4AJYB

Von hippel-lindau protein-elonginb-elonginc complex, bound to hif1- alpha peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ajyB00
4URKA 3VTVA 4JL9A 1AARA 4W9DA 2ZCBA 4MJSA 2KWUB 2EKEC 5AZHA 4NPNA 4HDOA 1P1AA 1WMHA 2D11A 2BYEA 3VHTC 1XQQA 4FADA 3AU5A 2G3QB 3HIZA 4FHJA 4NJ7A 1BT0A 4NQKE 5J2RA 3QHTA 2GMIC 3CMMB 3KUCB 3UIPB 1WJ4A 2MQJA 1V2YA 3ZKJC 3KUZA 4FJZA 2KDEB 1EO6A 2BYVE 2MBOA 3ZDMC 4EEWA 5L95C 1WZ3A 4NQLB 3ZTCA 3ZIMA 4CHKA 5L83A 2ZJDA 2A5UA 1E7UA 3H7PB 1WE6A 4MGYE 4WJQA 2D3GA 2KXJA 3S2AA 3ML9A 4OVUA 4F8CB 3CF6E 3N30A 3L10B 3M63B 3PTFC 3VTWA 3EFUA 2NBWB 1E8YA 2D2QA 4GOCA 5J17A 4G3XB 2KZRA 4AOFA 3A9JA 3L16A 4NAWB 3TIXA 1WXVA 2KLCA 1E90A 2LZ6A 2Y5BB 4ZRJA 1V80A 3KVFB 1IP9A 4XC2A 5JHAA 1U4AA 1WH3A 2O6VB 5IAAC 1WX7A 4DXAB 2D10A 1OGWA 4G11A 1SE9A 4CYEA 4KZCA 1RLFA 2Z0EB 2UWQA 3A9KA 4F7ZA 4CO7A 4J6IA 5DCNA 4KIKA 1Q1OA 3QWZB 4WQOB 3T9LA 2YLMA 3LJ3A 4ANVA 2M4NA 3TCAA 4ANWA 3IHPC 2JPHA 1C1YB 2K25A 4W9CA 4HCPB 4GDLA 5E6PA 2ZVNA 4EZKA 2KTRB 2MCNB 3V6CB 2JZZA 4II2B 3WAPA 1TZ1A 2KQSA 3CSFA 3PREA 2IO3B 4HJKA 2PJHA 2K8BA 3IG3A 1V81A 4ZRKA 3RUIB 2XK5B 3PZDA 4W9FA 4FBJB 4TV3A 5LXIB 3B1LX 3PVLA 3AI5A 4W9LA 3LDZE 4AP4C 2CHWA 3EHVA 3PV1A 2A4ZA 4YL8A 4ZYNA 4HPMB 2IYDB 1YD8U 2LRWA 2YVCA 4MELA 3PRPB 3A33B 2M17A 3PPAA 4IWQA 2LJ5A 3SDLC 2DYMA 4GGQA 3JVZX 1J0GA 2IO1B 1GJZA 2BKFA 2GOWA 2WDTB 3VH3B 2KDBA 3D32A 1GNUA 3DBRI 2JUOA 2L8JA 5KHOA 2KDFB 4BKGA 4GIVA 1NBFC 3T8MA 2N1VA 1A5RA 1UH6A 2V3SA 3L0WB 2LVQA 3AXCA 3IVFA 5JHBA 4BVUC 2DAJA 3QX1A 3DDCB 5FR6A 2ZEQA 1RFAA 2Z0DB 3TBLD 3SHQA 3DQVA 2HE7A 3IBEA 3RZWC 2BKRB 4NNJB 3X23A 2CS4A 2GBNA 2C5LC 2KO3A 4GN1A 4WWPA 5TR5A 1WJ6A 4E74A 2MWSB 5E6NA 4DBGA 3WA0A 1LFDA 2K6QA 1E5WA 3ZNZB 4B6WA 1WX9A 2G45B 4GDKB 4K7WA 2KN5A 3NS8A 2KFKB 2JRHA 2KJ6A 2MBBB 2N1WA 1KOTA 1X1MA 1P0RA 4MGZE 2ZVOA 4BKTA 2M1MA 2N9PC 2L7RA 4TUUA 3WALA 4W9KA 4G0NB 3C0RB 4PYZA 2JRIB 1PQSA 4BFRA 2Z59B 1WZ0A 1WF9A 3PHXB 4W9GA 1J8CA 3APFA 4DHZB 2MW5A 2V4LA 2MA9B 3DCGA 3PHWB 2LGDA 4BOZB 2XEWA 4A3OA 5D94A 3ONSA 4GU2A 3W1SA 2RR9A 2DZMA 3SD5A 4PS8A 4KDIC 4E3CA 3UINB 1VD2A 3V61A 4KV2A 2HD5B 2KFKA 3PSEB 3QAQA 2KJHB 4KDLB 3WAMA 1V5TA 4N9F4 4HLEA 3OLMD 3UGBB 2ZNVB 3NOBA 1UZXB 4KIKB 3KUDB 2J0JA 2DHZA 3WANA 3ZNGC 2HTHA 5GMVA 2JT4B 2NR2A 3AULA 4BKSA 2G4SA 4DHJD 2R2QA 1OQYA 4EKUA 4ASWC 1OEYJ 2BWFA 1V9JA 2FCQA 3Q3FA 3MTNB 1WR6E 3MJWA 3WAOA 4FULA 3RT3B 4HCNB 4ICUA 2LUEA 4F1SA 4DDGD 1WGDA 4HK2A 2GBRA 4KVGB 3B0AA 2FCNA 2OOBB 2WWZA 2BYFA 2N7EA 4GSWA 4RM9A 4DK5A 2JXXA 2KQ7A 2CR5A 2PE9A 3A1QB 1IYFA 2K8HA 5D6JB 3B08A 2C7HA 4MH0E 2KFJA 3K9OB 1TBEA 1WXMA 2AEHA 3K9PB 3UF8A 4A20A 2KNBA 1WY8A 3DVGX 4MDKE 3R7RA 4I6LB 2LWPA 2HJ8A 2FCSA 5KHQA 2VRRB 3P2BA 1KLVA 3ZTDA 2LXCA 1E7VA 1YX6B 3QC8B 5E6OA 2XK5A 3DBSA 1V5OA 4WWNA 3A9JB 3RULA 1E8WA 2FCMA 2G4DB 1UD7A 4TKNA 1OEYA 2C7MB 3X0WA 3QQ8B 2GBMA 4JGHB 2QHOA 3EECA 2BWES 1P3QU 1NI2A 2KDIA 4W9JA 1WXSA 3VXWA 4M8NA 3H7PA 3NZSA 2NCNA 1F9JA 1S1QB 2PE6B 3L13A 3M95A 4KSLC 1K8RB 2RPQA 3M62B 5DPTA 4EZJA 2DZJA 2B3AA 2DX5B 2I1KA 2C9WB 2UYZB 1YQBA 2FAZA 4BBNF 3RCZA 4LCDE 2KX0A 4MSQB 2FIDA 3IFWB 1GUAB 2CKHB 3ML8A 3W1SC 3WIMA 2N9EB 4BBNC 1XT9B 4GDKA 1WM2A 2O6VA 4ANXA 2L00B 2L3ZA 3A4RA 3BINA 3V62A 2NS5A 5CTRC 4JQWC 3APDA 4DHJB 3M3JA 1WGYA 2KLGA 2PEAA 2DAFA 3HM6X 5LLIA 4FJYA 5DPWA 4II3B 2KTFA 4FJVB 5LXHA 5G55A 3VUWA 4B9KA 3QCAA 2ZPNA 4B95A 3AU4A 2IBIB 2N7DA 4IG7B 4LDTB 3DVNU 3VQIA 2L76A 1LXDA 3DVNV 3ZDTA 4TQ0A 1C3TA 3OJ3A 2MP2A 3PGEA 1WR1A 2LASA 1WJNA 3QK0A 1LQBA 3A4SC 2WX0A 1WIAA 3TJPA 3QIJA 1UBQA 4K7SA 3RD2A 1WGRA 2K39A 3EC8A 3OAWA 5EDSA 4HDQA 2KC2A 4G50A 5DPSA 1R4MI 1WJUA 1MG8A 3H7SA 2C60A 4WJNA 3MHSD 4BOSC 4FN2A 3JYUA 3ZW3A 4FHKA 4DDID 3ZRCA 3ALBA 4AJYB 2DYOA 1E8ZA 4LDTD 1WX8A 2FNJB 4BKSD 4HXDA 3PLUA 2L0FA 1WMHB 2WYQA 3N32A 2KMCA 4WAAA 4NY0A 3UQAA 1V49A 2GBKA 4HWIB 2BF8B 1JRUA 3ZO5B 2AYOB 3PT2B 2RD0A 3VVWB 4NJ6A 1ISNA 2IO0B 2NPTA 3GOEA 1P9DU 3BY4B 2KVRA 2LRUA 2D07B 3RYTA 5J18A 1IPGA 1WE7A 2MSED 1H8CA 1WGGA 3O65B 2J0KA 3KYCD 3PLVA 3PS6A 2KTRA 3A9KB 1HE8A 2XBBC 1RAXA 1YX5B 2LVPA 2OJRA 2RSUA 2N9XA 1T0YA 4MGIE 5CX3A 1ZKHA 4KZ0A 1KJTA 3RZFA 1ZGUB 5HKHA 3VUXA 1GC7A 2DZIA 4JIOU 4XZ4A 3L54A 4IM0A 4WWOA 4PYUA 4ZRIA 1L2NA 2NBVB 3UQBA 3PRZA 4MGKE 3L17A 2ASQA 2MRPA 4EUTA 1V86A 1J19A 2IO2B 2IY0B 2IZVB 2AL6A 4AWJA 4IUMB 3L08A 2KMAA 4RM8A 5BO4B 2NPTB 3V60A 3R7QA 1CMXB 2FUHB 2K8CA 2KC1A 3VFKA 4EOYA 1D3ZA 2C7NB 1EF1A 3R66C 4GDLB 4MJSB 4MSMB 4M8MA 2LI5A 2BGFA 3CSTA 3QJZA 2M0XA 4K81A 2MLBA 1WXAA 1EF5A 3U8ZA 3V6EB 3VDZA 2LXAA 4LJOB 4K1RB 3GZNI 3NY5A 3NZUA 3PRMB 3QARA 3UIOB 2O2VB 2CHXA 1WGHA 2KWCA 5D7GA 3JSVB 2ZPYA 2MBEA 1XD3B 2JWZA 2EMSA 2DENB 2KHWB 2JF5A 1FXTB 3ECIA 3H9DA 1S3SG 3R3MA 3DBLI 4E71A 1GG3A 1WI0A 4JLCA 4IC7B 4KSKC 2LGXA 5C23A 1G6JA 3ZUNA 2JY6A 5CHWA 4PS3A 4AJWA 4EFOA 3ZLZA 1SIFA 4IM2A 1Q5WB 2MP2B 4K7UA 3U30A 3VAWA 5AEKB 3OJ4B 3VUYA 1V6EA 4W9HA 2KD0A 1UGMA 4W9IA 4WJPA 4NAWA 1ZW7A 4PS7A 2KK8A 4A3PA 2O2VA 1SGHA 4M0WB 3VH4B 3I3TB 3KW5B 1KM7A 2I1JA 2N4FA 4EZLA 1R4NI 4IW0A 4OVVA 2CU1A 1TTNA 4FA6A 3TMPB 2FIFA 5CHFA 1I42A 3NHEB 3ZRFA 2KANA 1NDDA 1GC6A 2RGFA 3ZVVA 4MM3A 3KH0A 1P98A 3HM3A 2GBJA 4DWFA 2MBQA 3DPDA 4IWPA 2REXA 2M8SA 1LM8B 2KKCA 4FLHA 2R2OA 1Z2MA 3HK0A 5DPRA 3DVGY 3QA8A 1QZEA 2JZ3B 3A1QA 4GXBA 2KOXA 2LVOA 4HPLB 2KJRA 1WRDB 2DYBA 2PPHA 3TL5A 1OTRB 1TGZB 2IY1B 2ZZPB 3H1UA 3DBHI 3H6NA 5AZFA 3ENEA 3ZNID 2J7QB 5IA7A 4GB9A 2L05A 2K1FA 2W9NA 4MEMA 2AWTA 5AZGA 2V1YA 2O6VD 1E8XA 1H4RA 2ZCCA 1YIWA 3ZNHB 1Z5SB 2K6DB 5D2MB 1RRBA 4HVBA 3U7DA 2MX2A 4RMAA 4ANUA 4GMVA 1Q0WB 4DHZE 4P7IA 4X57B 3VTUA 1WM3A 4I6PA 4IM3A 2L0TA 2LD9A 2NBUA 2ZNVC 2KX3A 1UBIA 2CHZA 3HHMA 4WJOA 2BPSA 3W1YA 2NVUI 1UELA 4TQ1A 3JW0X 3N3KB 1L7YA 4IWOA 2EMTA 2J0MA 4I6NB 1M94A 4W9EA 2KWVB 2AL3A 5JZEB 3DOWA 4LJPB 3APCA 1WYWB 2DZKA 2MBHA 1I35A 5C1ZA 5CHVC 3KYDD 2JVCA 5JH5C 3Q3JA 1WFYA 3JSVA 1EUVB 1Y8RC 2LGYA 4XX5A 4ICVA 1VCBA 2WX1A 4ZDVA 1YJ1A 5G2NA 4AUQC 3SU8X
chains in the Genus database with same CATH superfamily
1AARA 4W9DA 2RMMA 3R8BA 1L6VA 1ZE3D 1XXGA 1XLOA 4YWGG 4NQKE 3KUCB 3AE7B 2MQJA 3N1YC 3U7ZA 2KDEB 1EO6A 1JMLA 5L95C 1WZ3A 5L83A 2ZJDA 2A5UA 2J4XA 2WXMA 5IO9A 1WE6A 4MGYE 4WJQA 5EE1A 2D3GA 1ACCA 4OVUA 4F8CB 3CF6E 4YSZB 3L10B 3M63B 2QSDA 5J17A 4AOFA 4NAWB 1WYGA 4LNNA 1IP9A 5JHAA 2J53A 2K5PA 3BVGA 5IAAC 2G1EA 4WIPA 2D10A 4CYEA 3R2TA 2WXHA 2WXOA 3A9KA 1ZXHA 2QMTA 4WQOB 1FFVA 1TY2A 4UDUC 1YQ3B 3RI7C 3P4RB 4RF1A 4ANVA 2K25A 1MPEA 2KVZA 3Q8AA 5BYSA 1SJED 3WAPA 2KQSA 3CSFA 1L4ZB 4HJKA 2PJHA 2K8BA 4ZRKA 3NS1A 3RUIB 3PZDA 4FBJB 5IKCM 1P7FA 3B1LX 2INPE 4TSSA 4YL8A 4MT5A 1GJZA 1MFWA 2KDBA 4A9AA 1TS3A 2JUOA 4XYCA 2L8JA 1I4XA 3T8MA 2N1VA 4LLGM 1JROA 2LVQA 3AE1B 2NTSA 3QX1A 4EE2A 5FR6A 2HTME 2Z0DB 3SHQA 2BKRB 2INCC 2KO3A 4E74A 4BZAA 5E6NA 4DBGA 3ZNZB 2OHFA 4K7WA 1KOTA 2N1WA 1SXTA 1X1MA 2ZVOA 1GOZA 4BKTA 2E6XA 2L7RA 3WALA 4PYZA 2I38A 2JRIB 4DXFA 1WF9A 3P1MA 4W9GA 1EWCA 1J8CA 3DCGA 4C7YA 3SD5A 4RNAA 2HD5B 4KDLB 3ZJTA 2ZNVB 3TEZA 3ZNGC 1ZUD2 2JT4B 4XDCA 1UUPA 1OQYA 1K50A 4D2KA 2ZW0A 3NUHB 2BWFA 1V9JA 1FRRA 1QQRA 4FULA 3RT3B 3VRBB 4HCNB 4F1SA 1M4VA 3AM9A 5FK9C 3W9CB 2OOBB 3AEFB 4DK5A 2JXXA 2CR5A 1NVID 1KH0A 1SIJA 5D6JB 3N20C 1TBEA 3GZNB 3K9PB 3UF8A 2KNBA 4YTNB 4A6QA 2LMCA 2VRRB 5E6OA 3DBSA 3NG0A 4WWNA 3AB5A 4TKNA 1FPYA 1OEYA 2C7MB 5FKAC 2WXLA 2QHOA 2BWES 1XLPA 4N6EB 4M8NA 1PUTA 4CQNA 1KRHA 1JWBD 3PZ8A 2NCNA 5AUKA 1S1QB 2WLBA 3FKYA 1UNSA 5DPTA 3FILA 1WWTA 2UYZB 2NTTA 2FAZA 1F2RC 4RGMA 3RCZA 4LCDE 1L0XB 5AUIA 2V9HA 2FIDA 2CKHB 4LNKA 2L83A 1WM2A 3A4RA 2AQ2B 2NS5A 1FXIA 4DHJB 1WGYA 2KLGA 3KQ4A 1JWSD 4FJYA 4FJVB 4M0WA 2EELA 4B95A 2N7DA 4LDTB 4HJGE 3ZDTA 1C3TA 3PGEA 2LASA 4QAYA 1WJNA 3QK0A 3SFEB 2VH2A 2WX0A 1UBQA 2XNAC 4WURA 5EDSA 1XO3A 5DPSA 3AE3B 3H7SA 4WJNA 2C60A 1HTQA 3ZW3A 3JYUA 1SBBB 1D6EC 1D4BA 4NY0A 2GBKA 1ROEA 4ARCA 1JRUA 3PT2B 2RD0A 3VVWB 2N0SB 1JRPA 4RCOA 1WE7A 4YTMB 2CJOA 2J0KA 3KYCD 3RNCC 1RAXA 1YX5B 4REZA 2LVPA 2RSUA 1T0YA 3MC8A 1QOAA 3MC0B 3RZFA 1YMHE 3VUXA 4XZ4A 1FEHA 2MRPA 5D3IB 2IO2B 1A70A 4AWJA 2KMAA 4RM8A 2MHJA 5BO4B 1OQQA 2J42A 1D3ZA 2C7NB 3R66C 4GDLB 1QKZA 3CSTA 4HKQA 2MLBA 3U8ZA 3NVVA 3V6EB 2SEBD 3VDZA 2LXAA 3BK2A 3GZNI 3UIOB 2BVCA 2LGIA 2O2VB 3Q14C 2CHXA 5D7GA 1XD3B 1FXTB 3NZ3A 1S3SG 4AS1A 3VR9B 5C23A 1DOXA 1MHXA 3AEAB 2JY6A 5CHWA 2D3CA 4AJWA 4IM2A 3U30A 3OJ4B 4W9HA 1SE3A 1ZW7A 4M0WB 2I1JA 2N4FA 4IW0A 4NZLB 3BWUD 2YEPF 3TMPB 1MI0A 1NDDA 1GC6A 5MPOA 4DWFA 4MM3A 1ZDXA 3KH0A 2K3UA 4IWPA 2CU3A 4KGSA 1YJJA 3O13A 2M8SA 3TEWA 1LM8B 2KKCA 4C00A 2WXJA 4GXBA 4C4VB 4HPLB 1WRDB 1IGCA 2KJRA 2PPHA 1OTRB 3DBHI 3ENEA 2L05A 3MP9A 2W9NA 2L32A 5AZGA 5IOIA 3RNAC 3BK1A 4Q2JA 2ZCCA 3DBRB 4WAFA 1YIWA 4HROA 1Z5SB 1RRBA 1VZ6A 3U7DA 4RMAA 4ANUA 4GMVA 2LFIA 2W82A 4IM3A 2L0TA 1F77A 2KX3A 1UBIA 2HJ1A 3W1YA 2NVUI 4IWOA 3JW0X 4I6NB 1YQ4B 3BIID 5BMHA 1GAQB 4LJPB 5JZEB 1K53A 3AEBB 2V3PA 5CHVC 4M02A 3KYDD 5JH5C 3VR8B 1L0YB 4AQ7A 2HDEA 2K9XA 4ZDVA 1YJ1A 5EE9A 4FXCA 3AEDB 4AUQC 2WHIA 2KWUB 4HDOA 1OQRA 2QDFA 3DWMA 3W2DA 3AU5A 1AWDA 5C3JB 2OJWA 4FHJA 1PYWD 3QHTA 3CMMB 4C56C 4P1BC 5H92C 2PVOD 4EEWA 4NQLB 3ZIMA 1L4DB 2KN4A 1UWMA 1FCCC 1SE4A 2LHDA 3PTFC 3VTWA 1E8YA 2D2QA 4GOCA 1ZXIA 3TIXA 1WXVA 1E90A 1XEEA 3I9V1 1GB1A 2X8XX 3BYYB 1SE9A 3RNBC 4ACFA 2ACZB 4HEA1 3V3XA 3ABVB 4JWSC 4KIKA 1Q1OA 3T9LA 3RMKC 2YLMA 2M4NA 3TCAA 2JPHA 1C1YB 2IGGA 1TKEA 3SFDB 3ZYYX 4II2B 4OZAA 3AH7A 2IO3B 1EM7A 2ON8A 1V81A 2WU5B 2XK5B 4TV3A 2DNFA 4W9LA 3PO0A 1FM0D 3LDZE 1ENFA 3SEBA 3PV1A 1C76A 2PW9A 4HPMB 1YD8U 2LRWA 1Q10A 3PRPB 3A33B 2M17A 3PPAA 2LJ5A 4GGQA 4BAXA 1BUIC 3VH3B 4A55A 2K22A 1GNUA 3DBRI 5HHDG 4JE3B 2L52A 5KHOA 1TIFA 1FNUA 4BKGA 4GIVA 5BMGA 1UH6A 3AXCA 5JHBA 2DAJA 1VR9A 3DDCB 2SAKA 1RFAA 1QOGA 3DQVA 3IBEA 3RZWC 2CS4A 3AE6B 5TR5A 2PLPA 2KJ6A 2IJ0A 1P0RA 2VZKB 2M1MA 2N9PC 3Q8BA 3AE2B 3C0RB 1YN5A 1TKGA 3BVMA 1WZ0A 3PHXB 1SE2A 2MW5A 2AQ1B 1YNTE 4PS8A 4E3CA 1VD2A 3V61A 4KV2A 2H89B 3EA6A 2KFKA 3W5UB 2WXIA 3WAMA 4N9F4 3OLMD 3IXSA 3NOBA 3RNGC 2MH7A 2J0JA 2WXNA 5HI1A 5BYQA 4HRSA 3WANA 5GMVA 2NR2A 4BKSA 2DLBA 4YT0B 1ZDVA 1ZPSA 1IGDA 1OEYJ 3Q3FA 3MTNB 1WR6E 3MJWA 3WAOA 2LUEA 1D5MC 4DDGD 2GBRA 4KVGB 2WWZA 4YXDB 2N7EA 2KQ7A 3NRZA 2PE9A 3TUOA 1IYFA 2K8HA 4C7ZA 4MH0E 2KFJA 3K9OB 1FNWA 4A20A 1WY8A 3N1XC 3EFCA 3R7RA 2HJ8A 4YSXB 3P2BA 2LXCA 1J7AA 3AE8B 1YX6B 3OG5A 3MHZA 1TY0A 1DOIA 3QQ8B 2BW2A 3NZSA 1E6EB 1F9JA 4A8XC 3L13A 1K8RB 2RPQA 3M62B 1E0ZA 2PTLA 2KX0A 4MSQB 3WIMA 4ZHPA 1CJEA 1XT9B 4ANXA 1HTOA 5GXGB 3BINA 1HQRD 1SF0A 1E10A 3M3JA 1C79A 1V1OA 2DAFA 5DPWA 1N5XA 2KTFA 5G55A 1PFDA 1E7PB 2JYEA 2XN9C 3DVNU 3GB1A 3VQIA 2L76A 3DVNV 1FD6A 4TQ0A 3OJ3A 1LQBA 3A4SC 3QIJA 3Q8EA 1R4MI 1MG8A 5IP4D 1AYFA 2KAJA 4DDID 3ALBA 4AJYB 3MC9A 4LDTD 1WX8A 2DBYA 1R7SA 1J7BA 2ZW1A 3AECB 3N32A 4WAAA 1JALA 1SEBD 1QILA 3UI3A 2IGDA 1TT5B 4NJ6A 1ISNA 2IO0B 4OZCA 3BY4B 5EE3A 2MSED 1H8CA 1WGGA 3O65B 1UWXA 3PS6A 1TS4A 3A9KB 1WSPA 1T0RC 5HKHA 2DZIA 4JIOU 1L2NA 1QOFA 4IDIA 3N1ZC 1J19A 3L08A 4RF0A 2NPTB 3V60A 3VFKA 4EOYA 2JYTA 1EF1A 4MSMB 3C8YA 3QJZA 2BGFA 2M0XA 2WQYB 1PDXA 4B0MA 3NY5A 3RNFC 1XCQL 1WGHA 3NJTA 3JSVB 2KHWB 3R3MA 4B0EA 3BZDB 3DBLI 2WXQA 1GG3A 5LNK1 4N58A 4IC7B 1CQVA 4EFOA 2OEDA 3ZLZA 1SIFA 2KDMA 3VAWA 1Q5WB 1RYJA 2MP2B 1UGMA 3DBHB 2JSVX 3ZQ4A 1F52A 1SGHA 3VH4B 3KW5B 3HUIA 5JXVA 5CHFA 1I42A 2RGFA 4P16A 2QC8A 4PK1A 2MBQA 3DPDA 1VRAB 2KQ4X 1C78A 2R2OA 2JZ3B 3DHIC 5FR3A 2JX5A 2N7JA 2KMMA 3TL5A 3H6NA 1KF6B 4US8A 1SB3C 3LXFA 3C19A 5IA7A 1WRIA 4MEMA 2AWTA 2KWDA 2V1YA 2O6VD 2K0PA 2Y3AA 1MJDA 1VZ8A 1V1PA 1H4RA 1R4NB 3ZNHB 2MX2A 1NEKB 2DWQA 1Q0WB 4KKIA 1WM3A 4I6PA 1I7HA 2GI9A 2V3NA 4TQ1A 4K3BA 2Y5PA 2BB6A 2EMTA 2J0MA 1M94A 2JWUA 4W9EA 2KWVB 4OZBA 2AL3A 4N59A 2DZKA 1I35A 3Q3JA 3JSVA 4KGRA 3SR6A 2Z8LA 5G2NA 3VTVA 2ZCBA 4MJSA 3Q3OC 2EKEC 5AZHA 4NPNA 2V0GA 4XE0A 1WXQA 1L0VB 1WMHA 1OFFA 1XQQA 4FADA 2G3QB 3P4QB 1BT0A 3I5JC 5J2RA 1BXTA 3UIPB 1WJ4A 3ZKJC 4FJZA 2BS3B 2MBOA 3ZTCA 3H7PB 3T3OA 3ML9A 1NI3A 1SJHD 3FILB 3EFUA 4G3XB 2KZRA 3L16A 5T8IA 2LZ6A 3KVFB 2D5GA 4XC2A 1WH3A 3W5VB 2O6VB 3L4PA 1JCKB 4G11A 4DXAB 1RLFA 4F7ZA 4J6IA 3QWZB 1I4PA 4OVZA 3V05A 3BVZA 3MJ5A 4ANWA 2JQRB 1XLQA 4KKJA 4HCPB 2YEPB 5E6PA 2ZVNA 4EZKA 2KTRB 1C4AA 4M00A 3IG3A 1DGJA 4USAA 5LXIB 3PVLA 3AI5A 4AP4C 2BTEA 2CHWA 2A4ZA 2IYDB 2YVCA 2DYMA 1LGRA 3JVZX 3CIRB 3FAHA 3P4SB 2LEKA 1IBXA 1JWUD 2WDTB 4S17A 1EWYC 2MJ3A 4LTUA 1NBFC 2RDHA 1A5RA 2V3SA 4WQMA 4BVUC 3BYTB 2HE7A 3X23A 4P6VF 3WCQA 5TSSA 2K6QA 4B6WA 2G45B 2LHEA 1I4RA 2KN5A 2KFKB 2JRHA 2MBBB 1UGJA 4MGZE 1FXAA 2VH1A 4W9KA 4BFRA 2R61A 1RWSA 4BOZB 2MA9B 3PHWB 4A3OA 5D94A 3ONSA 2M0AA 4M01A 2RR9A 3W1SA 2DZMA 1QF6A 1HEZE 2KJHB 3IAS1 5C2TB 4HLEA 1FCLA 3UGBB 3PZ7A 4C80A 3Q8FA 4KIKB 1AW7A 3HRDD 1L5PA 2HTHA 1HZ6A 2G4SA 2QJLA 4K3CA 3B2FA 4DHJD 2R2QA 4EKUA 2FCQA 1QOBA 2E3TA 2RPVA 1XLNA 2FE8A 1V8CA 4HK2A 3B0AA 2BYFA 1LO5D 1F1HA 1IBXB 3A1QB 4NAMA 3B08A 3TEXA 3URYA 2C7HA 2LJIA 3Q2AC 3DVGX 4MDKE 2LWPA 2BS2B 1GB4A 1KLVA 1VLBA 5E6JA 3ZTDA 1ZOYB 3QC8B 2JZPA 3KWVA 2I2YA 2GRIA 1V5OA 3A9JB 3RULA 1E8WA 1RM6C 1UD7A 5BYRA 4JGHB 1P3QU 2KDIA 3B9JA 4W9JA 1WXSA 2KT7A 4LNIA 2WXPA 3M95A 4KSLC 4J3OD 4EZJA 2GB1A 2I1KA 2C9WB 4RGNA 1YQBA 1I4HA 3E56A 3ML8A 2N9EB 4BBNC 4GDKA 2O6VA 3IT4B 2L3ZA 1ET6A 4ZHOA 5CTRC 2BYTA 4ZRPA 1KLUD 2PEAA 3HM6X 4XGAB 3VUWA 1WGKA 2ZPNA 3QCAA 4IG7B 1ZP0B 3P4PB 2MP2A 1C4CA 3TJPA 4K7SA 3EC8A 3U4EG 2KC2A 4G50A 4C4VA 1T3QA 1C4PA 1KFYB 2G9HD 4FN2A 4FHKA 2TSSA 3ZRCA 1E8ZA 4BKSD 4HXDA 3U2SC 2PKOA 3UQAA 1V49A 1MHHE 2FBWB 3TSSA 2NPTA 3GOEA 1P9DU 2KVRA 3FC4A 2LRUA 4O1NA 2D07B 3H8HA 3AEGB 1MVKA 1P7EA 1HE8A 3RN9C 2OJRA 2Y5CA 4HPPA 4MGIE 4WWMA 1F0ZA 1KJTA 3Q69A 4XWWA 1ZGUB 1GC7A 1PGXA 3L54A 4IM0A 4ZRIA 4PYUA 3UQBA 4DXGA 3L17A 2ASQA 2IY0B 4IUMB 3P63A 3R7QA 2K8CA 4MJSB 4M8MA 2LI5A 4K81A 1EF5A 4LJOB 3QARA 3NZUA 2LUMA 2ZPYA 2MBEA 3H9DA 2DENB 2JF5A 3ECIA 4DQOC 2Q5WD 4RFBA 2MEKA 3GP7A 4JLCA 4GLSC 1FFUA 2LGXA 4H2AA 3ZUNA 4MM3B 4PS3A 3VUYA 1V6EA 4W9IA 4WJPA 2H88B 2CJNA 4PS7A 2KK8A 4ZOHC 4A3PA 2J52A 2O2VA 4OW0A 3I3TB 1KM7A 4EZLA 4OHJA 4OVVA 1B9RA 1HA5A 1TTNA 2INDC 2FIFA 3ZRFA 3ZVVA 2BS4B 2GBJA 4XWTA 4HKZE 2REXA 4FLHA 1Z2MA 3DVGY 3QA8A 3DHHC 1QZEA 3AE4B 2LVOA 3WA0A 3H1UA 4YTPB 1VDVA 2MJEA 2J7QB 1DOYA 2K1FA 4RGTA 3AMZA 1E8XA 3NVZA 1GPXA 2IDYA 2K6DB 5D2MB 5EE0A 4DHZE 4P7IA 4X57B 4ARIA 1UF0A 2LD9A 2PIAA 2NBUA 4R3DA 3HHMA 4WJOA 2WXFA 2BPSA 2JXTA 2NMQA 2WDQB 3DHGC 1UELA 3HVZA 1L7YA 2M19A 1AN8A 3DOWA 3APCA 1WYWB 5C1ZA 1WFYA 1Y8RC 1N62A 4ICVA 2WX1A 1ET9A 2PVGC 4XX5A 1MG4A 2W3SA 4URKA 4JL9A 4LNFA 1P1AA 2D11A 2BYEA 1K51A 3VHTC 3NVYA 3ZJVA 3HIZA 4NJ7A 3ZXRA 1T5XD 1HXYD 2GMIC 5HFYA 4KGTA 1V2YA 3KUZA 4IOIE 1FIQA 2BYVE 3ZDMC 2EKIA 1N60A 4CHKA 1E7UA 2KXJA 4LNOA 3S2AA 3N30A 3TEYA 2WDVB 2NBWB 1F2RI 3A9JA 2KLCA 1N5WA 2Y5BB 2RDBC 4ZRJA 1V80A 1U4AA 2ICIA 1J7CA 1WX7A 1OGWA 4KZCA 1NYQA 2Z0EB 2UWQA 4CO7A 5DCNA 3LJ3A 1TKYA 3IHPC 4L23A 1I4GA 4YSYB 3DWGC 4W9CA 4GDLA 4RGOS 2MCNB 4L1BA 3V6CB 2JZZA 3CWIA 3ZJUA 1TZ1A 3PREA 4W9FA 3Q3MC 1DYQA 3EHVA 4ZYNA 1VJKA 4MELA 4IWQA 3SDLC 1N6ZA 3NVWA 1J0GA 2IO1B 3IAM1 2BKFA 2GOWA 1NYRA 1VZ7A 3D32A 2KDFB 1SSNA 1YN3A 1TS5A 1QLBB 3R2IA 3L0WB 3HVDA 3IVFA 2UU7A 4S0RA 2ZEQA 3TBLD 2N9KA 2W55A 4NNJB 4GN1A 2GBNA 2C5LC 4WWPA 5G5HA 1WJ6A 2BBCA 2MWSB 4JWUC 1LFDA 4JX1C 1E5WA 3KWLA 1WX9A 4GDKB 3NS8A 3LYYA 1FMAD 4RH6A 4LK0M 2PMVA 1PGBA 4TUUA 4G0NB 1PQSA 2Z59B 3Q8CA 3APFA 4DHZB 2V4LA 3ETRA 2LGDA 2XEWA 3I63C 4GU2A 3OWEB 4KDIC 3UINB 1K52A 3QAQA 3PSEB 1V5TA 1D5ZC 1CK1A 1L6UA 1UZXB 3KUDB 2DHZA 2D3AA 2L1AA 2QIEB 3AULA 2WGSA 1HZ5A 2X38A 4ASWC 4XDDA 3RFZB 1TJEA 1YOVB 4ICUA 1T0QC 1WGDA 2FCNA 4GSWA 4RM9A 1CZPA 1EU3A 4L2YA 5I4DA 2WP9B 1WXMA 4WH4A 2AEHA 1RFKA 1N61A 3EUB2 4I6LB 2KYWA 2FCSA 5KHQA 1E7VA 1TYGB 2XK5A 1NENB 2FCMA 2G4DB 2AQ3B 3X0WA 2GBMA 2VZKD 3EECA 1NI2A 3VXWA 2MJDA 3H7PA 5BMIA 2PE6B 2DZJA 2B3AA 2DX5B 5H8YE 1JW9D 3E9SA 2QCZA 4BBNF 4A90A 1EU4A 3IFWB 3W1SC 1GUAB 2D3BA 2WU2B 3P42A 1XF5L 2L00B 2GLSA 3V62A 1TS2A 4JQWC 3APDA 5LLIA 3U52E 3MFGA 3GS2A 4II3B 5LXHA 1Y56A 4B9KA 3AU4A 2IBIB 1LXDA 1FRDA 1WR1A 2IGHA 3ZXVA 1WIAA 3IT6B 2BQQA 3RD2A 1WGRA 2K39A 3OAWA 4HDQA 1WJUA 2BT6A 3MHSD 4BOSC 2QEJC 1ESFA 2DYOA 2FNJB 3RPFC 1JWAD 3VRAB 4P1CC 3PLUA 1TZOA 1WMHB 2L0FA 2WYQA 2KMCA 1N63A 1STEA 1V1PB 2FUG1 4HWIB 2BF8B 3ZO5B 2AYOB 1C9FA 1KTKA 3Q3NC 3B2GA 3RYTA 5J18A 2ONQA 4JPSA 1IPGA 4US9A 2WXGA 3PLVA 2KTRA 1T0SC 2M56B 2XBBC 2WDRB 5G5GA 4ZYSA 2AX5A 2N9XA 3LB8C 3I57A 5CX3A 2IPKD 1ZKHA 4KZ0A 1JQ4A 4MH8A 4WWOA 4KX6B 2NBVB 1V97A 1C77A 1KLGD 3PRZA 4MGKE 1IUEA 4EUTA 1V86A 1FO4A 2IZVB 2AL6A 4MACA 2B76B 1CMXB 2FUHB 2KC1A 3AN1A 1WXAA 4TMAB 2KACA 3J9CA 5D3DA 4K1RB 1XCTL 3PRMB 2RDGA 2KWCA 2JWZA 1B1ZA 1R4MB 2EMSA 2WXKA 4E71A 1WI0A 4KSKC 3N9YC 1G6JA 3AEEB 2V4IB 3T3NA 4K7UA 5AEKB 2QILA 2KD0A 2N9LA 4NAWA 3EGRA 3GE3C 4NJCA 1I4QA 1R4NI 2CU1A 4FA6A 3NHEB 2KANA 1YN4A 1P98A 3HM3A 1FNVA 2INNE 4ITKA 3DBLB 1QT9A 2WXRA 3HK0A 5DPRA 3A1QA 2KOXA 3Q6BA 2DYBA 2IY1B 1TGZB 2ZZPB 5AZFA 2W54A 3ZNID 4GB9A 3GE8C 5HG2A 3KLSX 5IN7A 1JWMD 2W3RA 3RNEC 3AE9B 4HVBA 1PGAA 3AE5B 1BMLC 3VTUA 2ZNVC 1E9MA 2CHZA 2JU6X 3N3KB 1YJIA 1D5XC 2LGSA 2BB5A 2MBHA 4IKGA 2WS3B 2JVCA 3ZGZA 1EUVB 2LGYA 1T6BX 3AV8A 1VCBA 2WNMA 4ZRQA 4PT5A 3SU8X
chains in the Genus database with same CATH topology
4URKA 3VTVA 4JL9A 1AARA 4W9DA 2ZCBA 4MJSA 2KWUB 2EKEC 5AZHA 4NPNA 4HDOA 1P1AA 1WMHA 2D11A 2BYEA 3VHTC 1XQQA 4FADA 3AU5A 2G3QB 3HIZA 4FHJA 4NJ7A 1BT0A 4NQKE 5J2RA 3QHTA 2GMIC 3CMMB 3KUCB 3UIPB 1WJ4A 2MQJA 1V2YA 3ZKJC 3KUZA 4FJZA 2KDEB 1EO6A 2BYVE 2MBOA 3ZDMC 4EEWA 5L95C 1WZ3A 4NQLB 3ZTCA 3ZIMA 4CHKA 5L83A 2ZJDA 2A5UA 1E7UA 3H7PB 1WE6A 4MGYE 4WJQA 2D3GA 2KXJA 3S2AA 3ML9A 4OVUA 4F8CB 3CF6E 3N30A 3L10B 3M63B 3PTFC 3VTWA 3EFUA 2NBWB 1E8YA 2D2QA 4GOCA 5J17A 4G3XB 2KZRA 4AOFA 3A9JA 3L16A 4NAWB 3TIXA 1WXVA 2KLCA 1E90A 2LZ6A 2Y5BB 4ZRJA 1V80A 3KVFB 1IP9A 4XC2A 5JHAA 1U4AA 1WH3A 2O6VB 5IAAC 1WX7A 4DXAB 2D10A 1OGWA 4G11A 1SE9A 4CYEA 4KZCA 1RLFA 2Z0EB 2UWQA 3A9KA 4F7ZA 4CO7A 4J6IA 5DCNA 4KIKA 1Q1OA 3QWZB 4WQOB 3T9LA 2YLMA 3LJ3A 4ANVA 2M4NA 3TCAA 4ANWA 3IHPC 2JPHA 1C1YB 2K25A 4W9CA 4HCPB 4GDLA 5E6PA 2ZVNA 4EZKA 2KTRB 2MCNB 3V6CB 2JZZA 4II2B 3WAPA 1TZ1A 2KQSA 3CSFA 3PREA 2IO3B 4HJKA 2PJHA 2K8BA 3IG3A 1V81A 4ZRKA 3RUIB 2XK5B 3PZDA 4W9FA 4FBJB 4TV3A 5LXIB 3B1LX 3PVLA 3AI5A 4W9LA 3LDZE 4AP4C 2CHWA 3EHVA 3PV1A 2A4ZA 4YL8A 4ZYNA 4HPMB 2IYDB 1YD8U 2LRWA 2YVCA 4MELA 3PRPB 3A33B 2M17A 3PPAA 4IWQA 2LJ5A 3SDLC 2DYMA 4GGQA 3JVZX 1J0GA 2IO1B 1GJZA 2BKFA 2GOWA 2WDTB 3VH3B 2KDBA 3D32A 1GNUA 3DBRI 2JUOA 2L8JA 5KHOA 2KDFB 4BKGA 4GIVA 1NBFC 3T8MA 2N1VA 1A5RA 1UH6A 2V3SA 3L0WB 2LVQA 3AXCA 3IVFA 5JHBA 4BVUC 2DAJA 3QX1A 3DDCB 5FR6A 2ZEQA 1RFAA 2Z0DB 3TBLD 3SHQA 3DQVA 2HE7A 3IBEA 3RZWC 2BKRB 4NNJB 3X23A 2CS4A 2GBNA 2C5LC 2KO3A 4GN1A 4WWPA 5TR5A 1WJ6A 4E74A 2MWSB 5E6NA 4DBGA 3WA0A 1LFDA 2K6QA 1E5WA 3ZNZB 4B6WA 1WX9A 2G45B 4GDKB 4K7WA 2KN5A 3NS8A 2KFKB 2JRHA 2KJ6A 2MBBB 2N1WA 1KOTA 1X1MA 1P0RA 4MGZE 2ZVOA 4BKTA 2M1MA 2N9PC 2L7RA 4TUUA 3WALA 4W9KA 4G0NB 3C0RB 4PYZA 2JRIB 1PQSA 4BFRA 2Z59B 1WZ0A 1WF9A 3PHXB 4W9GA 1J8CA 3APFA 4DHZB 2MW5A 2V4LA 2MA9B 3DCGA 3PHWB 2LGDA 4BOZB 2XEWA 4A3OA 5D94A 3ONSA 4GU2A 3W1SA 2RR9A 2DZMA 3SD5A 4PS8A 4KDIC 4E3CA 3UINB 1VD2A 3V61A 4KV2A 2HD5B 2KFKA 3PSEB 3QAQA 2KJHB 4KDLB 3WAMA 1V5TA 4N9F4 4HLEA 3OLMD 3UGBB 2ZNVB 3NOBA 1UZXB 4KIKB 3KUDB 2J0JA 2DHZA 3WANA 3ZNGC 2HTHA 5GMVA 2JT4B 2NR2A 3AULA 4BKSA 2G4SA 4DHJD 2R2QA 1OQYA 4EKUA 4ASWC 1OEYJ 2BWFA 1V9JA 2FCQA 3Q3FA 3MTNB 1WR6E 3MJWA 3WAOA 4FULA 3RT3B 4HCNB 4ICUA 2LUEA 4F1SA 4DDGD 1WGDA 4HK2A 2GBRA 4KVGB 3B0AA 2FCNA 2OOBB 2WWZA 2BYFA 2N7EA 4GSWA 4RM9A 4DK5A 2JXXA 2KQ7A 2CR5A 2PE9A 3A1QB 1IYFA 2K8HA 5D6JB 3B08A 2C7HA 4MH0E 2KFJA 3K9OB 1TBEA 1WXMA 2AEHA 3K9PB 3UF8A 4A20A 2KNBA 1WY8A 3DVGX 4MDKE 3R7RA 4I6LB 2LWPA 2HJ8A 2FCSA 5KHQA 2VRRB 3P2BA 1KLVA 3ZTDA 2LXCA 1E7VA 1YX6B 3QC8B 5E6OA 2XK5A 3DBSA 1V5OA 4WWNA 3A9JB 3RULA 1E8WA 2FCMA 2G4DB 1UD7A 4TKNA 1OEYA 2C7MB 3X0WA 3QQ8B 2GBMA 4JGHB 2QHOA 3EECA 2BWES 1P3QU 1NI2A 2KDIA 4W9JA 1WXSA 3VXWA 4M8NA 3H7PA 3NZSA 2NCNA 1F9JA 1S1QB 2PE6B 3L13A 3M95A 4KSLC 1K8RB 2RPQA 3M62B 5DPTA 4EZJA 2DZJA 2B3AA 2DX5B 2I1KA 2C9WB 2UYZB 1YQBA 2FAZA 4BBNF 3RCZA 4LCDE 2KX0A 4MSQB 2FIDA 3IFWB 1GUAB 2CKHB 3ML8A 3W1SC 3WIMA 2N9EB 4BBNC 1XT9B 4GDKA 1WM2A 2O6VA 4ANXA 2L00B 2L3ZA 3A4RA 3BINA 3V62A 2NS5A 5CTRC 4JQWC 3APDA 4DHJB 3M3JA 1WGYA 2KLGA 2PEAA 2DAFA 3HM6X 5LLIA 4FJYA 5DPWA 4II3B 2KTFA 4FJVB 5LXHA 5G55A 3VUWA 4B9KA 3QCAA 2ZPNA 4B95A 3AU4A 2IBIB 2N7DA 4IG7B 4LDTB 3DVNU 3VQIA 2L76A 1LXDA 3DVNV 3ZDTA 4TQ0A 1C3TA 3OJ3A 2MP2A 3PGEA 1WR1A 2LASA 1WJNA 3QK0A 1LQBA 3A4SC 2WX0A 1WIAA 3TJPA 3QIJA 1UBQA 4K7SA 3RD2A 1WGRA 2K39A 3EC8A 3OAWA 5EDSA 4HDQA 2KC2A 4G50A 5DPSA 1R4MI 1WJUA 1MG8A 3H7SA 2C60A 4WJNA 3MHSD 4BOSC 4FN2A 3JYUA 3ZW3A 4FHKA 4DDID 3ZRCA 3ALBA 4AJYB 2DYOA 1E8ZA 4LDTD 1WX8A 2FNJB 4BKSD 4HXDA 3PLUA 2L0FA 1WMHB 2WYQA 3N32A 2KMCA 4WAAA 4NY0A 3UQAA 1V49A 2GBKA 4HWIB 2BF8B 1JRUA 3ZO5B 2AYOB 3PT2B 2RD0A 3VVWB 4NJ6A 1ISNA 2IO0B 2NPTA 3GOEA 1P9DU 3BY4B 2KVRA 2LRUA 2D07B 3RYTA 5J18A 1IPGA 1WE7A 2MSED 1H8CA 1WGGA 3O65B 2J0KA 3KYCD 3PLVA 3PS6A 2KTRA 3A9KB 1HE8A 2XBBC 1RAXA 1YX5B 2LVPA 2OJRA 2RSUA 2N9XA 1T0YA 4MGIE 5CX3A 1ZKHA 4KZ0A 1KJTA 3RZFA 1ZGUB 5HKHA 3VUXA 1GC7A 2DZIA 4JIOU 4XZ4A 3L54A 4IM0A 4WWOA 4PYUA 4ZRIA 1L2NA 2NBVB 3UQBA 3PRZA 4MGKE 3L17A 2ASQA 2MRPA 4EUTA 1V86A 1J19A 2IO2B 2IY0B 2IZVB 2AL6A 4AWJA 4IUMB 3L08A 2KMAA 4RM8A 5BO4B 2NPTB 3V60A 3R7QA 1CMXB 2FUHB 2K8CA 2KC1A 3VFKA 4EOYA 1D3ZA 2C7NB 1EF1A 3R66C 4GDLB 4MJSB 4MSMB 4M8MA 2LI5A 2BGFA 3CSTA 3QJZA 2M0XA 4K81A 2MLBA 1WXAA 1EF5A 3U8ZA 3V6EB 3VDZA 2LXAA 4LJOB 4K1RB 3GZNI 3NY5A 3NZUA 3PRMB 3QARA 3UIOB 2O2VB 2CHXA 1WGHA 2KWCA 5D7GA 3JSVB 2ZPYA 2MBEA 1XD3B 2JWZA 2EMSA 2DENB 2KHWB 2JF5A 1FXTB 3ECIA 3H9DA 1S3SG 3R3MA 3DBLI 4E71A 1GG3A 1WI0A 4JLCA 4IC7B 4KSKC 2LGXA 5C23A 1G6JA 3ZUNA 2JY6A 5CHWA 4PS3A 4AJWA 4EFOA 3ZLZA 1SIFA 4IM2A 1Q5WB 2MP2B 4K7UA 3U30A 3VAWA 5AEKB 3OJ4B 3VUYA 1V6EA 4W9HA 2KD0A 1UGMA 4W9IA 4WJPA 4NAWA 1ZW7A 4PS7A 2KK8A 4A3PA 2O2VA 1SGHA 4M0WB 3VH4B 3I3TB 3KW5B 1KM7A 2I1JA 2N4FA 4EZLA 1R4NI 4IW0A 4OVVA 2CU1A 1TTNA 4FA6A 3TMPB 2FIFA 5CHFA 1I42A 3NHEB 3ZRFA 2KANA 1NDDA 1GC6A 2RGFA 3ZVVA 4MM3A 3KH0A 1P98A 3HM3A 2GBJA 4DWFA 2MBQA 3DPDA 4IWPA 2REXA 2M8SA 1LM8B 2KKCA 4FLHA 2R2OA 1Z2MA 3HK0A 5DPRA 3DVGY 3QA8A 1QZEA 2JZ3B 3A1QA 4GXBA 2KOXA 2LVOA 4HPLB 2KJRA 1WRDB 2DYBA 2PPHA 3TL5A 1OTRB 1TGZB 2IY1B 2ZZPB 3H1UA 3DBHI 3H6NA 5AZFA 3ENEA 3ZNID 2J7QB 5IA7A 4GB9A 2L05A 2K1FA 2W9NA 4MEMA 2AWTA 5AZGA 2V1YA 2O6VD 1E8XA 1H4RA 2ZCCA 1YIWA 3ZNHB 1Z5SB 2K6DB 5D2MB 1RRBA 4HVBA 3U7DA 2MX2A 4RMAA 4ANUA 4GMVA 1Q0WB 4DHZE 4P7IA 4X57B 3VTUA 1WM3A 4I6PA 4IM3A 2L0TA 2LD9A 2NBUA 2ZNVC 2KX3A 1UBIA 2CHZA 3HHMA 4WJOA 2BPSA 3W1YA 2NVUI 1UELA 4TQ1A 3JW0X 3N3KB 1L7YA 4IWOA 2EMTA 2J0MA 4I6NB 1M94A 4W9EA 2KWVB 2AL3A 5JZEB 3DOWA 4LJPB 3APCA 1WYWB 2DZKA 2MBHA 1I35A 5C1ZA 5CHVC 3KYDD 2JVCA 5JH5C 3Q3JA 1WFYA 3JSVA 1EUVB 1Y8RC 2LGYA 4XX5A 4ICVA 1VCBA 2WX1A 4ZDVA 1YJ1A 5G2NA 4AUQC 3SU8X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4URK A;  3VTV A;  4JL9 A;  1AAR A;  4W9D A;  2ZCB A;  4MJS A;  2KWU B;  2EKE C;  5AZH A;  4NPN A;  4HDO A;  1P1A A;  1WMH A;  2D11 A;  2BYE A;  3VHT C;  1XQQ A;  4FAD A;  3AU5 A;  2G3Q B;  3HIZ A;  4FHJ A;  4NJ7 A;  1BT0 A;  4NQK E;  5J2R A;  3QHT A;  2GMI C;  3CMM B;  3KUC B;  3UIP B;  1WJ4 A;  2MQJ A;  1V2Y A;  3ZKJ C;  3KUZ A;  4FJZ A;  2KDE B;  1EO6 A;  2BYV E;  2MBO A;  3ZDM C;  4EEW A;  5L95 C;  1WZ3 A;  4NQL B;  3ZTC A;  3ZIM A;  4CHK A;  5L83 A;  2ZJD A;  2A5U A;  1E7U A;  3H7P B;  1WE6 A;  4MGY E;  4WJQ A;  2D3G A;  2KXJ A;  3S2A A;  3ML9 A;  4OVU A;  4F8C B;  3CF6 E;  3N30 A;  3L10 B;  3M63 B;  3PTF C;  3VTW A;  3EFU A;  2NBW B;  1E8Y A;  2D2Q A;  4GOC A;  5J17 A;  4G3X B;  2KZR A;  4AOF A;  3A9J A;  3L16 A;  4NAW B;  3TIX A;  1WXV A;  2KLC A;  1E90 A;  2LZ6 A;  2Y5B B;  4ZRJ A;  1V80 A;  3KVF B;  1IP9 A;  4XC2 A;  5JHA A;  1U4A A;  1WH3 A;  2O6V B;  5IAA C;  1WX7 A;  4DXA B;  2D10 A;  1OGW A;  4G11 A;  1SE9 A;  4CYE A;  4KZC A;  1RLF A;  2Z0E B;  2UWQ A;  3A9K A;  4F7Z A;  4CO7 A;  4J6I A;  5DCN A;  4KIK A;  1Q1O A;  3QWZ B;  4WQO B;  3T9L A;  2YLM A;  3LJ3 A;  4ANV A;  2M4N A;  3TCA A;  4ANW A;  3IHP C;  2JPH A;  1C1Y B;  2K25 A;  4W9C A;  4HCP B;  4GDL A;  5E6P A;  2ZVN A;  4EZK A;  2KTR B;  2MCN B;  3V6C B;  2JZZ A;  4II2 B;  3WAP A;  1TZ1 A;  2KQS A;  3CSF A;  3PRE A;  2IO3 B;  4HJK A;  2PJH A;  2K8B A;  3IG3 A;  1V81 A;  4ZRK A;  3RUI B;  2XK5 B;  3PZD A;  4W9F A;  4FBJ B;  4TV3 A;  5LXI B;  3B1L X;  3PVL A;  3AI5 A;  4W9L A;  3LDZ E;  4AP4 C;  2CHW A;  3EHV A;  3PV1 A;  2A4Z A;  4YL8 A;  4ZYN A;  4HPM B;  2IYD B;  1YD8 U;  2LRW A;  2YVC A;  4MEL A;  3PRP B;  3A33 B;  2M17 A;  3PPA A;  4IWQ A;  2LJ5 A;  3SDL C;  2DYM A;  4GGQ A;  3JVZ X;  1J0G A;  2IO1 B;  1GJZ A;  2BKF A;  2GOW A;  2WDT B;  3VH3 B;  2KDB A;  3D32 A;  1GNU A;  3DBR I;  2JUO A;  2L8J A;  5KHO A;  2KDF B;  4BKG A;  4GIV A;  1NBF C;  3T8M A;  2N1V A;  1A5R A;  1UH6 A;  2V3S A;  3L0W B;  2LVQ A;  3AXC A;  3IVF A;  5JHB A;  4BVU C;  2DAJ A;  3QX1 A;  3DDC B;  5FR6 A;  2ZEQ A;  1RFA A;  2Z0D B;  3TBL D;  3SHQ A;  3DQV A;  2HE7 A;  3IBE A;  3RZW C;  2BKR B;  4NNJ B;  3X23 A;  2CS4 A;  2GBN A;  2C5L C;  2KO3 A;  4GN1 A;  4WWP A;  5TR5 A;  1WJ6 A;  4E74 A;  2MWS B;  5E6N A;  4DBG A;  3WA0 A;  1LFD A;  2K6Q A;  1E5W A;  3ZNZ B;  4B6W A;  1WX9 A;  2G45 B;  4GDK B;  4K7W A;  2KN5 A;  3NS8 A;  2KFK B;  2JRH A;  2KJ6 A;  2MBB B;  2N1W A;  1KOT A;  1X1M A;  1P0R A;  4MGZ E;  2ZVO A;  4BKT A;  2M1M A;  2N9P C;  2L7R A;  4TUU A;  3WAL A;  4W9K A;  4G0N B;  3C0R B;  4PYZ A;  2JRI B;  1PQS A;  4BFR A;  2Z59 B;  1WZ0 A;  1WF9 A;  3PHX B;  4W9G A;  1J8C A;  3APF A;  4DHZ B;  2MW5 A;  2V4L A;  2MA9 B;  3DCG A;  3PHW B;  2LGD A;  4BOZ B;  2XEW A;  4A3O A;  5D94 A;  3ONS A;  4GU2 A;  3W1S A;  2RR9 A;  2DZM A;  3SD5 A;  4PS8 A;  4KDI C;  4E3C A;  3UIN B;  1VD2 A;  3V61 A;  4KV2 A;  2HD5 B;  2KFK A;  3PSE B;  3QAQ A;  2KJH B;  4KDL B;  3WAM A;  1V5T A;  4N9F 4;  4HLE A;  3OLM D;  3UGB B;  2ZNV B;  3NOB A;  1UZX B;  4KIK B;  3KUD B;  2J0J A;  2DHZ A;  3WAN A;  3ZNG C;  2HTH A;  5GMV A;  2JT4 B;  2NR2 A;  3AUL A;  4BKS A;  2G4S A;  4DHJ D;  2R2Q A;  1OQY A;  4EKU A;  4ASW C;  1OEY J;  2BWF A;  1V9J A;  2FCQ A;  3Q3F A;  3MTN B;  1WR6 E;  3MJW A;  3WAO A;  4FUL A;  3RT3 B;  4HCN B;  4ICU A;  2LUE A;  4F1S A;  4DDG D;  1WGD A;  4HK2 A;  2GBR A;  4KVG B;  3B0A A;  2FCN A;  2OOB B;  2WWZ A;  2BYF A;  2N7E A;  4GSW A;  4RM9 A;  4DK5 A;  2JXX A;  2KQ7 A;  2CR5 A;  2PE9 A;  3A1Q B;  1IYF A;  2K8H A;  5D6J B;  3B08 A;  2C7H A;  4MH0 E;  2KFJ A;  3K9O B;  1TBE A;  1WXM A;  2AEH A;  3K9P B;  3UF8 A;  4A20 A;  2KNB A;  1WY8 A;  3DVG X;  4MDK E;  3R7R A;  4I6L B;  2LWP A;  2HJ8 A;  2FCS A;  5KHQ A;  2VRR B;  3P2B A;  1KLV A;  3ZTD A;  2LXC A;  1E7V A;  1YX6 B;  3QC8 B;  5E6O A;  2XK5 A;  3DBS A;  1V5O A;  4WWN A;  3A9J B;  3RUL A;  1E8W A;  2FCM A;  2G4D B;  1UD7 A;  4TKN A;  1OEY A;  2C7M B;  3X0W A;  3QQ8 B;  2GBM A;  4JGH B;  2QHO A;  3EEC A;  2BWE S;  1P3Q U;  1NI2 A;  2KDI A;  4W9J A;  1WXS A;  3VXW A;  4M8N A;  3H7P A;  3NZS A;  2NCN A;  1F9J A;  1S1Q B;  2PE6 B;  3L13 A;  3M95 A;  4KSL C;  1K8R B;  2RPQ A;  3M62 B;  5DPT A;  4EZJ A;  2DZJ A;  2B3A A;  2DX5 B;  2I1K A;  2C9W B;  2UYZ B;  1YQB A;  2FAZ A;  4BBN F;  3RCZ A;  4LCD E;  2KX0 A;  4MSQ B;  2FID A;  3IFW B;  1GUA B;  2CKH B;  3ML8 A;  3W1S C;  3WIM A;  2N9E B;  4BBN C;  1XT9 B;  4GDK A;  1WM2 A;  2O6V A;  4ANX A;  2L00 B;  2L3Z A;  3A4R A;  3BIN A;  3V62 A;  2NS5 A;  5CTR C;  4JQW C;  3APD A;  4DHJ B;  3M3J A;  1WGY A;  2KLG A;  2PEA A;  2DAF A;  3HM6 X;  5LLI A;  4FJY A;  5DPW A;  4II3 B;  2KTF A;  4FJV B;  5LXH A;  5G55 A;  3VUW A;  4B9K A;  3QCA A;  2ZPN A;  4B95 A;  3AU4 A;  2IBI B;  2N7D A;  4IG7 B;  4LDT B;  3DVN U;  3VQI A;  2L76 A;  1LXD A;  3DVN V;  3ZDT A;  4TQ0 A;  1C3T A;  3OJ3 A;  2MP2 A;  3PGE A;  1WR1 A;  2LAS A;  1WJN A;  3QK0 A;  1LQB A;  3A4S C;  2WX0 A;  1WIA A;  3TJP A;  3QIJ A;  1UBQ A;  4K7S A;  3RD2 A;  1WGR A;  2K39 A;  3EC8 A;  3OAW A;  5EDS A;  4HDQ A;  2KC2 A;  4G50 A;  5DPS A;  1R4M I;  1WJU A;  1MG8 A;  3H7S A;  2C60 A;  4WJN A;  3MHS D;  4BOS C;  4FN2 A;  3JYU A;  3ZW3 A;  4FHK A;  4DDI D;  3ZRC A;  3ALB A;  4AJY B;  2DYO A;  1E8Z A;  4LDT D;  1WX8 A;  2FNJ B;  4BKS D;  4HXD A;  3PLU A;  2L0F A;  1WMH B;  2WYQ A;  3N32 A;  2KMC A;  4WAA A;  4NY0 A;  3UQA A;  1V49 A;  2GBK A;  4HWI B;  2BF8 B;  1JRU A;  3ZO5 B;  2AYO B;  3PT2 B;  2RD0 A;  3VVW B;  4NJ6 A;  1ISN A;  2IO0 B;  2NPT A;  3GOE A;  1P9D U;  3BY4 B;  2KVR A;  2LRU A;  2D07 B;  3RYT A;  5J18 A;  1IPG A;  1WE7 A;  2MSE D;  1H8C A;  1WGG A;  3O65 B;  2J0K A;  3KYC D;  3PLV A;  3PS6 A;  2KTR A;  3A9K B;  1HE8 A;  2XBB C;  1RAX A;  1YX5 B;  2LVP A;  2OJR A;  2RSU A;  2N9X A;  1T0Y A;  4MGI E;  5CX3 A;  1ZKH A;  4KZ0 A;  1KJT A;  3RZF A;  1ZGU B;  5HKH A;  3VUX A;  1GC7 A;  2DZI A;  4JIO U;  4XZ4 A;  3L54 A;  4IM0 A;  4WWO A;  4PYU A;  4ZRI A;  1L2N A;  2NBV B;  3UQB A;  3PRZ A;  4MGK E;  3L17 A;  2ASQ A;  2MRP A;  4EUT A;  1V86 A;  1J19 A;  2IO2 B;  2IY0 B;  2IZV B;  2AL6 A;  4AWJ A;  4IUM B;  3L08 A;  2KMA A;  4RM8 A;  5BO4 B;  2NPT B;  3V60 A;  3R7Q A;  1CMX B;  2FUH B;  2K8C A;  2KC1 A;  3VFK A;  4EOY A;  1D3Z A;  2C7N B;  1EF1 A;  3R66 C;  4GDL B;  4MJS B;  4MSM B;  4M8M A;  2LI5 A;  2BGF A;  3CST A;  3QJZ A;  2M0X A;  4K81 A;  2MLB A;  1WXA A;  1EF5 A;  3U8Z A;  3V6E B;  3VDZ A;  2LXA A;  4LJO B;  4K1R B;  3GZN I;  3NY5 A;  3NZU A;  3PRM B;  3QAR A;  3UIO B;  2O2V B;  2CHX A;  1WGH A;  2KWC A;  5D7G A;  3JSV B;  2ZPY A;  2MBE A;  1XD3 B;  2JWZ A;  2EMS A;  2DEN B;  2KHW B;  2JF5 A;  1FXT B;  3ECI A;  3H9D A;  1S3S G;  3R3M A;  3DBL I;  4E71 A;  1GG3 A;  1WI0 A;  4JLC A;  4IC7 B;  4KSK C;  2LGX A;  5C23 A;  1G6J A;  3ZUN A;  2JY6 A;  5CHW A;  4PS3 A;  4AJW A;  4EFO A;  3ZLZ A;  1SIF A;  4IM2 A;  1Q5W B;  2MP2 B;  4K7U A;  3U30 A;  3VAW A;  5AEK B;  3OJ4 B;  3VUY A;  1V6E A;  4W9H A;  2KD0 A;  1UGM A;  4W9I A;  4WJP A;  4NAW A;  1ZW7 A;  4PS7 A;  2KK8 A;  4A3P A;  2O2V A;  1SGH A;  4M0W B;  3VH4 B;  3I3T B;  3KW5 B;  1KM7 A;  2I1J A;  2N4F A;  4EZL A;  1R4N I;  4IW0 A;  4OVV A;  2CU1 A;  1TTN A;  4FA6 A;  3TMP B;  2FIF A;  5CHF A;  1I42 A;  3NHE B;  3ZRF A;  2KAN A;  1NDD A;  1GC6 A;  2RGF A;  3ZVV A;  4MM3 A;  3KH0 A;  1P98 A;  3HM3 A;  2GBJ A;  4DWF A;  2MBQ A;  3DPD A;  4IWP A;  2REX A;  2M8S A;  1LM8 B;  2KKC A;  4FLH A;  2R2O A;  1Z2M A;  3HK0 A;  5DPR A;  3DVG Y;  3QA8 A;  1QZE A;  2JZ3 B;  3A1Q A;  4GXB A;  2KOX A;  2LVO A;  4HPL B;  2KJR A;  1WRD B;  2DYB A;  2PPH A;  3TL5 A;  1OTR B;  1TGZ B;  2IY1 B;  2ZZP B;  3H1U A;  3DBH I;  3H6N A;  5AZF A;  3ENE A;  3ZNI D;  2J7Q B;  5IA7 A;  4GB9 A;  2L05 A;  2K1F A;  2W9N A;  4MEM A;  2AWT A;  5AZG A;  2V1Y A;  2O6V D;  1E8X A;  1H4R A;  2ZCC A;  1YIW A;  3ZNH B;  1Z5S B;  2K6D B;  5D2M B;  1RRB A;  4HVB A;  3U7D A;  2MX2 A;  4RMA A;  4ANU A;  4GMV A;  1Q0W B;  4DHZ E;  4P7I A;  4X57 B;  3VTU A;  1WM3 A;  4I6P A;  4IM3 A;  2L0T A;  2LD9 A;  2NBU A;  2ZNV C;  2KX3 A;  1UBI A;  2CHZ A;  3HHM A;  4WJO A;  2BPS A;  3W1Y A;  2NVU I;  1UEL A;  4TQ1 A;  3JW0 X;  3N3K B;  1L7Y A;  4IWO A;  2EMT A;  2J0M A;  4I6N B;  1M94 A;  4W9E A;  2KWV B;  2AL3 A;  5JZE B;  3DOW A;  4LJP B;  3APC A;  1WYW B;  2DZK A;  2MBH A;  1I35 A;  5C1Z A;  5CHV C;  3KYD D;  2JVC A;  5JH5 C;  3Q3J A;  1WFY A;  3JSV A;  1EUV B;  1Y8R C;  2LGY A;  4XX5 A;  4ICV A;  1VCB A;  2WX1 A;  4ZDV A;  1YJ1 A;  5G2N A;  4AUQ C;  3SU8 X; 
#chains in the Genus database with same CATH topology
 1AAR A;  4W9D A;  2RMM A;  3R8B A;  1L6V A;  1ZE3 D;  1XXG A;  1XLO A;  4YWG G;  4NQK E;  3KUC B;  3AE7 B;  2MQJ A;  3N1Y C;  3U7Z A;  2KDE B;  1EO6 A;  1JML A;  5L95 C;  1WZ3 A;  5L83 A;  2ZJD A;  2A5U A;  2J4X A;  2WXM A;  5IO9 A;  1WE6 A;  4MGY E;  4WJQ A;  5EE1 A;  2D3G A;  1ACC A;  4OVU A;  4F8C B;  3CF6 E;  4YSZ B;  3L10 B;  3M63 B;  2QSD A;  5J17 A;  4AOF A;  4NAW B;  1WYG A;  4LNN A;  1IP9 A;  5JHA A;  2J53 A;  2K5P A;  3BVG A;  5IAA C;  2G1E A;  4WIP A;  2D10 A;  4CYE A;  3R2T A;  2WXH A;  2WXO A;  3A9K A;  1ZXH A;  2QMT A;  4WQO B;  1FFV A;  1TY2 A;  4UDU C;  1YQ3 B;  3RI7 C;  3P4R B;  4RF1 A;  4ANV A;  2K25 A;  1MPE A;  2KVZ A;  3Q8A A;  5BYS A;  1SJE D;  3WAP A;  2KQS A;  3CSF A;  1L4Z B;  4HJK A;  2PJH A;  2K8B A;  4ZRK A;  3NS1 A;  3RUI B;  3PZD A;  4FBJ B;  5IKC M;  1P7F A;  3B1L X;  2INP E;  4TSS A;  4YL8 A;  4MT5 A;  1GJZ A;  1MFW A;  2KDB A;  4A9A A;  1TS3 A;  2JUO A;  4XYC A;  2L8J A;  1I4X A;  3T8M A;  2N1V A;  4LLG M;  1JRO A;  2LVQ A;  3AE1 B;  2NTS A;  3QX1 A;  4EE2 A;  5FR6 A;  2HTM E;  2Z0D B;  3SHQ A;  2BKR B;  2INC C;  2KO3 A;  4E74 A;  4BZA A;  5E6N A;  4DBG A;  3ZNZ B;  2OHF A;  4K7W A;  1KOT A;  2N1W A;  1SXT A;  1X1M A;  2ZVO A;  1GOZ A;  4BKT A;  2E6X A;  2L7R A;  3WAL A;  4PYZ A;  2I38 A;  2JRI B;  4DXF A;  1WF9 A;  3P1M A;  4W9G A;  1EWC A;  1J8C A;  3DCG A;  4C7Y A;  3SD5 A;  4RNA A;  2HD5 B;  4KDL B;  3ZJT A;  2ZNV B;  3TEZ A;  3ZNG C;  1ZUD 2;  2JT4 B;  4XDC A;  1UUP A;  1OQY A;  1K50 A;  4D2K A;  2ZW0 A;  3NUH B;  2BWF A;  1V9J A;  1FRR A;  1QQR A;  4FUL A;  3RT3 B;  3VRB B;  4HCN B;  4F1S A;  1M4V A;  3AM9 A;  5FK9 C;  3W9C B;  2OOB B;  3AEF B;  4DK5 A;  2JXX A;  2CR5 A;  1NVI D;  1KH0 A;  1SIJ A;  5D6J B;  3N20 C;  1TBE A;  3GZN B;  3K9P B;  3UF8 A;  2KNB A;  4YTN B;  4A6Q A;  2LMC A;  2VRR B;  5E6O A;  3DBS A;  3NG0 A;  4WWN A;  3AB5 A;  4TKN A;  1FPY A;  1OEY A;  2C7M B;  5FKA C;  2WXL A;  2QHO A;  2BWE S;  1XLP A;  4N6E B;  4M8N A;  1PUT A;  4CQN A;  1KRH A;  1JWB D;  3PZ8 A;  2NCN A;  5AUK A;  1S1Q B;  2WLB A;  3FKY A;  1UNS A;  5DPT A;  3FIL A;  1WWT A;  2UYZ B;  2NTT A;  2FAZ A;  1F2R C;  4RGM A;  3RCZ A;  4LCD E;  1L0X B;  5AUI A;  2V9H A;  2FID A;  2CKH B;  4LNK A;  2L83 A;  1WM2 A;  3A4R A;  2AQ2 B;  2NS5 A;  1FXI A;  4DHJ B;  1WGY A;  2KLG A;  3KQ4 A;  1JWS D;  4FJY A;  4FJV B;  4M0W A;  2EEL A;  4B95 A;  2N7D A;  4LDT B;  4HJG E;  3ZDT A;  1C3T A;  3PGE A;  2LAS A;  4QAY A;  1WJN A;  3QK0 A;  3SFE B;  2VH2 A;  2WX0 A;  1UBQ A;  2XNA C;  4WUR A;  5EDS A;  1XO3 A;  5DPS A;  3AE3 B;  3H7S A;  4WJN A;  2C60 A;  1HTQ A;  3ZW3 A;  3JYU A;  1SBB B;  1D6E C;  1D4B A;  4NY0 A;  2GBK A;  1ROE A;  4ARC A;  1JRU A;  3PT2 B;  2RD0 A;  3VVW B;  2N0S B;  1JRP A;  4RCO A;  1WE7 A;  4YTM B;  2CJO A;  2J0K A;  3KYC D;  3RNC C;  1RAX A;  1YX5 B;  4REZ A;  2LVP A;  2RSU A;  1T0Y A;  3MC8 A;  1QOA A;  3MC0 B;  3RZF A;  1YMH E;  3VUX A;  4XZ4 A;  1FEH A;  2MRP A;  5D3I B;  2IO2 B;  1A70 A;  4AWJ A;  2KMA A;  4RM8 A;  2MHJ A;  5BO4 B;  1OQQ A;  2J42 A;  1D3Z A;  2C7N B;  3R66 C;  4GDL B;  1QKZ A;  3CST A;  4HKQ A;  2MLB A;  3U8Z A;  3NVV A;  3V6E B;  2SEB D;  3VDZ A;  2LXA A;  3BK2 A;  3GZN I;  3UIO B;  2BVC A;  2LGI A;  2O2V B;  3Q14 C;  2CHX A;  5D7G A;  1XD3 B;  1FXT B;  3NZ3 A;  1S3S G;  4AS1 A;  3VR9 B;  5C23 A;  1DOX A;  1MHX A;  3AEA B;  2JY6 A;  5CHW A;  2D3C A;  4AJW A;  4IM2 A;  3U30 A;  3OJ4 B;  4W9H A;  1SE3 A;  1ZW7 A;  4M0W B;  2I1J A;  2N4F A;  4IW0 A;  4NZL B;  3BWU D;  2YEP F;  3TMP B;  1MI0 A;  1NDD A;  1GC6 A;  5MPO A;  4DWF A;  4MM3 A;  1ZDX A;  3KH0 A;  2K3U A;  4IWP A;  2CU3 A;  4KGS A;  1YJJ A;  3O13 A;  2M8S A;  3TEW A;  1LM8 B;  2KKC A;  4C00 A;  2WXJ A;  4GXB A;  4C4V B;  4HPL B;  1WRD B;  1IGC A;  2KJR A;  2PPH A;  1OTR B;  3DBH I;  3ENE A;  2L05 A;  3MP9 A;  2W9N A;  2L32 A;  5AZG A;  5IOI A;  3RNA C;  3BK1 A;  4Q2J A;  2ZCC A;  3DBR B;  4WAF A;  1YIW A;  4HRO A;  1Z5S B;  1RRB A;  1VZ6 A;  3U7D A;  4RMA A;  4ANU A;  4GMV A;  2LFI A;  2W82 A;  4IM3 A;  2L0T A;  1F77 A;  2KX3 A;  1UBI A;  2HJ1 A;  3W1Y A;  2NVU I;  4IWO A;  3JW0 X;  4I6N B;  1YQ4 B;  3BII D;  5BMH A;  1GAQ B;  4LJP B;  5JZE B;  1K53 A;  3AEB B;  2V3P A;  5CHV C;  4M02 A;  3KYD D;  5JH5 C;  3VR8 B;  1L0Y B;  4AQ7 A;  2HDE A;  2K9X A;  4ZDV A;  1YJ1 A;  5EE9 A;  4FXC A;  3AED B;  4AUQ C;  2WHI A;  2KWU B;  4HDO A;  1OQR A;  2QDF A;  3DWM A;  3W2D A;  3AU5 A;  1AWD A;  5C3J B;  2OJW A;  4FHJ A;  1PYW D;  3QHT A;  3CMM B;  4C56 C;  4P1B C;  5H92 C;  2PVO D;  4EEW A;  4NQL B;  3ZIM A;  1L4D B;  2KN4 A;  1UWM A;  1FCC C;  1SE4 A;  2LHD A;  3PTF C;  3VTW A;  1E8Y A;  2D2Q A;  4GOC A;  1ZXI A;  3TIX A;  1WXV A;  1E90 A;  1XEE A;  3I9V 1;  1GB1 A;  2X8X X;  3BYY B;  1SE9 A;  3RNB C;  4ACF A;  2ACZ B;  4HEA 1;  3V3X A;  3ABV B;  4JWS C;  4KIK A;  1Q1O A;  3T9L A;  3RMK C;  2YLM A;  2M4N A;  3TCA A;  2JPH A;  1C1Y B;  2IGG A;  1TKE A;  3SFD B;  3ZYY X;  4II2 B;  4OZA A;  3AH7 A;  2IO3 B;  1EM7 A;  2ON8 A;  1V81 A;  2WU5 B;  2XK5 B;  4TV3 A;  2DNF A;  4W9L A;  3PO0 A;  1FM0 D;  3LDZ E;  1ENF A;  3SEB A;  3PV1 A;  1C76 A;  2PW9 A;  4HPM B;  1YD8 U;  2LRW A;  1Q10 A;  3PRP B;  3A33 B;  2M17 A;  3PPA A;  2LJ5 A;  4GGQ A;  4BAX A;  1BUI C;  3VH3 B;  4A55 A;  2K22 A;  1GNU A;  3DBR I;  5HHD G;  4JE3 B;  2L52 A;  5KHO A;  1TIF A;  1FNU A;  4BKG A;  4GIV A;  5BMG A;  1UH6 A;  3AXC A;  5JHB A;  2DAJ A;  1VR9 A;  3DDC B;  2SAK A;  1RFA A;  1QOG A;  3DQV A;  3IBE A;  3RZW C;  2CS4 A;  3AE6 B;  5TR5 A;  2PLP A;  2KJ6 A;  2IJ0 A;  1P0R A;  2VZK B;  2M1M A;  2N9P C;  3Q8B A;  3AE2 B;  3C0R B;  1YN5 A;  1TKG A;  3BVM A;  1WZ0 A;  3PHX B;  1SE2 A;  2MW5 A;  2AQ1 B;  1YNT E;  4PS8 A;  4E3C A;  1VD2 A;  3V61 A;  4KV2 A;  2H89 B;  3EA6 A;  2KFK A;  3W5U B;  2WXI A;  3WAM A;  4N9F 4;  3OLM D;  3IXS A;  3NOB A;  3RNG C;  2MH7 A;  2J0J A;  2WXN A;  5HI1 A;  5BYQ A;  4HRS A;  3WAN A;  5GMV A;  2NR2 A;  4BKS A;  2DLB A;  4YT0 B;  1ZDV A;  1ZPS A;  1IGD A;  1OEY J;  3Q3F A;  3MTN B;  1WR6 E;  3MJW A;  3WAO A;  2LUE A;  1D5M C;  4DDG D;  2GBR A;  4KVG B;  2WWZ A;  4YXD B;  2N7E A;  2KQ7 A;  3NRZ A;  2PE9 A;  3TUO A;  1IYF A;  2K8H A;  4C7Z A;  4MH0 E;  2KFJ A;  3K9O B;  1FNW A;  4A20 A;  1WY8 A;  3N1X C;  3EFC A;  3R7R A;  2HJ8 A;  4YSX B;  3P2B A;  2LXC A;  1J7A A;  3AE8 B;  1YX6 B;  3OG5 A;  3MHZ A;  1TY0 A;  1DOI A;  3QQ8 B;  2BW2 A;  3NZS A;  1E6E B;  1F9J A;  4A8X C;  3L13 A;  1K8R B;  2RPQ A;  3M62 B;  1E0Z A;  2PTL A;  2KX0 A;  4MSQ B;  3WIM A;  4ZHP A;  1CJE A;  1XT9 B;  4ANX A;  1HTO A;  5GXG B;  3BIN A;  1HQR D;  1SF0 A;  1E10 A;  3M3J A;  1C79 A;  1V1O A;  2DAF A;  5DPW A;  1N5X A;  2KTF A;  5G55 A;  1PFD A;  1E7P B;  2JYE A;  2XN9 C;  3DVN U;  3GB1 A;  3VQI A;  2L76 A;  3DVN V;  1FD6 A;  4TQ0 A;  3OJ3 A;  1LQB A;  3A4S C;  3QIJ A;  3Q8E A;  1R4M I;  1MG8 A;  5IP4 D;  1AYF A;  2KAJ A;  4DDI D;  3ALB A;  4AJY B;  3MC9 A;  4LDT D;  1WX8 A;  2DBY A;  1R7S A;  1J7B A;  2ZW1 A;  3AEC B;  3N32 A;  4WAA A;  1JAL A;  1SEB D;  1QIL A;  3UI3 A;  2IGD A;  1TT5 B;  4NJ6 A;  1ISN A;  2IO0 B;  4OZC A;  3BY4 B;  5EE3 A;  2MSE D;  1H8C A;  1WGG A;  3O65 B;  1UWX A;  3PS6 A;  1TS4 A;  3A9K B;  1WSP A;  1T0R C;  5HKH A;  2DZI A;  4JIO U;  1L2N A;  1QOF A;  4IDI A;  3N1Z C;  1J19 A;  3L08 A;  4RF0 A;  2NPT B;  3V60 A;  3VFK A;  4EOY A;  2JYT A;  1EF1 A;  4MSM B;  3C8Y A;  3QJZ A;  2BGF A;  2M0X A;  2WQY B;  1PDX A;  4B0M A;  3NY5 A;  3RNF C;  1XCQ L;  1WGH A;  3NJT A;  3JSV B;  2KHW B;  3R3M A;  4B0E A;  3BZD B;  3DBL I;  2WXQ A;  1GG3 A;  5LNK 1;  4N58 A;  4IC7 B;  1CQV A;  4EFO A;  2OED A;  3ZLZ A;  1SIF A;  2KDM A;  3VAW A;  1Q5W B;  1RYJ A;  2MP2 B;  1UGM A;  3DBH B;  2JSV X;  3ZQ4 A;  1F52 A;  1SGH A;  3VH4 B;  3KW5 B;  3HUI A;  5JXV A;  5CHF A;  1I42 A;  2RGF A;  4P16 A;  2QC8 A;  4PK1 A;  2MBQ A;  3DPD A;  1VRA B;  2KQ4 X;  1C78 A;  2R2O A;  2JZ3 B;  3DHI C;  5FR3 A;  2JX5 A;  2N7J A;  2KMM A;  3TL5 A;  3H6N A;  1KF6 B;  4US8 A;  1SB3 C;  3LXF A;  3C19 A;  5IA7 A;  1WRI A;  4MEM A;  2AWT A;  2KWD A;  2V1Y A;  2O6V D;  2K0P A;  2Y3A A;  1MJD A;  1VZ8 A;  1V1P A;  1H4R A;  1R4N B;  3ZNH B;  2MX2 A;  1NEK B;  2DWQ A;  1Q0W B;  4KKI A;  1WM3 A;  4I6P A;  1I7H A;  2GI9 A;  2V3N A;  4TQ1 A;  4K3B A;  2Y5P A;  2BB6 A;  2EMT A;  2J0M A;  1M94 A;  2JWU A;  4W9E A;  2KWV B;  4OZB A;  2AL3 A;  4N59 A;  2DZK A;  1I35 A;  3Q3J A;  3JSV A;  4KGR A;  3SR6 A;  2Z8L A;  5G2N A;  3VTV A;  2ZCB A;  4MJS A;  3Q3O C;  2EKE C;  5AZH A;  4NPN A;  2V0G A;  4XE0 A;  1WXQ A;  1L0V B;  1WMH A;  1OFF A;  1XQQ A;  4FAD A;  2G3Q B;  3P4Q B;  1BT0 A;  3I5J C;  5J2R A;  1BXT A;  3UIP B;  1WJ4 A;  3ZKJ C;  4FJZ A;  2BS3 B;  2MBO A;  3ZTC A;  3H7P B;  3T3O A;  3ML9 A;  1NI3 A;  1SJH D;  3FIL B;  3EFU A;  4G3X B;  2KZR A;  3L16 A;  5T8I A;  2LZ6 A;  3KVF B;  2D5G A;  4XC2 A;  1WH3 A;  3W5V B;  2O6V B;  3L4P A;  1JCK B;  4G11 A;  4DXA B;  1RLF A;  4F7Z A;  4J6I A;  3QWZ B;  1I4P A;  4OVZ A;  3V05 A;  3BVZ A;  3MJ5 A;  4ANW A;  2JQR B;  1XLQ A;  4KKJ A;  4HCP B;  2YEP B;  5E6P A;  2ZVN A;  4EZK A;  2KTR B;  1C4A A;  4M00 A;  3IG3 A;  1DGJ A;  4USA A;  5LXI B;  3PVL A;  3AI5 A;  4AP4 C;  2BTE A;  2CHW A;  2A4Z A;  2IYD B;  2YVC A;  2DYM A;  1LGR A;  3JVZ X;  3CIR B;  3FAH A;  3P4S B;  2LEK A;  1IBX A;  1JWU D;  2WDT B;  4S17 A;  1EWY C;  2MJ3 A;  4LTU A;  1NBF C;  2RDH A;  1A5R A;  2V3S A;  4WQM A;  4BVU C;  3BYT B;  2HE7 A;  3X23 A;  4P6V F;  3WCQ A;  5TSS A;  2K6Q A;  4B6W A;  2G45 B;  2LHE A;  1I4R A;  2KN5 A;  2KFK B;  2JRH A;  2MBB B;  1UGJ A;  4MGZ E;  1FXA A;  2VH1 A;  4W9K A;  4BFR A;  2R61 A;  1RWS A;  4BOZ B;  2MA9 B;  3PHW B;  4A3O A;  5D94 A;  3ONS A;  2M0A A;  4M01 A;  2RR9 A;  3W1S A;  2DZM A;  1QF6 A;  1HEZ E;  2KJH B;  3IAS 1;  5C2T B;  4HLE A;  1FCL A;  3UGB B;  3PZ7 A;  4C80 A;  3Q8F A;  4KIK B;  1AW7 A;  3HRD D;  1L5P A;  2HTH A;  1HZ6 A;  2G4S A;  2QJL A;  4K3C A;  3B2F A;  4DHJ D;  2R2Q A;  4EKU A;  2FCQ A;  1QOB A;  2E3T A;  2RPV A;  1XLN A;  2FE8 A;  1V8C A;  4HK2 A;  3B0A A;  2BYF A;  1LO5 D;  1F1H A;  1IBX B;  3A1Q B;  4NAM A;  3B08 A;  3TEX A;  3URY A;  2C7H A;  2LJI A;  3Q2A C;  3DVG X;  4MDK E;  2LWP A;  2BS2 B;  1GB4 A;  1KLV A;  1VLB A;  5E6J A;  3ZTD A;  1ZOY B;  3QC8 B;  2JZP A;  3KWV A;  2I2Y A;  2GRI A;  1V5O A;  3A9J B;  3RUL A;  1E8W A;  1RM6 C;  1UD7 A;  5BYR A;  4JGH B;  1P3Q U;  2KDI A;  3B9J A;  4W9J A;  1WXS A;  2KT7 A;  4LNI A;  2WXP A;  3M95 A;  4KSL C;  4J3O D;  4EZJ A;  2GB1 A;  2I1K A;  2C9W B;  4RGN A;  1YQB A;  1I4H A;  3E56 A;  3ML8 A;  2N9E B;  4BBN C;  4GDK A;  2O6V A;  3IT4 B;  2L3Z A;  1ET6 A;  4ZHO A;  5CTR C;  2BYT A;  4ZRP A;  1KLU D;  2PEA A;  3HM6 X;  4XGA B;  3VUW A;  1WGK A;  2ZPN A;  3QCA A;  4IG7 B;  1ZP0 B;  3P4P B;  2MP2 A;  1C4C A;  3TJP A;  4K7S A;  3EC8 A;  3U4E G;  2KC2 A;  4G50 A;  4C4V A;  1T3Q A;  1C4P A;  1KFY B;  2G9H D;  4FN2 A;  4FHK A;  2TSS A;  3ZRC A;  1E8Z A;  4BKS D;  4HXD A;  3U2S C;  2PKO A;  3UQA A;  1V49 A;  1MHH E;  2FBW B;  3TSS A;  2NPT A;  3GOE A;  1P9D U;  2KVR A;  3FC4 A;  2LRU A;  4O1N A;  2D07 B;  3H8H A;  3AEG B;  1MVK A;  1P7E A;  1HE8 A;  3RN9 C;  2OJR A;  2Y5C A;  4HPP A;  4MGI E;  4WWM A;  1F0Z A;  1KJT A;  3Q69 A;  4XWW A;  1ZGU B;  1GC7 A;  1PGX A;  3L54 A;  4IM0 A;  4ZRI A;  4PYU A;  3UQB A;  4DXG A;  3L17 A;  2ASQ A;  2IY0 B;  4IUM B;  3P63 A;  3R7Q A;  2K8C A;  4MJS B;  4M8M A;  2LI5 A;  4K81 A;  1EF5 A;  4LJO B;  3QAR A;  3NZU A;  2LUM A;  2ZPY A;  2MBE A;  3H9D A;  2DEN B;  2JF5 A;  3ECI A;  4DQO C;  2Q5W D;  4RFB A;  2MEK A;  3GP7 A;  4JLC A;  4GLS C;  1FFU A;  2LGX A;  4H2A A;  3ZUN A;  4MM3 B;  4PS3 A;  3VUY A;  1V6E A;  4W9I A;  4WJP A;  2H88 B;  2CJN A;  4PS7 A;  2KK8 A;  4ZOH C;  4A3P A;  2J52 A;  2O2V A;  4OW0 A;  3I3T B;  1KM7 A;  4EZL A;  4OHJ A;  4OVV A;  1B9R A;  1HA5 A;  1TTN A;  2IND C;  2FIF A;  3ZRF A;  3ZVV A;  2BS4 B;  2GBJ A;  4XWT A;  4HKZ E;  2REX A;  4FLH A;  1Z2M A;  3DVG Y;  3QA8 A;  3DHH C;  1QZE A;  3AE4 B;  2LVO A;  3WA0 A;  3H1U A;  4YTP B;  1VDV A;  2MJE A;  2J7Q B;  1DOY A;  2K1F A;  4RGT A;  3AMZ A;  1E8X A;  3NVZ A;  1GPX A;  2IDY A;  2K6D B;  5D2M B;  5EE0 A;  4DHZ E;  4P7I A;  4X57 B;  4ARI A;  1UF0 A;  2LD9 A;  2PIA A;  2NBU A;  4R3D A;  3HHM A;  4WJO A;  2WXF A;  2BPS A;  2JXT A;  2NMQ A;  2WDQ B;  3DHG C;  1UEL A;  3HVZ A;  1L7Y A;  2M19 A;  1AN8 A;  3DOW A;  3APC A;  1WYW B;  5C1Z A;  1WFY A;  1Y8R C;  1N62 A;  4ICV A;  2WX1 A;  1ET9 A;  2PVG C;  4XX5 A;  1MG4 A;  2W3S A;  4URK A;  4JL9 A;  4LNF A;  1P1A A;  2D11 A;  2BYE A;  1K51 A;  3VHT C;  3NVY A;  3ZJV A;  3HIZ A;  4NJ7 A;  3ZXR A;  1T5X D;  1HXY D;  2GMI C;  5HFY A;  4KGT A;  1V2Y A;  3KUZ A;  4IOI E;  1FIQ A;  2BYV E;  3ZDM C;  2EKI A;  1N60 A;  4CHK A;  1E7U A;  2KXJ A;  4LNO A;  3S2A A;  3N30 A;  3TEY A;  2WDV B;  2NBW B;  1F2R I;  3A9J A;  2KLC A;  1N5W A;  2Y5B B;  2RDB C;  4ZRJ A;  1V80 A;  1U4A A;  2ICI A;  1J7C A;  1WX7 A;  1OGW A;  4KZC A;  1NYQ A;  2Z0E B;  2UWQ A;  4CO7 A;  5DCN A;  3LJ3 A;  1TKY A;  3IHP C;  4L23 A;  1I4G A;  4YSY B;  3DWG C;  4W9C A;  4GDL A;  4RGO S;  2MCN B;  4L1B A;  3V6C B;  2JZZ A;  3CWI A;  3ZJU A;  1TZ1 A;  3PRE A;  4W9F A;  3Q3M C;  1DYQ A;  3EHV A;  4ZYN A;  1VJK A;  4MEL A;  4IWQ A;  3SDL C;  1N6Z A;  3NVW A;  1J0G A;  2IO1 B;  3IAM 1;  2BKF A;  2GOW A;  1NYR A;  1VZ7 A;  3D32 A;  2KDF B;  1SSN A;  1YN3 A;  1TS5 A;  1QLB B;  3R2I A;  3L0W B;  3HVD A;  3IVF A;  2UU7 A;  4S0R A;  2ZEQ A;  3TBL D;  2N9K A;  2W55 A;  4NNJ B;  4GN1 A;  2GBN A;  2C5L C;  4WWP A;  5G5H A;  1WJ6 A;  2BBC A;  2MWS B;  4JWU C;  1LFD A;  4JX1 C;  1E5W A;  3KWL A;  1WX9 A;  4GDK B;  3NS8 A;  3LYY A;  1FMA D;  4RH6 A;  4LK0 M;  2PMV A;  1PGB A;  4TUU A;  4G0N B;  1PQS A;  2Z59 B;  3Q8C A;  3APF A;  4DHZ B;  2V4L A;  3ETR A;  2LGD A;  2XEW A;  3I63 C;  4GU2 A;  3OWE B;  4KDI C;  3UIN B;  1K52 A;  3QAQ A;  3PSE B;  1V5T A;  1D5Z C;  1CK1 A;  1L6U A;  1UZX B;  3KUD B;  2DHZ A;  2D3A A;  2L1A A;  2QIE B;  3AUL A;  2WGS A;  1HZ5 A;  2X38 A;  4ASW C;  4XDD A;  3RFZ B;  1TJE A;  1YOV B;  4ICU A;  1T0Q C;  1WGD A;  2FCN A;  4GSW A;  4RM9 A;  1CZP A;  1EU3 A;  4L2Y A;  5I4D A;  2WP9 B;  1WXM A;  4WH4 A;  2AEH A;  1RFK A;  1N61 A;  3EUB 2;  4I6L B;  2KYW A;  2FCS A;  5KHQ A;  1E7V A;  1TYG B;  2XK5 A;  1NEN B;  2FCM A;  2G4D B;  2AQ3 B;  3X0W A;  2GBM A;  2VZK D;  3EEC A;  1NI2 A;  3VXW A;  2MJD A;  3H7P A;  5BMI A;  2PE6 B;  2DZJ A;  2B3A A;  2DX5 B;  5H8Y E;  1JW9 D;  3E9S A;  2QCZ A;  4BBN F;  4A90 A;  1EU4 A;  3IFW B;  3W1S C;  1GUA B;  2D3B A;  2WU2 B;  3P42 A;  1XF5 L;  2L00 B;  2GLS A;  3V62 A;  1TS2 A;  4JQW C;  3APD A;  5LLI A;  3U52 E;  3MFG A;  3GS2 A;  4II3 B;  5LXH A;  1Y56 A;  4B9K A;  3AU4 A;  2IBI B;  1LXD A;  1FRD A;  1WR1 A;  2IGH A;  3ZXV A;  1WIA A;  3IT6 B;  2BQQ A;  3RD2 A;  1WGR A;  2K39 A;  3OAW A;  4HDQ A;  1WJU A;  2BT6 A;  3MHS D;  4BOS C;  2QEJ C;  1ESF A;  2DYO A;  2FNJ B;  3RPF C;  1JWA D;  3VRA B;  4P1C C;  3PLU A;  1TZO A;  1WMH B;  2L0F A;  2WYQ A;  2KMC A;  1N63 A;  1STE A;  1V1P B;  2FUG 1;  4HWI B;  2BF8 B;  3ZO5 B;  2AYO B;  1C9F A;  1KTK A;  3Q3N C;  3B2G A;  3RYT A;  5J18 A;  2ONQ A;  4JPS A;  1IPG A;  4US9 A;  2WXG A;  3PLV A;  2KTR A;  1T0S C;  2M56 B;  2XBB C;  2WDR B;  5G5G A;  4ZYS A;  2AX5 A;  2N9X A;  3LB8 C;  3I57 A;  5CX3 A;  2IPK D;  1ZKH A;  4KZ0 A;  1JQ4 A;  4MH8 A;  4WWO A;  4KX6 B;  2NBV B;  1V97 A;  1C77 A;  1KLG D;  3PRZ A;  4MGK E;  1IUE A;  4EUT A;  1V86 A;  1FO4 A;  2IZV B;  2AL6 A;  4MAC A;  2B76 B;  1CMX B;  2FUH B;  2KC1 A;  3AN1 A;  1WXA A;  4TMA B;  2KAC A;  3J9C A;  5D3D A;  4K1R B;  1XCT L;  3PRM B;  2RDG A;  2KWC A;  2JWZ A;  1B1Z A;  1R4M B;  2EMS A;  2WXK A;  4E71 A;  1WI0 A;  4KSK C;  3N9Y C;  1G6J A;  3AEE B;  2V4I B;  3T3N A;  4K7U A;  5AEK B;  2QIL A;  2KD0 A;  2N9L A;  4NAW A;  3EGR A;  3GE3 C;  4NJC A;  1I4Q A;  1R4N I;  2CU1 A;  4FA6 A;  3NHE B;  2KAN A;  1YN4 A;  1P98 A;  3HM3 A;  1FNV A;  2INN E;  4ITK A;  3DBL B;  1QT9 A;  2WXR A;  3HK0 A;  5DPR A;  3A1Q A;  2KOX A;  3Q6B A;  2DYB A;  2IY1 B;  1TGZ B;  2ZZP B;  5AZF A;  2W54 A;  3ZNI D;  4GB9 A;  3GE8 C;  5HG2 A;  3KLS X;  5IN7 A;  1JWM D;  2W3R A;  3RNE C;  3AE9 B;  4HVB A;  1PGA A;  3AE5 B;  1BML C;  3VTU A;  2ZNV C;  1E9M A;  2CHZ A;  2JU6 X;  3N3K B;  1YJI A;  1D5X C;  2LGS A;  2BB5 A;  2MBH A;  4IKG A;  2WS3 B;  2JVC A;  3ZGZ A;  1EUV B;  2LGY A;  1T6B X;  3AV8 A;  1VCB A;  2WNM A;  4ZRQ A;  4PT5 A;  3SU8 X; 
#chains in the Genus database with same CATH homology
 4URK A;  3VTV A;  4JL9 A;  1AAR A;  4W9D A;  2ZCB A;  4MJS A;  2KWU B;  2EKE C;  5AZH A;  4NPN A;  4HDO A;  1P1A A;  1WMH A;  2D11 A;  2BYE A;  3VHT C;  1XQQ A;  4FAD A;  3AU5 A;  2G3Q B;  3HIZ A;  4FHJ A;  4NJ7 A;  1BT0 A;  4NQK E;  5J2R A;  3QHT A;  2GMI C;  3CMM B;  3KUC B;  3UIP B;  1WJ4 A;  2MQJ A;  1V2Y A;  3ZKJ C;  3KUZ A;  4FJZ A;  2KDE B;  1EO6 A;  2BYV E;  2MBO A;  3ZDM C;  4EEW A;  5L95 C;  1WZ3 A;  4NQL B;  3ZTC A;  3ZIM A;  4CHK A;  5L83 A;  2ZJD A;  2A5U A;  1E7U A;  3H7P B;  1WE6 A;  4MGY E;  4WJQ A;  2D3G A;  2KXJ A;  3S2A A;  3ML9 A;  4OVU A;  4F8C B;  3CF6 E;  3N30 A;  3L10 B;  3M63 B;  3PTF C;  3VTW A;  3EFU A;  2NBW B;  1E8Y A;  2D2Q A;  4GOC A;  5J17 A;  4G3X B;  2KZR A;  4AOF A;  3A9J A;  3L16 A;  4NAW B;  3TIX A;  1WXV A;  2KLC A;  1E90 A;  2LZ6 A;  2Y5B B;  4ZRJ A;  1V80 A;  3KVF B;  1IP9 A;  4XC2 A;  5JHA A;  1U4A A;  1WH3 A;  2O6V B;  5IAA C;  1WX7 A;  4DXA B;  2D10 A;  1OGW A;  4G11 A;  1SE9 A;  4CYE A;  4KZC A;  1RLF A;  2Z0E B;  2UWQ A;  3A9K A;  4F7Z A;  4CO7 A;  4J6I A;  5DCN A;  4KIK A;  1Q1O A;  3QWZ B;  4WQO B;  3T9L A;  2YLM A;  3LJ3 A;  4ANV A;  2M4N A;  3TCA A;  4ANW A;  3IHP C;  2JPH A;  1C1Y B;  2K25 A;  4W9C A;  4HCP B;  4GDL A;  5E6P A;  2ZVN A;  4EZK A;  2KTR B;  2MCN B;  3V6C B;  2JZZ A;  4II2 B;  3WAP A;  1TZ1 A;  2KQS A;  3CSF A;  3PRE A;  2IO3 B;  4HJK A;  2PJH A;  2K8B A;  3IG3 A;  1V81 A;  4ZRK A;  3RUI B;  2XK5 B;  3PZD A;  4W9F A;  4FBJ B;  4TV3 A;  5LXI B;  3B1L X;  3PVL A;  3AI5 A;  4W9L A;  3LDZ E;  4AP4 C;  2CHW A;  3EHV A;  3PV1 A;  2A4Z A;  4YL8 A;  4ZYN A;  4HPM B;  2IYD B;  1YD8 U;  2LRW A;  2YVC A;  4MEL A;  3PRP B;  3A33 B;  2M17 A;  3PPA A;  4IWQ A;  2LJ5 A;  3SDL C;  2DYM A;  4GGQ A;  3JVZ X;  1J0G A;  2IO1 B;  1GJZ A;  2BKF A;  2GOW A;  2WDT B;  3VH3 B;  2KDB A;  3D32 A;  1GNU A;  3DBR I;  2JUO A;  2L8J A;  5KHO A;  2KDF B;  4BKG A;  4GIV A;  1NBF C;  3T8M A;  2N1V A;  1A5R A;  1UH6 A;  2V3S A;  3L0W B;  2LVQ A;  3AXC A;  3IVF A;  5JHB A;  4BVU C;  2DAJ A;  3QX1 A;  3DDC B;  5FR6 A;  2ZEQ A;  1RFA A;  2Z0D B;  3TBL D;  3SHQ A;  3DQV A;  2HE7 A;  3IBE A;  3RZW C;  2BKR B;  4NNJ B;  3X23 A;  2CS4 A;  2GBN A;  2C5L C;  2KO3 A;  4GN1 A;  4WWP A;  5TR5 A;  1WJ6 A;  4E74 A;  2MWS B;  5E6N A;  4DBG A;  3WA0 A;  1LFD A;  2K6Q A;  1E5W A;  3ZNZ B;  4B6W A;  1WX9 A;  2G45 B;  4GDK B;  4K7W A;  2KN5 A;  3NS8 A;  2KFK B;  2JRH A;  2KJ6 A;  2MBB B;  2N1W A;  1KOT A;  1X1M A;  1P0R A;  4MGZ E;  2ZVO A;  4BKT A;  2M1M A;  2N9P C;  2L7R A;  4TUU A;  3WAL A;  4W9K A;  4G0N B;  3C0R B;  4PYZ A;  2JRI B;  1PQS A;  4BFR A;  2Z59 B;  1WZ0 A;  1WF9 A;  3PHX B;  4W9G A;  1J8C A;  3APF A;  4DHZ B;  2MW5 A;  2V4L A;  2MA9 B;  3DCG A;  3PHW B;  2LGD A;  4BOZ B;  2XEW A;  4A3O A;  5D94 A;  3ONS A;  4GU2 A;  3W1S A;  2RR9 A;  2DZM A;  3SD5 A;  4PS8 A;  4KDI C;  4E3C A;  3UIN B;  1VD2 A;  3V61 A;  4KV2 A;  2HD5 B;  2KFK A;  3PSE B;  3QAQ A;  2KJH B;  4KDL B;  3WAM A;  1V5T A;  4N9F 4;  4HLE A;  3OLM D;  3UGB B;  2ZNV B;  3NOB A;  1UZX B;  4KIK B;  3KUD B;  2J0J A;  2DHZ A;  3WAN A;  3ZNG C;  2HTH A;  5GMV A;  2JT4 B;  2NR2 A;  3AUL A;  4BKS A;  2G4S A;  4DHJ D;  2R2Q A;  1OQY A;  4EKU A;  4ASW C;  1OEY J;  2BWF A;  1V9J A;  2FCQ A;  3Q3F A;  3MTN B;  1WR6 E;  3MJW A;  3WAO A;  4FUL A;  3RT3 B;  4HCN B;  4ICU A;  2LUE A;  4F1S A;  4DDG D;  1WGD A;  4HK2 A;  2GBR A;  4KVG B;  3B0A A;  2FCN A;  2OOB B;  2WWZ A;  2BYF A;  2N7E A;  4GSW A;  4RM9 A;  4DK5 A;  2JXX A;  2KQ7 A;  2CR5 A;  2PE9 A;  3A1Q B;  1IYF A;  2K8H A;  5D6J B;  3B08 A;  2C7H A;  4MH0 E;  2KFJ A;  3K9O B;  1TBE A;  1WXM A;  2AEH A;  3K9P B;  3UF8 A;  4A20 A;  2KNB A;  1WY8 A;  3DVG X;  4MDK E;  3R7R A;  4I6L B;  2LWP A;  2HJ8 A;  2FCS A;  5KHQ A;  2VRR B;  3P2B A;  1KLV A;  3ZTD A;  2LXC A;  1E7V A;  1YX6 B;  3QC8 B;  5E6O A;  2XK5 A;  3DBS A;  1V5O A;  4WWN A;  3A9J B;  3RUL A;  1E8W A;  2FCM A;  2G4D B;  1UD7 A;  4TKN A;  1OEY A;  2C7M B;  3X0W A;  3QQ8 B;  2GBM A;  4JGH B;  2QHO A;  3EEC A;  2BWE S;  1P3Q U;  1NI2 A;  2KDI A;  4W9J A;  1WXS A;  3VXW A;  4M8N A;  3H7P A;  3NZS A;  2NCN A;  1F9J A;  1S1Q B;  2PE6 B;  3L13 A;  3M95 A;  4KSL C;  1K8R B;  2RPQ A;  3M62 B;  5DPT A;  4EZJ A;  2DZJ A;  2B3A A;  2DX5 B;  2I1K A;  2C9W B;  2UYZ B;  1YQB A;  2FAZ A;  4BBN F;  3RCZ A;  4LCD E;  2KX0 A;  4MSQ B;  2FID A;  3IFW B;  1GUA B;  2CKH B;  3ML8 A;  3W1S C;  3WIM A;  2N9E B;  4BBN C;  1XT9 B;  4GDK A;  1WM2 A;  2O6V A;  4ANX A;  2L00 B;  2L3Z A;  3A4R A;  3BIN A;  3V62 A;  2NS5 A;  5CTR C;  4JQW C;  3APD A;  4DHJ B;  3M3J A;  1WGY A;  2KLG A;  2PEA A;  2DAF A;  3HM6 X;  5LLI A;  4FJY A;  5DPW A;  4II3 B;  2KTF A;  4FJV B;  5LXH A;  5G55 A;  3VUW A;  4B9K A;  3QCA A;  2ZPN A;  4B95 A;  3AU4 A;  2IBI B;  2N7D A;  4IG7 B;  4LDT B;  3DVN U;  3VQI A;  2L76 A;  1LXD A;  3DVN V;  3ZDT A;  4TQ0 A;  1C3T A;  3OJ3 A;  2MP2 A;  3PGE A;  1WR1 A;  2LAS A;  1WJN A;  3QK0 A;  1LQB A;  3A4S C;  2WX0 A;  1WIA A;  3TJP A;  3QIJ A;  1UBQ A;  4K7S A;  3RD2 A;  1WGR A;  2K39 A;  3EC8 A;  3OAW A;  5EDS A;  4HDQ A;  2KC2 A;  4G50 A;  5DPS A;  1R4M I;  1WJU A;  1MG8 A;  3H7S A;  2C60 A;  4WJN A;  3MHS D;  4BOS C;  4FN2 A;  3JYU A;  3ZW3 A;  4FHK A;  4DDI D;  3ZRC A;  3ALB A;  4AJY B;  2DYO A;  1E8Z A;  4LDT D;  1WX8 A;  2FNJ B;  4BKS D;  4HXD A;  3PLU A;  2L0F A;  1WMH B;  2WYQ A;  3N32 A;  2KMC A;  4WAA A;  4NY0 A;  3UQA A;  1V49 A;  2GBK A;  4HWI B;  2BF8 B;  1JRU A;  3ZO5 B;  2AYO B;  3PT2 B;  2RD0 A;  3VVW B;  4NJ6 A;  1ISN A;  2IO0 B;  2NPT A;  3GOE A;  1P9D U;  3BY4 B;  2KVR A;  2LRU A;  2D07 B;  3RYT A;  5J18 A;  1IPG A;  1WE7 A;  2MSE D;  1H8C A;  1WGG A;  3O65 B;  2J0K A;  3KYC D;  3PLV A;  3PS6 A;  2KTR A;  3A9K B;  1HE8 A;  2XBB C;  1RAX A;  1YX5 B;  2LVP A;  2OJR A;  2RSU A;  2N9X A;  1T0Y A;  4MGI E;  5CX3 A;  1ZKH A;  4KZ0 A;  1KJT A;  3RZF A;  1ZGU B;  5HKH A;  3VUX A;  1GC7 A;  2DZI A;  4JIO U;  4XZ4 A;  3L54 A;  4IM0 A;  4WWO A;  4PYU A;  4ZRI A;  1L2N A;  2NBV B;  3UQB A;  3PRZ A;  4MGK E;  3L17 A;  2ASQ A;  2MRP A;  4EUT A;  1V86 A;  1J19 A;  2IO2 B;  2IY0 B;  2IZV B;  2AL6 A;  4AWJ A;  4IUM B;  3L08 A;  2KMA A;  4RM8 A;  5BO4 B;  2NPT B;  3V60 A;  3R7Q A;  1CMX B;  2FUH B;  2K8C A;  2KC1 A;  3VFK A;  4EOY A;  1D3Z A;  2C7N B;  1EF1 A;  3R66 C;  4GDL B;  4MJS B;  4MSM B;  4M8M A;  2LI5 A;  2BGF A;  3CST A;  3QJZ A;  2M0X A;  4K81 A;  2MLB A;  1WXA A;  1EF5 A;  3U8Z A;  3V6E B;  3VDZ A;  2LXA A;  4LJO B;  4K1R B;  3GZN I;  3NY5 A;  3NZU A;  3PRM B;  3QAR A;  3UIO B;  2O2V B;  2CHX A;  1WGH A;  2KWC A;  5D7G A;  3JSV B;  2ZPY A;  2MBE A;  1XD3 B;  2JWZ A;  2EMS A;  2DEN B;  2KHW B;  2JF5 A;  1FXT B;  3ECI A;  3H9D A;  1S3S G;  3R3M A;  3DBL I;  4E71 A;  1GG3 A;  1WI0 A;  4JLC A;  4IC7 B;  4KSK C;  2LGX A;  5C23 A;  1G6J A;  3ZUN A;  2JY6 A;  5CHW A;  4PS3 A;  4AJW A;  4EFO A;  3ZLZ A;  1SIF A;  4IM2 A;  1Q5W B;  2MP2 B;  4K7U A;  3U30 A;  3VAW A;  5AEK B;  3OJ4 B;  3VUY A;  1V6E A;  4W9H A;  2KD0 A;  1UGM A;  4W9I A;  4WJP A;  4NAW A;  1ZW7 A;  4PS7 A;  2KK8 A;  4A3P A;  2O2V A;  1SGH A;  4M0W B;  3VH4 B;  3I3T B;  3KW5 B;  1KM7 A;  2I1J A;  2N4F A;  4EZL A;  1R4N I;  4IW0 A;  4OVV A;  2CU1 A;  1TTN A;  4FA6 A;  3TMP B;  2FIF A;  5CHF A;  1I42 A;  3NHE B;  3ZRF A;  2KAN A;  1NDD A;  1GC6 A;  2RGF A;  3ZVV A;  4MM3 A;  3KH0 A;  1P98 A;  3HM3 A;  2GBJ A;  4DWF A;  2MBQ A;  3DPD A;  4IWP A;  2REX A;  2M8S A;  1LM8 B;  2KKC A;  4FLH A;  2R2O A;  1Z2M A;  3HK0 A;  5DPR A;  3DVG Y;  3QA8 A;  1QZE A;  2JZ3 B;  3A1Q A;  4GXB A;  2KOX A;  2LVO A;  4HPL B;  2KJR A;  1WRD B;  2DYB A;  2PPH A;  3TL5 A;  1OTR B;  1TGZ B;  2IY1 B;  2ZZP B;  3H1U A;  3DBH I;  3H6N A;  5AZF A;  3ENE A;  3ZNI D;  2J7Q B;  5IA7 A;  4GB9 A;  2L05 A;  2K1F A;  2W9N A;  4MEM A;  2AWT A;  5AZG A;  2V1Y A;  2O6V D;  1E8X A;  1H4R A;  2ZCC A;  1YIW A;  3ZNH B;  1Z5S B;  2K6D B;  5D2M B;  1RRB A;  4HVB A;  3U7D A;  2MX2 A;  4RMA A;  4ANU A;  4GMV A;  1Q0W B;  4DHZ E;  4P7I A;  4X57 B;  3VTU A;  1WM3 A;  4I6P A;  4IM3 A;  2L0T A;  2LD9 A;  2NBU A;  2ZNV C;  2KX3 A;  1UBI A;  2CHZ A;  3HHM A;  4WJO A;  2BPS A;  3W1Y A;  2NVU I;  1UEL A;  4TQ1 A;  3JW0 X;  3N3K B;  1L7Y A;  4IWO A;  2EMT A;  2J0M A;  4I6N B;  1M94 A;  4W9E A;  2KWV B;  2AL3 A;  5JZE B;  3DOW A;  4LJP B;  3APC A;  1WYW B;  2DZK A;  2MBH A;  1I35 A;  5C1Z A;  5CHV C;  3KYD D;  2JVC A;  5JH5 C;  3Q3J A;  1WFY A;  3JSV A;  1EUV B;  1Y8R C;  2LGY A;  4XX5 A;  4ICV A;  1VCB A;  2WX1 A;  4ZDV A;  1YJ1 A;  5G2N A;  4AUQ C;  3SU8 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...