4AKRB

Crystal structure of the cytoplasmic actin capping protein cap32_34 from dictyostelium discoideum
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
245
Chain Sequence
TEKQLSCCLDLMRRLPPSQIEDNLAGLLDLVPDLTEDLLSSIDQPLKVAYDAVSKKDYLLCDYNRDADSYRSPWSNKYDPPLSGACYPSSKLRDIEVQANEIFEIYLNLYFEGGVSSVYCWDLDDNFAAVVLMKKTQDPMRGTWDSIHVVEVKLGKKDKAVYKLTSTVMLSIETDNDNTGKVNLAGSLTRQDEKEYTFNEVDTHCVNIGKMVEDMESKLRQTLETIYFGKTKEVVNTLRNATGNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation and Divergence between Cytoplasmic and Muscle-Specific Actin Capping Proteins: Insights from the Crystal Structure of Cytoplasmic CAP32/34 from Dictyostelium Discoideum.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Actin-binding protein
molecule keywords F-ACTIN-CAPPING PROTEIN SUBUNIT ALPHA
total genus 71
structure length 245
sequence length 251
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4akrB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 4akrB02
3LK3A 2KZ7A 3AA1A 3AAAA 3AAEA 3AA7A 1IZNA 3AA0A 5AFUL 5ADXL 3AA7B 1IZNB 3AAEB 3AAAB 3LK2A 3AA0B 3LK3B 2KXPA 2KZ7B 4AKRA 3AA6B 3AA1B 3LK42 3LK2B 5AFUK 5ADXK 3LK41 3AA6A 4AKRB 2KXPB
chains in the Genus database with same CATH superfamily
4ZHQE 3NKZA 3ZT6A 5FXVA 3RIAA 2YU2A 3JAFA 1UURA 4Z8XA 5HXSA 1UX5A 1E1HB 2K24A 2Q9QC 4LF7T 5GTHO 5LOVE 2M07A 3RIUA 4AKHA 4OYKA 1FIOA 3ABVA 3ZT7A 1B7TA 3KV5A 2J4GA 1SA0E 4GK5E 5L3BB 2Y7SA 1OXZA 2KT9A 4PJNA 2E9XC 2UXXB 4GCSA 1G8XA 1HTJF 3KBUA 3AEDA 4AYMC 4B6XA 4QX8B 2PBIA 1T7SA 4AQGA 2Y0KA 2LE8A 2C5JA 5HYAA 5PRNA 1S94A 5LMUT 3RBHA 3RI5A 3ZEFB 3SS1A 5HXRA 4RL9A 4AFKA 2V26A 3AEBA 4O2BE 3DTOA 1G73A 1HX8A 1LVFA 3H3MA 3RRWA 2W61A 5AFUK 5LYJE 5LGTB 1KEYA 2R8AA 4D65A 3PUYF 4H9OC 4H63H 3PUVF 2KC0A 2WB5A 4CI3B 4WZXA 5FMNA 2V5CA 4L9IA 4M1PA 2FBWA 3OBVE 4UELA 4KP3C 4EGWA 3UQ4A 4JEHB 1ZHTA 2VK9A 2WCAA 1YS5A 2JRKA 2B76A 2R88A 5A1LA 3PGRA 5J1GA 3N9LA 3MJXA 2W00A 2L9QA 3S4UA 1QJ9A 3GMIA 4NPPA 5GTIO 2WWUA 2XASB 3MA9A 2LM9A 6PRNA 2OLTA 4IT4A 1IAPA 4UXNB 3NRXA 2V6XA 5H2FO 3Q5DA 2QTKA 1YKEB 5JR9C 4ZS2A 4ZZCA 2H88A 4GOUA 3UU2A 2V1DB 3V5UA 2WVPA 3WAJA 1UK5A 3MKDA 4NUUA 2QYWA 3VZWX 2NOXA 4HWHA 5F8PA 1MMNA 5JREA 5JDNA 2M67A 3ZLIA 4QH4A 4KUMB 5FNVE 4GCPA 5LG3A 2BDEA 2L3LA 1XDPA 2LSIA 3U3IA 3CK6A 2BBJA 3DP7A 4HFBA 2BVMA 1GFPA 2YKSA 4YTMA 2IW5B 1LRZA 5AQHB 3BK9A 3DA4A 4AYID 4IE7A 3ANWA 4MFRA 2XAGB 4K3BA 4CXXA 4HFIA 3ONXA 4X5TA 3AA6B 3SFDA 3GWHA 5HEGA 4F8HA 4XZCA 2VVSA 3HKBE 3K3NA 4N59A 2YDRA 3O4XE 4FT6A 4JI8T 2ODUA 3JC6D 2JMKA 2HHHT 3O1HA 4QX7B 3RQWA 4AYNA 2SPCA 1XNQT 2W67A 4ISTA 4LF5T 3CIRA 4PJLA 2IWWA 3RQUA 3EI0A 1BT9A 4KHZF 3PUSA 2F4VT 4KHPT 4E1SA 4I0UA 2DNXA 2D0TA 4DR1T 1S35A 2ZFGA 3ZYMA 5IYZE 2RPAA 4LFBT 1MMAA 5HXEA 5LGUB 4UR9A 3E0ZA 4YSZA 3FBLA 3FZKB 3VKHA 5ABFA 2IAKA 1I94T 3POXA 2WBLA 2IWVA 1D0ZA 2X9HA 4ANJA 3AE5A 3T8OA 3WAKA 3ZYKA 3IHRA 1FMWA 5LA6E 5AQQB 4EXTA 5CA0E 4LSHA 5FL0A 3ZJ2A 3G06A 2VKDA 4YJ2E 3VKGA 3T1YT 5JVDE 5C2TA 4KMCA 3BQLA 2KXPA 2ZLDA 5DJQC 3VZUX 4ILCA 4TX5A 4Z3TA 5DQWA 5LHGB 2CHOA 4JI0T 4HFHA 4LMJA 4O3XB 4QWNB 3AAEA 3UULA 3OVUA 3R84B 2X0YA 5LXTE 1P4TA 2ODVA 3FZHB 3TLUA 4HFVA 5J0ZA 4NIQA 5L3EB 2WY2A 4G76A 4ILUA 1XDOA 2NW9A 2O4VA 3IBPA 4WYVA 4DUZT 1HG5A 3KINB 3KVBA 3VR8A 3HWBA 3C5OA 1MIVA 4FSPA 4C91A 5G3AA 3ZCJA 2EHOD 1V9DA 3GN5A 4YXDA 5FVLA 2WJRA 4B61A 5JRCA 2XHEB 3ZSSA 1FMVA 3AE4A 3K8PC 3P8CD 2DWKA 5EZYE 4BJNA 1UCUA 4K0KT 2JQHA 2HN2A 1HFAA 5BMVE 2QA7A 1JNZA 1IJ6A 4QKNA 3AE7A 4MALA 4A98A 2CMRA 2E8IA 4RJWA 1H7CA 1KNZA 4IGUA 5M4YA 4QXHB 2WS3A 2WAUA 3I9WA 3JADA 3MACA 3HA4A 5LCYA 2WDRA 4FRTA 4TV8E 1Y01A 3AA6A 3PE0A 2V7JA 3BRZA 4X65T 1N36T 2BG9C 3QRCA 4OHFA 1D0YA 5FY0A 3RHWA 4DR6T 3N2OA 3PV0F 3I0OA 4FOZA 3POUA 4DR2T 2BG9E 3T24A 1HXXA 2NR4A 1N33T 3N5LA 4KRAA 2CPTA 3POQA 2NTXA 5L3FB 3PJAA 5FL1A 1GFNA 2V5DA 1CUNA 4X1KE 1SUMB 4AYDC 3KV4A 1T72A 3ZMSB 2XTLA 1J5ET 4AIUA 2AE9A 5J2TE 2XTRA 1M62A 4EYUA 3V5SA 2Q9QA 2Y0HA 1WR6A 3EAMA 1XMOT 4LF9T 4FZMA 3MXZA 3HKDE 4DV6T 3AE9A 2W4XA 3PU8A 3PORA 4O4HE 5IWAT 2R4PA 1BR4A 2KSRA 3Q5XA 4B3MT 2E9XA 3NZQA 3PQSA 3LG7A 2VKHA 2E5LT 2LSJA 1OSMA 2A2FX 4EEBA 4HKAA 5LBQB 4HWCA 2PG8A 5JQGE 2ZM6T 5FXWA 2WDQA 2IIUA 5ABEA 3KVDD 4YLHA 3ZYLA 2W81C 5G39A 2NW7A 3KZIO 2YDQA 2XPKA 2FJEA 3UU8A 4DVDA 1G90A 2K0LA 1OEDA 4PNIA 3RIUC 2W80C 3EABA 5ADXL 4Z91A 3C98B 2IUBA 4IIJE 4U2ZA 4ILBA 1IBMT 2FJAA 4UB6O 4HFCA 2R4LA 2H7VC 3RPUA 2D5UA 3RRCA 2F1CX 1HS7A 4GKJT 2I6HA 3TKLB 4EZ4A 3UQ7A 3OPCA 5AQNB 4WBNE 3E22E 1Y64B 1E7PA 3ETVA 3ETUA 4ZEYA 1ORMA 2XQ7A 3F31A 2BVLA 5CA1E 4PR7A 4DV4T 2LHNA 3QB5A 3AA7A 4K0UA 5HEJA 4JI1T 3VRBA 4AI6A 3AE8A 2XM2A 4U3CA 2R4OA 3HOEA 4QHOA 2CRBA 3LK2B 1HXTA 4IE6A 3K3QC 4PFPA 4A5XA 1M7KA 3GA8A 4EZHA 1BXWA 4O3WA 3HI2A 3CX7B 2EHOB 2D0UA 4CN1A 4H9PC 1US7B 3T1HT 1NEKA 2ZM2A 5B66O 4FJOA 4UV8B 4IDPA 2X67A 3IF8B 2UXCT 3SYBA 1KFYA 4DV2T 4LMLA 2JQ9A 2Y0LA 2LKHA 3AE2A 5LHIB 3A0BO 3IA3A 2N2MA 4CN4A 4HFEA 5C8YE 2E9XB 3EMNX 2XSBA 4AUIA 2FJBA 2G0UA 4C4VA 4ILAA 5LBMA 5G38A 3PRNA 5FXXA 4B3RT 2H7OA 2N2NA 4UV9B 1JNRA 1D1AA 2JMHA 2K48A 2KWHA 3N9QA 2D9DA 1WFDA 4HWDA 2Q9QB 4H9SE 4JUYA 4CXYA 1LVKA 4AQFC 4RLBA 4I50E 1SE7A 5FYMA 3JAEA 3AXJB 4U7YA 5LGNB 4N78D 4JI2T 4TWHA 5AQRB 5ETWA 3M3ZB 1ZHXA 5LJNA 3TLSA 2Y48B 3O9XA 4P0AA 2F1TA 3CPZA 2E5VA 1UGOA 3P4PA 2CHNA 4UVBB 1PHOA 2C0SA 4DBRA 2NTYA 3RYIE 4AKRA 1OEDC 2ERVA 2LRKA 3UFEA 2NW8A 2KXPB 4EYYR 2WZHA 4ZI7E 5KAFO 1MNEA 1NENA 2YDSA 3N9NA 4UVAB 3PTRB 5D5DA 5BR8T 2IDOB 1NAFA 1HNZT 4TNWA 2CM0A 4U7IA 2OA5A 1CHUA 3PUZF 2KZ7A 2PORA 2CE7A 2V7LA 3UU4A 4IE5A 3NWIA 5F5WA 1YW0A 2JIWA 3VY8X 3TZGA 3O1IA 2XZEA 3KV9A 2BZBA 2J1DG 4U33A 3JTYA 4DV0T 1WYBA 3BQIA 1W0AA 4QXCB 4U31A 1YXRA 1E54A 2XQ6A 4FZLA 4MBQA 2PRNA 3SZVA 5AQKB 5AQOB 1Z0PA 2YEVC 1QSDA 5LP6E 3ZCIA 2DL1A 1W9RA 4GHBA 5L3CB 3AE6A 5J2UE 5LB7B 3LDQB 4ADZA 3CQXC 3SY7A 4ZI2D 5L4HA 3DWOX 4A56A 5IYUA 2E9XD 5HCMA 5ABFB 1XNRT 3ANWB 4IL4A 2CLYC 3Q9DA 4LSIA 2KWIB 2XMXA 5CGMA 2X51A 3KV6A 3P4SA 3LK3B 4LF6T 1ZHCA 4AQYT 3M65A 5HEOA 2VVNA 4CI1B 3B5MA 5B5EO 4GCQA 2YU1A 3UUNA 5KDMC 5L4EA 4KI0F 4UIGA 3KBTA 4E7SA 1DU2A 3DWNA 1VOMA 4A97A 2RP4A 5GONE 2H89A 2VB6A 4H9NC 2LJLA 3PF1A 2J4UP 5AQLB 4H9QC 4PW8A 3AA1B 1MM5A 3LK42 2X9KA 5FP3A 3UU5A 4AKRB 3AEEA 3NBXX 4ZZBA 2LM2A 3H37A 2LRLA 3C64A 3FXDB 3P50A 4JI4T 5FY1A 4AQFA 5L3DB 1GFMA 4D5UA 2XJ7A 2EHOA 3P4RA 1NWMX 3P7IA 1Z8UA 2XQYA 4CI2B 4FESA 4D64A 2DCFA 1MIWA 1S5LO 3SZDA 1YQ3A 4YY3T 3RLFF 4J2CA 2JJ9A 2BS2A 3SYSA 3HL6A 1T8BA 4PK5A 4AKGA 2YN6A 1WRDA 4O3ZA 2UUBT 3C4ZA 3PUQA 2YNKA 4LF8T 2C5KT 2GK9A 3J7Yq 4O4JE 3QOFA 4BJMA 3A7MA 3ONLC 4YTNA 3TLWA 1OWAA 2BKOA 3RX6A 4GYRA 4O2AE 1MM4A 4UB8O 1XMQT 2B1EA 4TUYE 2L8KA 4IL9A 3W15B 4O4IE 4GYSA 5LJMA 3AA0A 1QLBA 4FUVA 4DV7T 1AJ3A 3O1JA 2XY8B 3PGSA 2NWBA 2K5BB 4PK4A 2KINB 5E79O 5JR9A 2LOPA 5JDMA 3ZN0B 3GN5B 3G7GA 2LOSA 4YSXA 5ABHA 3LK3A 4IE4A 5JRCB 3JC6C 3HR0A 5DL6A 2ZM0A 2Q9QD 2KLQA 5E0OA 4DBQA 5JDPA 1OEDB 2LHFA 4XNLA 2KNDA 3K19A 1MMGA 1ZV4X 2LLYA 1J5WA 3PQUA 2VQET 4ZI3D 5CB4E 4G75A 4Q25A 4ISSA 1KK7A 4L0RA 4DUYT 3QK6A 4E7ZA 1WLXA 2CBIA 5HWYA 4YFSA 5AQFB 4GF4A 4PUXA 1W0BA 2WZIA 5HXCA 3DJBA 5AQTB 4JYAT 2WU5A 2X27X 2XE5A 1KF6A 2XQ5A 3TLTA 3K3OA 2XQ3A 5LNKA 4Z90A 3LK41 2MPKA 3OTOT 2QRXA 3O0EA 3PUWF 4TZ4C 2WM9A 1U5PA 2D2SA 2N2LA 2XUEA 3WI4A 4CQIA 1Q9GA 1BR1A 3ONJA 2R6GF 5JDGA 4DR3T 4JEUB 3JCUO 4U72A 4OX9T 5JDQA 2DWGA 2R89A 3OJAA 5H6QB 3PDYA 4NUVA 2CXDA 3UFGA 2K3WA 3RF1A 1VCSA 3NZPA 2A72A 3AA0B 1MIYA 3ESLA 2FGRA 3KFWX 5EE2A 3N2GE 4YTPA 2CA5A 1HR0T 4HEAA 5AQIB 2BG9B 3LFMA 2FGQX 1QUUA 1KNRA 4EIWA 1QJPA 2OV9A 1UUSA 2IC6A 4WNKA 3ZMTB 1ZOYA 5L3GB 3HW9A 2V8SV 4HFDA 3ZMUB 2XG6A 1QJ8A 5KMGP 2AXDS 3RYFE 3C4XA 4PJMA 4RLCA 4FMSA 2CEAA 3WI3A 2DLRA 5LHHB 2VWAA 2WMNA 4FQEA 5HAXA 3PURA 5ABGA 2AXTO 3FB2A 2Z6EA 4FSOA 1IBKT 3T0SA 3RH3A 4F4BA 3L3PA 3CQCB 3UU6A 3UAQA 4DR5T 4OK0A 2MTQA 3K1SA 2VASA 4JI7T 4EB6E 4F6RC 4MLKA 2LKGA 2MHLA 2XTQA 2LT3A 3DZMA 3FBZA 4I43B 2MYSA 2XAQB 5FVKA 2NP9A 5LMNT 2CCQA 2X9XA 4KX6A 1N34T 4OFZA 3P4WA 2JQYA 4JI6T 2WQYA 4U74A 3MZKB 1Q9FA 5CFBA 4C69X 3QB5K 4GIWA 1E2AA 1VCTA 3BQKA 3VRAA 2CBJA 4CTDA 1MPFA 3NVOA 3VE1A 2ACXA 3P4QA 3AAEB 4X20E 3QRAA 2HH7A 5CJ5A 1D1BA 1IBLT 4HWIB 4YJ3E 4EOZB 3A8YC 2PJQA 3FYXA 3Q5WA 3ZJ1A 3FZMB 2XSAA 1WR0A 3CWZB 3FZLB 4TV9E 2YINA 2CWOA 4GKKT 4O8SA 4U9CA 1HX1B 4OYJA 3ZKRA 2LSYA 2MOZA 4G2AA 4TNVA 4N75A 4N58A 4B3TT 2J1NA 5AFUL 4IDQA 3EHZA 3NJTA 4DV3T 2XAFB 3H3AA 2X0HA 2BG9A 4DR7T 3I9YA 4AKIA 4X64T 2Y6XA 2JPFA 5AQMB 3NSGA 1FEWA 5AQVB 4FRXA 3N9OA 2VL0A 2JQQA 4KBMB 2E2AA 4IDOA 2V7IA 3SOLA 3SFEA 2PTFA 1HNXT 5AQGB 3VE2A 4DV5T 3VZTX 3ZSTA 3AA1A 2W63A 1D1CA 2VKOA 4LFCT 2W66A 4PJ0O 2ES0A 4P1NA 3UU3A 2ZLYA 3UUXB 2A9UA 4U2YA 1VRBA 2WU2A 4HN9A 3ZC0A 2CXLA 3RYHE 3AE1A 4JI5T 3CQGB 1FJGT 4X62T 3OYZA 1ZHYA 3RYCE 5HWXA 4CXWA 1N32T 3AAAB 2GE4A 3UPGA 3DA3A 3CVRA 3PU3A 3E08A 3N9PA 1IJ5A 3I1AA 3VR9A 1O3XA 4CZZB 5JR9B 3UT5E 5HEUA 3RGLA 5C3JA 3C50A 2JMMA 3KDSE 2LFUA 3UUMA 3QC9A 2CWYA 5DQVA 3A5XA 3AA7B 3LSVA 4QH1A 4ZS3A 1X79A 1X9BA 5JDHA 2CLYB 2IMLA 2WWVA 2XQ9A 3J9X1 4B3ST 3D0TA 2V7KA 4XNKA 4QH5A 2BS3A 4C4VB 4H9RC 4QQ1A 4HWFA 4HE8A 2LHRA 2RA1A 3CKDA 1J1JA 4IL6O 4COFA 1BR0A 4UF0B 1XWMA 3A2SX 2VL8A 1KNPA 4GK0E 2OMFA 1U4QA 2ACZA 5TAOA 3AEGA 4PAGA 1SHZC 1T98A 4PJJA 2N1GA 3AEAA 1ZKEA 4JCHA 4ASKA 4KR8A 7PRNA 3OYXA 4E1TA 4O3YA 2M6BA 5DL8A 3PUAA 2J47A 4ZI2C 3FXEB 2R4NA 3B57A 2X0LB 3SY9A 2QVAA 5HXHA 2KDYA 3I0QA 2F1VA 1H6S1 1W09A 4TN7B 2YOEA 4NXNT 2EHOC 2UXDT 4C00A 3CX6B 1YQ4A 4ZI3C 2KMFA 5EK2A 1HG2A 4WBOA 4JFBA 2YPVA 2Y8DA 1GFOA 3L09A 3SWHA 3EVYA 1THQA 4YHJA 4FZNA 1WYCA 2LSGA 3C51A 5DL5A 4N74A 4DR4T 4O4XA 3IEEA 3RKOA 5F3JA 4AKLA 3HOLA 3OKQA 3L8RA 2UXNB 4UEMA 4XBFB 3RC3A 4DIDB 2M06A 5IHYA 2X66A 3RIFA 1HNWT 3AE3A 5FVNA 2WDVA 3PUGA 1HXUA 1ZHWA 5AQPB 4DNDA 2N9DA 4DMWA 1EZ3A 3JCFA 5KX5E 2V6YB 2DI4A 5JTGA 3AXJA 4O4LE 4TWFA 3ZN1B 5L2LA 3U78A 2ZM8A 3X1DA 2X9YA 4ZXLA 2ZMAA 2X9WA 4JBWF 3KVAA 2XAHB 3V8UA 5HEHA 1GQEA 2YK0A 4DV1T 4DMVA 5AQJB 3ZMZB 2KZ7B 3Q5EA 4UVCB 4UF0A 3QNUA 2CXFA 3AAAA 3RKGA 5EK3A 3HKCE 2XE2A 3FZFB 2UUCT 2HPJA 3CMLA 1OPFA 3F57A 3ZPOA 4AISA 4PK6A 8PRNA 3SRZA 3HKEE 3PGUA 2BKPA 2BKNA 3LBXA 3RC8A 2XQAA 3F2EA 4AXPA 4NXMT 4XAXB 4EV6A 4JV5T 4JLEA 1WCRA 1R8IA 2WJQA 4IDNA 4HGAA 4AKMA 2HPLA 3AECA 1IZNB 4IDZA 2MAWA 1HF8A 4AZLA 3EDUA 1BH3A 5KAIO 3ZC1A 5TISO 2H3RA 1GFQA 2C5IT 2I59A 3EUHA 2LEHA 5HCJA 1ZP0A 3C4WA 1D0XA 2W0GA 4X1YE 5GV0A 2X68A 4TWDA 2UUAT 4MHCA 3R6NA 2J62A 3LK2A 1LKXA 3QUJA 3L39A 2ODJA 1MMDA 5JDLA 2BS4A 5L47A 1YKHB 5H6RB 2WSSV 3UUBA 3ZMVB 4I4TE 2MBGA 1HCIA 4ERRA 1I6ZA 4CN6A 4O49A 4LFAT 1T1LA 3N9MA 4LMKA 3AVSA 3AAIA 3GP6A 2Y2XA 4LF4T 4RJXA 2V6YA 3AVRA 4PFOA 3VY9X 3UTKA 4H63V 4BAYB 1BR2A 4LSEA 5ADXK 2K9AA 4YT0A 4C90A 4LSFA 3T20A 2W62A 3PJAJ 2XM1A 2UU9T 4AYEC 2JQKA 4O4UA 4K3CA 2I0MA 1ZHZA 4YSYA 5IUXA 4FI5A 2LSKA 3CX8B 3EDVA 1MNDA 4EAHA 4X66T 2A3DA 2XE3A 2XAJB 3BS0A 2UXBT 2WMOA 3FHNA 5G26A 2DHRA 2HN1A 3Q2MA 3LJCA 4HTEA 5FXZA 3WI5A 3N2KE 5KXJA 4X1IE 5JH7E 2VURA 2W2UA 3WU2O 2WP9A 5AQSB 4EEDA 4JI3T 4YHHT 3PUXF 4IE0A 2IC9A 4P09A 2P9BA 3AEFA 3MK7C 4KR4A 2QGSA 4ZOLE 5AQUB 5DL7A 4IHJE 1T16A 2XQ4A 5JDFA 4WW0A 3B13A 4IREA 3NRYA 2V7MA 1PRNA 2XE1A 5T5FA 4L5GA 1IZNA 1L0VA 2FUPA 3VU7H 4BA9A 2MNHA 3VHLA 3BRYA 4V1Av 5DABA 5FY7A 4DO0A 2VQFT 3LBXB 4P0BA 4G63A 2IHR1 4QXBB 4BUMX 1OEDE 2XQ8A 5FKYA 2M6IA 2BBHA 1XZYA 4I55E 3TLVA 3AB3B 1ZEEA 2K4TA 5EK4A 5LG4A 1YD8G 3ZT5A 3A0HO 2PFVA 2FJDA 1UX4A 2VKJA
chains in the Genus database with same CATH topology
2JJ9A 4KRAA 4ZHQE 4HE8A 2LHRA 3POQA 3SYSA 2NTXA 2RA1A 5FXVA 3CKDA 5L3FB 2YU2A 3HL6A 1BR0A 4Z8XA 1GFNA 4PK5A 5HXSA 1CUNA 4UF0B 4X1KE 4AKGA 1UX5A 4AYDC 1E1HB 2K24A 3A2SX 2Q9QC 1WRDA 4O3ZA 3KV4A 3C4ZA 3PUQA 2YNKA 5LOVE 2VL8A 3ZMSB 2XTLA 2M07A 4GK0E 2OMFA 2C5KT 1U4QA 2GK9A 4O4JE 3J7Yq 4AKHA 5J2TE 4OYKA 2XTRA 5TAOA 4BJMA 4PAGA 4EYUA 1FIOA 3V5SA 2Q9QA 1OWAA 3RX6A 4GYRA 1SHZC 1T98A 1WR6A 4O2AE 1MM4A 1B7TA 2Y0HA 4PJJA 2N1GA 2B1EA 3KV5A 4TUYE 2L8KA 1ZKEA 4JCHA 3W15B 4FZMA 4ASKA 4KR8A 3MXZA 1SA0E 3OYXA 4O4IE 7PRNA 3HKDE 4GK5E 4GYSA 5L3BB 5LJMA 3AA0A 2Y7SA 4FUVA 4E1TA 3PU8A 1OXZA 4O3YA 1AJ3A 2KT9A 4PJNA 3PORA 3O1JA 4O4HE 2E9XC 5DL8A 3PUAA 4ZI2C 3FXEB 2NWBA 2K5BB 4PK4A 2KINB 2UXXB 3B57A 4GCSA 1BR4A 2X0LB 5JR9A 2LOPA 5JDMA 1G8XA 3SY9A 3ZN0B 1HTJF 3KBUA 3Q5XA 3GN5B 3G7GA 2LOSA 5HXHA 2E9XA 3NZQA 2KDYA 3PQSA 3I0QA 4AYMC 3LG7A 3LK3A 2F1VA 4IE4A 1H6S1 4TN7B 2VKHA 2EHOC 4B6XA 3JC6C 3HR0A 5JRCB 5DL6A 2ZM0A 4QX8B 2PBIA 2LSJA 2Q9QD 3CX6B 4ZI3C 1OSMA 2KLQA 2A2FX 2KMFA 4AQGA 4HKAA 2LE8A 2Y0KA 2C5JA 5LBQB 5EK2A 1HG2A 4WBOA 5HYAA 2PG8A 5E0OA 4JFBA 1S94A 4DBQA 2YPVA 5PRNA 3RBHA 2Y8DA 1GFOA 2LHFA 5JQGE 5JDPA 4XNLA 3ZEFB 3SS1A 2KNDA 3L09A 5HXRA 1MMGA 1ZV4X 3EVYA 2V26A 5FXWA 3SWHA 3K19A 4RL9A 4AFKA 4O2BE 4YHJA 1THQA 3DTOA 3PQUA 1G73A 1HX8A 4FZNA 1LVFA 3RRWA 2W61A 5AFUK 1WYCA 2LSGA 3KVDD 4ZI3D 3C51A 4YLHA 3ZYLA 2W81C 5CB4E 5LYJE 5DL5A 5LGTB 2NW7A 4O4XA 4G75A 3IEEA 4ISSA 4DVDA 1G90A 4D65A 1KK7A 4L0RA 2K0LA 4PNIA 3RKOA 3QK6A 2W80C 5F3JA 5ADXL 4E7ZA 4H9OC 4AKLA 1WLXA 5HWYA 4YFSA 3C98B 3OKQA 4H63H 3HOLA 2KC0A 4GF4A 4PUXA 2UXNB 4UEMA 4XBFB 3RC3A 5HXCA 4CI3B 3DJBA 5FMNA 4IIJE 4L9IA 2X27X 4M1PA 2M06A 2XE5A 5IHYA 3OBVE 2X66A 4UELA 3K3OA 5LNKA 2H7VC 3LK41 3RPUA 2D5UA 4KP3C 5FVNA 3RRCA 3PUGA 4JEHB 1HXUA 1ZHTA 2VK9A 1HS7A 1YS5A 2JRKA 1ZHWA 5A1LA 3O0EA 4TZ4C 5J1GA 3N9LA 3TKLB 4DNDA 2WM9A 4EZ4A 1U5PA 2D2SA 3MJXA 2N9DA 4DMWA 2N2LA 2XUEA 4WBNE 3WI4A 2W00A 2L9QA 1EZ3A 3S4UA 3E22E 1QJ9A 3GMIA 4CQIA 1Q9GA 5KX5E 1BR1A 2DI4A 5JDGA 1Y64B 2WWUA 3ETVA 2XASB 3MA9A 3ETUA 4JEUB 2LM9A 4O4LE 4U72A 6PRNA 1ORMA 5JDQA 3F31A 2BVLA 2DWGA 3ZN1B 1IAPA 5CA1E 5L2LA 3U78A 2ZM8A 4UXNB 3NRXA 3OJAA 5H6QB 2X9YA 3PDYA 4NUVA 2CXDA 2ZMAA 2X9WA 2LHNA 2QTKA 3KVAA 3AA7A 2XAHB 3V8UA 1YKEB 5JR9C 4K0UA 4ZS2A 4GOUA 3UU2A 2V1DB 3V5UA 4AI6A 2YK0A 3WAJA 3NZPA 3MKDA 4DMVA 4NUUA 3VZWX 2NOXA 5F8PA 2A72A 3AA0B 1MIYA 3HOEA 3ESLA 1MMNA 3ZMZB 2FGRA 2KZ7B 3KFWX 5EE2A 3N2GE 5JREA 4QHOA 5JDNA 2CA5A 3LK2B 2M67A 3ZLIA 4HEAA 1HXTA 4IE6A 3LFMA 4KUMB 5FNVE 4UVCB 3K3QC 4GCPA 4PFPA 3GA8A 4O3WA 2BDEA 2L3LA 4UF0A 4EZHA 1BXWA 2LSIA 2FGQX 1QUUA 2CXFA 3U3IA 4EIWA 3DP7A 3HI2A 3AAAA 3CX7B 2EHOB 2BVMA 1QJPA 1GFPA 5EK3A 3HKCE 2XE2A 2D0UA 2IW5B 2IC6A 4WNKA 2HPJA 1LRZA 3CMLA 1OPFA 3ZMTB 3BK9A 3F57A 5L3GB 3DA4A 3HW9A 4H9PC 4AYID 1US7B 3ZPOA 4IE7A 4PK6A 3ANWA 4MFRA 8PRNA 2XAGB 3SRZA 3HKEE 4CXXA 2ZM2A 3ONXA 3AA6B 3LBXA 3GWHA 3RC8A 3ZMUB 4FJOA 3F2EA 4UV8B 4AXPA 5KMGP 4XAXB 2X67A 3IF8B 1QJ8A 3SYBA 3RYFE 3C4XA 4JLEA 4XZCA 4PJMA 4RLCA 3HKBE 4FMSA 2CEAA 3WI3A 2DLRA 2Y0LA 5LHHB 3K3NA 4N59A 5LHIB 2VWAA 4HGAA 4AKMA 2HPLA 3O4XE 4FT6A 1IZNB 2WMNA 2N2MA 5C8YE 4IDZA 5HAXA 2E9XB 3EMNX 4AUIA 2ODUA 3PURA 1HF8A 2G0UA 4AZLA 3JC6D 3EDUA 2JMKA 3O1HA 4QX7B 4AYNA 1BH3A 3FB2A 2SPCA 3ZC1A 2H3RA 1GFQA 2Z6EA 4FSOA 2C5IT 2I59A 5LBMA 3EUHA 3T0SA 4ISTA 2LEHA 4PJLA 3C4WA 3RH3A 4F4BA 3PRNA 3L3PA 3CQCB 1D0XA 1BT9A 2W0GA 5FXXA 4X1YE 3UAQA 2H7OA 3PUSA 2N2NA 5GV0A 4UV9B 2X68A 1D1AA 2JMHA 2K48A 2KWHA 4E1SA 3N9QA 2DNXA 4MHCA 4OK0A 3R6NA 2MTQA 2D0TA 2Q9QB 2VASA 1S35A 4H9SE 4EB6E 4JUYA 4CXYA 1LVKA 2ZFGA 4AQFC 4F6RC 3LK2A 4RLBA 1LKXA 4MLKA 4I50E 3ZYMA 5IYZE 1MMAA 2MHLA 3QUJA 2ODJA 5FYMA 5HXEA 5LGNB 1MMDA 4N78D 5LGUB 3E0ZA 3FBLA 5JDLA 5ETWA 3VKHA 1ZHXA 2XTQA 1YKHB 2LT3A 2Y48B 3FBZA 2WSSV 4I43B 2MYSA 2XAQB 5H6RB 5LJNA 3O9XA 2IAKA 4P0AA 2F1TA 2NP9A 3CPZA 3POXA 3ZMVB 4I4TE 2CCQA 2WBLA 2X9XA 2MBGA 1HCIA 1D0ZA 2X9HA 4UVBB 2C0SA 4ANJA 1PHOA 4DBRA 4ERRA 4OFZA 2NTYA 3RYIE 4AKRA 4O49A 3T8OA 3WAKA 3ZYKA 3IHRA 4U74A 2ERVA 1FMWA 3N9MA 3UFEA 3MZKB 5LA6E 2NW8A 1Q9FA 2KXPB 4EYYR 4EXTA 4ZI7E 4GIWA 5CA0E 4LSHA 4C69X 3AVSA 3AAIA 3GP6A 3BQKA 3ZJ2A 2Y2XA 1MNEA 4RJXA 3N9NA 2VKDA 1MPFA 4UVAB 4YJ2E 3PTRB 3VKGA 5D5DA 3VE1A 2ACXA 5JVDE 3AVRA 4PFOA 4X20E 3AAEB 3QRAA 2HH7A 3VY9X 3UTKA 4H63V 1D1BA 1NAFA 4KMCA 4YJ3E 4BAYB 4EOZB 1BR2A 3BQLA 2KXPA 2CM0A 2PJQA 4LSEA 3FYXA 2ZLDA 3Q5WA 3ZJ1A 5ADXK 5DJQC 2K9AA 2OA5A 3CWZB 3VZUX 4TX5A 4C90A 4Z3TA 4TV9E 5DQWA 5LHGB 2YINA 2CWOA 2KZ7A 2PORA 4O8SA 4U9CA 4LSFA 2CE7A 4OYJA 2V7LA 3T20A 2LSYA 4O3XB 4QWNB 2MOZA 4G2AA 2W62A 3AAEA 4N58A 3UULA 2J1NA 5AFUL 4IE5A 4AYEC 3R84B 1YW0A 3VY8X 2XAFB 3H3AA 5LXTE 3TZGA 3O1IA 1P4TA 2ODVA 4O4UA 4HFVA 5L3EB 3I9YA 4AKIA 3KV9A 4G76A 2BZBA 2J1DG 1ZHZA 3JTYA 2Y6XA 1WYBA 3BQIA 4ILUA 2NW9A 2O4VA 4FI5A 2JPFA 2LSKA 3EDVA 3CX8B 3IBPA 4QXCB 1MNDA 1E54A 4EAHA 3NSGA 2A3DA 1HG5A 4FZLA 1FEWA 3KINB 3KVBA 4MBQA 2PRNA 2XE3A 2XAJB 3SZVA 3HWBA 4FRXA 2WMOA 3FHNA 1MIVA 3C5OA 5G26A 1Z0PA 2DHRA 3N9OA 4FSPA 3Q2MA 3LJCA 4C91A 4HTEA 2YEVC 1QSDA 5LP6E 3ZCIA 3ZCJA 5FXZA 2JQQA 2EHOD 3WI5A 1V9DA 3GN5A 3N2KE 4KBMB 4X1IE 4GHBA 4B61A 5L3CB 2V7IA 5JH7E 5J2UE 5JRCA 3SOLA 2XHEB 3VE2A 1FMVA 3K8PC 3P8CD 3VZTX 4ADZA 2DWKA 3CQXC 5EZYE 3SY7A 3AA1A 4BJNA 1UCUA 4ZI2D 4A56A 5IYUA 4IE0A 1HFAA 2E9XD 5BMVE 2IC9A 2W63A 1D1CA 2QA7A 2P9BA 2VKOA 3ANWB 4P09A 1IJ6A 4QKNA 2CLYC 3Q9DA 2XG6A 4LSIA 2KWIB 2ES0A 2XMXA 3MK7C 4MALA 2ZLYA 3UUXB 2X51A 4KR4A 3KV6A 1VRBA 2QGSA 3LK3B 4ZOLE 4HN9A 3ZC0A 5DL7A 2CMRA 2CXLA 2E8IA 4IHJE 4RJWA 1ZHCA 3RYHE 3M65A 3CQGB 1H7CA 1KNZA 4IGUA 4CI1B 5M4YA 4GCQA 5JDFA 2YU1A 4WW0A 3B13A 3UUNA 3NRYA 2V7MA 3OYZA 4QXHB 1PRNA 5KDMC 1ZHYA 2XE1A 5T5FA 4L5GA 2WAUA 3RYCE 1IZNA 3I9WA 5HWXA 4CXWA 4UIGA 3KBTA 4E7SA 1VOMA 3MACA 3AAAB 3VU7H 2GE4A 3UPGA 3HA4A 2RP4A 5GONE 5LCYA 4BA9A 4H9NC 2VB6A 2MNHA 3DA3A 3CVRA 3VHLA 4FRTA 2LJLA 3PU3A 2J4UP 3E08A 3N9PA 4TV8E 4H9QC 1IJ5A 4PW8A 3I1AA 1O3XA 4V1Av 3AA1B 1MM5A 3LK42 5DABA 5FY7A 4DO0A 5FP3A 4CZZB 3LBXB 3AA6A 3PE0A 4AKRB 2V7JA 3NBXX 5JR9B 3UT5E 3C50A 3H37A 4P0BA 4G63A 2JMMA 3QRCA 3C64A 3KDSE 3FXDB 5FY1A 4OHFA 1D0YA 3UUMA 2LFUA 4QXBB 3QC9A 2CWYA 5FY0A 4AQFA 5L3DB 1GFMA 4BUMX 4D5UA 3N2OA 5DQVA 3A5XA 3AA7B 4ZS3A 4I55E 2EHOA 1X79A 3I0OA 4FOZA 3AB3B 1ZEEA 5JDHA 5EK4A 2K4TA 3POUA 1NWMX 3P7IA 2CLYB 4CI2B 2XQYA 4FESA 4D64A 5LG4A 3J9X1 1YD8G 3T24A 2DCFA 1HXXA 1MIWA 3D0TA 2V7KA 4XNKA 2PFVA 3SZDA 4H9RC 4QQ1A 3N5LA 1UX4A 2VKJA 4J2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK3 A;  2KZ7 A;  3AA1 A;  3AAA A;  3AAE A;  3AA7 A;  1IZN A;  3AA0 A;  5AFU L;  5ADX L;  3AA7 B;  1IZN B;  3AAE B;  3AAA B;  3LK2 A;  3AA0 B;  3LK3 B;  2KXP A;  2KZ7 B;  4AKR A;  3AA6 B;  3AA1 B;  3LK4 2;  3LK2 B;  5AFU K;  5ADX K;  3LK4 1;  3AA6 A;  4AKR B;  2KXP B; 
#chains in the Genus database with same CATH topology
 4ZHQ E;  3NKZ A;  3ZT6 A;  5FXV A;  3RIA A;  2YU2 A;  3JAF A;  1UUR A;  4Z8X A;  5HXS A;  1UX5 A;  1E1H B;  2K24 A;  2Q9Q C;  4LF7 T;  5GTH O;  5LOV E;  2M07 A;  3RIU A;  4AKH A;  4OYK A;  1FIO A;  3ABV A;  3ZT7 A;  1B7T A;  3KV5 A;  2J4G A;  1SA0 E;  4GK5 E;  5L3B B;  2Y7S A;  1OXZ A;  2KT9 A;  4PJN A;  2E9X C;  2UXX B;  4GCS A;  1G8X A;  1HTJ F;  3KBU A;  3AED A;  4AYM C;  4B6X A;  4QX8 B;  2PBI A;  1T7S A;  4AQG A;  2Y0K A;  2LE8 A;  2C5J A;  5HYA A;  5PRN A;  1S94 A;  5LMU T;  3RBH A;  3RI5 A;  3ZEF B;  3SS1 A;  5HXR A;  4RL9 A;  4AFK A;  2V26 A;  3AEB A;  4O2B E;  3DTO A;  1G73 A;  1HX8 A;  1LVF A;  3H3M A;  3RRW A;  2W61 A;  5AFU K;  5LYJ E;  5LGT B;  1KEY A;  2R8A A;  4D65 A;  3PUY F;  4H9O C;  4H63 H;  3PUV F;  2KC0 A;  2WB5 A;  4CI3 B;  4WZX A;  5FMN A;  2V5C A;  4L9I A;  4M1P A;  2FBW A;  3OBV E;  4UEL A;  4KP3 C;  4EGW A;  3UQ4 A;  4JEH B;  1ZHT A;  2VK9 A;  2WCA A;  1YS5 A;  2JRK A;  2B76 A;  2R88 A;  5A1L A;  3PGR A;  5J1G A;  3N9L A;  3MJX A;  2W00 A;  2L9Q A;  3S4U A;  1QJ9 A;  3GMI A;  4NPP A;  5GTI O;  2WWU A;  2XAS B;  3MA9 A;  2LM9 A;  6PRN A;  2OLT A;  4IT4 A;  1IAP A;  4UXN B;  3NRX A;  2V6X A;  5H2F O;  3Q5D A;  2QTK A;  1YKE B;  5JR9 C;  4ZS2 A;  4ZZC A;  2H88 A;  4GOU A;  3UU2 A;  2V1D B;  3V5U A;  2WVP A;  3WAJ A;  1UK5 A;  3MKD A;  4NUU A;  2QYW A;  3VZW X;  2NOX A;  4HWH A;  5F8P A;  1MMN A;  5JRE A;  5JDN A;  2M67 A;  3ZLI A;  4QH4 A;  4KUM B;  5FNV E;  4GCP A;  5LG3 A;  2BDE A;  2L3L A;  1XDP A;  2LSI A;  3U3I A;  3CK6 A;  2BBJ A;  3DP7 A;  4HFB A;  2BVM A;  1GFP A;  2YKS A;  4YTM A;  2IW5 B;  1LRZ A;  5AQH B;  3BK9 A;  3DA4 A;  4AYI D;  4IE7 A;  3ANW A;  4MFR A;  2XAG B;  4K3B A;  4CXX A;  4HFI A;  3ONX A;  4X5T A;  3AA6 B;  3SFD A;  3GWH A;  5HEG A;  4F8H A;  4XZC A;  2VVS A;  3HKB E;  3K3N A;  4N59 A;  2YDR A;  3O4X E;  4FT6 A;  4JI8 T;  2ODU A;  3JC6 D;  2JMK A;  2HHH T;  3O1H A;  4QX7 B;  3RQW A;  4AYN A;  2SPC A;  1XNQ T;  2W67 A;  4IST A;  4LF5 T;  3CIR A;  4PJL A;  2IWW A;  3RQU A;  3EI0 A;  1BT9 A;  4KHZ F;  3PUS A;  2F4V T;  4KHP T;  4E1S A;  4I0U A;  2DNX A;  2D0T A;  4DR1 T;  1S35 A;  2ZFG A;  3ZYM A;  5IYZ E;  2RPA A;  4LFB T;  1MMA A;  5HXE A;  5LGU B;  4UR9 A;  3E0Z A;  4YSZ A;  3FBL A;  3FZK B;  3VKH A;  5ABF A;  2IAK A;  1I94 T;  3POX A;  2WBL A;  2IWV A;  1D0Z A;  2X9H A;  4ANJ A;  3AE5 A;  3T8O A;  3WAK A;  3ZYK A;  3IHR A;  1FMW A;  5LA6 E;  5AQQ B;  4EXT A;  5CA0 E;  4LSH A;  5FL0 A;  3ZJ2 A;  3G06 A;  2VKD A;  4YJ2 E;  3VKG A;  3T1Y T;  5JVD E;  5C2T A;  4KMC A;  3BQL A;  2KXP A;  2ZLD A;  5DJQ C;  3VZU X;  4ILC A;  4TX5 A;  4Z3T A;  5DQW A;  5LHG B;  2CHO A;  4JI0 T;  4HFH A;  4LMJ A;  4O3X B;  4QWN B;  3AAE A;  3UUL A;  3OVU A;  3R84 B;  2X0Y A;  5LXT E;  1P4T A;  2ODV A;  3FZH B;  3TLU A;  4HFV A;  5J0Z A;  4NIQ A;  5L3E B;  2WY2 A;  4G76 A;  4ILU A;  1XDO A;  2NW9 A;  2O4V A;  3IBP A;  4WYV A;  4DUZ T;  1HG5 A;  3KIN B;  3KVB A;  3VR8 A;  3HWB A;  3C5O A;  1MIV A;  4FSP A;  4C91 A;  5G3A A;  3ZCJ A;  2EHO D;  1V9D A;  3GN5 A;  4YXD A;  5FVL A;  2WJR A;  4B61 A;  5JRC A;  2XHE B;  3ZSS A;  1FMV A;  3AE4 A;  3K8P C;  3P8C D;  2DWK A;  5EZY E;  4BJN A;  1UCU A;  4K0K T;  2JQH A;  2HN2 A;  1HFA A;  5BMV E;  2QA7 A;  1JNZ A;  1IJ6 A;  4QKN A;  3AE7 A;  4MAL A;  4A98 A;  2CMR A;  2E8I A;  4RJW A;  1H7C A;  1KNZ A;  4IGU A;  5M4Y A;  4QXH B;  2WS3 A;  2WAU A;  3I9W A;  3JAD A;  3MAC A;  3HA4 A;  5LCY A;  2WDR A;  4FRT A;  4TV8 E;  1Y01 A;  3AA6 A;  3PE0 A;  2V7J A;  3BRZ A;  4X65 T;  1N36 T;  2BG9 C;  3QRC A;  4OHF A;  1D0Y A;  5FY0 A;  3RHW A;  4DR6 T;  3N2O A;  3PV0 F;  3I0O A;  4FOZ A;  3POU A;  4DR2 T;  2BG9 E;  3T24 A;  1HXX A;  2NR4 A;  1N33 T;  3N5L A;  4KRA A;  2CPT A;  3POQ A;  2NTX A;  5L3F B;  3PJA A;  5FL1 A;  1GFN A;  2V5D A;  1CUN A;  4X1K E;  1SUM B;  4AYD C;  3KV4 A;  1T72 A;  3ZMS B;  2XTL A;  1J5E T;  4AIU A;  2AE9 A;  5J2T E;  2XTR A;  1M62 A;  4EYU A;  3V5S A;  2Q9Q A;  2Y0H A;  1WR6 A;  3EAM A;  1XMO T;  4LF9 T;  4FZM A;  3MXZ A;  3HKD E;  4DV6 T;  3AE9 A;  2W4X A;  3PU8 A;  3POR A;  4O4H E;  5IWA T;  2R4P A;  1BR4 A;  2KSR A;  3Q5X A;  4B3M T;  2E9X A;  3NZQ A;  3PQS A;  3LG7 A;  2VKH A;  2E5L T;  2LSJ A;  1OSM A;  2A2F X;  4EEB A;  4HKA A;  5LBQ B;  4HWC A;  2PG8 A;  5JQG E;  2ZM6 T;  5FXW A;  2WDQ A;  2IIU A;  5ABE A;  3KVD D;  4YLH A;  3ZYL A;  2W81 C;  5G39 A;  2NW7 A;  3KZI O;  2YDQ A;  2XPK A;  2FJE A;  3UU8 A;  4DVD A;  1G90 A;  2K0L A;  1OED A;  4PNI A;  3RIU C;  2W80 C;  3EAB A;  5ADX L;  4Z91 A;  3C98 B;  2IUB A;  4IIJ E;  4U2Z A;  4ILB A;  1IBM T;  2FJA A;  4UB6 O;  4HFC A;  2R4L A;  2H7V C;  3RPU A;  2D5U A;  3RRC A;  2F1C X;  1HS7 A;  4GKJ T;  2I6H A;  3TKL B;  4EZ4 A;  3UQ7 A;  3OPC A;  5AQN B;  4WBN E;  3E22 E;  1Y64 B;  1E7P A;  3ETV A;  3ETU A;  4ZEY A;  1ORM A;  2XQ7 A;  3F31 A;  2BVL A;  5CA1 E;  4PR7 A;  4DV4 T;  2LHN A;  3QB5 A;  3AA7 A;  4K0U A;  5HEJ A;  4JI1 T;  3VRB A;  4AI6 A;  3AE8 A;  2XM2 A;  4U3C A;  2R4O A;  3HOE A;  4QHO A;  2CRB A;  3LK2 B;  1HXT A;  4IE6 A;  3K3Q C;  4PFP A;  4A5X A;  1M7K A;  3GA8 A;  4EZH A;  1BXW A;  4O3W A;  3HI2 A;  3CX7 B;  2EHO B;  2D0U A;  4CN1 A;  4H9P C;  1US7 B;  3T1H T;  1NEK A;  2ZM2 A;  5B66 O;  4FJO A;  4UV8 B;  4IDP A;  2X67 A;  3IF8 B;  2UXC T;  3SYB A;  1KFY A;  4DV2 T;  4LML A;  2JQ9 A;  2Y0L A;  2LKH A;  3AE2 A;  5LHI B;  3A0B O;  3IA3 A;  2N2M A;  4CN4 A;  4HFE A;  5C8Y E;  2E9X B;  3EMN X;  2XSB A;  4AUI A;  2FJB A;  2G0U A;  4C4V A;  4ILA A;  5LBM A;  5G38 A;  3PRN A;  5FXX A;  4B3R T;  2H7O A;  2N2N A;  4UV9 B;  1JNR A;  1D1A A;  2JMH A;  2K48 A;  2KWH A;  3N9Q A;  2D9D A;  1WFD A;  4HWD A;  2Q9Q B;  4H9S E;  4JUY A;  4CXY A;  1LVK A;  4AQF C;  4RLB A;  4I50 E;  1SE7 A;  5FYM A;  3JAE A;  3AXJ B;  4U7Y A;  5LGN B;  4N78 D;  4JI2 T;  4TWH A;  5AQR B;  5ETW A;  3M3Z B;  1ZHX A;  5LJN A;  3TLS A;  2Y48 B;  3O9X A;  4P0A A;  2F1T A;  3CPZ A;  2E5V A;  1UGO A;  3P4P A;  2CHN A;  4UVB B;  1PHO A;  2C0S A;  4DBR A;  2NTY A;  3RYI E;  4AKR A;  1OED C;  2ERV A;  2LRK A;  3UFE A;  2NW8 A;  2KXP B;  4EYY R;  2WZH A;  4ZI7 E;  5KAF O;  1MNE A;  1NEN A;  2YDS A;  3N9N A;  4UVA B;  3PTR B;  5D5D A;  5BR8 T;  2IDO B;  1NAF A;  1HNZ T;  4TNW A;  2CM0 A;  4U7I A;  2OA5 A;  1CHU A;  3PUZ F;  2KZ7 A;  2POR A;  2CE7 A;  2V7L A;  3UU4 A;  4IE5 A;  3NWI A;  5F5W A;  1YW0 A;  2JIW A;  3VY8 X;  3TZG A;  3O1I A;  2XZE A;  3KV9 A;  2BZB A;  2J1D G;  4U33 A;  3JTY A;  4DV0 T;  1WYB A;  3BQI A;  1W0A A;  4QXC B;  4U31 A;  1YXR A;  1E54 A;  2XQ6 A;  4FZL A;  4MBQ A;  2PRN A;  3SZV A;  5AQK B;  5AQO B;  1Z0P A;  2YEV C;  1QSD A;  5LP6 E;  3ZCI A;  2DL1 A;  1W9R A;  4GHB A;  5L3C B;  3AE6 A;  5J2U E;  5LB7 B;  3LDQ B;  4ADZ A;  3CQX C;  3SY7 A;  4ZI2 D;  5L4H A;  3DWO X;  4A56 A;  5IYU A;  2E9X D;  5HCM A;  5ABF B;  1XNR T;  3ANW B;  4IL4 A;  2CLY C;  3Q9D A;  4LSI A;  2KWI B;  2XMX A;  5CGM A;  2X51 A;  3KV6 A;  3P4S A;  3LK3 B;  4LF6 T;  1ZHC A;  4AQY T;  3M65 A;  5HEO A;  2VVN A;  4CI1 B;  3B5M A;  5B5E O;  4GCQ A;  2YU1 A;  3UUN A;  5KDM C;  5L4E A;  4KI0 F;  4UIG A;  3KBT A;  4E7S A;  1DU2 A;  3DWN A;  1VOM A;  4A97 A;  2RP4 A;  5GON E;  2H89 A;  2VB6 A;  4H9N C;  2LJL A;  3PF1 A;  2J4U P;  5AQL B;  4H9Q C;  4PW8 A;  3AA1 B;  1MM5 A;  3LK4 2;  2X9K A;  5FP3 A;  3UU5 A;  4AKR B;  3AEE A;  3NBX X;  4ZZB A;  2LM2 A;  3H37 A;  2LRL A;  3C64 A;  3FXD B;  3P50 A;  4JI4 T;  5FY1 A;  4AQF A;  5L3D B;  1GFM A;  4D5U A;  2XJ7 A;  2EHO A;  3P4R A;  1NWM X;  3P7I A;  1Z8U A;  2XQY A;  4CI2 B;  4FES A;  4D64 A;  2DCF A;  1MIW A;  1S5L O;  3SZD A;  1YQ3 A;  4YY3 T;  3RLF F;  4J2C A;  2JJ9 A;  2BS2 A;  3SYS A;  3HL6 A;  1T8B A;  4PK5 A;  4AKG A;  2YN6 A;  1WRD A;  4O3Z A;  2UUB T;  3C4Z A;  3PUQ A;  2YNK A;  4LF8 T;  2C5K T;  2GK9 A;  3J7Y q;  4O4J E;  3QOF A;  4BJM A;  3A7M A;  3ONL C;  4YTN A;  3TLW A;  1OWA A;  2BKO A;  3RX6 A;  4GYR A;  4O2A E;  1MM4 A;  4UB8 O;  1XMQ T;  2B1E A;  4TUY E;  2L8K A;  4IL9 A;  3W15 B;  4O4I E;  4GYS A;  5LJM A;  3AA0 A;  1QLB A;  4FUV A;  4DV7 T;  1AJ3 A;  3O1J A;  2XY8 B;  3PGS A;  2NWB A;  2K5B B;  4PK4 A;  2KIN B;  5E79 O;  5JR9 A;  2LOP A;  5JDM A;  3ZN0 B;  3GN5 B;  3G7G A;  2LOS A;  4YSX A;  5ABH A;  3LK3 A;  4IE4 A;  5JRC B;  3JC6 C;  3HR0 A;  5DL6 A;  2ZM0 A;  2Q9Q D;  2KLQ A;  5E0O A;  4DBQ A;  5JDP A;  1OED B;  2LHF A;  4XNL A;  2KND A;  3K19 A;  1MMG A;  1ZV4 X;  2LLY A;  1J5W A;  3PQU A;  2VQE T;  4ZI3 D;  5CB4 E;  4G75 A;  4Q25 A;  4ISS A;  1KK7 A;  4L0R A;  4DUY T;  3QK6 A;  4E7Z A;  1WLX A;  2CBI A;  5HWY A;  4YFS A;  5AQF B;  4GF4 A;  4PUX A;  1W0B A;  2WZI A;  5HXC A;  3DJB A;  5AQT B;  4JYA T;  2WU5 A;  2X27 X;  2XE5 A;  1KF6 A;  2XQ5 A;  3TLT A;  3K3O A;  2XQ3 A;  5LNK A;  4Z90 A;  3LK4 1;  2MPK A;  3OTO T;  2QRX A;  3O0E A;  3PUW F;  4TZ4 C;  2WM9 A;  1U5P A;  2D2S A;  2N2L A;  2XUE A;  3WI4 A;  4CQI A;  1Q9G A;  1BR1 A;  3ONJ A;  2R6G F;  5JDG A;  4DR3 T;  4JEU B;  3JCU O;  4U72 A;  4OX9 T;  5JDQ A;  2DWG A;  2R89 A;  3OJA A;  5H6Q B;  3PDY A;  4NUV A;  2CXD A;  3UFG A;  2K3W A;  3RF1 A;  1VCS A;  3NZP A;  2A72 A;  3AA0 B;  1MIY A;  3ESL A;  2FGR A;  3KFW X;  5EE2 A;  3N2G E;  4YTP A;  2CA5 A;  1HR0 T;  4HEA A;  5AQI B;  2BG9 B;  3LFM A;  2FGQ X;  1QUU A;  1KNR A;  4EIW A;  1QJP A;  2OV9 A;  1UUS A;  2IC6 A;  4WNK A;  3ZMT B;  1ZOY A;  5L3G B;  3HW9 A;  2V8S V;  4HFD A;  3ZMU B;  2XG6 A;  1QJ8 A;  5KMG P;  2AXD S;  3RYF E;  3C4X A;  4PJM A;  4RLC A;  4FMS A;  2CEA A;  3WI3 A;  2DLR A;  5LHH B;  2VWA A;  2WMN A;  4FQE A;  5HAX A;  3PUR A;  5ABG A;  2AXT O;  3FB2 A;  2Z6E A;  4FSO A;  1IBK T;  3T0S A;  3RH3 A;  4F4B A;  3L3P A;  3CQC B;  3UU6 A;  3UAQ A;  4DR5 T;  4OK0 A;  2MTQ A;  3K1S A;  2VAS A;  4JI7 T;  4EB6 E;  4F6R C;  4MLK A;  2LKG A;  2MHL A;  2XTQ A;  2LT3 A;  3DZM A;  3FBZ A;  4I43 B;  2MYS A;  2XAQ B;  5FVK A;  2NP9 A;  5LMN T;  2CCQ A;  2X9X A;  4KX6 A;  1N34 T;  4OFZ A;  3P4W A;  2JQY A;  4JI6 T;  2WQY A;  4U74 A;  3MZK B;  1Q9F A;  5CFB A;  4C69 X;  3QB5 K;  4GIW A;  1E2A A;  1VCT A;  3BQK A;  3VRA A;  2CBJ A;  4CTD A;  1MPF A;  3NVO A;  3VE1 A;  2ACX A;  3P4Q A;  3AAE B;  4X20 E;  3QRA A;  2HH7 A;  5CJ5 A;  1D1B A;  1IBL T;  4HWI B;  4YJ3 E;  4EOZ B;  3A8Y C;  2PJQ A;  3FYX A;  3Q5W A;  3ZJ1 A;  3FZM B;  2XSA A;  1WR0 A;  3CWZ B;  3FZL B;  4TV9 E;  2YIN A;  2CWO A;  4GKK T;  4O8S A;  4U9C A;  1HX1 B;  4OYJ A;  3ZKR A;  2LSY A;  2MOZ A;  4G2A A;  4TNV A;  4N75 A;  4N58 A;  4B3T T;  2J1N A;  5AFU L;  4IDQ A;  3EHZ A;  3NJT A;  4DV3 T;  2XAF B;  3H3A A;  2X0H A;  2BG9 A;  4DR7 T;  3I9Y A;  4AKI A;  4X64 T;  2Y6X A;  2JPF A;  5AQM B;  3NSG A;  1FEW A;  5AQV B;  4FRX A;  3N9O A;  2VL0 A;  2JQQ A;  4KBM B;  2E2A A;  4IDO A;  2V7I A;  3SOL A;  3SFE A;  2PTF A;  1HNX T;  5AQG B;  3VE2 A;  4DV5 T;  3VZT X;  3ZST A;  3AA1 A;  2W63 A;  1D1C A;  2VKO A;  4LFC T;  2W66 A;  4PJ0 O;  2ES0 A;  4P1N A;  3UU3 A;  2ZLY A;  3UUX B;  2A9U A;  4U2Y A;  1VRB A;  2WU2 A;  4HN9 A;  3ZC0 A;  2CXL A;  3RYH E;  3AE1 A;  4JI5 T;  3CQG B;  1FJG T;  4X62 T;  3OYZ A;  1ZHY A;  3RYC E;  5HWX A;  4CXW A;  1N32 T;  3AAA B;  2GE4 A;  3UPG A;  3DA3 A;  3CVR A;  3PU3 A;  3E08 A;  3N9P A;  1IJ5 A;  3I1A A;  3VR9 A;  1O3X A;  4CZZ B;  5JR9 B;  3UT5 E;  5HEU A;  3RGL A;  5C3J A;  3C50 A;  2JMM A;  3KDS E;  2LFU A;  3UUM A;  3QC9 A;  2CWY A;  5DQV A;  3A5X A;  3AA7 B;  3LSV A;  4QH1 A;  4ZS3 A;  1X79 A;  1X9B A;  5JDH A;  2CLY B;  2IML A;  2WWV A;  2XQ9 A;  3J9X 1;  4B3S T;  3D0T A;  2V7K A;  4XNK A;  4QH5 A;  2BS3 A;  4C4V B;  4H9R C;  4QQ1 A;  4HWF A;  4HE8 A;  2LHR A;  2RA1 A;  3CKD A;  1J1J A;  4IL6 O;  4COF A;  1BR0 A;  4UF0 B;  1XWM A;  3A2S X;  2VL8 A;  1KNP A;  4GK0 E;  2OMF A;  1U4Q A;  2ACZ A;  5TAO A;  3AEG A;  4PAG A;  1SHZ C;  1T98 A;  4PJJ A;  2N1G A;  3AEA A;  1ZKE A;  4JCH A;  4ASK A;  4KR8 A;  7PRN A;  3OYX A;  4E1T A;  4O3Y A;  2M6B A;  5DL8 A;  3PUA A;  2J47 A;  4ZI2 C;  3FXE B;  2R4N A;  3B57 A;  2X0L B;  3SY9 A;  2QVA A;  5HXH A;  2KDY A;  3I0Q A;  2F1V A;  1H6S 1;  1W09 A;  4TN7 B;  2YOE A;  4NXN T;  2EHO C;  2UXD T;  4C00 A;  3CX6 B;  1YQ4 A;  4ZI3 C;  2KMF A;  5EK2 A;  1HG2 A;  4WBO A;  4JFB A;  2YPV A;  2Y8D A;  1GFO A;  3L09 A;  3SWH A;  3EVY A;  1THQ A;  4YHJ A;  4FZN A;  1WYC A;  2LSG A;  3C51 A;  5DL5 A;  4N74 A;  4DR4 T;  4O4X A;  3IEE A;  3RKO A;  5F3J A;  4AKL A;  3HOL A;  3OKQ A;  3L8R A;  2UXN B;  4UEM A;  4XBF B;  3RC3 A;  4DID B;  2M06 A;  5IHY A;  2X66 A;  3RIF A;  1HNW T;  3AE3 A;  5FVN A;  2WDV A;  3PUG A;  1HXU A;  1ZHW A;  5AQP B;  4DND A;  2N9D A;  4DMW A;  1EZ3 A;  3JCF A;  5KX5 E;  2V6Y B;  2DI4 A;  5JTG A;  3AXJ A;  4O4L E;  4TWF A;  3ZN1 B;  5L2L A;  3U78 A;  2ZM8 A;  3X1D A;  2X9Y A;  4ZXL A;  2ZMA A;  2X9W A;  4JBW F;  3KVA A;  2XAH B;  3V8U A;  5HEH A;  1GQE A;  2YK0 A;  4DV1 T;  4DMV A;  5AQJ B;  3ZMZ B;  2KZ7 B;  3Q5E A;  4UVC B;  4UF0 A;  3QNU A;  2CXF A;  3AAA A;  3RKG A;  5EK3 A;  3HKC E;  2XE2 A;  3FZF B;  2UUC T;  2HPJ A;  3CML A;  1OPF A;  3F57 A;  3ZPO A;  4AIS A;  4PK6 A;  8PRN A;  3SRZ A;  3HKE E;  3PGU A;  2BKP A;  2BKN A;  3LBX A;  3RC8 A;  2XQA A;  3F2E A;  4AXP A;  4NXM T;  4XAX B;  4EV6 A;  4JV5 T;  4JLE A;  1WCR A;  1R8I A;  2WJQ A;  4IDN A;  4HGA A;  4AKM A;  2HPL A;  3AEC A;  1IZN B;  4IDZ A;  2MAW A;  1HF8 A;  4AZL A;  3EDU A;  1BH3 A;  5KAI O;  3ZC1 A;  5TIS O;  2H3R A;  1GFQ A;  2C5I T;  2I59 A;  3EUH A;  2LEH A;  5HCJ A;  1ZP0 A;  3C4W A;  1D0X A;  2W0G A;  4X1Y E;  5GV0 A;  2X68 A;  4TWD A;  2UUA T;  4MHC A;  3R6N A;  2J62 A;  3LK2 A;  1LKX A;  3QUJ A;  3L39 A;  2ODJ A;  1MMD A;  5JDL A;  2BS4 A;  5L47 A;  1YKH B;  5H6R B;  2WSS V;  3UUB A;  3ZMV B;  4I4T E;  2MBG A;  1HCI A;  4ERR A;  1I6Z A;  4CN6 A;  4O49 A;  4LFA T;  1T1L A;  3N9M A;  4LMK A;  3AVS A;  3AAI A;  3GP6 A;  2Y2X A;  4LF4 T;  4RJX A;  2V6Y A;  3AVR A;  4PFO A;  3VY9 X;  3UTK A;  4H63 V;  4BAY B;  1BR2 A;  4LSE A;  5ADX K;  2K9A A;  4YT0 A;  4C90 A;  4LSF A;  3T20 A;  2W62 A;  3PJA J;  2XM1 A;  2UU9 T;  4AYE C;  2JQK A;  4O4U A;  4K3C A;  2I0M A;  1ZHZ A;  4YSY A;  5IUX A;  4FI5 A;  2LSK A;  3CX8 B;  3EDV A;  1MND A;  4EAH A;  4X66 T;  2A3D A;  2XE3 A;  2XAJ B;  3BS0 A;  2UXB T;  2WMO A;  3FHN A;  5G26 A;  2DHR A;  2HN1 A;  3Q2M A;  3LJC A;  4HTE A;  5FXZ A;  3WI5 A;  3N2K E;  5KXJ A;  4X1I E;  5JH7 E;  2VUR A;  2W2U A;  3WU2 O;  2WP9 A;  5AQS B;  4EED A;  4JI3 T;  4YHH T;  3PUX F;  4IE0 A;  2IC9 A;  4P09 A;  2P9B A;  3AEF A;  3MK7 C;  4KR4 A;  2QGS A;  4ZOL E;  5AQU B;  5DL7 A;  4IHJ E;  1T16 A;  2XQ4 A;  5JDF A;  4WW0 A;  3B13 A;  4IRE A;  3NRY A;  2V7M A;  1PRN A;  2XE1 A;  5T5F A;  4L5G A;  1IZN A;  1L0V A;  2FUP A;  3VU7 H;  4BA9 A;  2MNH A;  3VHL A;  3BRY A;  4V1A v;  5DAB A;  5FY7 A;  4DO0 A;  2VQF T;  3LBX B;  4P0B A;  4G63 A;  2IHR 1;  4QXB B;  4BUM X;  1OED E;  2XQ8 A;  5FKY A;  2M6I A;  2BBH A;  1XZY A;  4I55 E;  3TLV A;  3AB3 B;  1ZEE A;  2K4T A;  5EK4 A;  5LG4 A;  1YD8 G;  3ZT5 A;  3A0H O;  2PFV A;  2FJD A;  1UX4 A;  2VKJ A; 
#chains in the Genus database with same CATH homology
 2JJ9 A;  4KRA A;  4ZHQ E;  4HE8 A;  2LHR A;  3POQ A;  3SYS A;  2NTX A;  2RA1 A;  5FXV A;  3CKD A;  5L3F B;  2YU2 A;  3HL6 A;  1BR0 A;  4Z8X A;  1GFN A;  4PK5 A;  5HXS A;  1CUN A;  4UF0 B;  4X1K E;  4AKG A;  1UX5 A;  4AYD C;  1E1H B;  2K24 A;  3A2S X;  2Q9Q C;  1WRD A;  4O3Z A;  3KV4 A;  3C4Z A;  3PUQ A;  2YNK A;  5LOV E;  2VL8 A;  3ZMS B;  2XTL A;  2M07 A;  4GK0 E;  2OMF A;  2C5K T;  1U4Q A;  2GK9 A;  4O4J E;  3J7Y q;  4AKH A;  5J2T E;  4OYK A;  2XTR A;  5TAO A;  4BJM A;  4PAG A;  4EYU A;  1FIO A;  3V5S A;  2Q9Q A;  1OWA A;  3RX6 A;  4GYR A;  1SHZ C;  1T98 A;  1WR6 A;  4O2A E;  1MM4 A;  1B7T A;  2Y0H A;  4PJJ A;  2N1G A;  2B1E A;  3KV5 A;  4TUY E;  2L8K A;  1ZKE A;  4JCH A;  3W15 B;  4FZM A;  4ASK A;  4KR8 A;  3MXZ A;  1SA0 E;  3OYX A;  4O4I E;  7PRN A;  3HKD E;  4GK5 E;  4GYS A;  5L3B B;  5LJM A;  3AA0 A;  2Y7S A;  4FUV A;  4E1T A;  3PU8 A;  1OXZ A;  4O3Y A;  1AJ3 A;  2KT9 A;  4PJN A;  3POR A;  3O1J A;  4O4H E;  2E9X C;  5DL8 A;  3PUA A;  4ZI2 C;  3FXE B;  2NWB A;  2K5B B;  4PK4 A;  2KIN B;  2UXX B;  3B57 A;  4GCS A;  1BR4 A;  2X0L B;  5JR9 A;  2LOP A;  5JDM A;  1G8X A;  3SY9 A;  3ZN0 B;  1HTJ F;  3KBU A;  3Q5X A;  3GN5 B;  3G7G A;  2LOS A;  5HXH A;  2E9X A;  3NZQ A;  2KDY A;  3PQS A;  3I0Q A;  4AYM C;  3LG7 A;  3LK3 A;  2F1V A;  4IE4 A;  1H6S 1;  4TN7 B;  2VKH A;  2EHO C;  4B6X A;  3JC6 C;  3HR0 A;  5JRC B;  5DL6 A;  2ZM0 A;  4QX8 B;  2PBI A;  2LSJ A;  2Q9Q D;  3CX6 B;  4ZI3 C;  1OSM A;  2KLQ A;  2A2F X;  2KMF A;  4AQG A;  4HKA A;  2LE8 A;  2Y0K A;  2C5J A;  5LBQ B;  5EK2 A;  1HG2 A;  4WBO A;  5HYA A;  2PG8 A;  5E0O A;  4JFB A;  1S94 A;  4DBQ A;  2YPV A;  5PRN A;  3RBH A;  2Y8D A;  1GFO A;  2LHF A;  5JQG E;  5JDP A;  4XNL A;  3ZEF B;  3SS1 A;  2KND A;  3L09 A;  5HXR A;  1MMG A;  1ZV4 X;  3EVY A;  2V26 A;  5FXW A;  3SWH A;  3K19 A;  4RL9 A;  4AFK A;  4O2B E;  4YHJ A;  1THQ A;  3DTO A;  3PQU A;  1G73 A;  1HX8 A;  4FZN A;  1LVF A;  3RRW A;  2W61 A;  5AFU K;  1WYC A;  2LSG A;  3KVD D;  4ZI3 D;  3C51 A;  4YLH A;  3ZYL A;  2W81 C;  5CB4 E;  5LYJ E;  5DL5 A;  5LGT B;  2NW7 A;  4O4X A;  4G75 A;  3IEE A;  4ISS A;  4DVD A;  1G90 A;  4D65 A;  1KK7 A;  4L0R A;  2K0L A;  4PNI A;  3RKO A;  3QK6 A;  2W80 C;  5F3J A;  5ADX L;  4E7Z A;  4H9O C;  4AKL A;  1WLX A;  5HWY A;  4YFS A;  3C98 B;  3OKQ A;  4H63 H;  3HOL A;  2KC0 A;  4GF4 A;  4PUX A;  2UXN B;  4UEM A;  4XBF B;  3RC3 A;  5HXC A;  4CI3 B;  3DJB A;  5FMN A;  4IIJ E;  4L9I A;  2X27 X;  4M1P A;  2M06 A;  2XE5 A;  5IHY A;  3OBV E;  2X66 A;  4UEL A;  3K3O A;  5LNK A;  2H7V C;  3LK4 1;  3RPU A;  2D5U A;  4KP3 C;  5FVN A;  3RRC A;  3PUG A;  4JEH B;  1HXU A;  1ZHT A;  2VK9 A;  1HS7 A;  1YS5 A;  2JRK A;  1ZHW A;  5A1L A;  3O0E A;  4TZ4 C;  5J1G A;  3N9L A;  3TKL B;  4DND A;  2WM9 A;  4EZ4 A;  1U5P A;  2D2S A;  3MJX A;  2N9D A;  4DMW A;  2N2L A;  2XUE A;  4WBN E;  3WI4 A;  2W00 A;  2L9Q A;  1EZ3 A;  3S4U A;  3E22 E;  1QJ9 A;  3GMI A;  4CQI A;  1Q9G A;  5KX5 E;  1BR1 A;  2DI4 A;  5JDG A;  1Y64 B;  2WWU A;  3ETV A;  2XAS B;  3MA9 A;  3ETU A;  4JEU B;  2LM9 A;  4O4L E;  4U72 A;  6PRN A;  1ORM A;  5JDQ A;  3F31 A;  2BVL A;  2DWG A;  3ZN1 B;  1IAP A;  5CA1 E;  5L2L A;  3U78 A;  2ZM8 A;  4UXN B;  3NRX A;  3OJA A;  5H6Q B;  2X9Y A;  3PDY A;  4NUV A;  2CXD A;  2ZMA A;  2X9W A;  2LHN A;  2QTK A;  3KVA A;  3AA7 A;  2XAH B;  3V8U A;  1YKE B;  5JR9 C;  4K0U A;  4ZS2 A;  4GOU A;  3UU2 A;  2V1D B;  3V5U A;  4AI6 A;  2YK0 A;  3WAJ A;  3NZP A;  3MKD A;  4DMV A;  4NUU A;  3VZW X;  2NOX A;  5F8P A;  2A72 A;  3AA0 B;  1MIY A;  3HOE A;  3ESL A;  1MMN A;  3ZMZ B;  2FGR A;  2KZ7 B;  3KFW X;  5EE2 A;  3N2G E;  5JRE A;  4QHO A;  5JDN A;  2CA5 A;  3LK2 B;  2M67 A;  3ZLI A;  4HEA A;  1HXT A;  4IE6 A;  3LFM A;  4KUM B;  5FNV E;  4UVC B;  3K3Q C;  4GCP A;  4PFP A;  3GA8 A;  4O3W A;  2BDE A;  2L3L A;  4UF0 A;  4EZH A;  1BXW A;  2LSI A;  2FGQ X;  1QUU A;  2CXF A;  3U3I A;  4EIW A;  3DP7 A;  3HI2 A;  3AAA A;  3CX7 B;  2EHO B;  2BVM A;  1QJP A;  1GFP A;  5EK3 A;  3HKC E;  2XE2 A;  2D0U A;  2IW5 B;  2IC6 A;  4WNK A;  2HPJ A;  1LRZ A;  3CML A;  1OPF A;  3ZMT B;  3BK9 A;  3F57 A;  5L3G B;  3DA4 A;  3HW9 A;  4H9P C;  4AYI D;  1US7 B;  3ZPO A;  4IE7 A;  4PK6 A;  3ANW A;  4MFR A;  8PRN A;  2XAG B;  3SRZ A;  3HKE E;  4CXX A;  2ZM2 A;  3ONX A;  3AA6 B;  3LBX A;  3GWH A;  3RC8 A;  3ZMU B;  4FJO A;  3F2E A;  4UV8 B;  4AXP A;  5KMG P;  4XAX B;  2X67 A;  3IF8 B;  1QJ8 A;  3SYB A;  3RYF E;  3C4X A;  4JLE A;  4XZC A;  4PJM A;  4RLC A;  3HKB E;  4FMS A;  2CEA A;  3WI3 A;  2DLR A;  2Y0L A;  5LHH B;  3K3N A;  4N59 A;  5LHI B;  2VWA A;  4HGA A;  4AKM A;  2HPL A;  3O4X E;  4FT6 A;  1IZN B;  2WMN A;  2N2M A;  5C8Y E;  4IDZ A;  5HAX A;  2E9X B;  3EMN X;  4AUI A;  2ODU A;  3PUR A;  1HF8 A;  2G0U A;  4AZL A;  3JC6 D;  3EDU A;  2JMK A;  3O1H A;  4QX7 B;  4AYN A;  1BH3 A;  3FB2 A;  2SPC A;  3ZC1 A;  2H3R A;  1GFQ A;  2Z6E A;  4FSO A;  2C5I T;  2I59 A;  5LBM A;  3EUH A;  3T0S A;  4IST A;  2LEH A;  4PJL A;  3C4W A;  3RH3 A;  4F4B A;  3PRN A;  3L3P A;  3CQC B;  1D0X A;  1BT9 A;  2W0G A;  5FXX A;  4X1Y E;  3UAQ A;  2H7O A;  3PUS A;  2N2N A;  5GV0 A;  4UV9 B;  2X68 A;  1D1A A;  2JMH A;  2K48 A;  2KWH A;  4E1S A;  3N9Q A;  2DNX A;  4MHC A;  4OK0 A;  3R6N A;  2MTQ A;  2D0T A;  2Q9Q B;  2VAS A;  1S35 A;  4H9S E;  4EB6 E;  4JUY A;  4CXY A;  1LVK A;  2ZFG A;  4AQF C;  4F6R C;  3LK2 A;  4RLB A;  1LKX A;  4MLK A;  4I50 E;  3ZYM A;  5IYZ E;  1MMA A;  2MHL A;  3QUJ A;  2ODJ A;  5FYM A;  5HXE A;  5LGN B;  1MMD A;  4N78 D;  5LGU B;  3E0Z A;  3FBL A;  5JDL A;  5ETW A;  3VKH A;  1ZHX A;  2XTQ A;  1YKH B;  2LT3 A;  2Y48 B;  3FBZ A;  2WSS V;  4I43 B;  2MYS A;  2XAQ B;  5H6R B;  5LJN A;  3O9X A;  2IAK A;  4P0A A;  2F1T A;  2NP9 A;  3CPZ A;  3POX A;  3ZMV B;  4I4T E;  2CCQ A;  2WBL A;  2X9X A;  2MBG A;  1HCI A;  1D0Z A;  2X9H A;  4UVB B;  2C0S A;  4ANJ A;  1PHO A;  4DBR A;  4ERR A;  4OFZ A;  2NTY A;  3RYI E;  4AKR A;  4O49 A;  3T8O A;  3WAK A;  3ZYK A;  3IHR A;  4U74 A;  2ERV A;  1FMW A;  3N9M A;  3UFE A;  3MZK B;  5LA6 E;  2NW8 A;  1Q9F A;  2KXP B;  4EYY R;  4EXT A;  4ZI7 E;  4GIW A;  5CA0 E;  4LSH A;  4C69 X;  3AVS A;  3AAI A;  3GP6 A;  3BQK A;  3ZJ2 A;  2Y2X A;  1MNE A;  4RJX A;  3N9N A;  2VKD A;  1MPF A;  4UVA B;  4YJ2 E;  3PTR B;  3VKG A;  5D5D A;  3VE1 A;  2ACX A;  5JVD E;  3AVR A;  4PFO A;  4X20 E;  3AAE B;  3QRA A;  2HH7 A;  3VY9 X;  3UTK A;  4H63 V;  1D1B A;  1NAF A;  4KMC A;  4YJ3 E;  4BAY B;  4EOZ B;  1BR2 A;  3BQL A;  2KXP A;  2CM0 A;  2PJQ A;  4LSE A;  3FYX A;  2ZLD A;  3Q5W A;  3ZJ1 A;  5ADX K;  5DJQ C;  2K9A A;  2OA5 A;  3CWZ B;  3VZU X;  4TX5 A;  4C90 A;  4Z3T A;  4TV9 E;  5DQW A;  5LHG B;  2YIN A;  2CWO A;  2KZ7 A;  2POR A;  4O8S A;  4U9C A;  4LSF A;  2CE7 A;  4OYJ A;  2V7L A;  3T20 A;  2LSY A;  4O3X B;  4QWN B;  2MOZ A;  4G2A A;  2W62 A;  3AAE A;  4N58 A;  3UUL A;  2J1N A;  5AFU L;  4IE5 A;  4AYE C;  3R84 B;  1YW0 A;  3VY8 X;  2XAF B;  3H3A A;  5LXT E;  3TZG A;  3O1I A;  1P4T A;  2ODV A;  4O4U A;  4HFV A;  5L3E B;  3I9Y A;  4AKI A;  3KV9 A;  4G76 A;  2BZB A;  2J1D G;  1ZHZ A;  3JTY A;  2Y6X A;  1WYB A;  3BQI A;  4ILU A;  2NW9 A;  2O4V A;  4FI5 A;  2JPF A;  2LSK A;  3EDV A;  3CX8 B;  3IBP A;  4QXC B;  1MND A;  1E54 A;  4EAH A;  3NSG A;  2A3D A;  1HG5 A;  4FZL A;  1FEW A;  3KIN B;  3KVB A;  4MBQ A;  2PRN A;  2XE3 A;  2XAJ B;  3SZV A;  3HWB A;  4FRX A;  2WMO A;  3FHN A;  1MIV A;  3C5O A;  5G26 A;  1Z0P A;  2DHR A;  3N9O A;  4FSP A;  3Q2M A;  3LJC A;  4C91 A;  4HTE A;  2YEV C;  1QSD A;  5LP6 E;  3ZCI A;  3ZCJ A;  5FXZ A;  2JQQ A;  2EHO D;  3WI5 A;  1V9D A;  3GN5 A;  3N2K E;  4KBM B;  4X1I E;  4GHB A;  4B61 A;  5L3C B;  2V7I A;  5JH7 E;  5J2U E;  5JRC A;  3SOL A;  2XHE B;  3VE2 A;  1FMV A;  3K8P C;  3P8C D;  3VZT X;  4ADZ A;  2DWK A;  3CQX C;  5EZY E;  3SY7 A;  3AA1 A;  4BJN A;  1UCU A;  4ZI2 D;  4A56 A;  5IYU A;  4IE0 A;  1HFA A;  2E9X D;  5BMV E;  2IC9 A;  2W63 A;  1D1C A;  2QA7 A;  2P9B A;  2VKO A;  3ANW B;  4P09 A;  1IJ6 A;  4QKN A;  2CLY C;  3Q9D A;  2XG6 A;  4LSI A;  2KWI B;  2ES0 A;  2XMX A;  3MK7 C;  4MAL A;  2ZLY A;  3UUX B;  2X51 A;  4KR4 A;  3KV6 A;  1VRB A;  2QGS A;  3LK3 B;  4ZOL E;  4HN9 A;  3ZC0 A;  5DL7 A;  2CMR A;  2CXL A;  2E8I A;  4IHJ E;  4RJW A;  1ZHC A;  3RYH E;  3M65 A;  3CQG B;  1H7C A;  1KNZ A;  4IGU A;  4CI1 B;  5M4Y A;  4GCQ A;  5JDF A;  2YU1 A;  4WW0 A;  3B13 A;  3UUN A;  3NRY A;  2V7M A;  3OYZ A;  4QXH B;  1PRN A;  5KDM C;  1ZHY A;  2XE1 A;  5T5F A;  4L5G A;  2WAU A;  3RYC E;  1IZN A;  3I9W A;  5HWX A;  4CXW A;  4UIG A;  3KBT A;  4E7S A;  1VOM A;  3MAC A;  3AAA B;  3VU7 H;  2GE4 A;  3UPG A;  3HA4 A;  2RP4 A;  5GON E;  5LCY A;  4BA9 A;  4H9N C;  2VB6 A;  2MNH A;  3DA3 A;  3CVR A;  3VHL A;  4FRT A;  2LJL A;  3PU3 A;  2J4U P;  3E08 A;  3N9P A;  4TV8 E;  4H9Q C;  1IJ5 A;  4PW8 A;  3I1A A;  1O3X A;  4V1A v;  3AA1 B;  1MM5 A;  3LK4 2;  5DAB A;  5FY7 A;  4DO0 A;  5FP3 A;  4CZZ B;  3LBX B;  3AA6 A;  3PE0 A;  4AKR B;  2V7J A;  3NBX X;  5JR9 B;  3UT5 E;  3C50 A;  3H37 A;  4P0B A;  4G63 A;  2JMM A;  3QRC A;  3C64 A;  3KDS E;  3FXD B;  5FY1 A;  4OHF A;  1D0Y A;  3UUM A;  2LFU A;  4QXB B;  3QC9 A;  2CWY A;  5FY0 A;  4AQF A;  5L3D B;  1GFM A;  4BUM X;  4D5U A;  3N2O A;  5DQV A;  3A5X A;  3AA7 B;  4ZS3 A;  4I55 E;  2EHO A;  1X79 A;  3I0O A;  4FOZ A;  3AB3 B;  1ZEE A;  5JDH A;  5EK4 A;  2K4T A;  3POU A;  1NWM X;  3P7I A;  2CLY B;  4CI2 B;  2XQY A;  4FES A;  4D64 A;  5LG4 A;  3J9X 1;  1YD8 G;  3T24 A;  2DCF A;  1HXX A;  1MIW A;  3D0T A;  2V7K A;  4XNK A;  2PFV A;  3SZD A;  4H9R C;  4QQ1 A;  3N5L A;  1UX4 A;  2VKJ A;  4J2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...