4AKMA

Crystal structure of the human lysosome-associated membrane protein lamp-3 (aka dc-lamp)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
155
structure length
155
Chain Sequence
VKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETVYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Conserved Domain of the Dc Lysosomal Associated Membrane Protein: Implications for the Lysosomal Glycocalyx.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords LYSOSOME-ASSOCIATED MEMBRANE GLYCOPROTEIN 3
total genus 22
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01299 Lamp Lysosome-associated membrane glycoprotein (Lamp)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.110 Mainly Beta Beta Barrel Porin Porin 4akmA00
5GV0A 4AKMA
chains in the Genus database with same CATH superfamily
2ERVA 1GFMA 2AXTO 2F1CX 2KZ7A 3DWNA 3K19A 4FOZA 4GF4A 5AFUK 3AA7A 2ZFGA 3BRZA 4N74A 1MM4A 3BS0A 1BT9A 2JQYA 4FZLA 4IL6O 4PR7A 4BUMX 1G90A 2XTRA 3DWOX 3LK3B 1GFPA 3BRYA 4FRTA 2QTKA 3RBHA 1ZHTA 4G76A 4XNLA 4C00A 2MNHA 2FGRA 3TZGA 5E79O 3WI5A 2O4VA 4AYMC 4B61A 5H2FO 3DA4A 3KZIO 5DL5A 2X9KA 2F1VA 2R4NA 2R8AA 4KR8A 1YS5A 2KC0A 3PF1A 3AAEB 3EMNX 3AA6B 4RL9A 4AKRB 4FUVA 6PRNA 3T20A 3HW9A 1P4TA 1IZNA 4O3ZA 3VZUX 3SYSA 3SY7A 2K4TA 2N2LA 3A2SX 4AKRA 4AYID 1ORMA 3POUA 1HXUA 1Q9FA 2XE2A 4UB6O 2K0LA 3A0HO 4O3WA 5G26A 7PRNA 4K3CA 3O0EA 3QRAA 4KRAA 1MPFA 1IZNB 2XMXA 4N58A 4FSPA 2MHLA 2XE3A 2Y0HA 4AYNA 3LK3A 3AAAA 1MM5A 5DL6A 4D5UA 4AKMA 2IWWA 4N75A 3AA7B 3WU2O 1PHOA 5EE2A 1QJPA 1Q9GA 3SY9A 3QRCA 4RLCA 3V8UA 2ODJA 2Y2XA 4FZMA 4C69X 2XTQA 5AFUL 1T16A 3HWBA 3PQSA 3C5OA 2OMFA 3T24A 3SZVA 4K3BA 1GFQA 2Y0KA 3VE1A 3VY8X 4PJ0O 2J4UP 3LK42 3PGUA 2IWVA 3PGRA 4KR4A 3UAQA 2KZ7B 5D5DA 4FESA 4D64A 4Z3TA 1GFOA 2YNKA 2LFUA 3VE2A 3UPGA 2X27X 4O4XA 3KVDD 3WI4A 5B66O 3PGSA 2KXPB 4FMSA 4FT6A 2XG6A 2WVPA 1HXTA 3HOEA 4FQEA 2JMMA 2R88A 3PQUA 4GHBA 4E1SA 2W80C 5B5EO 2R4PA 3PORA 4GCPA 1THQA 5GTHO 1GFNA 2PORA 5GV0A 4AFKA 1BH3A 2J1NA 3DZMA 5TISO 2PRNA 4JFBA 4AYEC 8PRNA 3A0BO 4PUXA 4CTDA 4E1TA 1QJ9A 5T5FA 3LK41 3DA3A 5ADXL 4O3YA 2GE4A 3VY9X 4GCQA 4N59A 1T1LA 3LK2B 4FSOA 1ZHWA 3G7GA 2R4LA 3AA0B 4AYDC 2FGQX 3GP6A 5G38A 3LK2A 2XE5A 1ZHXA 1S5LO 4O3XB 5FVNA 1H6S1 3AA0A 5DL7A 1ZHYA 1BXWA 3POXA 2F1TA 2LHFA 3AA1B 2R89A 5KAFO 4RJXA 5G39A 5DL8A 4C4VA 3POQA 2WJRA 5G3AA 2KXPA 2N2MA 1ZHZA 4RLBA 2XE1A 5PRNA 5ADXK 1OSMA 4D65A 4UB8O 4C4VB 2W81C 3FYXA 3AA1A 3AAEA 4GCSA 4LSHA 3VZTX 4FZNA 1E54A 4AUIA 5KAIO 3NJTA 3AAAB 3SYBA 4RJWA 4XNKA 1PRNA 2WJQA 2YPVA 4O49A 3HOLA 4O4UA 4QQ1A 2Y7SA 4F4BA 2M07A 3JCUO 3NSGA 3SZDA 3T0SA 2Y0LA 5GTIO 4JCHA 5IYUA 2KDYA 4FRXA 1QJ8A 3VZWX 4U9CA 1OPFA 2ZLDA 3UU2A 2M06A 4LSFA 4LSEA 2R4OA 3JTYA 4LSIA 5JDPA 1HXXA 3AA6A 3PRNA 4AZLA 4G75A
chains in the Genus database with same CATH topology
2ERVA 1GFMA 4FOZA 2KZ7A 3K19A 5AFUK 4GF4A 3AA7A 2ZFGA 1MM4A 4BUMX 1BT9A 4FZLA 1G90A 2XTRA 3LK3B 4FRTA 1GFPA 3RBHA 2QTKA 1ZHTA 4G76A 4XNLA 2MNHA 2FGRA 3TZGA 4AYMC 3WI5A 2O4VA 4B61A 3DA4A 5DL5A 2F1VA 4KR8A 1YS5A 2KC0A 3AAEB 3EMNX 3AA6B 4RL9A 4AKRB 4FUVA 6PRNA 3T20A 3HW9A 1P4TA 1IZNA 4O3ZA 3VZUX 3SYSA 3SY7A 2K4TA 2N2LA 3A2SX 4AKRA 4AYID 1ORMA 3POUA 1HXUA 1Q9FA 2XE2A 2K0LA 4O3WA 5G26A 7PRNA 3O0EA 3QRAA 4KRAA 1MPFA 1IZNB 2XMXA 4N58A 4FSPA 2MHLA 2XE3A 2Y0HA 4AYNA 3LK3A 3AAAA 1MM5A 5DL6A 4D5UA 4AKMA 3AA7B 1PHOA 5EE2A 1QJPA 1Q9GA 3SY9A 3QRCA 4RLCA 3V8UA 2ODJA 2Y2XA 4FZMA 4C69X 2XTQA 5AFUL 3HWBA 3PQSA 3C5OA 2OMFA 3T24A 3SZVA 1GFQA 2Y0KA 3VE1A 3VY8X 2J4UP 3LK42 4KR4A 3UAQA 2KZ7B 5D5DA 4FESA 4D64A 4Z3TA 1GFOA 2YNKA 2LFUA 3VE2A 3UPGA 2X27X 4O4XA 3KVDD 3WI4A 2KXPB 4FMSA 4FT6A 2XG6A 1HXTA 3HOEA 4E1SA 2JMMA 3PQUA 4GHBA 2W80C 3PORA 4GCPA 1THQA 1GFNA 2PORA 5GV0A 4AFKA 1BH3A 2J1NA 4AYEC 2PRNA 4JFBA 8PRNA 4PUXA 4E1TA 1QJ9A 5T5FA 3LK41 3DA3A 5ADXL 4O3YA 2GE4A 3VY9X 4GCQA 4N59A 3LK2B 4FSOA 1ZHWA 3G7GA 3AA0B 4AYDC 2FGQX 3GP6A 3LK2A 2XE5A 1ZHXA 4O3XB 5FVNA 1H6S1 3AA0A 5DL7A 1ZHYA 1BXWA 3POXA 2F1TA 2LHFA 3AA1B 4RJXA 5DL8A 3POQA 2KXPA 2N2MA 1ZHZA 4RLBA 2XE1A 5PRNA 5ADXK 1OSMA 4D65A 2W81C 3FYXA 3AA1A 3AAEA 4GCSA 4LSHA 3VZTX 4FZNA 1E54A 4AUIA 3AAAB 3SYBA 4RJWA 4XNKA 1PRNA 4O49A 2YPVA 3HOLA 4O4UA 4QQ1A 2Y7SA 4F4BA 2M07A 3NSGA 3T0SA 3SZDA 2Y0LA 4JCHA 5IYUA 2KDYA 4FRXA 1QJ8A 3VZWX 4U9CA 1OPFA 2ZLDA 3UU2A 2M06A 4LSFA 4LSEA 3JTYA 4LSIA 5JDPA 1HXXA 3AA6A 3PRNA 4AZLA 4G75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GV0 A;  4AKM A; 
#chains in the Genus database with same CATH topology
 2ERV A;  1GFM A;  2AXT O;  2F1C X;  2KZ7 A;  3DWN A;  3K19 A;  4FOZ A;  4GF4 A;  5AFU K;  3AA7 A;  2ZFG A;  3BRZ A;  4N74 A;  1MM4 A;  3BS0 A;  1BT9 A;  2JQY A;  4FZL A;  4IL6 O;  4PR7 A;  4BUM X;  1G90 A;  2XTR A;  3DWO X;  3LK3 B;  1GFP A;  3BRY A;  4FRT A;  2QTK A;  3RBH A;  1ZHT A;  4G76 A;  4XNL A;  4C00 A;  2MNH A;  2FGR A;  3TZG A;  5E79 O;  3WI5 A;  2O4V A;  4AYM C;  4B61 A;  5H2F O;  3DA4 A;  3KZI O;  5DL5 A;  2X9K A;  2F1V A;  2R4N A;  2R8A A;  4KR8 A;  1YS5 A;  2KC0 A;  3PF1 A;  3AAE B;  3EMN X;  3AA6 B;  4RL9 A;  4AKR B;  4FUV A;  6PRN A;  3T20 A;  3HW9 A;  1P4T A;  1IZN A;  4O3Z A;  3VZU X;  3SYS A;  3SY7 A;  2K4T A;  2N2L A;  3A2S X;  4AKR A;  4AYI D;  1ORM A;  3POU A;  1HXU A;  1Q9F A;  2XE2 A;  4UB6 O;  2K0L A;  3A0H O;  4O3W A;  5G26 A;  7PRN A;  4K3C A;  3O0E A;  3QRA A;  4KRA A;  1MPF A;  1IZN B;  2XMX A;  4N58 A;  4FSP A;  2MHL A;  2XE3 A;  2Y0H A;  4AYN A;  3LK3 A;  3AAA A;  1MM5 A;  5DL6 A;  4D5U A;  4AKM A;  2IWW A;  4N75 A;  3AA7 B;  3WU2 O;  1PHO A;  5EE2 A;  1QJP A;  1Q9G A;  3SY9 A;  3QRC A;  4RLC A;  3V8U A;  2ODJ A;  2Y2X A;  4FZM A;  4C69 X;  2XTQ A;  5AFU L;  1T16 A;  3HWB A;  3PQS A;  3C5O A;  2OMF A;  3T24 A;  3SZV A;  4K3B A;  1GFQ A;  2Y0K A;  3VE1 A;  3VY8 X;  4PJ0 O;  2J4U P;  3LK4 2;  3PGU A;  2IWV A;  3PGR A;  4KR4 A;  3UAQ A;  2KZ7 B;  5D5D A;  4FES A;  4D64 A;  4Z3T A;  1GFO A;  2YNK A;  2LFU A;  3VE2 A;  3UPG A;  2X27 X;  4O4X A;  3KVD D;  3WI4 A;  5B66 O;  3PGS A;  2KXP B;  4FMS A;  4FT6 A;  2XG6 A;  2WVP A;  1HXT A;  3HOE A;  4FQE A;  2JMM A;  2R88 A;  3PQU A;  4GHB A;  4E1S A;  2W80 C;  5B5E O;  2R4P A;  3POR A;  4GCP A;  1THQ A;  5GTH O;  1GFN A;  2POR A;  5GV0 A;  4AFK A;  1BH3 A;  2J1N A;  3DZM A;  5TIS O;  2PRN A;  4JFB A;  4AYE C;  8PRN A;  3A0B O;  4PUX A;  4CTD A;  4E1T A;  1QJ9 A;  5T5F A;  3LK4 1;  3DA3 A;  5ADX L;  4O3Y A;  2GE4 A;  3VY9 X;  4GCQ A;  4N59 A;  1T1L A;  3LK2 B;  4FSO A;  1ZHW A;  3G7G A;  2R4L A;  3AA0 B;  4AYD C;  2FGQ X;  3GP6 A;  5G38 A;  3LK2 A;  2XE5 A;  1ZHX A;  1S5L O;  4O3X B;  5FVN A;  1H6S 1;  3AA0 A;  5DL7 A;  1ZHY A;  1BXW A;  3POX A;  2F1T A;  2LHF A;  3AA1 B;  2R89 A;  5KAF O;  4RJX A;  5G39 A;  5DL8 A;  4C4V A;  3POQ A;  2WJR A;  5G3A A;  2KXP A;  2N2M A;  1ZHZ A;  4RLB A;  2XE1 A;  5PRN A;  5ADX K;  1OSM A;  4D65 A;  4UB8 O;  4C4V B;  2W81 C;  3FYX A;  3AA1 A;  3AAE A;  4GCS A;  4LSH A;  3VZT X;  4FZN A;  1E54 A;  4AUI A;  5KAI O;  3NJT A;  3AAA B;  3SYB A;  4RJW A;  4XNK A;  1PRN A;  2WJQ A;  2YPV A;  4O49 A;  3HOL A;  4O4U A;  4QQ1 A;  2Y7S A;  4F4B A;  2M07 A;  3JCU O;  3NSG A;  3SZD A;  3T0S A;  2Y0L A;  5GTI O;  4JCH A;  5IYU A;  2KDY A;  4FRX A;  1QJ8 A;  3VZW X;  4U9C A;  1OPF A;  2ZLD A;  3UU2 A;  2M06 A;  4LSF A;  4LSE A;  2R4O A;  3JTY A;  4LSI A;  5JDP A;  1HXX A;  3AA6 A;  3PRN A;  4AZL A;  4G75 A; 
#chains in the Genus database with same CATH homology
 2ERV A;  1GFM A;  4FOZ A;  2KZ7 A;  3K19 A;  5AFU K;  4GF4 A;  3AA7 A;  2ZFG A;  1MM4 A;  4BUM X;  1BT9 A;  4FZL A;  1G90 A;  2XTR A;  3LK3 B;  4FRT A;  1GFP A;  3RBH A;  2QTK A;  1ZHT A;  4G76 A;  4XNL A;  2MNH A;  2FGR A;  3TZG A;  4AYM C;  3WI5 A;  2O4V A;  4B61 A;  3DA4 A;  5DL5 A;  2F1V A;  4KR8 A;  1YS5 A;  2KC0 A;  3AAE B;  3EMN X;  3AA6 B;  4RL9 A;  4AKR B;  4FUV A;  6PRN A;  3T20 A;  3HW9 A;  1P4T A;  1IZN A;  4O3Z A;  3VZU X;  3SYS A;  3SY7 A;  2K4T A;  2N2L A;  3A2S X;  4AKR A;  4AYI D;  1ORM A;  3POU A;  1HXU A;  1Q9F A;  2XE2 A;  2K0L A;  4O3W A;  5G26 A;  7PRN A;  3O0E A;  3QRA A;  4KRA A;  1MPF A;  1IZN B;  2XMX A;  4N58 A;  4FSP A;  2MHL A;  2XE3 A;  2Y0H A;  4AYN A;  3LK3 A;  3AAA A;  1MM5 A;  5DL6 A;  4D5U A;  4AKM A;  3AA7 B;  1PHO A;  5EE2 A;  1QJP A;  1Q9G A;  3SY9 A;  3QRC A;  4RLC A;  3V8U A;  2ODJ A;  2Y2X A;  4FZM A;  4C69 X;  2XTQ A;  5AFU L;  3HWB A;  3PQS A;  3C5O A;  2OMF A;  3T24 A;  3SZV A;  1GFQ A;  2Y0K A;  3VE1 A;  3VY8 X;  2J4U P;  3LK4 2;  4KR4 A;  3UAQ A;  2KZ7 B;  5D5D A;  4FES A;  4D64 A;  4Z3T A;  1GFO A;  2YNK A;  2LFU A;  3VE2 A;  3UPG A;  2X27 X;  4O4X A;  3KVD D;  3WI4 A;  2KXP B;  4FMS A;  4FT6 A;  2XG6 A;  1HXT A;  3HOE A;  4E1S A;  2JMM A;  3PQU A;  4GHB A;  2W80 C;  3POR A;  4GCP A;  1THQ A;  1GFN A;  2POR A;  5GV0 A;  4AFK A;  1BH3 A;  2J1N A;  4AYE C;  2PRN A;  4JFB A;  8PRN A;  4PUX A;  4E1T A;  1QJ9 A;  5T5F A;  3LK4 1;  3DA3 A;  5ADX L;  4O3Y A;  2GE4 A;  3VY9 X;  4GCQ A;  4N59 A;  3LK2 B;  4FSO A;  1ZHW A;  3G7G A;  3AA0 B;  4AYD C;  2FGQ X;  3GP6 A;  3LK2 A;  2XE5 A;  1ZHX A;  4O3X B;  5FVN A;  1H6S 1;  3AA0 A;  5DL7 A;  1ZHY A;  1BXW A;  3POX A;  2F1T A;  2LHF A;  3AA1 B;  4RJX A;  5DL8 A;  3POQ A;  2KXP A;  2N2M A;  1ZHZ A;  4RLB A;  2XE1 A;  5PRN A;  5ADX K;  1OSM A;  4D65 A;  2W81 C;  3FYX A;  3AA1 A;  3AAE A;  4GCS A;  4LSH A;  3VZT X;  4FZN A;  1E54 A;  4AUI A;  3AAA B;  3SYB A;  4RJW A;  4XNK A;  1PRN A;  4O49 A;  2YPV A;  3HOL A;  4O4U A;  4QQ1 A;  2Y7S A;  4F4B A;  2M07 A;  3NSG A;  3T0S A;  3SZD A;  2Y0L A;  4JCH A;  5IYU A;  2KDY A;  4FRX A;  1QJ8 A;  3VZW X;  4U9C A;  1OPF A;  2ZLD A;  3UU2 A;  2M06 A;  4LSF A;  4LSE A;  3JTY A;  4LSI A;  5JDP A;  1HXX A;  3AA6 A;  3PRN A;  4AZL A;  4G75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...