4AKMA

Crystal structure of the human lysosome-associated membrane protein lamp-3 (aka dc-lamp)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
155
structure length
155
Chain Sequence
b'VKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETVYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LYSOSOME-ASSOCIATED MEMBRANE GLYCOPROTEIN 3
publication title Crystal Structure of the Conserved Domain of the Dc Lysosomal Associated Membrane Protein: Implications for the Lysosomal Glycocalyx.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 22
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01299 Lamp Lysosome-associated membrane glycoprotein (Lamp)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.110 Mainly Beta Beta Barrel Porin Porin 4akmA00
4AKMA 5GV0A
chains in the Genus database with same CATH superfamily
3A0BO 3A0HO 1ORMA 3AA7A 4O49A 1GFQA 5DL6A 4FUVA 2ODJA 3HW9A 4AKRA 4AZLA 2XE1A 4O3YA 4FZNA 2KXPB 4RLCA 4E1SA 4XNLA 1Q9FA 2F1TA 1GFNA 4AKMA 1ZHZA 4N59A 5AFUL 4E1TA 5GV0A 2M06A 3PGRA 4RL9A 3DZMA 4AYEC 1T16A 3AA1B 5H2FO 4U9CA 4O3XB 4PR7A 1YS5A 3GP6A 3VZWX 7PRNA 2OMFA 1QJ9A 5ADXL 4FSPA 3KZIO 4KR8A 4FOZA 8PRNA 3O0EA 2F1VA 4RLBA 3AAEB 4PJ0O 5FVNA 2LFUA 4LSIA 2ERVA 2R4OA 2XTQA 2YPVA 3AAAA 3T20A 2F1CX 2K0LA 1QJPA 1HXTA 2LHFA 2KDYA 4FRXA 3T0SA 3TZGA 2W80C 4GCPA 4LSFA 3AA6A 2KZ7B 1ZHYA 2R8AA 3SYSA 3JTYA 2Y0HA 4XNKA 5DL7A 5PRNA 3WI5A 1IZNA 2PRNA 1GFMA 1HXXA 3AA0A 3SYBA 2KXPA 2Y0LA 3NJTA 3DA3A 3WI4A 4AYDC 4AUIA 4GHBA 2J1NA 4FQEA 1MPFA 2O4VA 3FYXA 5D5DA 4AYMC 1GFOA 3BRZA 4AYNA 2YNKA 2N2LA 3K19A 3DA4A 5G26A 4AYID 4C4VA 3A2SX 3JCUO 3VY9X 4QQ1A 2WVPA 5AFUK 6PRNA 1THQA 4KR4A 4G76A 2N2MA 5B5EO 2GE4A 3UAQA 1E54A 3LK3B 4GCQA 4N75A 2WJRA 3SZVA 3QRAA 3BS0A 3HWBA 1P4TA 4O3WA 4D5UA 5ADXK 2KZ7A 4LSHA 2R89A 2W81C 3SZDA 4CTDA 4G75A 4JFBA 4AKRB 3VZUX 1GFPA 1PRNA 2FGRA 2XMXA 1ZHWA 3LK2B 2XE3A 4N58A 2XTRA 2Y0KA 5TISO 4BUMX 1Q9GA 3BRYA 4FZLA 1MM4A 5GTIO 4GF4A 2M07A 2QTKA 3POQA 3AA1A 3C5OA 1OPFA 4D65A 5JDPA 2ZLDA 5KAFO 4RJWA 1BH3A 1HXUA 1PHOA 1QJ8A 1ZHTA 1ZHXA 3LK41 3EMNX 5DL5A 4FT6A 3VE2A 4FRTA 3AAEA 4O4UA 5DL8A 5KAIO 3T24A 3UPGA 1G90A 3POXA 5E79O 3PF1A 1S5LO 2Y7SA 2R4LA 3G7GA 2K4TA 3LK3A 2XG6A 3LK42 3PGSA 4N74A 4RJXA 2AXTO 2WJQA 4F4BA 5T5FA 4C69X 3AA7B 4GCSA 3AA0B 5EE2A 4C00A 3DWOX 4UB8O 4K3CA 4FZMA 2KC0A 3LK2A 3PGUA 2FGQX 4JCHA 4AFKA 3RBHA 2X27X 3VY8X 2IWWA 1OSMA 1BXWA 3PRNA 5B66O 5IYUA 3HOEA 2MHLA 2MNHA 4O3ZA 4LSEA 2XE2A 4KRAA 3WU2O 4O4XA 2JMMA 3VE1A 5G39A 3UU2A 4B61A 4C4VB 4PUXA 4UB6O 3NSGA 3SY7A 4Z3TA 1H6S1 5G38A 3PQSA 1T1LA 1BT9A 3PQUA 3SY9A 2PORA 3AAAB 2Y2XA 4FESA 4FSOA 3VZTX 5GTHO 2JQYA 1MM5A 5G3AA 2IWVA 2XE5A 3AA6B 3POUA 3HOLA 3V8UA 2J4UP 2R4NA 3PORA 4IL6O 3DWNA 3KVDD 3QRCA 2X9KA 2R4PA 2R88A 4FMSA 4K3BA 2ZFGA 4D64A 1IZNB
chains in the Genus database with same CATH topology
3AA7A 1ORMA 4O49A 1GFQA 5DL6A 4FUVA 2ODJA 3HW9A 4AKRA 4AZLA 2XE1A 4O3YA 4FZNA 2KXPB 4RLCA 4E1SA 4XNLA 1Q9FA 2F1TA 1GFNA 4AKMA 1ZHZA 4N59A 5AFUL 4E1TA 5GV0A 2M06A 4RL9A 4AYEC 3AA1B 4U9CA 4O3XB 1YS5A 3GP6A 3VZWX 7PRNA 2OMFA 1QJ9A 5ADXL 4FSPA 4KR8A 4FOZA 8PRNA 3O0EA 2F1VA 4RLBA 3AAEB 5FVNA 2LFUA 4LSIA 2ERVA 2XTQA 2YPVA 3AAAA 3T20A 2K0LA 1QJPA 1HXTA 2LHFA 2KDYA 4FRXA 3TZGA 2W80C 4GCPA 4LSFA 3AA6A 2KZ7B 1ZHYA 3SYSA 3JTYA 2Y0HA 4XNKA 5DL7A 5PRNA 3WI5A 1IZNA 2PRNA 1GFMA 1HXXA 3AA0A 3SYBA 2KXPA 2Y0LA 3WI4A 3DA3A 4AYDC 4AUIA 4GHBA 2J1NA 1MPFA 2O4VA 3FYXA 5D5DA 4AYMC 1GFOA 4AYNA 2YNKA 2N2LA 3K19A 3DA4A 5G26A 4AYID 3A2SX 3VY9X 5AFUK 4QQ1A 6PRNA 1THQA 4KR4A 4G76A 2N2MA 2GE4A 3UAQA 1E54A 3LK3B 4GCQA 3SZVA 3QRAA 3HWBA 4D5UA 1P4TA 4O3WA 5ADXK 2KZ7A 4LSHA 2W81C 3SZDA 4G75A 4JFBA 4AKRB 3VZUX 1GFPA 1PRNA 2FGRA 2XMXA 1ZHWA 3LK2B 2XE3A 4N58A 2XTRA 2Y0KA 4BUMX 1Q9GA 4FZLA 1MM4A 4GF4A 2M07A 2QTKA 3POQA 3AA1A 3C5OA 1OPFA 4D65A 5JDPA 2ZLDA 4RJWA 1BH3A 1HXUA 1PHOA 1QJ8A 1ZHTA 1ZHXA 3LK41 3EMNX 5DL5A 4FT6A 3VE2A 4FRTA 3AAEA 4O4UA 5DL8A 3T24A 3UPGA 1G90A 3POXA 2Y7SA 3LK42 3G7GA 2K4TA 3LK3A 2XG6A 4RJXA 4F4BA 5T5FA 4C69X 3AA7B 4GCSA 3AA0B 5EE2A 4FZMA 2KC0A 3LK2A 2FGQX 4JCHA 4AFKA 3RBHA 2X27X 3VY8X 1OSMA 1BXWA 3PRNA 5IYUA 3HOEA 2MHLA 2MNHA 4O3ZA 4LSEA 2XE2A 4KRAA 4O4XA 2JMMA 3VE1A 3UU2A 4Z3TA 4B61A 4PUXA 3NSGA 3SY7A 1H6S1 3PQSA 1BT9A 3PQUA 3SY9A 2PORA 3AAAB 2Y2XA 4FESA 4FSOA 3VZTX 1MM5A 2XE5A 3AA6B 3POUA 3HOLA 3V8UA 2J4UP 3PORA 3QRCA 3KVDD 4FMSA 3T0SA 4D64A 2ZFGA 1IZNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKM A;  5GV0 A; 
#chains in the Genus database with same CATH topology
 3A0B O;  3A0H O;  1ORM A;  3AA7 A;  4O49 A;  1GFQ A;  5DL6 A;  4FUV A;  2ODJ A;  3HW9 A;  4AKR A;  4AZL A;  2XE1 A;  4O3Y A;  4FZN A;  2KXP B;  4RLC A;  4E1S A;  4XNL A;  1Q9F A;  2F1T A;  1GFN A;  4AKM A;  1ZHZ A;  4N59 A;  5AFU L;  4E1T A;  5GV0 A;  2M06 A;  3PGR A;  4RL9 A;  3DZM A;  4AYE C;  1T16 A;  3AA1 B;  5H2F O;  4U9C A;  4O3X B;  4PR7 A;  1YS5 A;  3GP6 A;  3VZW X;  7PRN A;  2OMF A;  1QJ9 A;  5ADX L;  4FSP A;  3KZI O;  4KR8 A;  4FOZ A;  8PRN A;  3O0E A;  2F1V A;  4RLB A;  3AAE B;  4PJ0 O;  5FVN A;  2LFU A;  4LSI A;  2ERV A;  2R4O A;  2XTQ A;  2YPV A;  3AAA A;  3T20 A;  2F1C X;  2K0L A;  1QJP A;  1HXT A;  2LHF A;  2KDY A;  4FRX A;  3T0S A;  3TZG A;  2W80 C;  4GCP A;  4LSF A;  3AA6 A;  2KZ7 B;  1ZHY A;  2R8A A;  3SYS A;  3JTY A;  2Y0H A;  4XNK A;  5DL7 A;  5PRN A;  3WI5 A;  1IZN A;  2PRN A;  1GFM A;  1HXX A;  3AA0 A;  3SYB A;  2KXP A;  2Y0L A;  3NJT A;  3DA3 A;  3WI4 A;  4AYD C;  4AUI A;  4GHB A;  2J1N A;  4FQE A;  1MPF A;  2O4V A;  3FYX A;  5D5D A;  4AYM C;  1GFO A;  3BRZ A;  4AYN A;  2YNK A;  2N2L A;  3K19 A;  3DA4 A;  5G26 A;  4AYI D;  4C4V A;  3A2S X;  3JCU O;  3VY9 X;  4QQ1 A;  2WVP A;  5AFU K;  6PRN A;  1THQ A;  4KR4 A;  4G76 A;  2N2M A;  5B5E O;  2GE4 A;  3UAQ A;  1E54 A;  3LK3 B;  4GCQ A;  4N75 A;  2WJR A;  3SZV A;  3QRA A;  3BS0 A;  3HWB A;  1P4T A;  4O3W A;  4D5U A;  5ADX K;  2KZ7 A;  4LSH A;  2R89 A;  2W81 C;  3SZD A;  4CTD A;  4G75 A;  4JFB A;  4AKR B;  3VZU X;  1GFP A;  1PRN A;  2FGR A;  2XMX A;  1ZHW A;  3LK2 B;  2XE3 A;  4N58 A;  2XTR A;  2Y0K A;  5TIS O;  4BUM X;  1Q9G A;  3BRY A;  4FZL A;  1MM4 A;  5GTI O;  4GF4 A;  2M07 A;  2QTK A;  3POQ A;  3AA1 A;  3C5O A;  1OPF A;  4D65 A;  5JDP A;  2ZLD A;  5KAF O;  4RJW A;  1BH3 A;  1HXU A;  1PHO A;  1QJ8 A;  1ZHT A;  1ZHX A;  3LK4 1;  3EMN X;  5DL5 A;  4FT6 A;  3VE2 A;  4FRT A;  3AAE A;  4O4U A;  5DL8 A;  5KAI O;  3T24 A;  3UPG A;  1G90 A;  3POX A;  5E79 O;  3PF1 A;  1S5L O;  2Y7S A;  2R4L A;  3G7G A;  2K4T A;  3LK3 A;  2XG6 A;  3LK4 2;  3PGS A;  4N74 A;  4RJX A;  2AXT O;  2WJQ A;  4F4B A;  5T5F A;  4C69 X;  3AA7 B;  4GCS A;  3AA0 B;  5EE2 A;  4C00 A;  3DWO X;  4UB8 O;  4K3C A;  4FZM A;  2KC0 A;  3LK2 A;  3PGU A;  2FGQ X;  4JCH A;  4AFK A;  3RBH A;  2X27 X;  3VY8 X;  2IWW A;  1OSM A;  1BXW A;  3PRN A;  5B66 O;  5IYU A;  3HOE A;  2MHL A;  2MNH A;  4O3Z A;  4LSE A;  2XE2 A;  4KRA A;  3WU2 O;  4O4X A;  2JMM A;  3VE1 A;  5G39 A;  3UU2 A;  4B61 A;  4C4V B;  4PUX A;  4UB6 O;  3NSG A;  3SY7 A;  4Z3T A;  1H6S 1;  5G38 A;  3PQS A;  1T1L A;  1BT9 A;  3PQU A;  3SY9 A;  2POR A;  3AAA B;  2Y2X A;  4FES A;  4FSO A;  3VZT X;  5GTH O;  2JQY A;  1MM5 A;  5G3A A;  2IWV A;  2XE5 A;  3AA6 B;  3POU A;  3HOL A;  3V8U A;  2J4U P;  2R4N A;  3POR A;  4IL6 O;  3DWN A;  3KVD D;  3QRC A;  2X9K A;  2R4P A;  2R88 A;  4FMS A;  4K3B A;  2ZFG A;  4D64 A;  1IZN B; 
#chains in the Genus database with same CATH homology
 3AA7 A;  1ORM A;  4O49 A;  1GFQ A;  5DL6 A;  4FUV A;  2ODJ A;  3HW9 A;  4AKR A;  4AZL A;  2XE1 A;  4O3Y A;  4FZN A;  2KXP B;  4RLC A;  4E1S A;  4XNL A;  1Q9F A;  2F1T A;  1GFN A;  4AKM A;  1ZHZ A;  4N59 A;  5AFU L;  4E1T A;  5GV0 A;  2M06 A;  4RL9 A;  4AYE C;  3AA1 B;  4U9C A;  4O3X B;  1YS5 A;  3GP6 A;  3VZW X;  7PRN A;  2OMF A;  1QJ9 A;  5ADX L;  4FSP A;  4KR8 A;  4FOZ A;  8PRN A;  3O0E A;  2F1V A;  4RLB A;  3AAE B;  5FVN A;  2LFU A;  4LSI A;  2ERV A;  2XTQ A;  2YPV A;  3AAA A;  3T20 A;  2K0L A;  1QJP A;  1HXT A;  2LHF A;  2KDY A;  4FRX A;  3TZG A;  2W80 C;  4GCP A;  4LSF A;  3AA6 A;  2KZ7 B;  1ZHY A;  3SYS A;  3JTY A;  2Y0H A;  4XNK A;  5DL7 A;  5PRN A;  3WI5 A;  1IZN A;  2PRN A;  1GFM A;  1HXX A;  3AA0 A;  3SYB A;  2KXP A;  2Y0L A;  3WI4 A;  3DA3 A;  4AYD C;  4AUI A;  4GHB A;  2J1N A;  1MPF A;  2O4V A;  3FYX A;  5D5D A;  4AYM C;  1GFO A;  4AYN A;  2YNK A;  2N2L A;  3K19 A;  3DA4 A;  5G26 A;  4AYI D;  3A2S X;  3VY9 X;  5AFU K;  4QQ1 A;  6PRN A;  1THQ A;  4KR4 A;  4G76 A;  2N2M A;  2GE4 A;  3UAQ A;  1E54 A;  3LK3 B;  4GCQ A;  3SZV A;  3QRA A;  3HWB A;  4D5U A;  1P4T A;  4O3W A;  5ADX K;  2KZ7 A;  4LSH A;  2W81 C;  3SZD A;  4G75 A;  4JFB A;  4AKR B;  3VZU X;  1GFP A;  1PRN A;  2FGR A;  2XMX A;  1ZHW A;  3LK2 B;  2XE3 A;  4N58 A;  2XTR A;  2Y0K A;  4BUM X;  1Q9G A;  4FZL A;  1MM4 A;  4GF4 A;  2M07 A;  2QTK A;  3POQ A;  3AA1 A;  3C5O A;  1OPF A;  4D65 A;  5JDP A;  2ZLD A;  4RJW A;  1BH3 A;  1HXU A;  1PHO A;  1QJ8 A;  1ZHT A;  1ZHX A;  3LK4 1;  3EMN X;  5DL5 A;  4FT6 A;  3VE2 A;  4FRT A;  3AAE A;  4O4U A;  5DL8 A;  3T24 A;  3UPG A;  1G90 A;  3POX A;  2Y7S A;  3LK4 2;  3G7G A;  2K4T A;  3LK3 A;  2XG6 A;  4RJX A;  4F4B A;  5T5F A;  4C69 X;  3AA7 B;  4GCS A;  3AA0 B;  5EE2 A;  4FZM A;  2KC0 A;  3LK2 A;  2FGQ X;  4JCH A;  4AFK A;  3RBH A;  2X27 X;  3VY8 X;  1OSM A;  1BXW A;  3PRN A;  5IYU A;  3HOE A;  2MHL A;  2MNH A;  4O3Z A;  4LSE A;  2XE2 A;  4KRA A;  4O4X A;  2JMM A;  3VE1 A;  3UU2 A;  4Z3T A;  4B61 A;  4PUX A;  3NSG A;  3SY7 A;  1H6S 1;  3PQS A;  1BT9 A;  3PQU A;  3SY9 A;  2POR A;  3AAA B;  2Y2X A;  4FES A;  4FSO A;  3VZT X;  1MM5 A;  2XE5 A;  3AA6 B;  3POU A;  3HOL A;  3V8U A;  2J4U P;  3POR A;  3QRC A;  3KVD D;  4FMS A;  3T0S A;  4D64 A;  2ZFG A;  1IZN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...