4AKRB

Crystal structure of the cytoplasmic actin capping protein cap32_34 from dictyostelium discoideum
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
245
Chain Sequence
TEKQLSCCLDLMRRLPPSQIEDNLAGLLDLVPDLTEDLLSSIDQPLKVAYDAVSKKDYLLCDYNRDADSYRSPWSNKYDPPLSGACYPSSKLRDIEVQANEIFEIYLNLYFEGGVSSVYCWDLDDNFAAVVLMKKTQDPMRGTWDSIHVVEVKLGKKDKAVYKLTSTVMLSIETDNDNTGKVNLAGSLTRQDEKEYTFNEVDTHCVNIGKMVEDMESKLRQTLETIYFGKTKEVVNTLRNATGNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-ACTIN-CAPPING PROTEIN SUBUNIT ALPHA
publication title Conservation and Divergence between Cytoplasmic and Muscle-Specific Actin Capping Proteins: Insights from the Crystal Structure of Cytoplasmic CAP32/34 from Dictyostelium Discoideum.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Actin-binding protein
total genus 71
structure length 245
sequence length 251
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4akrB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 4akrB02
3LK2A 3LK3A 3AA6A 3LK2B 3AA1A 1IZNA 3AAAA 5ADXL 3LK42 3LK3B 2KXPA 5ADXK 3AA6B 1IZNB 3AA1B 3AAEA 3AAAB 2KXPB 5AFUL 3AAEB 5AFUK 3AA0A 3LK41 2KZ7A 4AKRA 3AA7A 3AA0B 2KZ7B 4AKRB 3AA7B
chains in the Genus database with same CATH superfamily
4UV8B 2CMRA 2XPKA 3VY8X 1JNRA 3A0BO 2E9XC 3SOLA 2NW9A 4UEMA 1W0AA 2YK0A 2ODVA 4Z90A 4N78D 3N2GE 2WZIA 4AZLA 1UX5A 3L3PA 3MXZA 2Y2XA 3AEGA 5GONE 3NZPA 4B6XA 4IIJE 5AQTB 4ILAA 5T5FA 2A72A 3GN5B 2J1DG 3SYBA 2KSRA 2DL1A 3E0ZA 5JDPA 1ZHWA 3ZC1A 3L39A 1XDOA 5HXHA 5DQWA 4WBNE 5DJQC 5HXCA 2IMLA 3AA7B 4BA9A 3SZVA 1S94A 3ZPOA 2FGRA 4GKKT 1GFOA 2M06A 4J2CA 2W00A 4QKNA 4UF0B 3P4QA 1VCTA 2XE3A 4IE7A 3AXJA 5E79O 1HXXA 2XY8B 3IA3A 2KWHA 5HWYA 1T72A 1XNQT 2JQHA 4ILCA 5LB7B 2ZLDA 3KVBA 2WU5A 2CXLA 4MBQA 3LBXB 3H3AA 2BKOA 3UFEA 3BQLA 1HX1B 3K3NA 5C3JA 4HFCA 4H9RC 4JI8T 4NUVA 4XBFB 3A8YC 3Q5DA 1N33T 4PW8A 1Z8UA 3LK3B 1SA0E 3HOLA 1D1BA 4G75A 3ZMUB 3MK7C 1PRNA 4IL6O 4DR3T 5LA6E 5B5EO 5LGUB 4TUYE 2VURA 2W66A 2J47A 3EAMA 5G38A 4CXWA 2V7KA 3UQ4A 3L8RA 2WDRA 4H63H 5JDMA 5LGNB 1AJ3A 3ZCJA 4GCQA 3AE5A 5KAFO 1MM5A 2PJQA 5LCYA 4X66T 3MACA 3GMIA 3KINB 4NXNT 4AKRB 2Q9QA 4UVCB 5F3JA 4BUMX 2I6HA 2NTXA 4HKAA 2F4VT 4F4BA 3HKDE 2KXPB 4FZNA 3AAEB 4JI3T 4PFPA 1MMDA 1T7SA 5G26A 2KNDA 2EHOB 4IDPA 4KI0F 2LM2A 2E8IA 4O4IE 1PHOA 3QOFA 1HTJF 4AQGA 4D65A 3P7IA 4EV6A 4ZI3C 2FJDA 4DBQA 4BAYB 2MBGA 3CVRA 4H9PC 5JQGE 2WWVA 5J2UE 1MNDA 3EDVA 2UXDT 3RRCA 2QYWA 1WYBA 4XNKA 4CTDA 3NZQA 2XTLA 2DLRA 3JAFA 1UX4A 4N58A 1GFQA 3PURA 4AQFA 4AKLA 3PDYA 1EZ3A 2D5UA 2XQ8A 5D5DA 3M65A 1YS5A 1LKXA 5LP6E 5L3FB 1KF6A 1T16A 4ILBA 1BR4A 2LEHA 4QXHB 2BG9E 4IGUA 2LJLA 2LHRA 3DWNA 3X1DA 2M67A 3LK41 4ZI2D 2CLYC 3HI2A 2KT9A 2YDSA 3ZJ1A 2LSYA 2UXBT 3PJAA 1Z0PA 1E7PA 3R6NA 2CE7A 2XUEA 5LJNA 1T8BA 4K0UA 4FESA 2L3LA 3N9MA 2YDRA 4CI1B 3PUAA 3NWIA 2ZMAA 5JVDE 4K3BA 3C5OA 2G0UA 3RQUA 3MZKB 1N36T 1MMAA 3ZLIA 3V5SA 5JREA 3POUA 2Y0HA 5LBMA 2BG9A 4LFCT 3CQCB 3WAJA 3VKHA 1OPFA 4YJ2E 3ABVA 1OEDB 4I50E 1BXWA 1XMQT 1ZP0A 5JH7E 1KNZA 4RJXA 3OYZA 3TLUA 2KINB 2BKNA 4DVDA 2PG8A 5AQNB 4JBWF 3UU4A 3C64A 3KBTA 1KEYA 3SFDA 3UUNA 3LK2B 2YNKA 2X9YA 2F1TA 5FNVE 4YJ3E 4C4VB 3AE8A 1UGOA 4ZZBA 3OBVE 4KHZF 4YSYA 4LSIA 4HFHA 1D0XA 2E5LT 2ODJA 2EHOC 4ZI3D 4XNLA 5ABFB 2HN2A 5EK4A 3EMNX 2FJBA 3SYSA 4LSEA 5ABGA 3RF1A 3ZSTA 4O3WA 5IYZE 1D1CA 3LSVA 1HG5A 4DV6T 2GK9A 3P8CD 1VCSA 3RYHE 2DHRA 2VKOA 2UUAT 2R4NA 2HHHT 3LG7A 3PUWF 3DTOA 4ASKA 4PJ0O 4FI5A 2R89A 5IYUA 3VZTX 5A1LA 3VE2A 4JEUB 1ZHCA 4LF8T 2Y0KA 2DI4A 4UB6O 3PUQA 5LBQB 4O2BE 1HG2A 3I9WA 2OV9A 2JMMA 2KLQA 2VKDA 5DL8A 1NEKA 2R8AA 2C5KT 3R84B 4JLEA 3OVUA 4ILUA 5FP3A 3J9X1 1WRDA 3UU5A 2X66A 4ANJA 5FVLA 2UUCT 2DWKA 4LMJA 3GA8A 3PV0F 3NRXA 2BS3A 2X0LB 1QJ8A 4QH5A 3AA6A 4UB8O 4E1SA 4B61A 1MMGA 4B3MT 3OKQA 5L2LA 1G90A 3I0QA 2X0HA 5LMUT 4JYAT 3AB3B 2LM9A 4NIQA 3UUMA 3JAEA 2DWGA 4IE6A 4WYVA 3A5XA 5LMNT 1V9DA 2WBLA 4FRTA 3HR0A 4HFVA 3VR9A 4TN7B 2VQET 4KHPT 5LHGB 2MPKA 2CBIA 3NBXX 2K24A 2XQ4A 5GTHO 1LVKA 1OEDC 3K1SA 3AA0A 1W0BA 3U3IA 4YY3T 3C50A 4DMVA 4YT0A 3FZFB 2E9XA 4RLCA 3G06A 4EYUA 4FT6A 4O3YA 5HXSA 3V8UA 4TV8E 3RH3A 4H9OC 2Y48B 3PTRB 2FBWA 2CCQA 5FVNA 1I6ZA 5LJMA 5L4HA 3VZWX 2XTRA 3K3OA 1MIYA 2QGSA 3AEFA 4CXYA 4HWDA 1Y01A 2CWOA 2EHOD 4AUIA 4HGAA 5AQLB 4K0KT 3UU2A 4EAHA 3DZMA 3BRZA 3F57A 3QB5K 2XE2A 4JI2T 4Z3TA 1XMOT 4IT4A 3ZYLA 4U7IA 5HWXA 3RX6A 2K4TA 4YFSA 3EVYA 1IZNA 3IF8B 2BVLA 1E2AA 2NP9A 4RJWA 2WY2A 4AKHA 2WAUA 4FZLA 3QC9A 1Y64B 4NPPA 2IDOB 4A56A 2SPCA 3PE0A 3GWHA 4O4LE 2XHEB 4PFOA 3PU8A 5ABEA 1UCUA 4AYNA 4M1PA 3LK42 2AXTO 5E0OA 3UUXB 3EHZA 4B3ST 4DR1T 3PGRA 4Z91A 1YD8G 2QRXA 3RC3A 2HPJA 2X9WA 3UPGA 3H37A 5G3AA 4ZXLA 3M3ZB 1HXTA 4X20E 5HEGA 3K8PC 1T98A 4JUYA 1D1AA 2X68A 3ZEFB 2XG6A 1QUUA 5AFUL 1NWMX 4U2ZA 1NAFA 2Y8DA 2MHLA 3E08A 5HCJA 2XAGB 3AE7A 3G7GA 4EZHA 1W09A 4DV0T 2BDEA 5JRCB 2MNHA 3PUSA 2XQYA 2K0LA 3B13A 4OFZA 2UXNB 3TLTA 3Q2MA 4E7SA 5AFUK 3JCFA 4JI1T 1L0VA 2B1EA 4QHOA 1MM4A 5JDNA 2CHOA 3U78A 2N2LA 3ANWB 3N9PA 4IE0A 3KFWX 4DV2T 4LF4T 4AI6A 4TWFA 1HNWT 2J4GA 4HWIB 3CMLA 3VU7H 2WJQA 4DUZT 2ZM2A 3OJAA 4PK4A 2J1NA 5ETWA 4HN9A 1SUMB 1KFYA 2WDQA 2WMOA 5BMVE 4NUUA 4JI4T 3RGLA 2JQKA 5J0ZA 2KC0A 2CLYB 4KBMB 4UR9A 1M7KA 2WQYA 3CQGB 5TISO 3JTYA 4V1Av 3V5UA 3GN5A 4ZI2C 1FEWA 1BR2A 4MALA 2M6BA 4IHJE 3ESLA 4YLHA 3ZMZB 5LG3A 4QH4A 2IHR1 5DABA 3C51A 1ZEEA 2XJ7A 4WBOA 2VL0A 3AA7A 5AQMB 4U74A 4AYDC 1ZHTA 3H3MA 4EZ4A 3O0EA 1UUSA 4UF0A 4UELA 3SWHA 4OHFA 1CHUA 5JDGA 2LSGA 2LLYA 3P4RA 4DIDB 3O1IA 4C91A 4KRAA 3P4PA 2RA1A 4DR7T 1E1HB 5AQHB 2IWVA 3CK6A 2VB6A 1MIVA 3PU3A 2CHNA 4C69X 3ZT6A 2WCAA 1T1LA 2LOSA 4ADZA 3AA1B 3LBXA 2WB5A 2QA7A 4IDQA 1HR0T 4F6RC 2NOXA 2CRBA 3OPCA 3MA9A 3OTOT 2VL8A 3ONLC 3LK3A 3N2OA 3O4XE 1IBMT 2XQAA 3I1AA 5H6RB 3TLWA 2CEAA 1OWAA 5L3CB 1GFMA 2WU2A 3UQ7A 5JDHA 3UAQA 3ZMSB 3ZKRA 4PK6A 1HXUA 4HE8A 1X79A 1YKHB 5HEJA 3QRAA 8PRNA 2A3DA 2D0TA 3A7MA 3N9NA 4QH1A 4HFIA 1P4TA 2B76A 1O3XA 4GK5E 4LSFA 2CWYA 2HPLA 2LT3A 2H7OA 4DV1T 2WM9A 2LOPA 4AKRA 5KXJA 2J4UP 2KZ7B 3ZN1B 3RKGA 3ZJ2A 2K3WA 3RKOA 3NJTA 5AQSB 4AIUA 2BG9B 2HH7A 3EABA 2Z6EA 2V7LA 2WWUA 1MMNA 3PUYF 3RYIE 5KDMC 3SZDA 4HWFA 1XDPA 2IW5B 3WI5A 5LGTB 3PUGA 2Y6XA 3CQXC 1WFDA 3AE4A 4MHCA 4KR8A 2WMNA 3T1HT 4EOZB 4ZI7E 2NWBA 3WI4A 1UK5A 5CA0E 2I0MA 2N2NA 4GOUA 2V7IA 4TNWA 3FZMB 3RYCE 2LSKA 5EZYE 1QJPA 3RI5A 4E7ZA 2ZLYA 2XMXA 2V5DA 3VE1A 3BS0A 2Y7SA 3RHWA 3CPZA 1HNXT 3F2EA 2FJEA 1U4QA 1OEDE 2JQ9A 5FXWA 4IL4A 3RIUC 5ABHA 2LHNA 3PUZF 4FOZA 3K19A 3UTKA 3RRWA 3RYFE 3WU2O 4LF6T 4O4JE 5JR9A 1ZHXA 2N9DA 4C90A 3VZUX 4COFA 1G73A 5DQVA 4X1YE 3ONXA 1M62A 2KDYA 5HYAA 1IJ6A 2A9UA 4IDZA 5L47A 3FZLB 4JI6T 2JQYA 2JQQA 2K9AA 3Q5EA 4KR4A 1J5WA 4CN1A 3O1HA 5F8PA 5PRNA 3TLSA 2YU1A 4YTNA 4RLBA 3L09A 3PGSA 2Y0LA 2C0SA 1IBKT 2VQFT 2XAQB 2A2FX 1OEDA 5HEOA 5BR8T 3CX7B 2AE9A 4AKGA 1THQA 3AAAB 3HA4A 4BJMA 1ZHYA 3DP7A 2WZHA 4YHHT 2CXDA 2W4XA 3RBHA 3J7Yq 3EDUA 2XSAA 4ZHQE 4GK0E 4G76A 5EE2A 4LFBT 4MLKA 3DA4A 4I0UA 4ZS3A 1MIWA 4GIWA 4TX5A 2XM2A 2BG9C 3C4ZA 2XQ6A 3ETUA 3HOEA 3AE3A 5LG4A 3GP6A 5ABFA 5H6QB 3IHRA 4H9SE 4O3ZA 1IAPA 2R4LA 2K5BB 2BBHA 5J2TE 4KX6A 2NR4A 4P09A 4U33A 4A97A 2V26A 5JTGA 3VRAA 1YKEB 2IIUA 2MYSA 4U3CA 3SY9A 7PRNA 2V6YB 4EIWA 4D5UA 2C5IT 4X65T 3N9LA 2BVMA 2E2AA 2ACXA 1SE7A 2R6GF 4WW0A 3K3QC 3WAKA 1IZNB 4N75A 4UVAB 4LSHA 3NKZA 4XAXB 2CXFA 2XASB 4Q25A 3SS1A 1ZHZA 2KWIB 4YSXA 3UU3A 2LRLA 3I0OA 2XSBA 3ZT5A 3HW9A 2VASA 3T24A 3KV9A 1VOMA 1ZV4X 1WYCA 2R88A 4AXPA 4HWCA 5FY0A 5L3GB 2LKHA 3FZKB 5IHYA 2NW7A 2ZM0A 3MKDA 4QXCB 2IWWA 5HCMA 1GFPA 3FXDB 3ZC0A 4K3CA 4GYRA 3BQIA 3SFEA 4LMLA 1YW0A 3HKCE 4AKMA 4QX8B 1BR1A 2M07A 4GCSA 4L5GA 4OK0A 2W61A 1WR6A 4JI7T 4H9NC 3ZYMA 1FIOA 4FZMA 3RIFA 4G2AA 5FL0A 2OLTA 3LDQB 3PUVF 3VR8A 2YEVC 2ACZA 5G39A 2JMHA 3Q5XA 4O2AE 1KK7A 4P1NA 3WI3A 2XAHB 3RQWA 4LF5T 3HWBA 4YSZA 4QXBB 5FL1A 2XQ3A 3VY9X 3T0SA 3FBZA 3C98B 4JV5T 3PJAJ 3BRYA 4LFAT 1MNEA 2W2UA 3AE1A 2YPVA 1R8IA 3CIRA 4FRXA 3UU8A 2H3RA 5AQVB 3I9YA 4DUYT 3B57A 4MFRA 1FMWA 1I94T 4UXNB 3AXJB 3W15B 4I55E 2DCFA 2E5VA 3HKBE 3RPUA 1QJ9A 2XZEA 2WS3A 3BK9A 1N32T 5LXTE 2XM1A 3N5LA 2W80C 2XAFB 3AE2A 4QQ1A 1BH3A 4DV4T 3KDSE 3UFGA 5LOVE 4TWDA 2BBJA 2MTQA 5HAXA 1XNRT 3ZMVB 3SY7A 1YQ4A 2VKHA 3KV5A 4DR4T 2N1GA 4N74A 3KVDD 2V1DB 2N2MA 2ES0A 2WP9A 2ZFGA 3AE6A 5GTIO 4TV9E 5CA1E 2IUBA 2ERVA 2LHFA 4A5XA 3QRCA 4DV3T 3FB2A 5CGMA 2XQ9A 3DWOX 3OYXA 5ADXL 2FUPA 4X64T 4EEDA 3ETVA 1FMVA 2YN6A 3P4SA 2X67A 2BS4A 1U5PA 5JRCA 1DU2A 2LSIA 3VHLA 5EK3A 5FMNA 5CB4E 2MAWA 3Q5WA 4HFBA 4CI2B 5L3BB 3TLVA 2Q9QB 1QLBA 3IBPA 1HX8A 4JEHB 5ADXK 4P0AA 2M6IA 4FSPA 5LYJE 4IDNA 1HFAA 1HCIA 5AQPB 3FYXA 1J1JA 3FBLA 1ORMA 3ANWA 4HWHA 2QTKA 3TKLB 4DV5T 3UT5E 4H9QC 3RC8A 3HL6A 1SHZC 3FZHB 2H88A 4U72A 2X9KA 2VVSA 4HFDA 5KMGP 2R4PA 4ISTA 2PORA 3ONJA 2X27X 4DO0A 3QUJA 4FMSA 3POXA 2AXDS 4DR5T 4U31A 1HF8A 4FUVA 2D9DA 4AYMC 2UUBT 3UUBA 2IC6A 1YXRA 3EUHA 4B3TT 4KP3C 2W62A 1LRZA 1J5ET 2E9XD 5LHHB 1HNZT 4QWNB 1OXZA 1VRBA 3T1YT 2UU9T 2UXCT 3T20A 5GV0A 4B3RT 3PUXF 5JDFA 3AVSA 4O8SA 4I43B 2ODUA 2CBJA 1XZYA 2LRKA 3P50A 4AYEC 3KBUA 2MOZA 1W9RA 4LF7T 4CN6A 5DL5A 1D0YA 2FGQX 3LJCA 3O9XA 4OYJA 3UULA 5AQIB 2WVPA 4HEAA 2L8KA 2JIWA 5HXEA 4YTMA 1S35A 4AKIA 3PGUA 4AQYT 2KMFA 3RIUA 4GF4A 4EYYR 2XQ7A 5FY1A 4U2YA 4LF9T 4OX9T 3AA1A 3AE9A 4IREA 3EI0A 3ZSSA 2KXPA 2JRKA 5L3EB 2VWAA 3AAEA 2LKGA 1IJ5A 4Z8XA 2XE1A 3PQSA 4C00A 2PBIA 1QSDA 2EHOA 3ZCIA 4ZZCA 4L0RA 2CM0A 4DV7T 4E1TA 2LSJA 3NRYA 4CZZB 4WZXA 4F8HA 4CXXA 4IDOA 2C5JA 1S5LO 4A98A 5EK2A 5CJ5A 1BT9A 2UXXB 2DNXA 2YKSA 4DR6T 2Q9QC 3JADA 3POQA 5DL6A 4FSOA 3PORA 3B5MA 4PNIA 1D0ZA 2ZM8A 4H63V 5IWAT 2CPTA 4RL9A 4PJMA 5JR9B 3VKGA 5LNKA 5FY7A 4AFKA 3HKEE 4ZS2A 1WR0A 1G8XA 3AVRA 1X9BA 2WDVA 4PR7A 4PUXA 4O49A 2KZ7A 4O4XA 5M4YA 3ZMTB 5FKYA 2PTFA 5FXVA 1XWMA 2VKJA 3AEDA 1UURA 3S4UA 2LE8A 2V7JA 4X5TA 4HTEA 3BQKA 2F1CX 4OYKA 2JPFA 2XQ5A 2R4OA 3FXEB 3C4XA 3FHNA 3KZIO 4AYID 1E54A 3RLFF 4AQFC 2NTYA 4IL9A 4DR2T 5AQRB 5KAIO 4BJNA 2K48A 1Q9FA 4XZCA 4U7YA 2X9HA 1KNRA 3N2KE 5HEHA 2NW8A 4ZOLE 4GHBA 3PQUA 5C8YE 1GFNA 5KX5E 3AAIA 3A2SX 1CUNA 2W63A 5FVKA 1JNZA 5JDQA 5TAOA 4IE4A 1OSMA 5AQGB 5DL7A 4AISA 2OMFA 4X62T 5AQUB 2BS2A 2IAKA 2WJRA 3AA6B 3N9QA 3CX6B 2CA5A 1GQEA 5AQQB 5AQKB 2W0GA 4X1KE 4TNVA 3C4WA 4UVBB 2PRNA 4NXMT 2YINA 2H89A 2F1VA 4PJNA 2YU2A 3D0TA 5B66O 2WSSV 3LK2A 1ZKEA 1H6S1 3QK6A 2X0YA 3Q9DA 4KUMB 2W67A 1H7CA 4QX7B 3SRZA 4C4VA 1HS7A 2OA5A 1FJGT 4FJOA 3JC6C 4WNKA 4P0BA 4KMCA 3AA0B 2P9BA 2VVNA 5L4EA 2Q9QD 4GYSA 2IC9A 2E9XB 5F5WA 2FJAA 5AQJB 3NVOA 2XE5A 1N34T 4YHJA 4CN4A 4U9CA 3N9OA 4G63A 3UU6A 2XTQA 4YXDA 4DBRA 3ZN0B 3ZYKA 2I59A 4EB6E 5FXZA 2X51A 3KV6A 4JFBA 3NSGA 3LFMA 5FXXA 2VK9A 2W81C 3DA3A 4EGWA 4PJJA 3AAAA 1Q9GA 4LMKA 5JR9C 3CX8B 3CKDA 5HEUA 2HN1A 3TZGA 5LHIB 4JCHA 2D2SA 2GE4A 4DNDA 4YTPA 3O1JA 4ERRA 1WLXA 4ISSA 3ZT7A 5IUXA 3PRNA 3KV4A 1MPFA 2BKPA 2YDQA 3PF1A 5H2FO 6PRNA 2ZM6T 4GCPA 2JMKA 3CWZB 1BR0A 5AQOB 2J62A 5FYMA 2X9XA 3E22E 1KNPA 5AQFB 4HFEA 5C2TA 1LVFA 4JI0T 1WCRA 4O3XB 5HXRA 4GKJT 3A0HO 2V6YA 4CQIA 2V5CA 3QB5A 3DJBA 4O4HE 4PJLA 4JI5T 2PFVA 3T8OA 4D64A 2XAJB 5J1GA 5CFBA 2V7MA 1YQ3A 2L9QA 4EXTA 5JDLA 1ZOYA 4IE5A 1B7TA 4CI3B 4O4UA 3AEBA 3AEEA 4N59A 3AECA 3RIAA 2JJ9A 1NENA 2H7VC 2LFUA 2QVAA 2RP4A 4EEBA 2RPAA 2BZBA 3P4WA 4UV9B 4TZ4C 2V6XA 2V8SV 4DMWA 3JC6D 2O4VA 2D0UA 5L3DB 4PAGA 2YOEA 3IEEA 4PK5A 4UIGA 4FQEA 3AEAA 4ZEYA 4X1IE 3KVAA 3MJXA 4I4TE 4L9IA 3JCUO 1US7B 4TWHA 3F31A 3QNUA 3VRBA 1IBLT
chains in the Genus database with same CATH topology
2N2NA 4DO0A 2X0LB 1QJ8A 4UV8B 3QUJA 4GOUA 3AA6A 2CMRA 3VY8X 4E1SA 2V7IA 4FMSA 4B61A 3POXA 1MMGA 2E9XC 3OKQA 5L2LA 3RYCE 3SOLA 1G90A 2NW9A 3I0QA 4UEMA 2LSKA 1HF8A 5EZYE 4FUVA 1QJPA 4AYMC 2YK0A 2LM9A 3AB3B 2ODVA 2IC6A 3UUMA 3EUHA 4N78D 3N2GE 4E7ZA 2ZLYA 2XMXA 2DWGA 4IE6A 3VE1A 4AZLA 3A5XA 4KP3C 2W62A 1LRZA 1UX5A 1V9DA 3L3PA 2WBLA 3MXZA 2E9XD 5LHHB 2Y2XA 4FRTA 4QWNB 1OXZA 3HR0A 5GONE 3NZPA 4B6XA 2Y7SA 1VRBA 4IIJE 3CPZA 4HFVA 3F2EA 4TN7B 1U4QA 5T5FA 3T20A 2A72A 3GN5B 2J1DG 3SYBA 5GV0A 5LHGB 5JDFA 3AVSA 4O8SA 4I43B 2ODUA 5FXWA 3NBXX 2K24A 3E0ZA 5JDPA 1ZHWA 3ZC1A 2LHNA 4FOZA 1LVKA 3K19A 3UTKA 3AA0A 3RRWA 4AYEC 3KBUA 3RYFE 5HXHA 2MOZA 5DQWA 3U3IA 4WBNE 3C50A 5DJQC 4DMVA 5DL5A 4O4JE 5HXCA 2E9XA 4RLCA 4EYUA 5JR9A 3AA7B 4FT6A 4BA9A 1D0YA 2N9DA 4C90A 5HXSA 1S94A 3ZPOA 4TV8E 3RH3A 4H9OC 1ZHXA 1G73A 2FGQX 5DQVA 2FGRA 2Y48B 3PTRB 3LJCA 4X1YE 3ONXA 2KDYA 2CCQA 5HYAA 1IJ6A 4IDZA 5FVNA 5LJMA 3O9XA 1GFOA 2M06A 4J2CA 2W00A 4QKNA 4UF0B 2XTRA 3VZWX 2JQQA 2K9AA 4OYJA 3UULA 3K3OA 4KR4A 1MIYA 2QGSA 4CXYA 2XE3A 4HEAA 2CWOA 2L8KA 4IE7A 3O1HA 2EHOD 5F8PA 5PRNA 5HXEA 4AUIA 1HXXA 2YU1A 4HGAA 4RLBA 3L09A 3UU2A 4EAHA 2Y0LA 1S35A 4AKIA 2KWHA 3F57A 2KMFA 2C0SA 2XE2A 4Z3TA 4GF4A 4EYYR 5HWYA 3ZYLA 5FY1A 5HWXA 2XAQB 3RX6A 2K4TA 2A2FX 4YFSA 3EVYA 3AA1A 1IZNA 3IF8B 2BVLA 2KXPA 2NP9A 3CX7B 4RJWA 2ZLDA 4AKHA 2WAUA 4AKGA 2JRKA 3KVBA 2VWAA 5L3EB 1THQA 1IJ5A 3AAAB 4Z8XA 3HA4A 4BJMA 3QC9A 1ZHYA 3DP7A 2CXLA 2XE1A 1Y64B 3PQSA 2PBIA 4A56A 4MBQA 2SPCA 1QSDA 2CXDA 2EHOA 3LBXB 3PE0A 3ZCIA 3RBHA 3J7Yq 3H3AA 3EDUA 3BQLA 3GWHA 2CM0A 4L0RA 4O4LE 3K3NA 3UFEA 4ZHQE 2LSJA 3NRYA 4GK0E 4CZZB 2XHEB 4G76A 4E1TA 4H9RC 5EE2A 4NUVA 4CXXA 4XBFB 2C5JA 5EK2A 4PFOA 4MLKA 1BT9A 3DA4A 3PU8A 4ZS3A 2UXXB 1UCUA 1MIWA 4PW8A 4M1PA 4AYNA 3LK42 3LK3B 2DNXA 4GIWA 4TX5A 1SA0E 5E0OA 3UUXB 3HOLA 2Q9QC 3C4ZA 1D1BA 4G75A 3POQA 3ZMUB 3MK7C 5DL6A 4FSOA 3PORA 3ETUA 3HOEA 1YD8G 4PNIA 1D0ZA 2ZM8A 3RC3A 2HPJA 4H63V 2X9WA 1PRNA 3UPGA 5LG4A 3H37A 3GP6A 5H6QB 3IHRA 4H9SE 5LA6E 5LGUB 4O3ZA 4RL9A 4TUYE 4PJMA 5JR9B 1IAPA 2K5BB 4X20E 1HXTA 3VKGA 3K8PC 5LNKA 5FY7A 4AFKA 5J2TE 1T98A 4JUYA 3HKEE 1D1AA 4CXWA 4ZS2A 2V7KA 4P09A 2V26A 2X68A 3ZEFB 2XG6A 1QUUA 1YKEB 1G8XA 3AVRA 2MYSA 5AFUL 4H63H 1NWMX 5JDMA 5LGNB 1AJ3A 3ZCJA 4GCQA 3SY9A 4PUXA 7PRNA 1NAFA 2Y8DA 4EIWA 2KZ7A 1MM5A 2MHLA 4O49A 3E08A 2PJQA 5LCYA 4D5UA 3MACA 2XAGB 3GMIA 2C5IT 3G7GA 4EZHA 3KINB 3N9LA 5M4YA 2BVMA 4O4XA 3ZMTB 2ACXA 2BDEA 4AKRB 2Q9QA 5JRCB 4UVCB 5F3JA 4BUMX 5FXVA 2MNHA 2VKJA 2NTXA 4HKAA 3PUSA 4WW0A 3S4UA 2XQYA 3K3QC 3WAKA 4F4BA 1IZNB 2LE8A 2V7JA 3HKDE 4UVAB 2K0LA 3B13A 4O3YA 2KXPB 4HTEA 4OFZA 4FZNA 2UXNB 3BQKA 3AAEB 4LSHA 3Q2MA 4E7SA 5AFUK 4OYKA 4PFPA 1MMDA 4XAXB 5G26A 2CXFA 2JPFA 2KNDA 2EHOB 2XASB 3FXEB 3C4XA 3SS1A 1ZHZA 3FHNA 4AYID 1E54A 2KWIB 4AQFC 2B1EA 2NTYA 4QHOA 1MM4A 5JDNA 2E8IA 4BJNA 2K48A 3I0OA 3U78A 4O4IE 1Q9FA 2N2LA 1PHOA 1HTJF 3HW9A 3ANWB 4XZCA 2VASA 3T24A 3KV9A 4AQGA 3N9PA 2X9HA 1VOMA 4D65A 1ZV4X 4IE0A 3KFWX 1WYCA 3N2KE 3P7IA 2NW8A 4ZOLE 4ZI3C 4AI6A 3PQUA 4GHBA 4DBQA 5C8YE 4AXPA 1GFNA 4BAYB 2MBGA 5KX5E 3AAIA 5FY0A 3CVRA 4H9PC 5L3GB 3A2SX 3CMLA 5JQGE 3VU7H 1CUNA 2W63A 5IHYA 5J2UE 1MNDA 2NW7A 2ZM0A 3EDVA 3MKDA 5JDQA 2ZM2A 3OJAA 3RRCA 4PK4A 5TAOA 2J1NA 4IE4A 5ETWA 1OSMA 1WYBA 4HN9A 4QXCB 4XNKA 3NZQA 1GFPA 5DL7A 2XTLA 3FXDB 2OMFA 3ZC0A 2DLRA 4GYRA 1UX4A 2WMOA 3BQIA 4NUUA 2IAKA 5BMVE 1YW0A 3AA6B 3HKCE 4AKMA 4N58A 1GFQA 4QX8B 3PURA 1BR1A 4AQFA 2KC0A 2M07A 4GCSA 2CLYB 4AKLA 3N9QA 3PDYA 3CX6B 4L5GA 1EZ3A 4KBMB 3V8UA 2D5UA 2CA5A 4OK0A 2W61A 1WR6A 3M65A 3CQGB 5D5DA 4H9NC 1LKXA 1FIOA 2W0GA 4X1KE 3ZYMA 5LP6E 1YS5A 3JTYA 4FZMA 3C4WA 4UVBB 2PRNA 4V1Av 5L3FB 3V5UA 2YINA 4G2AA 2F1VA 1BR4A 4PJNA 2YU2A 3D0TA 3GN5A 2WSSV 3LK2A 2LEHA 1ZKEA 1H6S1 4ZI2C 3QK6A 2YEVC 3Q9DA 1FEWA 4QXHB 1BR2A 4MALA 4IGUA 4KUMB 4IHJE 1H7CA 2JMHA 4QX7B 3SRZA 3ESLA 3Q5XA 4YLHA 2OA5A 3ZMZB 1HS7A 2LJLA 2LHRA 4O2AE 2M67A 4FJOA 1KK7A 3JC6C 5DABA 3WI3A 3LK41 3C51A 1ZEEA 2XAHB 4WBOA 4ZI2D 2CLYC 3HI2A 4WNKA 2KT9A 4P0BA 3AA7A 3ZJ1A 2LSYA 3HWBA 4KMCA 3AA0B 2P9BA 4QXBB 4U74A 3SZVA 1Z0PA 3R6NA 3VY9X 4AYDC 1ZHTA 2CE7A 3FBZA 3C98B 3T0SA 4EZ4A 2Q9QD 2XUEA 4GYSA 2IC9A 2E9XB 5LJNA 3O0EA 1MNEA 4K0UA 2L3LA 4UF0A 4UELA 3SWHA 2YPVA 4FESA 2XE5A 4OHFA 3N9MA 4YHJA 4FRXA 4U9CA 5JDGA 2H3RA 3N9OA 2LSGA 3PUAA 3I9YA 4G63A 4CI1B 2XTQA 3B57A 4DBRA 2ZMAA 4MFRA 5JVDE 3O1IA 3ZN0B 3ZYKA 4C91A 1FMWA 3C5OA 2G0UA 4UXNB 4KRAA 3MZKB 2I59A 4EB6E 5FXZA 2RA1A 2X51A 1E1HB 1MMAA 3KV6A 4JFBA 3ZLIA 3V5SA 5JREA 3W15B 3NSGA 3POUA 2Y0HA 4I55E 3LFMA 5LBMA 5FXXA 2DCFA 2VK9A 3VZUX 3HKBE 2W81C 3DA3A 2VB6A 3CQCB 3RPUA 1MIVA 1QJ9A 3PU3A 3WAJA 3VKHA 3BK9A 1OPFA 4C69X 4PJJA 3AAAA 5LXTE 4YJ2E 3N5LA 1Q9GA 5JR9C 3CX8B 3CKDA 2LOSA 4ADZA 3AA1B 3LBXA 2W80C 2XAFB 4I50E 1BXWA 3TZGA 5LHIB 2QA7A 4JCHA 4QQ1A 5JH7E 2D2SA 1BH3A 2GE4A 1KNZA 4DNDA 3O1JA 4ERRA 4RJXA 3OYZA 3KDSE 4F6RC 5LOVE 1WLXA 2KINB 4ISSA 2NOXA 2MTQA 3PRNA 3KV4A 5HAXA 4DVDA 1MPFA 2PG8A 3MA9A 2VL8A 3ZMVB 3SY7A 3LK3A 3C64A 2VKHA 3KBTA 3N2OA 3KV5A 3O4XE 2N1GA 3UUNA 3LK2B 2YNKA 2X9YA 3KVDD 2F1TA 3I1AA 2V1DB 2N2MA 5FNVE 5H6RB 6PRNA 2ES0A 4GCPA 2JMKA 4YJ3E 3CWZB 2CEAA 2ZFGA 1OWAA 1BR0A 4TV9E 5L3CB 5CA1E 1GFMA 3AAEA 3OBVE 5FYMA 2ERVA 2LHFA 2X9XA 3E22E 5JDHA 3UAQA 3ZMSB 3QRCA 4LSIA 4PK6A 1D0XA 1HXUA 4HE8A 1X79A 1YKHB 1LVFA 2EHOC 3FB2A 2ODJA 3QRAA 4ZI3D 4XNLA 8PRNA 2A3DA 2D0TA 3EMNX 5EK4A 4O3XB 3N9NA 1P4TA 3SYSA 1O3XA 4LSEA 3OYXA 5ADXL 4GK5E 4LSFA 2CWYA 2HPLA 2LT3A 5HXRA 4O3WA 5IYZE 3ETVA 1D1CA 1FMVA 4CQIA 2H7OA 2X67A 2WM9A 1HG5A 2LOPA 3DJBA 4O4HE 4AKRA 1U5PA 4PJLA 5JRCA 2GK9A 2PFVA 3P8CD 2J4UP 2LSIA 3T8OA 4D64A 2XAJB 5EK3A 5FMNA 5CB4E 2KZ7B 2DHRA 2VKOA 3Q5WA 3RYHE 3VHLA 3ZJ2A 3ZN1B 5J1GA 2V7MA 3RKOA 4CI2B 3LG7A 5L3BB 2L9QA 3DTOA 4ASKA 4EXTA 5JDLA 2Q9QB 4FI5A 3IBPA 5IYUA 1HX8A 2HH7A 4JEHB 3VZTX 4IE5A 5A1LA 1B7TA 5ADXK 3VE2A 2Z6EA 4JEUB 1ZHCA 2V7LA 2WWUA 4CI3B 2Y0KA 1MMNA 2DI4A 4P0AA 3RYIE 4FSPA 5KDMC 5LYJE 4O4UA 4N59A 3SZDA 1HFAA 1HCIA 2H7VC 2JJ9A 2LFUA 3FYXA 2IW5B 3PUQA 5LBQB 4O2BE 3WI5A 1HG2A 3I9WA 2RP4A 5LGTB 3PUGA 3FBLA 2JMMA 2BZBA 2KLQA 2Y6XA 3CQXC 2VKDA 1ORMA 4UV9B 3ANWA 2QTKA 4MHCA 4KR8A 5DL8A 2WMNA 4TZ4C 3TKLB 2C5KT 3R84B 4DMWA 3JC6D 4EOZB 4JLEA 2O4VA 2D0UA 4H9QC 3UT5E 4ILUA 5L3DB 4FZLA 4PAGA 5FP3A 3HL6A 3RC8A 1SHZC 3J9X1 4ZI7E 1WRDA 3IEEA 4PK5A 4UIGA 2NWBA 2X66A 4X1IE 4ANJA 3WI4A 3KVAA 3MJXA 4I4TE 4L9IA 4U72A 2DWKA 5CA0E 1US7B 5KMGP 3GA8A 4ISTA 3F31A 2PORA 3NRXA 2X27X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK2 A;  3LK3 A;  3AA6 A;  3LK2 B;  3AA1 A;  1IZN A;  3AAA A;  5ADX L;  3LK4 2;  3LK3 B;  2KXP A;  5ADX K;  3AA6 B;  1IZN B;  3AA1 B;  3AAE A;  3AAA B;  2KXP B;  5AFU L;  3AAE B;  5AFU K;  3AA0 A;  3LK4 1;  2KZ7 A;  4AKR A;  3AA7 A;  3AA0 B;  2KZ7 B;  4AKR B;  3AA7 B; 
#chains in the Genus database with same CATH topology
 4UV8 B;  2CMR A;  2XPK A;  3VY8 X;  1JNR A;  3A0B O;  2E9X C;  3SOL A;  2NW9 A;  4UEM A;  1W0A A;  2YK0 A;  2ODV A;  4Z90 A;  4N78 D;  3N2G E;  2WZI A;  4AZL A;  1UX5 A;  3L3P A;  3MXZ A;  2Y2X A;  3AEG A;  5GON E;  3NZP A;  4B6X A;  4IIJ E;  5AQT B;  4ILA A;  5T5F A;  2A72 A;  3GN5 B;  2J1D G;  3SYB A;  2KSR A;  2DL1 A;  3E0Z A;  5JDP A;  1ZHW A;  3ZC1 A;  3L39 A;  1XDO A;  5HXH A;  5DQW A;  4WBN E;  5DJQ C;  5HXC A;  2IML A;  3AA7 B;  4BA9 A;  3SZV A;  1S94 A;  3ZPO A;  2FGR A;  4GKK T;  1GFO A;  2M06 A;  4J2C A;  2W00 A;  4QKN A;  4UF0 B;  3P4Q A;  1VCT A;  2XE3 A;  4IE7 A;  3AXJ A;  5E79 O;  1HXX A;  2XY8 B;  3IA3 A;  2KWH A;  5HWY A;  1T72 A;  1XNQ T;  2JQH A;  4ILC A;  5LB7 B;  2ZLD A;  3KVB A;  2WU5 A;  2CXL A;  4MBQ A;  3LBX B;  3H3A A;  2BKO A;  3UFE A;  3BQL A;  1HX1 B;  3K3N A;  5C3J A;  4HFC A;  4H9R C;  4JI8 T;  4NUV A;  4XBF B;  3A8Y C;  3Q5D A;  1N33 T;  4PW8 A;  1Z8U A;  3LK3 B;  1SA0 E;  3HOL A;  1D1B A;  4G75 A;  3ZMU B;  3MK7 C;  1PRN A;  4IL6 O;  4DR3 T;  5LA6 E;  5B5E O;  5LGU B;  4TUY E;  2VUR A;  2W66 A;  2J47 A;  3EAM A;  5G38 A;  4CXW A;  2V7K A;  3UQ4 A;  3L8R A;  2WDR A;  4H63 H;  5JDM A;  5LGN B;  1AJ3 A;  3ZCJ A;  4GCQ A;  3AE5 A;  5KAF O;  1MM5 A;  2PJQ A;  5LCY A;  4X66 T;  3MAC A;  3GMI A;  3KIN B;  4NXN T;  4AKR B;  2Q9Q A;  4UVC B;  5F3J A;  4BUM X;  2I6H A;  2NTX A;  4HKA A;  2F4V T;  4F4B A;  3HKD E;  2KXP B;  4FZN A;  3AAE B;  4JI3 T;  4PFP A;  1MMD A;  1T7S A;  5G26 A;  2KND A;  2EHO B;  4IDP A;  4KI0 F;  2LM2 A;  2E8I A;  4O4I E;  1PHO A;  3QOF A;  1HTJ F;  4AQG A;  4D65 A;  3P7I A;  4EV6 A;  4ZI3 C;  2FJD A;  4DBQ A;  4BAY B;  2MBG A;  3CVR A;  4H9P C;  5JQG E;  2WWV A;  5J2U E;  1MND A;  3EDV A;  2UXD T;  3RRC A;  2QYW A;  1WYB A;  4XNK A;  4CTD A;  3NZQ A;  2XTL A;  2DLR A;  3JAF A;  1UX4 A;  4N58 A;  1GFQ A;  3PUR A;  4AQF A;  4AKL A;  3PDY A;  1EZ3 A;  2D5U A;  2XQ8 A;  5D5D A;  3M65 A;  1YS5 A;  1LKX A;  5LP6 E;  5L3F B;  1KF6 A;  1T16 A;  4ILB A;  1BR4 A;  2LEH A;  4QXH B;  2BG9 E;  4IGU A;  2LJL A;  2LHR A;  3DWN A;  3X1D A;  2M67 A;  3LK4 1;  4ZI2 D;  2CLY C;  3HI2 A;  2KT9 A;  2YDS A;  3ZJ1 A;  2LSY A;  2UXB T;  3PJA A;  1Z0P A;  1E7P A;  3R6N A;  2CE7 A;  2XUE A;  5LJN A;  1T8B A;  4K0U A;  4FES A;  2L3L A;  3N9M A;  2YDR A;  4CI1 B;  3PUA A;  3NWI A;  2ZMA A;  5JVD E;  4K3B A;  3C5O A;  2G0U A;  3RQU A;  3MZK B;  1N36 T;  1MMA A;  3ZLI A;  3V5S A;  5JRE A;  3POU A;  2Y0H A;  5LBM A;  2BG9 A;  4LFC T;  3CQC B;  3WAJ A;  3VKH A;  1OPF A;  4YJ2 E;  3ABV A;  1OED B;  4I50 E;  1BXW A;  1XMQ T;  1ZP0 A;  5JH7 E;  1KNZ A;  4RJX A;  3OYZ A;  3TLU A;  2KIN B;  2BKN A;  4DVD A;  2PG8 A;  5AQN B;  4JBW F;  3UU4 A;  3C64 A;  3KBT A;  1KEY A;  3SFD A;  3UUN A;  3LK2 B;  2YNK A;  2X9Y A;  2F1T A;  5FNV E;  4YJ3 E;  4C4V B;  3AE8 A;  1UGO A;  4ZZB A;  3OBV E;  4KHZ F;  4YSY A;  4LSI A;  4HFH A;  1D0X A;  2E5L T;  2ODJ A;  2EHO C;  4ZI3 D;  4XNL A;  5ABF B;  2HN2 A;  5EK4 A;  3EMN X;  2FJB A;  3SYS A;  4LSE A;  5ABG A;  3RF1 A;  3ZST A;  4O3W A;  5IYZ E;  1D1C A;  3LSV A;  1HG5 A;  4DV6 T;  2GK9 A;  3P8C D;  1VCS A;  3RYH E;  2DHR A;  2VKO A;  2UUA T;  2R4N A;  2HHH T;  3LG7 A;  3PUW F;  3DTO A;  4ASK A;  4PJ0 O;  4FI5 A;  2R89 A;  5IYU A;  3VZT X;  5A1L A;  3VE2 A;  4JEU B;  1ZHC A;  4LF8 T;  2Y0K A;  2DI4 A;  4UB6 O;  3PUQ A;  5LBQ B;  4O2B E;  1HG2 A;  3I9W A;  2OV9 A;  2JMM A;  2KLQ A;  2VKD A;  5DL8 A;  1NEK A;  2R8A A;  2C5K T;  3R84 B;  4JLE A;  3OVU A;  4ILU A;  5FP3 A;  3J9X 1;  1WRD A;  3UU5 A;  2X66 A;  4ANJ A;  5FVL A;  2UUC T;  2DWK A;  4LMJ A;  3GA8 A;  3PV0 F;  3NRX A;  2BS3 A;  2X0L B;  1QJ8 A;  4QH5 A;  3AA6 A;  4UB8 O;  4E1S A;  4B61 A;  1MMG A;  4B3M T;  3OKQ A;  5L2L A;  1G90 A;  3I0Q A;  2X0H A;  5LMU T;  4JYA T;  3AB3 B;  2LM9 A;  4NIQ A;  3UUM A;  3JAE A;  2DWG A;  4IE6 A;  4WYV A;  3A5X A;  5LMN T;  1V9D A;  2WBL A;  4FRT A;  3HR0 A;  4HFV A;  3VR9 A;  4TN7 B;  2VQE T;  4KHP T;  5LHG B;  2MPK A;  2CBI A;  3NBX X;  2K24 A;  2XQ4 A;  5GTH O;  1LVK A;  1OED C;  3K1S A;  3AA0 A;  1W0B A;  3U3I A;  4YY3 T;  3C50 A;  4DMV A;  4YT0 A;  3FZF B;  2E9X A;  4RLC A;  3G06 A;  4EYU A;  4FT6 A;  4O3Y A;  5HXS A;  3V8U A;  4TV8 E;  3RH3 A;  4H9O C;  2Y48 B;  3PTR B;  2FBW A;  2CCQ A;  5FVN A;  1I6Z A;  5LJM A;  5L4H A;  3VZW X;  2XTR A;  3K3O A;  1MIY A;  2QGS A;  3AEF A;  4CXY A;  4HWD A;  1Y01 A;  2CWO A;  2EHO D;  4AUI A;  4HGA A;  5AQL B;  4K0K T;  3UU2 A;  4EAH A;  3DZM A;  3BRZ A;  3F57 A;  3QB5 K;  2XE2 A;  4JI2 T;  4Z3T A;  1XMO T;  4IT4 A;  3ZYL A;  4U7I A;  5HWX A;  3RX6 A;  2K4T A;  4YFS A;  3EVY A;  1IZN A;  3IF8 B;  2BVL A;  1E2A A;  2NP9 A;  4RJW A;  2WY2 A;  4AKH A;  2WAU A;  4FZL A;  3QC9 A;  1Y64 B;  4NPP A;  2IDO B;  4A56 A;  2SPC A;  3PE0 A;  3GWH A;  4O4L E;  2XHE B;  4PFO A;  3PU8 A;  5ABE A;  1UCU A;  4AYN A;  4M1P A;  3LK4 2;  2AXT O;  5E0O A;  3UUX B;  3EHZ A;  4B3S T;  4DR1 T;  3PGR A;  4Z91 A;  1YD8 G;  2QRX A;  3RC3 A;  2HPJ A;  2X9W A;  3UPG A;  3H37 A;  5G3A A;  4ZXL A;  3M3Z B;  1HXT A;  4X20 E;  5HEG A;  3K8P C;  1T98 A;  4JUY A;  1D1A A;  2X68 A;  3ZEF B;  2XG6 A;  1QUU A;  5AFU L;  1NWM X;  4U2Z A;  1NAF A;  2Y8D A;  2MHL A;  3E08 A;  5HCJ A;  2XAG B;  3AE7 A;  3G7G A;  4EZH A;  1W09 A;  4DV0 T;  2BDE A;  5JRC B;  2MNH A;  3PUS A;  2XQY A;  2K0L A;  3B13 A;  4OFZ A;  2UXN B;  3TLT A;  3Q2M A;  4E7S A;  5AFU K;  3JCF A;  4JI1 T;  1L0V A;  2B1E A;  4QHO A;  1MM4 A;  5JDN A;  2CHO A;  3U78 A;  2N2L A;  3ANW B;  3N9P A;  4IE0 A;  3KFW X;  4DV2 T;  4LF4 T;  4AI6 A;  4TWF A;  1HNW T;  2J4G A;  4HWI B;  3CML A;  3VU7 H;  2WJQ A;  4DUZ T;  2ZM2 A;  3OJA A;  4PK4 A;  2J1N A;  5ETW A;  4HN9 A;  1SUM B;  1KFY A;  2WDQ A;  2WMO A;  5BMV E;  4NUU A;  4JI4 T;  3RGL A;  2JQK A;  5J0Z A;  2KC0 A;  2CLY B;  4KBM B;  4UR9 A;  1M7K A;  2WQY A;  3CQG B;  5TIS O;  3JTY A;  4V1A v;  3V5U A;  3GN5 A;  4ZI2 C;  1FEW A;  1BR2 A;  4MAL A;  2M6B A;  4IHJ E;  3ESL A;  4YLH A;  3ZMZ B;  5LG3 A;  4QH4 A;  2IHR 1;  5DAB A;  3C51 A;  1ZEE A;  2XJ7 A;  4WBO A;  2VL0 A;  3AA7 A;  5AQM B;  4U74 A;  4AYD C;  1ZHT A;  3H3M A;  4EZ4 A;  3O0E A;  1UUS A;  4UF0 A;  4UEL A;  3SWH A;  4OHF A;  1CHU A;  5JDG A;  2LSG A;  2LLY A;  3P4R A;  4DID B;  3O1I A;  4C91 A;  4KRA A;  3P4P A;  2RA1 A;  4DR7 T;  1E1H B;  5AQH B;  2IWV A;  3CK6 A;  2VB6 A;  1MIV A;  3PU3 A;  2CHN A;  4C69 X;  3ZT6 A;  2WCA A;  1T1L A;  2LOS A;  4ADZ A;  3AA1 B;  3LBX A;  2WB5 A;  2QA7 A;  4IDQ A;  1HR0 T;  4F6R C;  2NOX A;  2CRB A;  3OPC A;  3MA9 A;  3OTO T;  2VL8 A;  3ONL C;  3LK3 A;  3N2O A;  3O4X E;  1IBM T;  2XQA A;  3I1A A;  5H6R B;  3TLW A;  2CEA A;  1OWA A;  5L3C B;  1GFM A;  2WU2 A;  3UQ7 A;  5JDH A;  3UAQ A;  3ZMS B;  3ZKR A;  4PK6 A;  1HXU A;  4HE8 A;  1X79 A;  1YKH B;  5HEJ A;  3QRA A;  8PRN A;  2A3D A;  2D0T A;  3A7M A;  3N9N A;  4QH1 A;  4HFI A;  1P4T A;  2B76 A;  1O3X A;  4GK5 E;  4LSF A;  2CWY A;  2HPL A;  2LT3 A;  2H7O A;  4DV1 T;  2WM9 A;  2LOP A;  4AKR A;  5KXJ A;  2J4U P;  2KZ7 B;  3ZN1 B;  3RKG A;  3ZJ2 A;  2K3W A;  3RKO A;  3NJT A;  5AQS B;  4AIU A;  2BG9 B;  2HH7 A;  3EAB A;  2Z6E A;  2V7L A;  2WWU A;  1MMN A;  3PUY F;  3RYI E;  5KDM C;  3SZD A;  4HWF A;  1XDP A;  2IW5 B;  3WI5 A;  5LGT B;  3PUG A;  2Y6X A;  3CQX C;  1WFD A;  3AE4 A;  4MHC A;  4KR8 A;  2WMN A;  3T1H T;  4EOZ B;  4ZI7 E;  2NWB A;  3WI4 A;  1UK5 A;  5CA0 E;  2I0M A;  2N2N A;  4GOU A;  2V7I A;  4TNW A;  3FZM B;  3RYC E;  2LSK A;  5EZY E;  1QJP A;  3RI5 A;  4E7Z A;  2ZLY A;  2XMX A;  2V5D A;  3VE1 A;  3BS0 A;  2Y7S A;  3RHW A;  3CPZ A;  1HNX T;  3F2E A;  2FJE A;  1U4Q A;  1OED E;  2JQ9 A;  5FXW A;  4IL4 A;  3RIU C;  5ABH A;  2LHN A;  3PUZ F;  4FOZ A;  3K19 A;  3UTK A;  3RRW A;  3RYF E;  3WU2 O;  4LF6 T;  4O4J E;  5JR9 A;  1ZHX A;  2N9D A;  4C90 A;  3VZU X;  4COF A;  1G73 A;  5DQV A;  4X1Y E;  3ONX A;  1M62 A;  2KDY A;  5HYA A;  1IJ6 A;  2A9U A;  4IDZ A;  5L47 A;  3FZL B;  4JI6 T;  2JQY A;  2JQQ A;  2K9A A;  3Q5E A;  4KR4 A;  1J5W A;  4CN1 A;  3O1H A;  5F8P A;  5PRN A;  3TLS A;  2YU1 A;  4YTN A;  4RLB A;  3L09 A;  3PGS A;  2Y0L A;  2C0S A;  1IBK T;  2VQF T;  2XAQ B;  2A2F X;  1OED A;  5HEO A;  5BR8 T;  3CX7 B;  2AE9 A;  4AKG A;  1THQ A;  3AAA B;  3HA4 A;  4BJM A;  1ZHY A;  3DP7 A;  2WZH A;  4YHH T;  2CXD A;  2W4X A;  3RBH A;  3J7Y q;  3EDU A;  2XSA A;  4ZHQ E;  4GK0 E;  4G76 A;  5EE2 A;  4LFB T;  4MLK A;  3DA4 A;  4I0U A;  4ZS3 A;  1MIW A;  4GIW A;  4TX5 A;  2XM2 A;  2BG9 C;  3C4Z A;  2XQ6 A;  3ETU A;  3HOE A;  3AE3 A;  5LG4 A;  3GP6 A;  5ABF A;  5H6Q B;  3IHR A;  4H9S E;  4O3Z A;  1IAP A;  2R4L A;  2K5B B;  2BBH A;  5J2T E;  4KX6 A;  2NR4 A;  4P09 A;  4U33 A;  4A97 A;  2V26 A;  5JTG A;  3VRA A;  1YKE B;  2IIU A;  2MYS A;  4U3C A;  3SY9 A;  7PRN A;  2V6Y B;  4EIW A;  4D5U A;  2C5I T;  4X65 T;  3N9L A;  2BVM A;  2E2A A;  2ACX A;  1SE7 A;  2R6G F;  4WW0 A;  3K3Q C;  3WAK A;  1IZN B;  4N75 A;  4UVA B;  4LSH A;  3NKZ A;  4XAX B;  2CXF A;  2XAS B;  4Q25 A;  3SS1 A;  1ZHZ A;  2KWI B;  4YSX A;  3UU3 A;  2LRL A;  3I0O A;  2XSB A;  3ZT5 A;  3HW9 A;  2VAS A;  3T24 A;  3KV9 A;  1VOM A;  1ZV4 X;  1WYC A;  2R88 A;  4AXP A;  4HWC A;  5FY0 A;  5L3G B;  2LKH A;  3FZK B;  5IHY A;  2NW7 A;  2ZM0 A;  3MKD A;  4QXC B;  2IWW A;  5HCM A;  1GFP A;  3FXD B;  3ZC0 A;  4K3C A;  4GYR A;  3BQI A;  3SFE A;  4LML A;  1YW0 A;  3HKC E;  4AKM A;  4QX8 B;  1BR1 A;  2M07 A;  4GCS A;  4L5G A;  4OK0 A;  2W61 A;  1WR6 A;  4JI7 T;  4H9N C;  3ZYM A;  1FIO A;  4FZM A;  3RIF A;  4G2A A;  5FL0 A;  2OLT A;  3LDQ B;  3PUV F;  3VR8 A;  2YEV C;  2ACZ A;  5G39 A;  2JMH A;  3Q5X A;  4O2A E;  1KK7 A;  4P1N A;  3WI3 A;  2XAH B;  3RQW A;  4LF5 T;  3HWB A;  4YSZ A;  4QXB B;  5FL1 A;  2XQ3 A;  3VY9 X;  3T0S A;  3FBZ A;  3C98 B;  4JV5 T;  3PJA J;  3BRY A;  4LFA T;  1MNE A;  2W2U A;  3AE1 A;  2YPV A;  1R8I A;  3CIR A;  4FRX A;  3UU8 A;  2H3R A;  5AQV B;  3I9Y A;  4DUY T;  3B57 A;  4MFR A;  1FMW A;  1I94 T;  4UXN B;  3AXJ B;  3W15 B;  4I55 E;  2DCF A;  2E5V A;  3HKB E;  3RPU A;  1QJ9 A;  2XZE A;  2WS3 A;  3BK9 A;  1N32 T;  5LXT E;  2XM1 A;  3N5L A;  2W80 C;  2XAF B;  3AE2 A;  4QQ1 A;  1BH3 A;  4DV4 T;  3KDS E;  3UFG A;  5LOV E;  4TWD A;  2BBJ A;  2MTQ A;  5HAX A;  1XNR T;  3ZMV B;  3SY7 A;  1YQ4 A;  2VKH A;  3KV5 A;  4DR4 T;  2N1G A;  4N74 A;  3KVD D;  2V1D B;  2N2M A;  2ES0 A;  2WP9 A;  2ZFG A;  3AE6 A;  5GTI O;  4TV9 E;  5CA1 E;  2IUB A;  2ERV A;  2LHF A;  4A5X A;  3QRC A;  4DV3 T;  3FB2 A;  5CGM A;  2XQ9 A;  3DWO X;  3OYX A;  5ADX L;  2FUP A;  4X64 T;  4EED A;  3ETV A;  1FMV A;  2YN6 A;  3P4S A;  2X67 A;  2BS4 A;  1U5P A;  5JRC A;  1DU2 A;  2LSI A;  3VHL A;  5EK3 A;  5FMN A;  5CB4 E;  2MAW A;  3Q5W A;  4HFB A;  4CI2 B;  5L3B B;  3TLV A;  2Q9Q B;  1QLB A;  3IBP A;  1HX8 A;  4JEH B;  5ADX K;  4P0A A;  2M6I A;  4FSP A;  5LYJ E;  4IDN A;  1HFA A;  1HCI A;  5AQP B;  3FYX A;  1J1J A;  3FBL A;  1ORM A;  3ANW A;  4HWH A;  2QTK A;  3TKL B;  4DV5 T;  3UT5 E;  4H9Q C;  3RC8 A;  3HL6 A;  1SHZ C;  3FZH B;  2H88 A;  4U72 A;  2X9K A;  2VVS A;  4HFD A;  5KMG P;  2R4P A;  4IST A;  2POR A;  3ONJ A;  2X27 X;  4DO0 A;  3QUJ A;  4FMS A;  3POX A;  2AXD S;  4DR5 T;  4U31 A;  1HF8 A;  4FUV A;  2D9D A;  4AYM C;  2UUB T;  3UUB A;  2IC6 A;  1YXR A;  3EUH A;  4B3T T;  4KP3 C;  2W62 A;  1LRZ A;  1J5E T;  2E9X D;  5LHH B;  1HNZ T;  4QWN B;  1OXZ A;  1VRB A;  3T1Y T;  2UU9 T;  2UXC T;  3T20 A;  5GV0 A;  4B3R T;  3PUX F;  5JDF A;  3AVS A;  4O8S A;  4I43 B;  2ODU A;  2CBJ A;  1XZY A;  2LRK A;  3P50 A;  4AYE C;  3KBU A;  2MOZ A;  1W9R A;  4LF7 T;  4CN6 A;  5DL5 A;  1D0Y A;  2FGQ X;  3LJC A;  3O9X A;  4OYJ A;  3UUL A;  5AQI B;  2WVP A;  4HEA A;  2L8K A;  2JIW A;  5HXE A;  4YTM A;  1S35 A;  4AKI A;  3PGU A;  4AQY T;  2KMF A;  3RIU A;  4GF4 A;  4EYY R;  2XQ7 A;  5FY1 A;  4U2Y A;  4LF9 T;  4OX9 T;  3AA1 A;  3AE9 A;  4IRE A;  3EI0 A;  3ZSS A;  2KXP A;  2JRK A;  5L3E B;  2VWA A;  3AAE A;  2LKG A;  1IJ5 A;  4Z8X A;  2XE1 A;  3PQS A;  4C00 A;  2PBI A;  1QSD A;  2EHO A;  3ZCI A;  4ZZC A;  4L0R A;  2CM0 A;  4DV7 T;  4E1T A;  2LSJ A;  3NRY A;  4CZZ B;  4WZX A;  4F8H A;  4CXX A;  4IDO A;  2C5J A;  1S5L O;  4A98 A;  5EK2 A;  5CJ5 A;  1BT9 A;  2UXX B;  2DNX A;  2YKS A;  4DR6 T;  2Q9Q C;  3JAD A;  3POQ A;  5DL6 A;  4FSO A;  3POR A;  3B5M A;  4PNI A;  1D0Z A;  2ZM8 A;  4H63 V;  5IWA T;  2CPT A;  4RL9 A;  4PJM A;  5JR9 B;  3VKG A;  5LNK A;  5FY7 A;  4AFK A;  3HKE E;  4ZS2 A;  1WR0 A;  1G8X A;  3AVR A;  1X9B A;  2WDV A;  4PR7 A;  4PUX A;  4O49 A;  2KZ7 A;  4O4X A;  5M4Y A;  3ZMT B;  5FKY A;  2PTF A;  5FXV A;  1XWM A;  2VKJ A;  3AED A;  1UUR A;  3S4U A;  2LE8 A;  2V7J A;  4X5T A;  4HTE A;  3BQK A;  2F1C X;  4OYK A;  2JPF A;  2XQ5 A;  2R4O A;  3FXE B;  3C4X A;  3FHN A;  3KZI O;  4AYI D;  1E54 A;  3RLF F;  4AQF C;  2NTY A;  4IL9 A;  4DR2 T;  5AQR B;  5KAI O;  4BJN A;  2K48 A;  1Q9F A;  4XZC A;  4U7Y A;  2X9H A;  1KNR A;  3N2K E;  5HEH A;  2NW8 A;  4ZOL E;  4GHB A;  3PQU A;  5C8Y E;  1GFN A;  5KX5 E;  3AAI A;  3A2S X;  1CUN A;  2W63 A;  5FVK A;  1JNZ A;  5JDQ A;  5TAO A;  4IE4 A;  1OSM A;  5AQG B;  5DL7 A;  4AIS A;  2OMF A;  4X62 T;  5AQU B;  2BS2 A;  2IAK A;  2WJR A;  3AA6 B;  3N9Q A;  3CX6 B;  2CA5 A;  1GQE A;  5AQQ B;  5AQK B;  2W0G A;  4X1K E;  4TNV A;  3C4W A;  4UVB B;  2PRN A;  4NXM T;  2YIN A;  2H89 A;  2F1V A;  4PJN A;  2YU2 A;  3D0T A;  5B66 O;  2WSS V;  3LK2 A;  1ZKE A;  1H6S 1;  3QK6 A;  2X0Y A;  3Q9D A;  4KUM B;  2W67 A;  1H7C A;  4QX7 B;  3SRZ A;  4C4V A;  1HS7 A;  2OA5 A;  1FJG T;  4FJO A;  3JC6 C;  4WNK A;  4P0B A;  4KMC A;  3AA0 B;  2P9B A;  2VVN A;  5L4E A;  2Q9Q D;  4GYS A;  2IC9 A;  2E9X B;  5F5W A;  2FJA A;  5AQJ B;  3NVO A;  2XE5 A;  1N34 T;  4YHJ A;  4CN4 A;  4U9C A;  3N9O A;  4G63 A;  3UU6 A;  2XTQ A;  4YXD A;  4DBR A;  3ZN0 B;  3ZYK A;  2I59 A;  4EB6 E;  5FXZ A;  2X51 A;  3KV6 A;  4JFB A;  3NSG A;  3LFM A;  5FXX A;  2VK9 A;  2W81 C;  3DA3 A;  4EGW A;  4PJJ A;  3AAA A;  1Q9G A;  4LMK A;  5JR9 C;  3CX8 B;  3CKD A;  5HEU A;  2HN1 A;  3TZG A;  5LHI B;  4JCH A;  2D2S A;  2GE4 A;  4DND A;  4YTP A;  3O1J A;  4ERR A;  1WLX A;  4ISS A;  3ZT7 A;  5IUX A;  3PRN A;  3KV4 A;  1MPF A;  2BKP A;  2YDQ A;  3PF1 A;  5H2F O;  6PRN A;  2ZM6 T;  4GCP A;  2JMK A;  3CWZ B;  1BR0 A;  5AQO B;  2J62 A;  5FYM A;  2X9X A;  3E22 E;  1KNP A;  5AQF B;  4HFE A;  5C2T A;  1LVF A;  4JI0 T;  1WCR A;  4O3X B;  5HXR A;  4GKJ T;  3A0H O;  2V6Y A;  4CQI A;  2V5C A;  3QB5 A;  3DJB A;  4O4H E;  4PJL A;  4JI5 T;  2PFV A;  3T8O A;  4D64 A;  2XAJ B;  5J1G A;  5CFB A;  2V7M A;  1YQ3 A;  2L9Q A;  4EXT A;  5JDL A;  1ZOY A;  4IE5 A;  1B7T A;  4CI3 B;  4O4U A;  3AEB A;  3AEE A;  4N59 A;  3AEC A;  3RIA A;  2JJ9 A;  1NEN A;  2H7V C;  2LFU A;  2QVA A;  2RP4 A;  4EEB A;  2RPA A;  2BZB A;  3P4W A;  4UV9 B;  4TZ4 C;  2V6X A;  2V8S V;  4DMW A;  3JC6 D;  2O4V A;  2D0U A;  5L3D B;  4PAG A;  2YOE A;  3IEE A;  4PK5 A;  4UIG A;  4FQE A;  3AEA A;  4ZEY A;  4X1I E;  3KVA A;  3MJX A;  4I4T E;  4L9I A;  3JCU O;  1US7 B;  4TWH A;  3F31 A;  3QNU A;  3VRB A;  1IBL T; 
#chains in the Genus database with same CATH homology
 2N2N A;  4DO0 A;  2X0L B;  1QJ8 A;  4UV8 B;  3QUJ A;  4GOU A;  3AA6 A;  2CMR A;  3VY8 X;  4E1S A;  2V7I A;  4FMS A;  4B61 A;  3POX A;  1MMG A;  2E9X C;  3OKQ A;  5L2L A;  3RYC E;  3SOL A;  1G90 A;  2NW9 A;  3I0Q A;  4UEM A;  2LSK A;  1HF8 A;  5EZY E;  4FUV A;  1QJP A;  4AYM C;  2YK0 A;  2LM9 A;  3AB3 B;  2ODV A;  2IC6 A;  3UUM A;  3EUH A;  4N78 D;  3N2G E;  4E7Z A;  2ZLY A;  2XMX A;  2DWG A;  4IE6 A;  3VE1 A;  4AZL A;  3A5X A;  4KP3 C;  2W62 A;  1LRZ A;  1UX5 A;  1V9D A;  3L3P A;  2WBL A;  3MXZ A;  2E9X D;  5LHH B;  2Y2X A;  4FRT A;  4QWN B;  1OXZ A;  3HR0 A;  5GON E;  3NZP A;  4B6X A;  2Y7S A;  1VRB A;  4IIJ E;  3CPZ A;  4HFV A;  3F2E A;  4TN7 B;  1U4Q A;  5T5F A;  3T20 A;  2A72 A;  3GN5 B;  2J1D G;  3SYB A;  5GV0 A;  5LHG B;  5JDF A;  3AVS A;  4O8S A;  4I43 B;  2ODU A;  5FXW A;  3NBX X;  2K24 A;  3E0Z A;  5JDP A;  1ZHW A;  3ZC1 A;  2LHN A;  4FOZ A;  1LVK A;  3K19 A;  3UTK A;  3AA0 A;  3RRW A;  4AYE C;  3KBU A;  3RYF E;  5HXH A;  2MOZ A;  5DQW A;  3U3I A;  4WBN E;  3C50 A;  5DJQ C;  4DMV A;  5DL5 A;  4O4J E;  5HXC A;  2E9X A;  4RLC A;  4EYU A;  5JR9 A;  3AA7 B;  4FT6 A;  4BA9 A;  1D0Y A;  2N9D A;  4C90 A;  5HXS A;  1S94 A;  3ZPO A;  4TV8 E;  3RH3 A;  4H9O C;  1ZHX A;  1G73 A;  2FGQ X;  5DQV A;  2FGR A;  2Y48 B;  3PTR B;  3LJC A;  4X1Y E;  3ONX A;  2KDY A;  2CCQ A;  5HYA A;  1IJ6 A;  4IDZ A;  5FVN A;  5LJM A;  3O9X A;  1GFO A;  2M06 A;  4J2C A;  2W00 A;  4QKN A;  4UF0 B;  2XTR A;  3VZW X;  2JQQ A;  2K9A A;  4OYJ A;  3UUL A;  3K3O A;  4KR4 A;  1MIY A;  2QGS A;  4CXY A;  2XE3 A;  4HEA A;  2CWO A;  2L8K A;  4IE7 A;  3O1H A;  2EHO D;  5F8P A;  5PRN A;  5HXE A;  4AUI A;  1HXX A;  2YU1 A;  4HGA A;  4RLB A;  3L09 A;  3UU2 A;  4EAH A;  2Y0L A;  1S35 A;  4AKI A;  2KWH A;  3F57 A;  2KMF A;  2C0S A;  2XE2 A;  4Z3T A;  4GF4 A;  4EYY R;  5HWY A;  3ZYL A;  5FY1 A;  5HWX A;  2XAQ B;  3RX6 A;  2K4T A;  2A2F X;  4YFS A;  3EVY A;  3AA1 A;  1IZN A;  3IF8 B;  2BVL A;  2KXP A;  2NP9 A;  3CX7 B;  4RJW A;  2ZLD A;  4AKH A;  2WAU A;  4AKG A;  2JRK A;  3KVB A;  2VWA A;  5L3E B;  1THQ A;  1IJ5 A;  3AAA B;  4Z8X A;  3HA4 A;  4BJM A;  3QC9 A;  1ZHY A;  3DP7 A;  2CXL A;  2XE1 A;  1Y64 B;  3PQS A;  2PBI A;  4A56 A;  4MBQ A;  2SPC A;  1QSD A;  2CXD A;  2EHO A;  3LBX B;  3PE0 A;  3ZCI A;  3RBH A;  3J7Y q;  3H3A A;  3EDU A;  3BQL A;  3GWH A;  2CM0 A;  4L0R A;  4O4L E;  3K3N A;  3UFE A;  4ZHQ E;  2LSJ A;  3NRY A;  4GK0 E;  4CZZ B;  2XHE B;  4G76 A;  4E1T A;  4H9R C;  5EE2 A;  4NUV A;  4CXX A;  4XBF B;  2C5J A;  5EK2 A;  4PFO A;  4MLK A;  1BT9 A;  3DA4 A;  3PU8 A;  4ZS3 A;  2UXX B;  1UCU A;  1MIW A;  4PW8 A;  4M1P A;  4AYN A;  3LK4 2;  3LK3 B;  2DNX A;  4GIW A;  4TX5 A;  1SA0 E;  5E0O A;  3UUX B;  3HOL A;  2Q9Q C;  3C4Z A;  1D1B A;  4G75 A;  3POQ A;  3ZMU B;  3MK7 C;  5DL6 A;  4FSO A;  3POR A;  3ETU A;  3HOE A;  1YD8 G;  4PNI A;  1D0Z A;  2ZM8 A;  3RC3 A;  2HPJ A;  4H63 V;  2X9W A;  1PRN A;  3UPG A;  5LG4 A;  3H37 A;  3GP6 A;  5H6Q B;  3IHR A;  4H9S E;  5LA6 E;  5LGU B;  4O3Z A;  4RL9 A;  4TUY E;  4PJM A;  5JR9 B;  1IAP A;  2K5B B;  4X20 E;  1HXT A;  3VKG A;  3K8P C;  5LNK A;  5FY7 A;  4AFK A;  5J2T E;  1T98 A;  4JUY A;  3HKE E;  1D1A A;  4CXW A;  4ZS2 A;  2V7K A;  4P09 A;  2V26 A;  2X68 A;  3ZEF B;  2XG6 A;  1QUU A;  1YKE B;  1G8X A;  3AVR A;  2MYS A;  5AFU L;  4H63 H;  1NWM X;  5JDM A;  5LGN B;  1AJ3 A;  3ZCJ A;  4GCQ A;  3SY9 A;  4PUX A;  7PRN A;  1NAF A;  2Y8D A;  4EIW A;  2KZ7 A;  1MM5 A;  2MHL A;  4O49 A;  3E08 A;  2PJQ A;  5LCY A;  4D5U A;  3MAC A;  2XAG B;  3GMI A;  2C5I T;  3G7G A;  4EZH A;  3KIN B;  3N9L A;  5M4Y A;  2BVM A;  4O4X A;  3ZMT B;  2ACX A;  2BDE A;  4AKR B;  2Q9Q A;  5JRC B;  4UVC B;  5F3J A;  4BUM X;  5FXV A;  2MNH A;  2VKJ A;  2NTX A;  4HKA A;  3PUS A;  4WW0 A;  3S4U A;  2XQY A;  3K3Q C;  3WAK A;  4F4B A;  1IZN B;  2LE8 A;  2V7J A;  3HKD E;  4UVA B;  2K0L A;  3B13 A;  4O3Y A;  2KXP B;  4HTE A;  4OFZ A;  4FZN A;  2UXN B;  3BQK A;  3AAE B;  4LSH A;  3Q2M A;  4E7S A;  5AFU K;  4OYK A;  4PFP A;  1MMD A;  4XAX B;  5G26 A;  2CXF A;  2JPF A;  2KND A;  2EHO B;  2XAS B;  3FXE B;  3C4X A;  3SS1 A;  1ZHZ A;  3FHN A;  4AYI D;  1E54 A;  2KWI B;  4AQF C;  2B1E A;  2NTY A;  4QHO A;  1MM4 A;  5JDN A;  2E8I A;  4BJN A;  2K48 A;  3I0O A;  3U78 A;  4O4I E;  1Q9F A;  2N2L A;  1PHO A;  1HTJ F;  3HW9 A;  3ANW B;  4XZC A;  2VAS A;  3T24 A;  3KV9 A;  4AQG A;  3N9P A;  2X9H A;  1VOM A;  4D65 A;  1ZV4 X;  4IE0 A;  3KFW X;  1WYC A;  3N2K E;  3P7I A;  2NW8 A;  4ZOL E;  4ZI3 C;  4AI6 A;  3PQU A;  4GHB A;  4DBQ A;  5C8Y E;  4AXP A;  1GFN A;  4BAY B;  2MBG A;  5KX5 E;  3AAI A;  5FY0 A;  3CVR A;  4H9P C;  5L3G B;  3A2S X;  3CML A;  5JQG E;  3VU7 H;  1CUN A;  2W63 A;  5IHY A;  5J2U E;  1MND A;  2NW7 A;  2ZM0 A;  3EDV A;  3MKD A;  5JDQ A;  2ZM2 A;  3OJA A;  3RRC A;  4PK4 A;  5TAO A;  2J1N A;  4IE4 A;  5ETW A;  1OSM A;  1WYB A;  4HN9 A;  4QXC B;  4XNK A;  3NZQ A;  1GFP A;  5DL7 A;  2XTL A;  3FXD B;  2OMF A;  3ZC0 A;  2DLR A;  4GYR A;  1UX4 A;  2WMO A;  3BQI A;  4NUU A;  2IAK A;  5BMV E;  1YW0 A;  3AA6 B;  3HKC E;  4AKM A;  4N58 A;  1GFQ A;  4QX8 B;  3PUR A;  1BR1 A;  4AQF A;  2KC0 A;  2M07 A;  4GCS A;  2CLY B;  4AKL A;  3N9Q A;  3PDY A;  3CX6 B;  4L5G A;  1EZ3 A;  4KBM B;  3V8U A;  2D5U A;  2CA5 A;  4OK0 A;  2W61 A;  1WR6 A;  3M65 A;  3CQG B;  5D5D A;  4H9N C;  1LKX A;  1FIO A;  2W0G A;  4X1K E;  3ZYM A;  5LP6 E;  1YS5 A;  3JTY A;  4FZM A;  3C4W A;  4UVB B;  2PRN A;  4V1A v;  5L3F B;  3V5U A;  2YIN A;  4G2A A;  2F1V A;  1BR4 A;  4PJN A;  2YU2 A;  3D0T A;  3GN5 A;  2WSS V;  3LK2 A;  2LEH A;  1ZKE A;  1H6S 1;  4ZI2 C;  3QK6 A;  2YEV C;  3Q9D A;  1FEW A;  4QXH B;  1BR2 A;  4MAL A;  4IGU A;  4KUM B;  4IHJ E;  1H7C A;  2JMH A;  4QX7 B;  3SRZ A;  3ESL A;  3Q5X A;  4YLH A;  2OA5 A;  3ZMZ B;  1HS7 A;  2LJL A;  2LHR A;  4O2A E;  2M67 A;  4FJO A;  1KK7 A;  3JC6 C;  5DAB A;  3WI3 A;  3LK4 1;  3C51 A;  1ZEE A;  2XAH B;  4WBO A;  4ZI2 D;  2CLY C;  3HI2 A;  4WNK A;  2KT9 A;  4P0B A;  3AA7 A;  3ZJ1 A;  2LSY A;  3HWB A;  4KMC A;  3AA0 B;  2P9B A;  4QXB B;  4U74 A;  3SZV A;  1Z0P A;  3R6N A;  3VY9 X;  4AYD C;  1ZHT A;  2CE7 A;  3FBZ A;  3C98 B;  3T0S A;  4EZ4 A;  2Q9Q D;  2XUE A;  4GYS A;  2IC9 A;  2E9X B;  5LJN A;  3O0E A;  1MNE A;  4K0U A;  2L3L A;  4UF0 A;  4UEL A;  3SWH A;  2YPV A;  4FES A;  2XE5 A;  4OHF A;  3N9M A;  4YHJ A;  4FRX A;  4U9C A;  5JDG A;  2H3R A;  3N9O A;  2LSG A;  3PUA A;  3I9Y A;  4G63 A;  4CI1 B;  2XTQ A;  3B57 A;  4DBR A;  2ZMA A;  4MFR A;  5JVD E;  3O1I A;  3ZN0 B;  3ZYK A;  4C91 A;  1FMW A;  3C5O A;  2G0U A;  4UXN B;  4KRA A;  3MZK B;  2I59 A;  4EB6 E;  5FXZ A;  2RA1 A;  2X51 A;  1E1H B;  1MMA A;  3KV6 A;  4JFB A;  3ZLI A;  3V5S A;  5JRE A;  3W15 B;  3NSG A;  3POU A;  2Y0H A;  4I55 E;  3LFM A;  5LBM A;  5FXX A;  2DCF A;  2VK9 A;  3VZU X;  3HKB E;  2W81 C;  3DA3 A;  2VB6 A;  3CQC B;  3RPU A;  1MIV A;  1QJ9 A;  3PU3 A;  3WAJ A;  3VKH A;  3BK9 A;  1OPF A;  4C69 X;  4PJJ A;  3AAA A;  5LXT E;  4YJ2 E;  3N5L A;  1Q9G A;  5JR9 C;  3CX8 B;  3CKD A;  2LOS A;  4ADZ A;  3AA1 B;  3LBX A;  2W80 C;  2XAF B;  4I50 E;  1BXW A;  3TZG A;  5LHI B;  2QA7 A;  4JCH A;  4QQ1 A;  5JH7 E;  2D2S A;  1BH3 A;  2GE4 A;  1KNZ A;  4DND A;  3O1J A;  4ERR A;  4RJX A;  3OYZ A;  3KDS E;  4F6R C;  5LOV E;  1WLX A;  2KIN B;  4ISS A;  2NOX A;  2MTQ A;  3PRN A;  3KV4 A;  5HAX A;  4DVD A;  1MPF A;  2PG8 A;  3MA9 A;  2VL8 A;  3ZMV B;  3SY7 A;  3LK3 A;  3C64 A;  2VKH A;  3KBT A;  3N2O A;  3KV5 A;  3O4X E;  2N1G A;  3UUN A;  3LK2 B;  2YNK A;  2X9Y A;  3KVD D;  2F1T A;  3I1A A;  2V1D B;  2N2M A;  5FNV E;  5H6R B;  6PRN A;  2ES0 A;  4GCP A;  2JMK A;  4YJ3 E;  3CWZ B;  2CEA A;  2ZFG A;  1OWA A;  1BR0 A;  4TV9 E;  5L3C B;  5CA1 E;  1GFM A;  3AAE A;  3OBV E;  5FYM A;  2ERV A;  2LHF A;  2X9X A;  3E22 E;  5JDH A;  3UAQ A;  3ZMS B;  3QRC A;  4LSI A;  4PK6 A;  1D0X A;  1HXU A;  4HE8 A;  1X79 A;  1YKH B;  1LVF A;  2EHO C;  3FB2 A;  2ODJ A;  3QRA A;  4ZI3 D;  4XNL A;  8PRN A;  2A3D A;  2D0T A;  3EMN X;  5EK4 A;  4O3X B;  3N9N A;  1P4T A;  3SYS A;  1O3X A;  4LSE A;  3OYX A;  5ADX L;  4GK5 E;  4LSF A;  2CWY A;  2HPL A;  2LT3 A;  5HXR A;  4O3W A;  5IYZ E;  3ETV A;  1D1C A;  1FMV A;  4CQI A;  2H7O A;  2X67 A;  2WM9 A;  1HG5 A;  2LOP A;  3DJB A;  4O4H E;  4AKR A;  1U5P A;  4PJL A;  5JRC A;  2GK9 A;  2PFV A;  3P8C D;  2J4U P;  2LSI A;  3T8O A;  4D64 A;  2XAJ B;  5EK3 A;  5FMN A;  5CB4 E;  2KZ7 B;  2DHR A;  2VKO A;  3Q5W A;  3RYH E;  3VHL A;  3ZJ2 A;  3ZN1 B;  5J1G A;  2V7M A;  3RKO A;  4CI2 B;  3LG7 A;  5L3B B;  2L9Q A;  3DTO A;  4ASK A;  4EXT A;  5JDL A;  2Q9Q B;  4FI5 A;  3IBP A;  5IYU A;  1HX8 A;  2HH7 A;  4JEH B;  3VZT X;  4IE5 A;  5A1L A;  1B7T A;  5ADX K;  3VE2 A;  2Z6E A;  4JEU B;  1ZHC A;  2V7L A;  2WWU A;  4CI3 B;  2Y0K A;  1MMN A;  2DI4 A;  4P0A A;  3RYI E;  4FSP A;  5KDM C;  5LYJ E;  4O4U A;  4N59 A;  3SZD A;  1HFA A;  1HCI A;  2H7V C;  2JJ9 A;  2LFU A;  3FYX A;  2IW5 B;  3PUQ A;  5LBQ B;  4O2B E;  3WI5 A;  1HG2 A;  3I9W A;  2RP4 A;  5LGT B;  3PUG A;  3FBL A;  2JMM A;  2BZB A;  2KLQ A;  2Y6X A;  3CQX C;  2VKD A;  1ORM A;  4UV9 B;  3ANW A;  2QTK A;  4MHC A;  4KR8 A;  5DL8 A;  2WMN A;  4TZ4 C;  3TKL B;  2C5K T;  3R84 B;  4DMW A;  3JC6 D;  4EOZ B;  4JLE A;  2O4V A;  2D0U A;  4H9Q C;  3UT5 E;  4ILU A;  5L3D B;  4FZL A;  4PAG A;  5FP3 A;  3HL6 A;  3RC8 A;  1SHZ C;  3J9X 1;  4ZI7 E;  1WRD A;  3IEE A;  4PK5 A;  4UIG A;  2NWB A;  2X66 A;  4X1I E;  4ANJ A;  3WI4 A;  3KVA A;  3MJX A;  4I4T E;  4L9I A;  4U72 A;  2DWK A;  5CA0 E;  1US7 B;  5KMG P;  3GA8 A;  4IST A;  3F31 A;  2POR A;  3NRX A;  2X27 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...