZ E;  1WXV A;  3M3J A;  2ZPN A;  2Z0E B;  1Z5S B;  2DX5 B;  1WMH A;  1OQY A;  2RD0 A;  2DHZ A;  4EFO A;  2M0X A;  3NS1 A;  2MBE A;  2MWS B;  3A4S C;  1JML A;  4OVZ A;  1R4N B;  3KUZ A;  4IM0 A;  3BYT B;  4GU2 A;  1GUA B;  1QLB B;  5EE9 A;  4L1B A;  5CX3 A;  3T8M A;  4NAW B;  2I1K A;  4B0M A;  3GE3 C;  2RPQ A;  1SXT A;  2WP9 B;  2V3N A;  4GOC A;  1KLG D;  3BII D;  1M94 A;  3DHH C;  2FAZ A;  2M1M A;  2IDY A;  2IZV B;  1N6Z A;  2FNJ B;  2IPK D;  4PT5 A;  2QC8 A;  2GBJ A;  1WYG A;  3LJ3 A;  3PGE A;  3DBL B;  2KJR A;  1WRD B;  1UNS A;  5DPT A;  4URK A;  1V81 A;  1XCQ L;  3TJP A;  4XDC A;  4KKJ A;  3TUO A;  3H6N A;  2WXO A;  5C1Z A;  2L32 A;  1ZDV A;  1L6U A;  2LHE A;  5IN7 A;  4ARC A;  1WX8 A;  3C0R B;  2MA9 B;  3M95 A;  1RRB A;  2KX0 A;  3V62 A;  3OG5 A;  4K3C A;  2GBR A;  4JIO U;  2ZCC A;  2BYT A;  3QQ8 B;  1MFW A;  3A1Q A;  1V8C A;  3P4P B;  2L1A A;  1HTQ A;  1VLB A;  1MG8 A;  4DDI D;  1YN4 A;  4XC2 A;  4A3P A;  3DWG C;  2LGX A;  3IT4 B;  3RNC C;  1C4A A;  4KDL B;  1E0Z A;  4RGT A;  1J7A A;  2Y5P A;  4W9K A;  2O6V A;  2Z8L A;  5JZE B;  1SGH A;  2XK5 A;  2VRR B;  2LXA A;  1CZP A;  2ONQ A;  3KUD B;  5LLI A;  1F2R I;  3GB1 A;  5CTR C;  3VVW B;  3T3N A;  1Y8R C;  3NJT A;  3FC4 A;  3AI5 A;  5JH5 C;  2BB5 A;  2V4I B;  3FAH A;  1GB1 A;  3MJ5 A;  4IUM B;  4DK5 A;  1VZ6 A;  2JVC A;  4DXA B;  2OJR A;  3PV1 A;  1UD7 A;  1AW7 A;  3AMZ A;  1HZ6 A;  3FIL B;  1J7C A;  2HJ8 A;  1YN5 A;  2VZK B;  4P6V F;  3IXS A;  2O2V A;  2JU6 X;  2XNA C;  2KC1 A;  2DZM A;  3QAQ A;  3A9J A;  1XD3 B;  3APF A;  2CJO A;  2LHD A;  3N1Z C;  1V1P A;  2GB1 A;  1YJ1 A;  1RFA A;  3GZN B;  3MC0 B;  2N4F A;  4MH8 A;  3CIR B;  3TIX A;  1E6E B;  2LEK A;  1SSN A;  4D2K A;  2PE6 B;  1E5W A;  2LUM A;  5J17 A;  1AWD A;  2WDR B;  2D3B A;  1ROE A;  4KDI C;  2AL3 A;  1RM6 C;  1V49 A;  3R7R A;  2KDM A;  3DVN V;  4K7U A;  1ISN A;  1L5P A;  2MBB B;  1DOX A;  3GE8 C;  1LFD A;  3UIP B;  1N5W A;  1OFF A;  5GXG B;  1TS3 A;  5AZG A;  4WAF A;  4M01 A;  1WXA A;  4MH0 E;  3APC A;  3PO0 A;  2KJH B;  4A20 A;  2PTL A;  4US9 A;  5KHO A;  3DBH B;  3RT3 B;  5D7G A;  1TGZ B;  3TL5 A;  4B9K A;  1E8W A;  1DYQ A;  2LVQ A;  3N9Y C;  3BVM A;  3ABV B;  1SEB D;  1Q0W B;  2AL6 A;  1WJ6 A;  4FN2 A;  2WXR A;  1JW9 D;  4BZA A;  5DPR A;  4XDD A;  4KIK A;  3BIN A;  4LNO A;  1K51 A;  4A9A A;  4HWI B;  4YXD B;  1QOA A;  4AP4 C;  1MHX A;  2BQQ A;  1PGB A;  1YX5 B;  2G4S A;  3Q3M C;  2BVC A;  2FUH B;  1MPE A;  2QJL A;  2AQ3 B;  4G3X B;  4DWF A;  2M8S A;  3JSV A;  3OJ4 B;  1WJ4 A;  3UQB A;  1WJN A;  2N0S B;  1FNV A;  1I4H A;  5EE0 A;  2LUE A;  5TR5 A;  1TS2 A;  2C9W B;  2WXJ A;  2FCM A;  2KWC A;  1ENF A;  4W9L A;  3UI3 A;  3DVG X;  3EA6 A;  2N7D A;  3PZD A;  1L4D B;  2BWE S;  2IYD B;  1WGY A;  3Q8E A;  2UU7 A;  3A1Q B;  3EHV A;  2O6V D;  3X23 A;  3NZU A;  1GOZ A;  3MC8 A;  1DOI A;  4EZJ A;  2R61 A;  3RNE C;  2IO2 B;  3P2B A;  4DBG A;  2D2Q A;  5BMH A;  3EC8 A;  1YJJ A;  3HVD A;  1FO4 A;  2O6V B;  2XK5 B;  2SEB D;  1E8Y A;  1WY8 A;  2SAK A;  2NMQ A;  2WXG A;  1KRH A;  4GMV A;  4C4V A;  2JWZ A;  1TZ1 A;  1OEY J;  1WJU A;  3QHT A;  2ACZ B;  4F1S A;  4EKU A;  2JZ3 B;  4IWQ A;  4BKS D;  2PPH A;  3BYY B;  1FD6 A;  1EU4 A;  3VHT C;  2M0A A;  2KDE B;  3AE2 B;  1GJZ A;  2J52 A;  2KKC A;  5CHF A;  2V3S A;  2GOW A;  2O2V B;  2KMM A;  2INC C;  2K8H A;  3DWM A;  2L8J A;  4A3O A;  1SE9 A;  3DBR B;  3A9J B;  4WWP A;  3U2S C;  3VUW A;  2IGD A;  1QKZ A;  1NEN B;  2BS4 B;  1I7H A;  5BYQ A;  5HFY A;  1YNT E;  1I4G A;  3NRZ A;  2DZI A;  2WDQ B;  2KO3 A;  4EEW A;  2KYW A;  4GGQ A;  4WWM A;  3Q6B A;  1K8R B;  2Q5W D;  4WJQ A;  5IAA C;  2KDF B;  3RNA C;  5IKC M;  1EM7 A;  1HQR D;  4MSM B;  3ZJU A;  5TSS A;  2DYB A;  2KAJ A;  2Y5C A;  3L54 A;  1GPX A;  1RLF A;  4WJP A;  2KAC A;  3NVZ A;  4ZHP A;  1UEL A;  2DAF A;  4N58 A;  4YSY B;  2B76 B;  4NNJ B;  3LXF A;  4PS7 A;  2KFJ A;  5D3D A;  2YLM A;  2GLS A;  4WQM A;  2AEH A;  2HJ1 A;  1SIJ A;  4RH6 A;  3W5V B;  1QZE A;  1FXI A;  2BTE A;  2MW5 A;  2Y3A A;  3KYC D;  3U30 A;  1R4N I;  5HHD G;  3ALB A;  4GIV A;  4WJN A;  2L0F A;  3NZS A;  4KGT A;  4AWJ A;  4WH4 A;  1DOY A;  3AEE B;  5FR3 A;  3WAL A;  1FMA D;  4DHZ B;  1EWC A;  1GAQ B;  4A55 A;  1I4P A;  4FXC A;  1GC6 A;  4OZB A;  3PTF C;  4IWO A;  4MGI E;  1UF0 A;  5KHQ A;  4C7Y A;  1KF6 B;  2KWU B;  3DBL I;  4HDQ A;  4XYC A;  3T9L A;  3MHS D;  1Q5W B;  4TMA B;  3H7P B;  4XZ4 A;  4QAY A;  1BXT A;  3JSV B;  4O1N A;  5FK9 C;  1Z2M A;  3VAW A;  4DXG A;  2WS3 B;  4ZYS A;  2AQ2 B;  1XLO A;  3ZQ4 A;  3AE8 B;  1FIQ A;  4AJW A;  4W9D A;  2JUO A;  3OJ3 A;  1IYF A;  2JWU A;  5EE3 A;  1E7P B;  3W1S A;  1EF5 A;  2ZNV B;  1KM7 A;  2FCN A;  3IAM 1;  2YEP F;  2PE9 A;  5J2R A;  2OJW A;  4TQ1 A;  2CR5 A;  4RM8 A;  2M19 A;  4RCO A;  4US8 A;  1TS5 A;  1VZ7 A;  2BKR B;  1NI2 A;  4CHK A;  1B9R A;  4HJG E;  4GB9 A;  3RNB C;  3N3K B;  2NVU I;  2KTR B;  3VDZ A;  3RN9 C;  3BY4 B;  3FIL A;  4FJZ A;  1XEE A;  3WA0 A;  1EO6 A;  1L0X B;  2OED A;  1NYR A;  2JY6 A;  4MEM A;  3R8B A;  1VDV A;  5IP4 D;  2WNM A;  4RGO S;  1WR1 A;  3EUB 2;  3ZTC A;  3TBL D;  4GDK B;  3UIN B;  4PYZ A;  2MHJ A;  3NHE B;  5BMI A;  3ZTD A;  2WXL A;  2BWF A;  2MCN B;  1V9J A;  2ZW1 A;  4E74 A;  2WXF A;  2OHF A;  2BS2 B;  4AOF A;  3KWV A;  3PRZ A;  3UGB B;  5G55 A;  2NR2 A;  4ANW A;  5H92 C;  1XT9 B;  4B6W A;  2LJI A;  2IGH A;  3ZXR A;  1WXQ A;  4K3B A;  4K7W A;  3WCQ A;  2CU1 A;  1GG3 A;  3V60 A;  4HEA 1;  3PLU A;  1JWA D;  3B2G A;  1J0G A;  2DWQ A;  2BF8 B;  5D94 A;  3L4P A;  3PRM B;  4KZ0 A;  2RSU A;  4UDU C;  1C78 A;  1WX9 A;  4ZRK A;  3ZKJ C;  4DXF A;  3RNF C;  4G50 A;  2AYO B;  4BFR A;  3CF6 E;  3DHG C;  1RFK A;  4HPP A;  3Q3O C;  2BYF A;  1FPY A;  4ACF A;  3QK0 A;  3LDZ E;  4IC7 B;  3ZNG C;  5CHV C;  3DBH I;  3CWI A;  3IHP C;  2L0T A;  4OZA A;  1BML C;  1LO5 D;  5D3I B;  1J8C A;  1ZXI A;  1QIL A;  3NY5 A;  4KGS A;  3Q8F A;  5C23 A;  3S2A A;  3HIZ A;  2BT6 A;  3V05 A;  2KLG A;  3A33 B;  2V3P A;  3Q14 C;  2D3C A;  1K53 A;  3U8Z A;  5HKH A;  3OAW A;  4WJO A;  5JHB A;  3DOW A;  4HVB A;  2W54 A;  1JWU D;  2CKH B;  2V0G A;  2R2Q A;  4HRS A;  2JYT A;  4MGK E;  1AAR A;  2DBY A;  3UIO B;  4ICV A;  4IWP A;  4M0W A;  4MGY E;  1YOV B;  1WGH A;  3C19 A;  3I5J C;  1TTN A;  3ZVV A;  3KH0 A;  1WWT A;  1VJK A;  1F77 A;  2CHW A;  2KWD A;  1F1H A;  5G2N A;  1STE A;  2CU3 A;  3L13 A;  3ML8 A;  1TKY A;  1D3Z A;  4YSZ B;  3AE7 B;  1VR9 A;  3ML9 A;  4WUR A;  1HTO A;  4EE2 A;  3PZ8 A;  3QAR A;  2LVP A;  3NS8 A;  3MFG A;  2WXQ A;  2DAJ A;  1T0Q C;  1I42 A;  3AEF B;  3P4S B;  1CK1 A;  3H9D A;  1WE7 A;  1KH0 A;  2KVR A;  1E7V A;  4NQK E;  2B3A A;  2BYV E;  1V1O A;  2PLP A;  1FXA A;  2N9L A;  1VD2 A;  2EMS A;  1NDD A;  2E6X A;  3R2T A;  3E56 A;  2VZK D;  3DCG A;  2IBI B;  1K50 A;  2J4X A;  1E8X A;  3SEB A;  1JAL A;  3SD5 A;  3H7S A;  3GOE A;  2DZJ A;  5L95 C;  2ASQ A;  1FCL A;  1BUI C;  5D2M B;  2ON8 A;  1ZKH A;  4BVU C;  1WXS A;  1N62 A;  1LXD A;  3APD A;  1OQQ A;  2LI5 A;  1IP9 A;  4R3D A;  1V6E A;  4KSL C;  1ZXH A;  3RNG C;  4YTP B;  3TEW A;  3L0W B;  1FEH A;  1H4R A;  3ETR A;  4JWS C;  2QSD A;  1L0V B;  2NBV B;  1TZO A;  3AEG B;  1ZW7 A;  3R2I A;  4J6I A;  1V5T A;  4LCD E;  3IG3 A;  5HI1 A;  1L2N A;  2K8C A;  3DVG Y;  2LJ5 A;  1JWM D;  2H89 B;  3RPF C;  3P4R B;  3RI7 C;  1P3Q U;  1PDX A;  5D6J B;  2KQS A;  2MX2 A;  1JQ4 A;  1JWB D;  1P7E A;  4P1B C;  1NEK B;  4PS3 A;  2PMV A;  1YD8 U;  1WGR A;  2N7J A;  4J3O D;  4FLH A;  2JT4 B;  3J9C A;  1R4M B;  3KYD D;  1T0Y A;  4B0E A;  2KC2 A;  2WQY B;  3WAM A;  1E8Z A;  2L3Z A;  2C60 A;  2AX5 A;  3MC9 A;  4G0N B; 
#chains in the Genus database with same CATH homology
 5E6P A;  1LQB A;  5DPS A;  4EEW A;  2KFK B;  4GGQ A;  3DQV A;  3ZRF A;  3QWZ B;  2D07 B;  1K8R B;  2W9N A;  3K9O B;  3HK0 A;  4WJQ A;  4GDL A;  2K1F A;  4W9C A;  2JPH A;  2HD5 B;  5IAA C;  2KDF B;  5EDS A;  3VH4 B;  4E3C A;  1U4A A;  3IVF A;  2Z0D B;  4NY0 A;  4MSM B;  3ENE A;  5IA7 A;  5AZH A;  2IY1 B;  2DYB A;  2MSE D;  3M62 B;  4PYU A;  2OOB B;  3PHX B;  4JQW C;  4FHJ A;  2JZZ A;  3L54 A;  3H1U A;  2CHZ A;  1RLF A;  4WJP A;  3VUX A;  4EOY A;  2EKE C;  3ZO5 B;  1WX7 A;  1YIW A;  1UEL A;  2DAF A;  3H7P A;  4IW0 A;  3PRP B;  4ANU A;  4DDG D;  1S1Q B;  5AZF A;  3QCA A;  3B0A A;  2KDI A;  2WYQ A;  4NNJ B;  4PS7 A;  2KFJ A;  3DPD A;  2L05 A;  2KXJ A;  2YLM A;  2UYZ B;  1UBI A;  2AEH A;  2NCN A;  1BT0 A;  3M63 B;  1QZE A;  4FJV B;  2ZPY A;  2KD0 A;  2BKF A;  2MW5 A;  3KYC D;  3U30 A;  1R4N I;  3JVZ X;  4AJY B;  2MP2 A;  2V4L A;  3ALB A;  4GIV A;  4M0W B;  4OVV A;  4WJN A;  4HJK A;  2K25 A;  3ONS A;  3SHQ A;  5AEK B;  2L0F A;  3L17 A;  3NZS A;  4HDO A;  4AWJ A;  3AU5 A;  2V1Y A;  3L10 B;  2WX0 A;  2ZCB A;  4MEL A;  1L7Y A;  4BBN F;  2K39 A;  3DDC B;  4BKT A;  4II2 B;  4FHK A;  4HPM B;  2IY0 B;  4MGZ E;  1WXV A;  1Q1O A;  3RUI B;  3VTW A;  3WAL A;  1P0R A;  3M3J A;  4DHZ B;  2DYM A;  2ZPN A;  3RCZ A;  4YL8 A;  2Z0E B;  2K6D B;  2KLC A;  1Z5S B;  2DX5 B;  1WMH A;  1OQY A;  2RD0 A;  2DYO A;  2D11 A;  2DHZ A;  4EFO A;  2M0X A;  4M8M A;  4M8N A;  1GC6 A;  2FCS A;  2MBE A;  2MWS B;  3A4S C;  3PTF C;  4IWO A;  4HK2 A;  3NOB A;  1PQS A;  4NQL B;  1UZX B;  3KUZ A;  3PPA A;  2A4Z A;  4MGI E;  4IM0 A;  2DEN B;  3QIJ A;  1E7U A;  5KHQ A;  2L7R A;  2KWU B;  3DBL I;  4GU2 A;  3QX1 A;  4W9I A;  1GUA B;  4HDQ A;  4BKS A;  2ZJD A;  3T9L A;  3ZNZ B;  2KTR A;  3HHM A;  3MHS D;  2LRU A;  1X1M A;  5CX3 A;  3T8M A;  1Q5W B;  3ZLZ A;  3ZNH B;  3QA8 A;  4NAW B;  3H7P B;  2I1K A;  4XZ4 A;  1WF9 A;  4W9E A;  2RPQ A;  3JSV B;  5DCN A;  4BOZ B;  4GOC A;  4JGH B;  1P98 A;  1Z2M A;  3DBR I;  3VAW A;  1M94 A;  2FAZ A;  2M1M A;  2IZV B;  3L16 A;  2FNJ B;  5CHW A;  1V80 A;  2GBJ A;  4W9D A;  2KMA A;  4AJW A;  2JUO A;  2N7E A;  4FBJ B;  1C3T A;  1OGW A;  3OJ3 A;  4KVG B;  3SU8 X;  1IYF A;  4AUQ C;  3LJ3 A;  3W1S A;  3PGE A;  1EF5 A;  2ZNV B;  2KJR A;  2MP2 B;  2N9X A;  1KM7 A;  1WRD B;  4GDK A;  3VTV A;  2FCN A;  4F8C B;  4FA6 A;  5DPT A;  3MTN B;  3A9K B;  4URK A;  2MLB A;  2PE9 A;  1V81 A;  3WAO A;  2NPT A;  3TJP A;  4NJ7 A;  1IPG A;  2GBM A;  4ANV A;  5J2R A;  4TQ1 A;  2CR5 A;  3H6N A;  4RM8 A;  4MDK E;  3WAN A;  5C1Z A;  2WWZ A;  3L08 A;  1WMH B;  2YVC A;  4IM2 A;  1EF1 A;  3W1S C;  2BKR B;  1NI2 A;  1WX8 A;  3RZW C;  4CHK A;  3ECI A;  3C0R B;  4JL9 A;  2MA9 B;  4ZYN A;  3V61 A;  3M95 A;  4HXD A;  1RRB A;  4GB9 A;  1SIF A;  2KX0 A;  3V62 A;  5JHA A;  3N3K B;  2NVU I;  4MSQ B;  1GC7 A;  2KTR B;  3Q3F A;  3VDZ A;  3BY4 B;  3IBE A;  2MBQ A;  3TCA A;  2MBO A;  2GBR A;  4FJZ A;  4I6N B;  2KX3 A;  2MBH A;  2ZCC A;  4JIO U;  3QQ8 B;  4HCP B;  3WA0 A;  4DHJ B;  4EZL A;  3A1Q A;  1H8C A;  1EO6 A;  3R3M A;  2XBB C;  1WZ0 A;  4W9G A;  4ICU A;  2JY6 A;  4W9F A;  4MEM A;  3R66 C;  1MG8 A;  4WAA A;  4IG7 B;  4MJS A;  4DDI D;  4A3P A;  4XC2 A;  4X57 B;  1WR6 E;  3VFK A;  4BOS C;  2M4N A;  4HCN B;  1WR1 A;  3UQA A;  2J0J A;  3IFW B;  2LGX A;  4HPL B;  2JF5 A;  3ZTC A;  4KDL B;  3TBL D;  4GDK B;  3UIN B;  2MQJ A;  2PJH A;  4PYZ A;  3KUC B;  5BO4 B;  4ZDV A;  4W9K A;  2O6V A;  5JZE B;  1SGH A;  2XK5 A;  3NHE B;  2VRR B;  2LXA A;  3ZTD A;  2BWF A;  2MCN B;  1V9J A;  1UH6 A;  5DPW A;  4P7I A;  1V5O A;  4E74 A;  4I6L B;  3KUD B;  4ZRI A;  4JLC A;  5LLI A;  2FIF A;  5CTR C;  3VVW B;  2ZZP B;  5E6N A;  4AOF A;  2NS5 A;  1Y8R C;  2LVO A;  3PRZ A;  3UGB B;  2KQ7 A;  5G55 A;  4E71 A;  2NR2 A;  1WFY A;  3AI5 A;  4ANW A;  2C5L C;  5JH5 C;  4PS8 A;  1XT9 B;  4TKN A;  1WGD A;  1V86 A;  4B6W A;  5L83 A;  4EUT A;  2KNB A;  4IUM B;  2FID A;  4DK5 A;  2NBU A;  2JVC A;  4K7W A;  2NBW B;  2CU1 A;  4DXA B;  1F9J A;  2OJR A;  3PRE A;  3RYT A;  3PV1 A;  1UD7 A;  1GG3 A;  4GDL B;  2LGY A;  3V60 A;  3ZIM A;  2HJ8 A;  3PLU A;  1HE8 A;  4BBN C;  4LDT B;  1GNU A;  2O2V A;  3DVN U;  1J0G A;  2PEA A;  2J0K A;  2BF8 B;  5D94 A;  3PRM B;  1UGM A;  2KC1 A;  4KZ0 A;  1WE6 A;  3TMP B;  1J19 A;  2DZM A;  2DZK A;  3QAQ A;  3A9J A;  4FUL A;  1XD3 B;  2JRI B;  2RSU A;  3APF A;  3CMM B;  3O65 B;  1YJ1 A;  2KHW B;  3D32 A;  2KK8 A;  1RFA A;  2ZVO A;  2ZEQ A;  3VTU A;  1WX9 A;  2A5U A;  4ZRK A;  4CYE A;  3ZKJ C;  4G50 A;  4XX5 A;  4B95 A;  2AYO B;  4BFR A;  2N4F A;  4I6P A;  4GSW A;  2KN5 A;  3CF6 E;  4IM3 A;  3TIX A;  3PT2 B;  2PE6 B;  1E5W A;  2BYF A;  3N32 A;  5J17 A;  3JYU A;  3RZF A;  2KWV B;  1WI0 A;  3DBS A;  3ZDM C;  3QK0 A;  3LDZ E;  4IC7 B;  3V6E B;  3ZNG C;  4W9H A;  5CHV C;  2KZR A;  4KDI C;  3QC8 B;  3V6C B;  3DBH I;  3HM6 X;  2AL3 A;  3IHP C;  2L0T A;  4NJ6 A;  3WIM A;  2CS4 A;  1V49 A;  1J8C A;  3R7R A;  3NY5 A;  1OTR B;  3VUY A;  3DVN V;  5C23 A;  4K7U A;  1ISN A;  3S2A A;  2MBB B;  3HIZ A;  1E90 A;  2KLG A;  1LFD A;  3A33 B;  3UIP B;  2N9P C;  2LZ6 A;  4GXB A;  4N9F 4;  5AZG A;  2BGF A;  3U8Z A;  3VH3 B;  4G0N B;  5HKH A;  3PS6 A;  1WXA A;  3OAW A;  1WM3 A;  4MH0 E;  2G45 B;  2GBN A;  4WJO A;  3APC A;  5JHB A;  2EMT A;  2KJH B;  4LJO B;  4A20 A;  2L76 A;  4DHJ D;  3PVL A;  3DOW A;  1JRU A;  2CHX A;  2J7Q B;  2N1W A;  3R7Q A;  3ZDT A;  5KHO A;  4HVB A;  1G6J A;  2CKH B;  2HTH A;  2D3G A;  2R2Q A;  3RT3 B;  5D7G A;  1KOT A;  2Z59 B;  4MGK E;  3W1Y A;  1AAR A;  1TGZ B;  2K8B A;  3TL5 A;  4ASW C;  1P9D U;  4B9K A;  3UIO B;  4ICV A;  4OVU A;  4IWP A;  1E8W A;  2LVQ A;  4MGY E;  3CST A;  1YQB A;  4KV2 A;  4DHZ E;  3MJW A;  1WGH A;  2C7N B;  1WZ3 A;  2N9E B;  1Q0W B;  1OEY A;  1TTN A;  3KH0 A;  2AL6 A;  3N30 A;  3ZVV A;  1WJ6 A;  2LXC A;  2GMI C;  2CHW A;  5G2N A;  2KJ6 A;  1C1Y B;  2G3Q B;  2KOX A;  2IO0 B;  4FN2 A;  3L13 A;  3AXC A;  3ML8 A;  3ZW3 A;  1P1A A;  1D3Z A;  2UWQ A;  5DPR A;  4TUU A;  1KJT A;  1VCB A;  1YX6 B;  4KIK A;  3KVF B;  3ML9 A;  2JXX A;  3BIN A;  4KZC A;  2REX A;  1CMX B;  4HWI B;  3WAP A;  4AP4 C;  3QAR A;  2LVP A;  3NS8 A;  2Y5B B;  2DAJ A;  1I42 A;  3PSE B;  3K9P B;  2NPT B;  1YX5 B;  2G4S A;  3X0W A;  1XQQ A;  2FUH B;  3H9D A;  1WE7 A;  2IO3 B;  2L00 B;  4LJP B;  2KVR A;  4NAW A;  1E7V A;  1WM2 A;  2K6Q A;  2KTF A;  4G3X B;  4NQK E;  2B3A A;  4DWF A;  2BYV E;  4MM3 A;  4KSK C;  2M8S A;  3JSV A;  2I1J A;  1VD2 A;  3OJ4 B;  2EMS A;  3PHW B;  1NDD A;  1WJ4 A;  3UQB A;  1WJN A;  3DCG A;  2IBI B;  2LUE A;  3ZNI D;  1E8X A;  4EZK A;  4LDT D;  1WYW B;  4WQO B;  2GBK A;  5E6O A;  5TR5 A;  3GZN I;  3SD5 A;  3H7S A;  2C9W B;  3GOE A;  4WWN A;  2FCM A;  2DZJ A;  2KWC A;  1RAX A;  4TV3 A;  3CSF A;  2ZVN A;  4W9L A;  5L95 C;  3DVG X;  2ASQ A;  2N7D A;  3PZD A;  2LWP A;  1LM8 B;  2MRP A;  3I3T B;  3OLM D;  1I35 A;  2BWE S;  2LAS A;  2IYD B;  5D2M B;  3A9K A;  1ZKH A;  1WGY A;  3RD2 A;  3A1Q B;  4BVU C;  2BYE A;  2BPS A;  3EHV A;  2O6V D;  1WXS A;  3X23 A;  1LXD A;  3NZU A;  3APD A;  4MJS B;  4EZJ A;  2LI5 A;  1IP9 A;  2IO2 B;  2M17 A;  4TQ0 A;  3P2B A;  4W9J A;  4RM9 A;  2FCQ A;  2J0M A;  1V6E A;  4KSL C;  3Q3J A;  4DBG A;  1ZGU B;  2KAN A;  2D2Q A;  3EC8 A;  4KIK B;  1WIA A;  2G4D B;  2ZNV C;  4ANX A;  4CO7 A;  3L0W B;  2O6V B;  2JRH A;  2XK5 B;  3HM3 A;  3B1L X;  1E8Y A;  1H4R A;  1WY8 A;  2KFK A;  3EEC A;  4NPN A;  2NBV B;  3A4R A;  3UF8 A;  4GMV A;  2QHO A;  5GMV A;  4K1R B;  1NBF C;  2RR9 A;  2HE7 A;  4HLE A;  1ZW7 A;  2AWT A;  2JWZ A;  2WDT B;  2LGD A;  1WXM A;  1TZ1 A;  1WH3 A;  1V5T A;  4J6I A;  4ZRJ A;  3U7D A;  4LCD E;  3IG3 A;  4GN1 A;  1A5R A;  1L2N A;  1OEY J;  2C7M B;  1WJU A;  1R4M I;  3QHT A;  3QJZ A;  4RMA A;  2K8C A;  3DVG Y;  2WX1 A;  2D10 A;  2LJ5 A;  4BKG A;  2R2O A;  4F1S A;  4EKU A;  2JZ3 B;  4II3 B;  3ZUN A;  4IWQ A;  4BKS D;  1WGG A;  4K7S A;  2C7H A;  1EUV B;  2PPH A;  2KMC A;  3SDL C;  1P3Q U;  2IO1 B;  4F7Z A;  2RGF A;  5D6J B;  3RUL A;  3VHT C;  2KDE B;  1TBE A;  2KQS A;  1UBQ A;  2MX2 A;  1GJZ A;  3KW5 B;  1KLV A;  2KKC A;  4PS3 A;  5CHF A;  1YD8 U;  2V3S A;  1S3S G;  1WGR A;  3VXW A;  5LXH A;  4FJY A;  4FLH A;  2GOW A;  2JT4 B;  2O2V B;  3EFU A;  3B08 A;  5FR6 A;  5LXI B;  1FXT B;  3VQI A;  3PLV A;  2K8H A;  2L8J A;  4A3O A;  1SE9 A;  5J18 A;  3A9J B;  3KYD D;  4WWO A;  4WWP A;  1T0Y A;  3VUW A;  2LD9 A;  2LRW A;  1V2Y A;  3AUL A;  3JW0 X;  2XEW A;  4FAD A;  4K81 A;  2KC2 A;  2KDB A;  3WAM A;  4G11 A;  3ZRC A;  1E8Z A;  2N1V A;  2L3Z A;  2C60 A;  2DZI A;  3AU4 A;  2KO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...