4AKMA

Crystal structure of the human lysosome-associated membrane protein lamp-3 (aka dc-lamp)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
155
structure length
155
Chain Sequence
VKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETVYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Conserved Domain of the Dc Lysosomal Associated Membrane Protein: Implications for the Lysosomal Glycocalyx.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords LYSOSOME-ASSOCIATED MEMBRANE GLYCOPROTEIN 3
total genus 22
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01299 Lamp Lysosome-associated membrane glycoprotein (Lamp)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.110 Mainly Beta Beta Barrel Porin Porin 4akmA00
5GV0A 4AKMA
chains in the Genus database with same CATH superfamily
2LFUA 5B66O 3VE2A 3WU2O 4CTDA 4FZNA 3VZUX 2R4NA 2WJQA 3A0BO 5DL5A 2R4OA 3G7GA 5TISO 4AKRA 4FZLA 2XE1A 3FYXA 3LK3B 4UB8O 4FMSA 4D64A 3QRAA 3T0SA 1BXWA 3PQUA 1ZHZA 4PJ0O 4FESA 1ORMA 2M06A 2XE2A 5PRNA 3HWBA 8PRNA 3AA0A 2J4UP 2GE4A 4FQEA 5GTHO 4C00A 2KXPA 3SYSA 2YNKA 3UU2A 5D5DA 4FT6A 3RBHA 4O3YA 3VZWX 2Y0HA 1MPFA 2WVPA 1T1LA 4K3CA 4FSOA 4BUMX 4G75A 5G39A 4O3ZA 2AXTO 1E54A 4D5UA 4O3XB 1P4TA 3POXA 5T5FA 3O0EA 5E79O 2IWVA 3HOLA 2MNHA 5G26A 3SY7A 3T20A 2N2MA 1GFOA 2FGQX 3KZIO 3PGUA 1YS5A 4IL6O 4JCHA 4UB6O 3WI4A 4AYID 3A2SX 3AA1A 2JQYA 3POUA 4N59A 3WI5A 4C4VA 2O4VA 1MM5A 4QQ1A 2F1VA 3KVDD 4O4UA 3JTYA 1ZHTA 1G90A 3AA6A 4FOZA 4U9CA 4GCPA 5GV0A 3K19A 3V8UA 2X9KA 1IZNA 1ZHYA 3AAAB 3PF1A 3UAQA 2KZ7B 2J1NA 5H2FO 3SY9A 1GFPA 3DZMA 3NJTA 2X27X 2Y0KA 2XTQA 3NSGA 4XNLA 5AFUK 1GFMA 2KDYA 1MM4A 3DWNA 2WJRA 4KR4A 2R89A 1ZHXA 4RLBA 4AFKA 4E1SA 4O49A 3PGRA 2Y2XA 2K0LA 4AKMA 2QTKA 4N75A 4G76A 4AYDC 5ADXL 1HXUA 2XE3A 1ZHWA 3SYBA 6PRNA 2IWWA 1QJ9A 1QJPA 2XE5A 3HOEA 3A0HO 3HW9A 2XTRA 1PRNA 1Q9GA 3BS0A 2W80C 1S5LO 1Q9FA 3PRNA 4PUXA 4KR8A 2Y0LA 5G38A 4RL9A 1BT9A 4N74A 1T16A 2XMXA 3DA3A 4AYEC 4FSPA 1QJ8A 2F1CX 1PHOA 2F1TA 3AAAA 5DL6A 3LK3A 4AUIA 3DWOX 2ZFGA 3VE1A 3JCUO 2YPVA 2ZLDA 4KRAA 1GFQA 3AA7B 3PQSA 4GCSA 1OPFA 4RJXA 5AFUL 3AA0B 4K3BA 3LK41 5EE2A 7PRNA 4B61A 4D65A 3AA7A 2ERVA 4JFBA 5DL7A 5KAIO 2KXPB 2KZ7A 3C5OA 4GCQA 2OMFA 3VY9X 4FRXA 4RLCA 4LSHA 3T24A 2PRNA 4C69X 4F4BA 4XNKA 2FGRA 3GP6A 1H6S1 4Z3TA 2PORA 3EMNX 4FRTA 5IYUA 4GF4A 4AZLA 3VY8X 5ADXK 3LK42 4FUVA 3AA1B 4C4VB 4AKRB 2M07A 2ODJA 1BH3A 4PR7A 2R88A 4AYMC 4AYNA 5B5EO 3AA6B 3BRYA 2K4TA 3LK2B 3VZTX 4FZMA 2N2LA 4N58A 3TZGA 1HXXA 1IZNB 2W81C 4LSIA 3LK2A 3SZVA 2LHFA 2R4PA 4LSFA 4RJWA 5KAFO 2KC0A 4O4XA 3POQA 4LSEA 5FVNA 3BRZA 2R8AA 2XG6A 2R4LA 5G3AA 3DA4A 1THQA 5GTIO 5JDPA 1HXTA 1OSMA 4GHBA 3AAEA 3UPGA 2MHLA 3SZDA 2Y7SA 5DL8A 3PORA 4E1TA 3PGSA 3QRCA 2JMMA 4O3WA 1GFNA 3AAEB
chains in the Genus database with same CATH topology
2LFUA 3VE2A 4FZNA 3VZUX 5DL5A 3G7GA 4AKRA 4FZLA 2XE1A 3FYXA 3LK3B 4FMSA 4D64A 3QRAA 3T0SA 1BXWA 3PQUA 1ZHZA 4FESA 1ORMA 2M06A 2XE2A 5PRNA 3HWBA 2J4UP 3AA0A 2GE4A 2KXPA 3SYSA 2YNKA 3UU2A 5D5DA 4FT6A 3RBHA 4O3YA 3VZWX 2Y0HA 1MPFA 4FSOA 4BUMX 4G75A 4O3ZA 1E54A 4D5UA 4O3XB 1P4TA 3POXA 5T5FA 3O0EA 3HOLA 5G26A 2MNHA 3SY7A 3T20A 2N2MA 1GFOA 2FGQX 4JCHA 1YS5A 3WI4A 3UPGA 4AYID 3A2SX 3AA1A 3POUA 4N59A 3WI5A 2O4VA 1MM5A 4QQ1A 2F1VA 3KVDD 4O4UA 3JTYA 1ZHTA 1G90A 3AA6A 4FOZA 4U9CA 4GCPA 5GV0A 3K19A 3V8UA 1IZNA 1ZHYA 3AAAB 3UAQA 2KZ7B 2J1NA 3SY9A 1GFPA 2X27X 2Y0KA 2XTQA 3NSGA 4XNLA 5AFUK 1GFMA 2KDYA 1MM4A 4KR4A 4AFKA 4E1SA 8PRNA 1ZHXA 4RLBA 4O49A 2Y2XA 2K0LA 4AKMA 2QTKA 4G76A 4AYDC 5ADXL 1HXUA 2XE3A 1ZHWA 3SYBA 6PRNA 1QJ9A 1QJPA 2XE5A 3HOEA 3HW9A 2XTRA 1PRNA 1Q9GA 2W80C 3PRNA 1Q9FA 4PUXA 4KR8A 2Y0LA 4RL9A 1BT9A 3DA3A 2XMXA 4AYEC 4FSPA 1QJ8A 1PHOA 2F1TA 3AAAA 5DL6A 3LK3A 4AUIA 2ZFGA 3VE1A 2YPVA 2ZLDA 4KRAA 1GFQA 3AA7B 3PQSA 4GCSA 1OPFA 4RJXA 5AFUL 3AA0B 7PRNA 3LK41 5EE2A 4B61A 4D65A 3AA7A 2ERVA 4JFBA 5DL7A 3VY9X 2KXPB 2KZ7A 3C5OA 4GCQA 2OMFA 4AYNA 4FRXA 4RLCA 4LSHA 3T24A 2PRNA 4C69X 4F4BA 4XNKA 2FGRA 3GP6A 1H6S1 4Z3TA 2PORA 3EMNX 4FRTA 5IYUA 4GF4A 4AZLA 3VY8X 5ADXK 3LK42 4FUVA 3AA1B 4AKRB 2M07A 2ODJA 1BH3A 4AYMC 3AA6B 2K4TA 3LK2B 3VZTX 4FZMA 2N2LA 4N58A 3TZGA 1HXXA 1IZNB 2W81C 4LSIA 3LK2A 3SZVA 2LHFA 4LSFA 4RJWA 2KC0A 4O4XA 3POQA 4LSEA 5FVNA 2XG6A 3DA4A 1THQA 5JDPA 1HXTA 1OSMA 4GHBA 3AAEA 2MHLA 3SZDA 2Y7SA 5DL8A 3PORA 4E1TA 3QRCA 2JMMA 4O3WA 1GFNA 3AAEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GV0 A;  4AKM A; 
#chains in the Genus database with same CATH topology
 2LFU A;  5B66 O;  3VE2 A;  3WU2 O;  4CTD A;  4FZN A;  3VZU X;  2R4N A;  2WJQ A;  3A0B O;  5DL5 A;  2R4O A;  3G7G A;  5TIS O;  4AKR A;  4FZL A;  2XE1 A;  3FYX A;  3LK3 B;  4UB8 O;  4FMS A;  4D64 A;  3QRA A;  3T0S A;  1BXW A;  3PQU A;  1ZHZ A;  4PJ0 O;  4FES A;  1ORM A;  2M06 A;  2XE2 A;  5PRN A;  3HWB A;  8PRN A;  3AA0 A;  2J4U P;  2GE4 A;  4FQE A;  5GTH O;  4C00 A;  2KXP A;  3SYS A;  2YNK A;  3UU2 A;  5D5D A;  4FT6 A;  3RBH A;  4O3Y A;  3VZW X;  2Y0H A;  1MPF A;  2WVP A;  1T1L A;  4K3C A;  4FSO A;  4BUM X;  4G75 A;  5G39 A;  4O3Z A;  2AXT O;  1E54 A;  4D5U A;  4O3X B;  1P4T A;  3POX A;  5T5F A;  3O0E A;  5E79 O;  2IWV A;  3HOL A;  2MNH A;  5G26 A;  3SY7 A;  3T20 A;  2N2M A;  1GFO A;  2FGQ X;  3KZI O;  3PGU A;  1YS5 A;  4IL6 O;  4JCH A;  4UB6 O;  3WI4 A;  4AYI D;  3A2S X;  3AA1 A;  2JQY A;  3POU A;  4N59 A;  3WI5 A;  4C4V A;  2O4V A;  1MM5 A;  4QQ1 A;  2F1V A;  3KVD D;  4O4U A;  3JTY A;  1ZHT A;  1G90 A;  3AA6 A;  4FOZ A;  4U9C A;  4GCP A;  5GV0 A;  3K19 A;  3V8U A;  2X9K A;  1IZN A;  1ZHY A;  3AAA B;  3PF1 A;  3UAQ A;  2KZ7 B;  2J1N A;  5H2F O;  3SY9 A;  1GFP A;  3DZM A;  3NJT A;  2X27 X;  2Y0K A;  2XTQ A;  3NSG A;  4XNL A;  5AFU K;  1GFM A;  2KDY A;  1MM4 A;  3DWN A;  2WJR A;  4KR4 A;  2R89 A;  1ZHX A;  4RLB A;  4AFK A;  4E1S A;  4O49 A;  3PGR A;  2Y2X A;  2K0L A;  4AKM A;  2QTK A;  4N75 A;  4G76 A;  4AYD C;  5ADX L;  1HXU A;  2XE3 A;  1ZHW A;  3SYB A;  6PRN A;  2IWW A;  1QJ9 A;  1QJP A;  2XE5 A;  3HOE A;  3A0H O;  3HW9 A;  2XTR A;  1PRN A;  1Q9G A;  3BS0 A;  2W80 C;  1S5L O;  1Q9F A;  3PRN A;  4PUX A;  4KR8 A;  2Y0L A;  5G38 A;  4RL9 A;  1BT9 A;  4N74 A;  1T16 A;  2XMX A;  3DA3 A;  4AYE C;  4FSP A;  1QJ8 A;  2F1C X;  1PHO A;  2F1T A;  3AAA A;  5DL6 A;  3LK3 A;  4AUI A;  3DWO X;  2ZFG A;  3VE1 A;  3JCU O;  2YPV A;  2ZLD A;  4KRA A;  1GFQ A;  3AA7 B;  3PQS A;  4GCS A;  1OPF A;  4RJX A;  5AFU L;  3AA0 B;  4K3B A;  3LK4 1;  5EE2 A;  7PRN A;  4B61 A;  4D65 A;  3AA7 A;  2ERV A;  4JFB A;  5DL7 A;  5KAI O;  2KXP B;  2KZ7 A;  3C5O A;  4GCQ A;  2OMF A;  3VY9 X;  4FRX A;  4RLC A;  4LSH A;  3T24 A;  2PRN A;  4C69 X;  4F4B A;  4XNK A;  2FGR A;  3GP6 A;  1H6S 1;  4Z3T A;  2POR A;  3EMN X;  4FRT A;  5IYU A;  4GF4 A;  4AZL A;  3VY8 X;  5ADX K;  3LK4 2;  4FUV A;  3AA1 B;  4C4V B;  4AKR B;  2M07 A;  2ODJ A;  1BH3 A;  4PR7 A;  2R88 A;  4AYM C;  4AYN A;  5B5E O;  3AA6 B;  3BRY A;  2K4T A;  3LK2 B;  3VZT X;  4FZM A;  2N2L A;  4N58 A;  3TZG A;  1HXX A;  1IZN B;  2W81 C;  4LSI A;  3LK2 A;  3SZV A;  2LHF A;  2R4P A;  4LSF A;  4RJW A;  5KAF O;  2KC0 A;  4O4X A;  3POQ A;  4LSE A;  5FVN A;  3BRZ A;  2R8A A;  2XG6 A;  2R4L A;  5G3A A;  3DA4 A;  1THQ A;  5GTI O;  5JDP A;  1HXT A;  1OSM A;  4GHB A;  3AAE A;  3UPG A;  2MHL A;  3SZD A;  2Y7S A;  5DL8 A;  3POR A;  4E1T A;  3PGS A;  3QRC A;  2JMM A;  4O3W A;  1GFN A;  3AAE B; 
#chains in the Genus database with same CATH homology
 2LFU A;  3VE2 A;  4FZN A;  3VZU X;  5DL5 A;  3G7G A;  4AKR A;  4FZL A;  2XE1 A;  3FYX A;  3LK3 B;  4FMS A;  4D64 A;  3QRA A;  3T0S A;  1BXW A;  3PQU A;  1ZHZ A;  4FES A;  1ORM A;  2M06 A;  2XE2 A;  5PRN A;  3HWB A;  2J4U P;  3AA0 A;  2GE4 A;  2KXP A;  3SYS A;  2YNK A;  3UU2 A;  5D5D A;  4FT6 A;  3RBH A;  4O3Y A;  3VZW X;  2Y0H A;  1MPF A;  4FSO A;  4BUM X;  4G75 A;  4O3Z A;  1E54 A;  4D5U A;  4O3X B;  1P4T A;  3POX A;  5T5F A;  3O0E A;  3HOL A;  5G26 A;  2MNH A;  3SY7 A;  3T20 A;  2N2M A;  1GFO A;  2FGQ X;  4JCH A;  1YS5 A;  3WI4 A;  3UPG A;  4AYI D;  3A2S X;  3AA1 A;  3POU A;  4N59 A;  3WI5 A;  2O4V A;  1MM5 A;  4QQ1 A;  2F1V A;  3KVD D;  4O4U A;  3JTY A;  1ZHT A;  1G90 A;  3AA6 A;  4FOZ A;  4U9C A;  4GCP A;  5GV0 A;  3K19 A;  3V8U A;  1IZN A;  1ZHY A;  3AAA B;  3UAQ A;  2KZ7 B;  2J1N A;  3SY9 A;  1GFP A;  2X27 X;  2Y0K A;  2XTQ A;  3NSG A;  4XNL A;  5AFU K;  1GFM A;  2KDY A;  1MM4 A;  4KR4 A;  4AFK A;  4E1S A;  8PRN A;  1ZHX A;  4RLB A;  4O49 A;  2Y2X A;  2K0L A;  4AKM A;  2QTK A;  4G76 A;  4AYD C;  5ADX L;  1HXU A;  2XE3 A;  1ZHW A;  3SYB A;  6PRN A;  1QJ9 A;  1QJP A;  2XE5 A;  3HOE A;  3HW9 A;  2XTR A;  1PRN A;  1Q9G A;  2W80 C;  3PRN A;  1Q9F A;  4PUX A;  4KR8 A;  2Y0L A;  4RL9 A;  1BT9 A;  3DA3 A;  2XMX A;  4AYE C;  4FSP A;  1QJ8 A;  1PHO A;  2F1T A;  3AAA A;  5DL6 A;  3LK3 A;  4AUI A;  2ZFG A;  3VE1 A;  2YPV A;  2ZLD A;  4KRA A;  1GFQ A;  3AA7 B;  3PQS A;  4GCS A;  1OPF A;  4RJX A;  5AFU L;  3AA0 B;  7PRN A;  3LK4 1;  5EE2 A;  4B61 A;  4D65 A;  3AA7 A;  2ERV A;  4JFB A;  5DL7 A;  3VY9 X;  2KXP B;  2KZ7 A;  3C5O A;  4GCQ A;  2OMF A;  4AYN A;  4FRX A;  4RLC A;  4LSH A;  3T24 A;  2PRN A;  4C69 X;  4F4B A;  4XNK A;  2FGR A;  3GP6 A;  1H6S 1;  4Z3T A;  2POR A;  3EMN X;  4FRT A;  5IYU A;  4GF4 A;  4AZL A;  3VY8 X;  5ADX K;  3LK4 2;  4FUV A;  3AA1 B;  4AKR B;  2M07 A;  2ODJ A;  1BH3 A;  4AYM C;  3AA6 B;  2K4T A;  3LK2 B;  3VZT X;  4FZM A;  2N2L A;  4N58 A;  3TZG A;  1HXX A;  1IZN B;  2W81 C;  4LSI A;  3LK2 A;  3SZV A;  2LHF A;  4LSF A;  4RJW A;  2KC0 A;  4O4X A;  3POQ A;  4LSE A;  5FVN A;  2XG6 A;  3DA4 A;  1THQ A;  5JDP A;  1HXT A;  1OSM A;  4GHB A;  3AAE A;  2MHL A;  3SZD A;  2Y7S A;  5DL8 A;  3POR A;  4E1T A;  3QRC A;  2JMM A;  4O3W A;  1GFN A;  3AAE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...