4AKRB

Crystal structure of the cytoplasmic actin capping protein cap32_34 from dictyostelium discoideum
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
245
Chain Sequence
b'TEKQLSCCLDLMRRLPPSQIEDNLAGLLDLVPDLTEDLLSSIDQPLKVAYDAVSKKDYLLCDYNRDADSYRSPWSNKYDPPLSGACYPSSKLRDIEVQANEIFEIYLNLYFEGGVSSVYCWDLDDNFAAVVLMKKTQDPMRGTWDSIHVVEVKLGKKDKAVYKLTSTVMLSIETDNDNTGKVNLAGSLTRQDEKEYTFNEVDTHCVNIGKMVEDMESKLRQTLETIYFGKTKEVVNTLRNATGNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-ACTIN-CAPPING PROTEIN SUBUNIT ALPHA
publication title Conservation and Divergence between Cytoplasmic and Muscle-Specific Actin Capping Proteins: Insights from the Crystal Structure of Cytoplasmic CAP32/34 from Dictyostelium Discoideum.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Actin-binding protein
total genus 71
structure length 245
sequence length 251
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4akrB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 4akrB02
3LK2A 3AA1A 3LK3B 3AA7B 4AKRA 3AA6A 2KXPB 3LK3A 3AAEB 3AA7A 1IZNB 2KZ7B 3AA0B 5ADXL 3AAAB 5ADXK 3LK2B 3LK42 2KXPA 3AA1B 3AAEA 3LK41 5AFUL 2KZ7A 3AA0A 1IZNA 4AKRB 5AFUK 3AA6B 3AAAA
chains in the Genus database with same CATH superfamily
1XDPA 4H9OC 4WZXA 3FYXA 3KV6A 1UCUA 4DV5T 4E7ZA 4IGUA 4C4VA 4GCQA 2BG9E 4HGAA 5FYMA 1WYCA 3K1SA 3PTRB 4NUVA 2LEHA 4EAHA 5HCJA 4C4VB 2X9KA 3UUXB 4YTNA 3VRBA 2UUAT 1UX5A 2HH7A 3Q5EA 3BK9A 5FKYA 2W2UA 4JI8T 1HG2A 3HL6A 1FJGT 4FUVA 4PAGA 1QJ8A 3VZWX 2LM9A 2WY2A 4MLKA 2K4TA 3WAKA 2V6YA 1KK7A 4CI2B 4X1KE 4G2AA 1YQ4A 3QRAA 3F2EA 5DL5A 3ZCIA 3O1HA 4K3CA 3BQLA 3ZJ1A 4O3WA 2V6YB 5KAIO 4DV4T 2V8SV 5JDFA 4JEUB 1MMAA 3PU8A 2K5BB 4KI0F 3ZSTA 3G06A 3C50A 4KP3C 1M62A 4GHBA 2KT9A 3LK2A 3AXJA 1MPFA 3AE1A 4ANJA 2O4VA 4KR8A 1BR2A 3RIUC 2XM2A 5T5FA 3LK2B 3AXJB 1MIYA 1ZHYA 3AA0A 5LB7B 3N2KE 4LSEA 2XTLA 4QX8B 2XQ6A 4I43B 4F6RC 4X64T 2CBJA 2X0LB 2H7VC 3AA6A 1ZHWA 3OPCA 3ZYKA 5J0ZA 2V6XA 2XAHB 2YOEA 5LBQB 3ZYMA 4KX6A 3AECA 5HYAA 1LVKA 4IE5A 3SS1A 2JMMA 3UPGA 1OEDC 2LJLA 1PRNA 5JDNA 4O4XA 5AQJB 5B5EO 1VCSA 3P4RA 2UXBT 4EYYR 4JEHB 3GP6A 3NZQA 3J9X1 2SPCA 2KZ7B 5L3DB 1QLBA 2WDVA 3BQKA 5FY0A 1G90A 4F8HA 1BR0A 5B66O 4JUYA 4TWHA 1MMDA 4RJWA 2YDSA 3OJAA 5CA0E 4TZ4C 2XTRA 2IUBA 3PURA 3L8RA 2LE8A 3FZMB 4ZXLA 1KF6A 4AKHA 5H6RB 3WI5A 4EGWA 3GN5B 3P50A 3A8YC 2LM2A 4ZZBA 1GFPA 1T8BA 2ACXA 3PV0F 3LK41 3JAEA 2VURA 2ZMAA 5HAXA 2VVNA 2ZM2A 3HKDE 2H3RA 4UR9A 1UK5A 1GFNA 3PUWF 2KWIB 8PRNA 2W61A 1E2AA 3ZPOA 2VL8A 2WMNA 3QB5K 2LRLA 4H9NC 4I55E 1KEYA 2JQHA 1T98A 3LK3B 4H63V 2VKHA 2E5LT 1DU2A 4PJNA 5IYZE 3Q5WA 4QXCB 2VKOA 2XQ7A 5ETWA 3N9OA 2XE2A 1UGOA 2N2LA 4N59A 3FXEB 2WU5A 1QJPA 2DHRA 5LG4A 3GMIA 1X79A 3IEEA 4HFVA 4QXBB 5F8PA 3RI5A 2PJQA 5IUXA 5HEGA 2X66A 4BJNA 2HN2A 3ONXA 3LBXA 1KFYA 4FT6A 5KX5E 4YTMA 5LGTB 4X1IE 4PJJA 4PK4A 4GF4A 4IDPA 1HS7A 4AYID 3QB5A 3PUSA 3HW9A 3HKCE 4TUYE 4BUMX 2Y48B 5JDGA 4H9PC 2KNDA 3LBXB 2J1DG 3ANWA 2KSRA 4E1TA 2Q9QD 3KV5A 2IHR1 3RKOA 1QJ9A 4ILAA 4A56A 5C8YE 6PRNA 3RPUA 5HEOA 3NSGA 3UTKA 3QNUA 4C91A 2CBIA 3WAJA 4OK0A 4YLHA 1WFDA 4HEAA 2LT3A 2NW9A 2Y6XA 1BR1A 3AEGA 2DNXA 3SWHA 2R8AA 3EMNX 4E1SA 2BG9C 4BAYB 1NWMX 4HFBA 4YFSA 4QWNB 5KDMC 4PK5A 2WSSV 1HXTA 4ZI3C 4LSHA 3ZMUB 3PUYF 2CWYA 1D0YA 4KUMB 4FESA 3AEAA 2IWVA 3HOEA 1QSDA 2WB5A 1YKHB 5JVDE 4ZZCA 2C5KT 3SY9A 3RC8A 3W15B 4AXPA 2GE4A 5E79O 3UU3A 3LJCA 4N75A 1H7CA 5HCMA 4G75A 4HWIB 4GCPA 2KWHA 4LF8T 3SOLA 3AEBA 4GYSA 5HEJA 3C98B 5AQUB 4YSXA 3UUBA 1GQEA 2RP4A 1FMWA 3ABVA 5KXJA 2WJRA 1GFMA 2Q9QC 4ZOLE 1NENA 4X1YE 2MNHA 5GTIO 5JDQA 1UUSA 2HHHT 4XNKA 2F1CX 4AKRB 3SFEA 1VOMA 1VCTA 5E0OA 4ISSA 4MHCA 4CI1B 4AQFC 5ABEA 4ADZA 2LOPA 3DJBA 3SY7A 3K3OA 3RIFA 1W0BA 1XDOA 2E9XD 3N9LA 4B3RT 3RYIE 2WWVA 2Y8DA 2R4LA 3AEDA 3N9NA 3T1HT 1Y01A 4UB6O 2CLYB 4B6XA 5AQOB 2ZM0A 3O1JA 3A2SX 5LMUT 2HPJA 2UUCT 3K19A 2M67A 4AQYT 4QXHB 5TAOA 4QHOA 5LHIB 2F1VA 3O4XE 4EV6A 3N2GE 1H6S1 3UU8A 4UVAB 1W09A 4O2AE 1FEWA 3SYBA 3AAIA 4OYKA 1YW0A 2CHOA 4P1NA 3G7GA 1MM4A 4N74A 2W0GA 4L0RA 1G8XA 3X1DA 3T8OA 5DQWA 4CZZB 3QUJA 4HWHA 3CQXC 2G0UA 5JQGE 2A72A 2YDQA 4X62T 3NRYA 4HFCA 1ORMA 3HR0A 4O4UA 3AA1A 2XAGB 4U2ZA 5CFBA 3FZKB 4RLBA 4U3CA 3AE6A 2CXDA 4AYEC 3N5LA 2XAQB 4AKIA 3MZKB 4JI7T 3KVAA 3PQUA 4GKJT 5JR9C 4IL4A 3AVSA 3MJXA 3FBZA 4FZLA 3P4WA 3T0SA 4EZHA 2LHNA 2FGQX 4FSPA 4EZ4A 3CPZA 3U78A 1Q9FA 3V5SA 3UT5E 3KZIO 2YKSA 5FNVE 4EXTA 1ZHXA 5G26A 5FL1A 4DBQA 1IBMT 3KDSE 5ABFA 3CX8B 3C4ZA 1IJ6A 2E9XA 4LFAT 4IREA 4AQGA 5JR9A 1WRDA 3PJAA 2VWAA 4B61A 3L39A 4WYVA 2E9XB 3TLVA 1Z8UA 4B3TT 4ZS2A 5AQFB 3VE2A 5AFUK 3ONJA 5JH7E 4X65T 5JDPA 5DL6A 4TNWA 2UXXB 4DR3T 4XZCA 4Z91A 1ZHZA 5FVLA 3T1YT 2XPKA 4CN4A 3UFGA 2VQFT 4LMKA 5AQMB 2YN6A 4G76A 3F31A 2F4VT 3UFEA 5AQIB 2YEVC 3L3PA 3A7MA 4IDNA 4DR1T 3C4XA 2PBIA 1HX8A 2I59A 3PGRA 2KDYA 3T20A 4U2YA 3A0BO 5C3JA 4LF5T 5LCYA 1MNEA 1S35A 3JCUO 4BJMA 3SYSA 4QKNA 2C5JA 5JDHA 3RH3A 3FZFB 5AQPB 3V8UA 3CKDA 4WNKA 2NOXA 3EAMA 3ZKRA 1YQ3A 5LJMA 1N32T 3AE7A 5H2FO 4GKKT 4TX5A 3M3ZB 2EHOD 3CQCB 4XAXB 5HEHA 2K48A 2MPKA 2UXDT 2L8KA 4H9RC 4DUZT 3LSVA 1YKEB 4DR7T 2A2FX 2NW7A 1O3XA 3P4PA 3CIRA 2BS2A 2VL0A 3RYHE 2V7IA 3N9PA 5J1GA 1N34T 2R4NA 4D5UA 2VQET 2X0YA 3KINB 1BR4A 2E5VA 2WM9A 1IAPA 3HKEE 2PRNA 1IJ5A 4NIQA 3WI4A 4LFBT 2XAJB 5AFUL 1UX4A 3O9XA 2JRKA 5G39A 4LF7T 2R6GF 1YXRA 4YT0A 4DR4T 5DQVA 3RIUA 2JQKA 3RRCA 3AA0B 2XE3A 4DO0A 2MYSA 2OA5A 4Q25A 2K24A 3DWNA 4GIWA 1J5WA 2BS4A 4HTEA 3AA6B 5EK4A 4K3BA 2KINB 3NRXA 3CWZB 4CXYA 3MKDA 2WVPA 2OMFA 2WP9A 3I1AA 2KC0A 2ACZA 3MACA 5LHHB 3ETUA 2X9HA 4ZI7E 2XQ9A 4YY3T 4JV5T 3AE5A 2EHOC 4UEMA 2IMLA 1OEDA 2C0SA 4U72A 3KBTA 3RQUA 2W4XA 1HXXA 3OBVE 2LSGA 3AE9A 2WZHA 5L4EA 4K0KT 4JI5T 1HXUA 3UAQA 2IDOB 1PHOA 2R88A 2UUBT 4E7SA 4OX9T 2CMRA 4U9CA 4YXDA 2LKGA 2V7MA 1MIWA 1GFOA 3JTYA 2LRKA 2WMOA 5JRCA 3ZN0B 1ZEEA 3MXZA 1D0XA 4DNDA 4DV1T 4UVCB 3JADA 1S94A 4COFA 3PGUA 4PJLA 3LK42 1D0ZA 1THQA 3MA9A 3CX7B 3C64A 2JMKA 3FB2A 4XNLA 2XJ7A 4LF6T 2X68A 2BVLA 1US7B 5LA6E 4NPPA 4I4TE 4PNIA 5HXCA 5F3JA 1YS5A 2XY8B 2GK9A 4Z90A 4J2CA 3AEFA 4AYNA 3ZC1A 1GFQA 4P0AA 5EK3A 4H63H 3UU2A 5FP3A 2L9QA 5G38A 2FJDA 4AIUA 4TN7B 2NW8A 2DL1A 3I9WA 4ZI3D 2Y7SA 2BS3A 3FBLA 2NP9A 4U74A 4BA9A 4U7YA 4FRXA 2CCQA 3R84B 1I6ZA 1XWMA 4U33A 1KNRA 3PRNA 3JC6D 4GYRA 3VZUX 3KVBA 4NXNT 3FHNA 1KNZA 3AB3B 4D64A 4ISTA 1KNPA 1Z0PA 4AKLA 2WS3A 4H9QC 2JQ9A 2V5DA 1NEKA 4DBRA 2KLQA 5M4YA 5A1LA 5L3CB 3ANWB 2V5CA 2QRXA 1VRBA 1ZKEA 3IBPA 4JI0T 3Q5DA 4MALA 4UXNB 4O3YA 4ZS3A 2W80C 2FUPA 4YJ2E 1ZHCA 4O4JE 4KR4A 4ZHQE 2D5UA 2V26A 4FI5A 5GV0A 2RPAA 5FXWA 3PJAJ 4U7IA 2W81C 1W0AA 4QH4A 3JAFA 4DMVA 5DL8A 2E8IA 2AXTO 2BG9A 2H89A 2OLTA 5L3BB 4ERRA 3M65A 3BRZA 1ZP0A 2X9WA 3RIAA 4YHJA 2X9YA 5IYUA 3JC6C 3B57A 5HXRA 1SA0E 2F1TA 3PDYA 2BG9B 4IE0A 5JDLA 3TZGA 2QGSA 3F57A 2D2SA 5ABGA 3K8PC 1HG5A 4EEDA 2LOSA 2AXDS 2R4PA 1OWAA 2XE5A 4LMLA 2PTFA 3TLUA 2ODVA 3K3NA 4IE7A 3PUXF 5FMNA 2XM1A 2L3LA 1L0VA 3WU2O 4AFKA 2W67A 3LG7A 5DJQC 3BRYA 5LYJE 4QX7B 2Q9QA 4TV9E 3NWIA 1T72A 4FJOA 1S5LO 2XASB 2XTQA 2HPLA 2NR4A 2A9UA 5JREA 4EIWA 4N78D 5L47A 2Q9QB 3RF1A 3POXA 2XQ8A 4B3MT 4LFCT 4F4BA 4PW8A 4AQFA 3AE8A 1BXWA 5L3EB 3ZMZB 5LNKA 4A98A 3VE1A 2WDRA 1CHUA 3DA3A 2NTXA 2PFVA 2YINA 1BT9A 4C90A 5JDMA 2N2NA 4XBFB 1AJ3A 2MBGA 2XQ5A 5BMVE 5JTGA 4DV6T 2DWKA 3RC3A 2N9DA 2M6BA 4O3ZA 3ZMSB 4CTDA 2WAUA 2C5IT 3B13A 1E54A 4JLEA 3RBHA 5FXVA 3AE4A 4HFEA 4PJ0O 3ONLC 1ZV4X 3PUZF 3FZLB 3KFWX 3TKLB 4JI1T 4LF9T 3T24A 1T1LA 3WI3A 3GWHA 1MMGA 2X0HA 3PQSA 4YSYA 3AA1B 3DP7A 3ESLA 2VASA 4KRAA 1Y64B 1HNWT 4RJXA 4JI2T 1WCRA 1HTJF 2E2AA 3VU7H 1N33T 3POUA 4DMWA 5BR8T 2R4OA 3Q9DA 4UVBB 5L2LA 1JNZA 1HF8A 3AAEA 2NWBA 2XUEA 1UURA 5DL7A 2LKHA 4C69X 2N1GA 4ILUA 2V7KA 2YU1A 1HR0T 2XZEA 3IA3A 2DWGA 2J1NA 2BKOA 5AQSB 1EZ3A 4EYUA 5ABFB 3AA7A 2W62A 2LSJA 2YDRA 3HI2A 5JR9B 3UQ7A 3R6NA 1FMVA 3N9MA 4IL9A 4PK6A 3EDUA 4FRTA 3SZVA 5AQGB 1WYBA 2VB6A 4A5XA 3AA7B 4HKAA 4HFDA 2JJ9A 3AE3A 3RYFE 3ZT5A 3CK6A 4AUIA 3HWBA 2LHRA 4NXMT 4HFHA 4ZI2C 1HX1B 1QUUA 2QYWA 4IDQA 3FZHB 2MAWA 4AKMA 4LSFA 5LJNA 2H88A 1U5PA 2LSIA 4DV7T 4JFBA 4X5TA 2I6HA 2ZLYA 4EB6E 3RHWA 4FZNA 2V7JA 4ASKA 4EEBA 2WBLA 3QK6A 3ZMTB 4UF0A 2IAKA 4HN9A 2ZFGA 3KV4A 4Z3TA 2LLYA 3HKBE 5AQTB 3DZMA 3ZCJA 5FY1A 4CI3B 4UV8B 2FBWA 4K0UA 4UF0B 1JNRA 1NAFA 4FSOA 1LRZA 4CN6A 5EZYE 4FQEA 2DLRA 3VKGA 4C00A 5L3FB 3J7Yq 2Y0KA 3HOLA 2M06A 2K0LA 4PR7A 1U4QA 3H3MA 1OPFA 2B76A 3KV9A 4I50E 3SZDA 1T7SA 4JI3T 4O49A 4YJ3E 3C4WA 3AEEA 4HWCA 3E08A 5LGNB 3OYZA 4YSZA 2IC6A 2ZM6T 3VZTX 4RL9A 4O2BE 1W9RA 3VY9X 4CQIA 4JI6T 3D0TA 5HXEA 2XAFB 2RA1A 4A97A 3OTOT 4N58A 3PGSA 3N2OA 5KMGP 4H9SE 2IIUA 4P0BA 1HFAA 2PORA 4ILBA 4JYAT 2ODUA 3UULA 5LGUB 4X66T 3PUGA 2YNKA 5L4HA 5AQNB 3NKZA 1D1BA 3RKGA 2HN1A 2LHFA 3SRZA 3PF1A 3ZJ2A 2WJQA 3UUNA 2CEAA 3PUVF 2WQYA 4UIGA 3EABA 2KZ7A 2AE9A 2FJBA 4OYJA 4P09A 4GOUA 4KMCA 2QA7A 2XQAA 2BKNA 4HFIA 3PORA 3P7IA 2P9BA 3QRCA 1OEDB 3DTOA 2EHOA 3K3QC 3GN5A 3I9YA 5IHYA 4I0UA 2WZIA 2CXLA 3NVOA 5H6QB 3CVRA 4MBQA 1LKXA 2MHLA 2XE1A 3LFMA 2EHOB 4DR2T 5AQRB 1MIVA 4O8SA 4YHHT 3O0EA 5AQHB 5ADXK 2VKJA 5HEUA 3A5XA 4GCSA 2CA5A 1MNDA 4IT4A 1G73A 4QH5A 5JRCB 4IL6O 1XMOT 4O4IE 3KBUA 3PUAA 5EE2A 4MFRA 3AE2A 3OYXA 3LK3A 2IW5B 4WW0A 3QC9A 5LBMA 2ZLDA 3UU4A 3VY8X 2I0MA 3MK7C 4PFOA 1ZHTA 2XSAA 3V5UA 3AAAA 4IHJE 2N2MA 4CN1A 2X9XA 3UU5A 5FXXA 2QVAA 3IF8B 1SHZC 4TWDA 1WLXA 3AAAB 1Q9GA 2CWOA 2A3DA 3N9QA 7PRNA 2KXPA 2VK9A 2XG6A 3ZYLA 2Z6EA 2FJEA 5ABHA 4PJMA 4D65A 3GA8A 3DWOX 1XZYA 4X20E 2XSBA 4GK0E 2D9DA 5FY7A 4B3ST 4AZLA 2KXPB 3EUHA 5CJ5A 5FL0A 1E1HB 5HXHA 4WBOA 2NTYA 4TNVA 5CB4E 4DV2T 5IWAT 2BBHA 2WDQA 4L5GA 5AQKB 1D1CA 4M1PA 2JPFA 5AQLB 5AQQB 2CE7A 4UB8O 4JCHA 2H7OA 4IIJE 5ADXL 3P4SA 1R8IA 5DABA 4JI4T 3RQWA 2BZBA 3CMLA 2V7LA 4KHZF 2K3WA 4LMJA 3S4UA 2CXFA 4DUYT 3TLTA 2B1EA 4FOZA 3P8CD 3C51A 3ZSSA 5LOVE 1D1AA 1MMNA 1J5ET 3U3IA 2J4UP 5LG3A 2DI4A 2UXCT 4OFZA 2K9AA 4UELA 1FIOA 4AYMC 1I94T 4TWFA 5CGMA 4CXWA 4UV9B 3RRWA 3Q5XA 2WU2A 4EOZB 3KVDD 3FXDB 3VR9A 2CHNA 1IBLT 3HA4A 1LVFA 3VHLA 2X67A 2LSYA 2V1DB 1ZOYA 1XNRT 5EK2A 3DA4A 4IDOA 4KHPT 2ES0A 1IZNA 4O3XB 3RYCE 2WCAA 4O4LE 3ZT7A 3RX6A 4ZEYA 3RGLA 2YPVA 5L3GB 5FVKA 2DCFA 3H37A 3LDQB 1IZNB 4V1Av 5TISO 2JQYA 2J62A 5D5DA 5J2UE 3POQA 5HWYA 2ZM8A 2WWUA 2KMFA 3VRAA 1CUNA 1P4TA 4AYDC 1OEDE 3ZT6A 4CXXA 3EI0A 1IBKT 1HNXT 4AISA 2OV9A 1XNQT 4ILCA 4JBWF 4O4HE 4AKRA 2BVMA 1SUMB 2MTQA 3QOFA 2CLYC 2BKPA 4IDZA 3SFDA 2J4GA 5G3AA 4NUUA 2XQ4A 2FJAA 1HNZT 5C2TA 4KBMB 4HWFA 2YU2A 3ZEFB 3A0HO 5CA1E 5FXZA 2Y2XA 3PUQA 4DR5T 3IHRA 4WBNE 3O1IA 1MM5A 5GTHO 2JMHA 1XMQT 4RLCA 2XQ3A 1J1JA 5LXTE 1M7KA 1OSMA 2CPTA 2ERVA 4FZMA 2D0TA 1WR6A 3JCFA 2LSKA 3P4QA 4IE6A 3PU3A 4LSIA 3L09A 3VKHA 3UU6A 3CQGB 4DVDA 2FGRA 3EDVA 4QH1A 2BDEA 3E22E 5HXSA 5HWXA 2UU9T 4YTPA 4DR6T 1SE7A 2W63A 2MOZA 1WR0A 4ZI2D 1HCIA 4U31A 3ZMVB 1OXZA 3RLFF 1X9BA 3Q2MA 3ETVA 4FMSA 3NBXX 3TLSA 5F5WA 3OVUA 2R89A 4Z8XA 2ODJA 2BBJA 2PG8A 3UQ4A 3B5MA 2D0UA 5PRNA 2YK0A 3EHZA 4G63A 2X51A 2M07A 2XMXA 2VVSA 2LFUA 4LF4T 4QQ1A 4L9IA 3BS0A 3E0ZA 3AVRA 4GK5E 2JQQA 4PUXA 3VR8A 3UUMA 1B7TA 2Y0LA 5LMNT 2W66A 1YD8G 3ZLIA 2E9XC 3ZC0A 1T16A 2VKDA 4DV3T 1V9DA 3I0OA 4TV8E 3EVYA 3NZPA 3PE0A 2JIWA 4OHFA 4HE8A 3TLWA 4PFPA 4DIDB 2CRBA 1BH3A 3BQIA 2IC9A 3AAEB 4IE4A 5FVNA 2XHEB 5LHGB 1N36T 4AI6A 2XQYA 5AQVB 2UXNB 2M6IA 2X27X 2CM0A 5LP6E 2IWWA 3NJTA 5GONE 2QTKA 1E7PA 3OKQA 4AKGA 3ZN1B 2W00A 3H3AA 3CX6B 2Y0HA 4HWDA 3C5OA 2J47A 5KAFO 5J2TE 4DV0T 3I0QA
chains in the Genus database with same CATH topology
4KMCA 4H9QC 2QA7A 3O1JA 4H9OC 3A2SX 3FYXA 2HPJA 3KV6A 4DBRA 2KLQA 3K19A 2M67A 1UCUA 4QXHB 5TAOA 4E7ZA 4IGUA 5M4YA 3PORA 3P7IA 5A1LA 4QHOA 2P9BA 5LHIB 3QRCA 5L3CB 2F1VA 3O4XE 4GCQA 4HGAA 5FYMA 3N2GE 1H6S1 3ANWB 4UVAB 4O2AE 3DTOA 1VRBA 1ZKEA 1WYCA 2EHOA 3IBPA 3PTRB 4NUVA 1FEWA 2LEHA 3K3QC 3AAIA 3SYBA 3GN5A 4EAHA 4OYKA 3I9YA 4MALA 1YW0A 4UXNB 5IHYA 3UUXB 3G7GA 2CXLA 4ZS3A 5H6QB 2W80C 4O3YA 3CVRA 4MBQA 1LKXA 1UX5A 2HH7A 1MM4A 2W0GA 4L0RA 2MHLA 2XE1A 3BK9A 4YJ2E 3LFMA 1G8XA 2EHOB 1ZHCA 1HG2A 3HL6A 3T8OA 1MIVA 4O8SA 4O4JE 4PAGA 5DQWA 4FUVA 4CZZB 3QUJA 3CQXC 2G0UA 5JQGE 1QJ8A 3O0EA 3VZWX 2VKJA 5ADXK 2LM9A 3A5XA 4MLKA 2CA5A 4GCSA 4KR4A 2K4TA 1MNDA 2A72A 3WAKA 1KK7A 4ZHQE 2D5UA 1G73A 2V26A 4CI2B 4X1KE 4G2AA 3NRYA 1ORMA 4FI5A 5JRCB 5GV0A 5FXWA 3HR0A 4O4UA 3AA1A 2XAGB 3QRAA 2W81C 3F2EA 5DL5A 4O4IE 3ZCIA 3KBUA 3PUAA 3O1HA 4MFRA 4DMVA 3BQLA 3ZJ1A 4RLBA 5EE2A 5DL8A 2E8IA 3OYXA 3LK3A 4O3WA 2CXDA 2IW5B 4WW0A 5JDFA 4AYEC 4JEUB 3N5LA 2XAQB 5L3BB 3QC9A 5LBMA 4AKIA 3MZKB 2ZLDA 4ERRA 3M65A 2X9WA 4YHJA 2X9YA 5IYUA 1MMAA 3KVAA 3PU8A 3JC6C 2K5BB 3VY8X 3B57A 3C50A 4KP3C 3PQUA 3MK7C 4PFOA 1ZHTA 3AAAA 3V5UA 4IHJE 5HXRA 1SA0E 2F1TA 2N2MA 2KT9A 3PDYA 5JR9C 3LK2A 1MPFA 4GHBA 4IE0A 5JDLA 2X9XA 3TZGA 4ANJA 2O4VA 3AVSA 3MJXA 4KR8A 2QGSA 1BR2A 3FBZA 3F57A 4FZLA 3T0SA 2D2SA 4EZHA 5FXXA 3K8PC 2LHNA 4OYJA 1HG5A 2FGQX 3IF8B 4EZ4A 3CPZA 2LOSA 3U78A 1Q9FA 3V5SA 5T5FA 3UT5E 1SHZC 1OWAA 1WLXA 3AAAB 5FNVE 4EXTA 1Q9GA 1ZHXA 2CWOA 2XE5A 5G26A 4DBQA 2A3DA 2ODVA 3K3NA 3LK2B 3N9QA 7PRNA 4IE7A 2KXPA 2VK9A 3KDSE 2XG6A 1MIYA 3ZYLA 1ZHYA 3CX8B 2Z6EA 3C4ZA 5FMNA 3AA0A 1IJ6A 3N2KE 2E9XA 2XTLA 2L3LA 4PJMA 4QX8B 3GA8A 4LSEA 4AQGA 4AFKA 5JR9A 4D65A 1WRDA 3LG7A 4I43B 4F6RC 5DJQC 4X20E 2X0LB 2H7VC 2VWAA 4GK0E 5LYJE 5FY7A 3AA6A 1ZHWA 4AZLA 4QX7B 4B61A 3ZYKA 2KXPB 2Q9QA 4TV9E 3EUHA 2E9XB 4FJOA 1E1HB 2XAHB 5HXHA 2XASB 2XTQA 2HPLA 5LBQB 3ZYMA 5HYAA 4WBOA 5JREA 4ZS2A 1LVKA 4IE5A 3SS1A 3VE2A 2JMMA 3UPGA 5AFUK 4EIWA 2LJLA 2NTYA 4N78D 5JH7E 2Q9QB 5CB4E 5JDPA 1PRNA 3POXA 5DL6A 4F4BA 2UXXB 4PW8A 4AQFA 5JDNA 4O4XA 4L5GA 4XZCA 1D1CA 4M1PA 2JPFA 1ZHZA 1BXWA 2CE7A 5L3EB 3ZMZB 5LNKA 4JCHA 2H7OA 4EYYR 3VE1A 4JEHB 3GP6A 3NZQA 3J9X1 2SPCA 2KZ7B 4IIJE 5ADXL 5DABA 5L3DB 4G76A 3BQKA 5FY0A 3F31A 1G90A 3DA3A 3UFEA 2YEVC 2NTXA 2PFVA 3L3PA 1BR0A 2BZBA 2YINA 1BT9A 4JUYA 4C90A 3CMLA 2V7LA 5JDMA 1MMDA 2N2NA 3C4XA 4RJWA 4XBFB 1AJ3A 2PBIA 3OJAA 2MBGA 5BMVE 5CA0E 3S4UA 1HX8A 4TZ4C 2I59A 2CXFA 2XTRA 2KDYA 2B1EA 2DWKA 2N9DA 3P8CD 3C51A 3PURA 3RC3A 4FOZA 3T20A 2LE8A 4O3ZA 5LOVE 3ZMSB 1D1AA 1MMNA 4AKHA 5LCYA 1MNEA 2WAUA 2C5IT 3B13A 5H6RB 1S35A 3U3IA 2DI4A 4BJMA 1E54A 4OFZA 3WI5A 2J4UP 2K9AA 4UELA 3GN5B 1FIOA 3SYSA 4AYMC 4JLEA 3RBHA 1GFPA 4QKNA 5PRNA 2C5JA 5JDHA 2ACXA 3RH3A 3V8UA 3LK41 4CXWA 3CKDA 2ZMAA 5FXVA 5HAXA 4WNKA 2NOXA 4UV9B 3RRWA 2ZM2A 3Q5XA 3HKDE 1ZV4X 3TKLB 5LJMA 3KFWX 4EOZB 3KVDD 3T24A 3FXDB 4TX5A 2H3RA 3WI3A 3GWHA 3HA4A 1GFNA 2EHOD 2KWIB 3CQCB 1LVFA 1MMGA 2X67A 4XAXB 3VHLA 8PRNA 2LSYA 2K48A 2V1DB 2W61A 2L8KA 4H9RC 4FSPA 3ZPOA 2VL8A 2WMNA 3PQSA 5EK2A 1YKEB 3AA1B 4H9NC 4I55E 3DP7A 3ESLA 3DA4A 2A2FX 2VASA 4KRAA 2NW7A 1Y64B 1O3XA 2ES0A 1IZNA 1T98A 3RYHE 4O3XB 3RYCE 4O4LE 2V7IA 3N9PA 5J1GA 3LK3B 3RX6A 4RJXA 4D5UA 1HTJF 4H63V 2VKHA 3KINB 1BR4A 3VU7H 2WM9A 1IAPA 2YPVA 5L3GB 4PJNA 3HKEE 2DCFA 3H37A 2PRNA 3POUA 1IZNB 5IYZE 1IJ5A 4V1Av 4DMWA 5D5DA 3Q9DA 5J2UE 3Q5WA 4UVBB 4QXCB 2VKOA 5HWYA 5L2LA 2ZM8A 2WWUA 1HF8A 2XAJB 3WI4A 3AAEA 2KMFA 2NWBA 1CUNA 1P4TA 2XUEA 5AFUL 5DL7A 4AYDC 1UX4A 5ETWA 3O9XA 3N9OA 2XE2A 2JRKA 4C69X 4CXXA 2N2LA 2N1GA 4ILUA 4N59A 3FXEB 2V7KA 2YU1A 1QJPA 2DWGA 2DHRA 5DQVA 4O4HE 4AKRA 5LG4A 2BVMA 2MTQA 3GMIA 2CLYC 2J1NA 1X79A 4IDZA 1EZ3A 4EYUA 4NUUA 3AA7A 3RRCA 3AA0B 2W62A 2XE3A 2LSJA 3IEEA 3HI2A 4HFVA 4QXBB 5F8PA 4KBMB 4DO0A 5JR9B 2MYSA 2OA5A 2PJQA 3R6NA 2YU2A 2K24A 3ZEFB 1FMVA 2X66A 4GIWA 3N9MA 4PK6A 5CA1E 4HTEA 3AA6B 3EDUA 4BJNA 5FXZA 4FRTA 5EK4A 3SZVA 2KINB 3NRXA 1WYBA 2Y2XA 3ONXA 3LBXA 3CWZB 2VB6A 4FT6A 4CXYA 3MKDA 3PUQA 5KX5E 3AA7B 4HKAA 2JJ9A 3IHRA 4X1IE 4PJJA 4PK4A 3I1AA 5LGTB 2OMFA 3RYFE 4GF4A 1HS7A 2KC0A 4AYID 4WBNE 3O1IA 1MM5A 4AUIA 3MACA 3HWBA 2LHRA 3PUSA 5LHHB 2JMHA 3HW9A 3HKCE 3ETUA 4TUYE 2X9HA 1QUUA 4ZI2C 4RLCA 2Y48B 4BUMX 5JDGA 4H9PC 4ZI7E 5LXTE 2KNDA 1OSMA 3LBXB 2EHOC 4UEMA 2J1DG 2ERVA 3ANWA 4AKMA 2C0SA 4LSFA 4E1TA 2Q9QD 3KV5A 5LJNA 4FZMA 2D0TA 3KBTA 4U72A 1WR6A 3RKOA 1U5PA 2LSIA 2LSKA 1HXXA 3OBVE 2LSGA 1QJ9A 4IE6A 4A56A 5C8YE 4JFBA 6PRNA 3PU3A 4LSIA 3RPUA 3L09A 3VKHA 3NSGA 3CQGB 3UTKA 2ZLYA 4EB6E 4DVDA 2FGRA 3EDVA 4C91A 4FZNA 2BDEA 3E22E 2V7JA 1HXUA 5HXSA 5HWXA 3UAQA 1PHOA 3WAJA 4ASKA 4E7SA 4OK0A 2WBLA 2CMRA 3QK6A 4YLHA 3ZMTB 4HEAA 4UF0A 2LT3A 2V7MA 4U9CA 2IAKA 4HN9A 1MIWA 2W63A 2NW9A 2Y6XA 1BR1A 1GFOA 3JTYA 2ZFGA 3KV4A 4Z3TA 2MOZA 2DNXA 2WMOA 4ZI2D 3SWHA 1HCIA 3EMNX 5JRCA 3HKBE 3ZMVB 3ZN0B 4E1SA 1ZEEA 1OXZA 3MXZA 5FY1A 3ZCJA 4CI3B 1D0XA 3Q2MA 4UV8B 4DNDA 4BAYB 4UVCB 1NWMX 1S94A 3ETVA 4K0UA 4YFSA 4FMSA 3NBXX 4UF0B 1NAFA 4FSOA 1LRZA 4QWNB 5EZYE 4PJLA 3LK42 1D0ZA 1THQA 2DLRA 4Z8XA 5KDMC 3MA9A 4PK5A 2WSSV 3VKGA 5L3FB 2ODJA 3J7Yq 3CX7B 2Y0KA 2PG8A 3HOLA 3C64A 2D0UA 1HXTA 2JMKA 3FB2A 4ZI3C 2M06A 2K0LA 4LSHA 2YK0A 4XNLA 3ZMUB 1U4QA 4G63A 2X51A 1OPFA 2M07A 2XMXA 2CWYA 1D0YA 2X68A 4KUMB 4FESA 2LFUA 2BVLA 3KV9A 4QQ1A 1US7B 4L9IA 5LA6E 3HOEA 1QSDA 3E0ZA 3AVRA 4GK5E 4I4TE 2JQQA 1YKHB 5JVDE 4PUXA 4PNIA 2C5KT 4I50E 5HXCA 5F3JA 3W15B 3RC8A 3SY9A 3SZDA 4AXPA 1YS5A 3UUMA 1B7TA 2GK9A 4O49A 4YJ3E 4J2CA 3C4WA 2GE4A 2Y0LA 3LJCA 4AYNA 1H7CA 3ZC1A 1YD8G 3E08A 3ZLIA 5LGNB 3OYZA 4G75A 4GCPA 2E9XC 3ZC0A 1GFQA 2KWHA 2IC6A 2VKDA 3SOLA 4P0AA 3VZTX 1V9DA 4O2BE 3I0OA 4TV8E 5EK3A 4RL9A 4H63H 3EVYA 4GYSA 3UU2A 3C98B 3NZPA 3PE0A 5FP3A 2L9QA 2RP4A 4OHFA 4HE8A 1FMWA 4PFPA 4TN7B 2NW8A 1BH3A 3VY9X 3BQIA 2Q9QC 1GFMA 4CQIA 2IC9A 4ZOLE 3I9WA 3AAEB 3D0TA 4IE4A 5FVNA 4ZI3D 2Y7SA 5HXEA 2XHEB 2XAFB 4X1YE 2RA1A 5LHGB 4N58A 2MNHA 4AI6A 3FBLA 5JDQA 3N2OA 2NP9A 5KMGP 4U74A 4BA9A 2XQYA 4H9SE 2UXNB 4FRXA 2CCQA 4XNKA 4AKRB 3R84B 2X27X 3POQA 1VOMA 4P0BA 5E0OA 2CM0A 1HFAA 4ISSA 4MHCA 4CI1B 2PORA 5LP6E 4AQFC 2ODUA 4ADZA 3PRNA 5GONE 3UULA 2LOPA 2QTKA 5LGUB 3OKQA 3DJBA 4AKGA 3SY7A 3ZN1B 3JC6D 3K3OA 4GYRA 3PUGA 2W00A 2YNKA 3VZUX 3H3AA 1D1BA 2E9XD 3KVBA 3N9LA 3FHNA 1KNZA 3AB3B 2LHFA 3SRZA 3CX6B 4D64A 3ZJ2A 2Y0HA 3RYIE 2CEAA 4ISTA 3UUNA 2Y8DA 4UIGA 3C5OA 3N9NA 2KZ7A 5J2TE 1Z0PA 2CLYB 4B6XA 4AKLA 2ZM0A 3I0QA 4P09A 4GOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK2 A;  3AA1 A;  3LK3 B;  3AA7 B;  4AKR A;  3AA6 A;  2KXP B;  3LK3 A;  3AAE B;  3AA7 A;  1IZN B;  2KZ7 B;  3AA0 B;  5ADX L;  3AAA B;  5ADX K;  3LK2 B;  3LK4 2;  2KXP A;  3AA1 B;  3AAE A;  3LK4 1;  5AFU L;  2KZ7 A;  3AA0 A;  1IZN A;  4AKR B;  5AFU K;  3AA6 B;  3AAA A; 
#chains in the Genus database with same CATH topology
 1XDP A;  4H9O C;  4WZX A;  3FYX A;  3KV6 A;  1UCU A;  4DV5 T;  4E7Z A;  4IGU A;  4C4V A;  4GCQ A;  2BG9 E;  4HGA A;  5FYM A;  1WYC A;  3K1S A;  3PTR B;  4NUV A;  2LEH A;  4EAH A;  5HCJ A;  4C4V B;  2X9K A;  3UUX B;  4YTN A;  3VRB A;  2UUA T;  1UX5 A;  2HH7 A;  3Q5E A;  3BK9 A;  5FKY A;  2W2U A;  4JI8 T;  1HG2 A;  3HL6 A;  1FJG T;  4FUV A;  4PAG A;  1QJ8 A;  3VZW X;  2LM9 A;  2WY2 A;  4MLK A;  2K4T A;  3WAK A;  2V6Y A;  1KK7 A;  4CI2 B;  4X1K E;  4G2A A;  1YQ4 A;  3QRA A;  3F2E A;  5DL5 A;  3ZCI A;  3O1H A;  4K3C A;  3BQL A;  3ZJ1 A;  4O3W A;  2V6Y B;  5KAI O;  4DV4 T;  2V8S V;  5JDF A;  4JEU B;  1MMA A;  3PU8 A;  2K5B B;  4KI0 F;  3ZST A;  3G06 A;  3C50 A;  4KP3 C;  1M62 A;  4GHB A;  2KT9 A;  3LK2 A;  3AXJ A;  1MPF A;  3AE1 A;  4ANJ A;  2O4V A;  4KR8 A;  1BR2 A;  3RIU C;  2XM2 A;  5T5F A;  3LK2 B;  3AXJ B;  1MIY A;  1ZHY A;  3AA0 A;  5LB7 B;  3N2K E;  4LSE A;  2XTL A;  4QX8 B;  2XQ6 A;  4I43 B;  4F6R C;  4X64 T;  2CBJ A;  2X0L B;  2H7V C;  3AA6 A;  1ZHW A;  3OPC A;  3ZYK A;  5J0Z A;  2V6X A;  2XAH B;  2YOE A;  5LBQ B;  3ZYM A;  4KX6 A;  3AEC A;  5HYA A;  1LVK A;  4IE5 A;  3SS1 A;  2JMM A;  3UPG A;  1OED C;  2LJL A;  1PRN A;  5JDN A;  4O4X A;  5AQJ B;  5B5E O;  1VCS A;  3P4R A;  2UXB T;  4EYY R;  4JEH B;  3GP6 A;  3NZQ A;  3J9X 1;  2SPC A;  2KZ7 B;  5L3D B;  1QLB A;  2WDV A;  3BQK A;  5FY0 A;  1G90 A;  4F8H A;  1BR0 A;  5B66 O;  4JUY A;  4TWH A;  1MMD A;  4RJW A;  2YDS A;  3OJA A;  5CA0 E;  4TZ4 C;  2XTR A;  2IUB A;  3PUR A;  3L8R A;  2LE8 A;  3FZM B;  4ZXL A;  1KF6 A;  4AKH A;  5H6R B;  3WI5 A;  4EGW A;  3GN5 B;  3P50 A;  3A8Y C;  2LM2 A;  4ZZB A;  1GFP A;  1T8B A;  2ACX A;  3PV0 F;  3LK4 1;  3JAE A;  2VUR A;  2ZMA A;  5HAX A;  2VVN A;  2ZM2 A;  3HKD E;  2H3R A;  4UR9 A;  1UK5 A;  1GFN A;  3PUW F;  2KWI B;  8PRN A;  2W61 A;  1E2A A;  3ZPO A;  2VL8 A;  2WMN A;  3QB5 K;  2LRL A;  4H9N C;  4I55 E;  1KEY A;  2JQH A;  1T98 A;  3LK3 B;  4H63 V;  2VKH A;  2E5L T;  1DU2 A;  4PJN A;  5IYZ E;  3Q5W A;  4QXC B;  2VKO A;  2XQ7 A;  5ETW A;  3N9O A;  2XE2 A;  1UGO A;  2N2L A;  4N59 A;  3FXE B;  2WU5 A;  1QJP A;  2DHR A;  5LG4 A;  3GMI A;  1X79 A;  3IEE A;  4HFV A;  4QXB B;  5F8P A;  3RI5 A;  2PJQ A;  5IUX A;  5HEG A;  2X66 A;  4BJN A;  2HN2 A;  3ONX A;  3LBX A;  1KFY A;  4FT6 A;  5KX5 E;  4YTM A;  5LGT B;  4X1I E;  4PJJ A;  4PK4 A;  4GF4 A;  4IDP A;  1HS7 A;  4AYI D;  3QB5 A;  3PUS A;  3HW9 A;  3HKC E;  4TUY E;  4BUM X;  2Y48 B;  5JDG A;  4H9P C;  2KND A;  3LBX B;  2J1D G;  3ANW A;  2KSR A;  4E1T A;  2Q9Q D;  3KV5 A;  2IHR 1;  3RKO A;  1QJ9 A;  4ILA A;  4A56 A;  5C8Y E;  6PRN A;  3RPU A;  5HEO A;  3NSG A;  3UTK A;  3QNU A;  4C91 A;  2CBI A;  3WAJ A;  4OK0 A;  4YLH A;  1WFD A;  4HEA A;  2LT3 A;  2NW9 A;  2Y6X A;  1BR1 A;  3AEG A;  2DNX A;  3SWH A;  2R8A A;  3EMN X;  4E1S A;  2BG9 C;  4BAY B;  1NWM X;  4HFB A;  4YFS A;  4QWN B;  5KDM C;  4PK5 A;  2WSS V;  1HXT A;  4ZI3 C;  4LSH A;  3ZMU B;  3PUY F;  2CWY A;  1D0Y A;  4KUM B;  4FES A;  3AEA A;  2IWV A;  3HOE A;  1QSD A;  2WB5 A;  1YKH B;  5JVD E;  4ZZC A;  2C5K T;  3SY9 A;  3RC8 A;  3W15 B;  4AXP A;  2GE4 A;  5E79 O;  3UU3 A;  3LJC A;  4N75 A;  1H7C A;  5HCM A;  4G75 A;  4HWI B;  4GCP A;  2KWH A;  4LF8 T;  3SOL A;  3AEB A;  4GYS A;  5HEJ A;  3C98 B;  5AQU B;  4YSX A;  3UUB A;  1GQE A;  2RP4 A;  1FMW A;  3ABV A;  5KXJ A;  2WJR A;  1GFM A;  2Q9Q C;  4ZOL E;  1NEN A;  4X1Y E;  2MNH A;  5GTI O;  5JDQ A;  1UUS A;  2HHH T;  4XNK A;  2F1C X;  4AKR B;  3SFE A;  1VOM A;  1VCT A;  5E0O A;  4ISS A;  4MHC A;  4CI1 B;  4AQF C;  5ABE A;  4ADZ A;  2LOP A;  3DJB A;  3SY7 A;  3K3O A;  3RIF A;  1W0B A;  1XDO A;  2E9X D;  3N9L A;  4B3R T;  3RYI E;  2WWV A;  2Y8D A;  2R4L A;  3AED A;  3N9N A;  3T1H T;  1Y01 A;  4UB6 O;  2CLY B;  4B6X A;  5AQO B;  2ZM0 A;  3O1J A;  3A2S X;  5LMU T;  2HPJ A;  2UUC T;  3K19 A;  2M67 A;  4AQY T;  4QXH B;  5TAO A;  4QHO A;  5LHI B;  2F1V A;  3O4X E;  4EV6 A;  3N2G E;  1H6S 1;  3UU8 A;  4UVA B;  1W09 A;  4O2A E;  1FEW A;  3SYB A;  3AAI A;  4OYK A;  1YW0 A;  2CHO A;  4P1N A;  3G7G A;  1MM4 A;  4N74 A;  2W0G A;  4L0R A;  1G8X A;  3X1D A;  3T8O A;  5DQW A;  4CZZ B;  3QUJ A;  4HWH A;  3CQX C;  2G0U A;  5JQG E;  2A72 A;  2YDQ A;  4X62 T;  3NRY A;  4HFC A;  1ORM A;  3HR0 A;  4O4U A;  3AA1 A;  2XAG B;  4U2Z A;  5CFB A;  3FZK B;  4RLB A;  4U3C A;  3AE6 A;  2CXD A;  4AYE C;  3N5L A;  2XAQ B;  4AKI A;  3MZK B;  4JI7 T;  3KVA A;  3PQU A;  4GKJ T;  5JR9 C;  4IL4 A;  3AVS A;  3MJX A;  3FBZ A;  4FZL A;  3P4W A;  3T0S A;  4EZH A;  2LHN A;  2FGQ X;  4FSP A;  4EZ4 A;  3CPZ A;  3U78 A;  1Q9F A;  3V5S A;  3UT5 E;  3KZI O;  2YKS A;  5FNV E;  4EXT A;  1ZHX A;  5G26 A;  5FL1 A;  4DBQ A;  1IBM T;  3KDS E;  5ABF A;  3CX8 B;  3C4Z A;  1IJ6 A;  2E9X A;  4LFA T;  4IRE A;  4AQG A;  5JR9 A;  1WRD A;  3PJA A;  2VWA A;  4B61 A;  3L39 A;  4WYV A;  2E9X B;  3TLV A;  1Z8U A;  4B3T T;  4ZS2 A;  5AQF B;  3VE2 A;  5AFU K;  3ONJ A;  5JH7 E;  4X65 T;  5JDP A;  5DL6 A;  4TNW A;  2UXX B;  4DR3 T;  4XZC A;  4Z91 A;  1ZHZ A;  5FVL A;  3T1Y T;  2XPK A;  4CN4 A;  3UFG A;  2VQF T;  4LMK A;  5AQM B;  2YN6 A;  4G76 A;  3F31 A;  2F4V T;  3UFE A;  5AQI B;  2YEV C;  3L3P A;  3A7M A;  4IDN A;  4DR1 T;  3C4X A;  2PBI A;  1HX8 A;  2I59 A;  3PGR A;  2KDY A;  3T20 A;  4U2Y A;  3A0B O;  5C3J A;  4LF5 T;  5LCY A;  1MNE A;  1S35 A;  3JCU O;  4BJM A;  3SYS A;  4QKN A;  2C5J A;  5JDH A;  3RH3 A;  3FZF B;  5AQP B;  3V8U A;  3CKD A;  4WNK A;  2NOX A;  3EAM A;  3ZKR A;  1YQ3 A;  5LJM A;  1N32 T;  3AE7 A;  5H2F O;  4GKK T;  4TX5 A;  3M3Z B;  2EHO D;  3CQC B;  4XAX B;  5HEH A;  2K48 A;  2MPK A;  2UXD T;  2L8K A;  4H9R C;  4DUZ T;  3LSV A;  1YKE B;  4DR7 T;  2A2F X;  2NW7 A;  1O3X A;  3P4P A;  3CIR A;  2BS2 A;  2VL0 A;  3RYH E;  2V7I A;  3N9P A;  5J1G A;  1N34 T;  2R4N A;  4D5U A;  2VQE T;  2X0Y A;  3KIN B;  1BR4 A;  2E5V A;  2WM9 A;  1IAP A;  3HKE E;  2PRN A;  1IJ5 A;  4NIQ A;  3WI4 A;  4LFB T;  2XAJ B;  5AFU L;  1UX4 A;  3O9X A;  2JRK A;  5G39 A;  4LF7 T;  2R6G F;  1YXR A;  4YT0 A;  4DR4 T;  5DQV A;  3RIU A;  2JQK A;  3RRC A;  3AA0 B;  2XE3 A;  4DO0 A;  2MYS A;  2OA5 A;  4Q25 A;  2K24 A;  3DWN A;  4GIW A;  1J5W A;  2BS4 A;  4HTE A;  3AA6 B;  5EK4 A;  4K3B A;  2KIN B;  3NRX A;  3CWZ B;  4CXY A;  3MKD A;  2WVP A;  2OMF A;  2WP9 A;  3I1A A;  2KC0 A;  2ACZ A;  3MAC A;  5LHH B;  3ETU A;  2X9H A;  4ZI7 E;  2XQ9 A;  4YY3 T;  4JV5 T;  3AE5 A;  2EHO C;  4UEM A;  2IML A;  1OED A;  2C0S A;  4U72 A;  3KBT A;  3RQU A;  2W4X A;  1HXX A;  3OBV E;  2LSG A;  3AE9 A;  2WZH A;  5L4E A;  4K0K T;  4JI5 T;  1HXU A;  3UAQ A;  2IDO B;  1PHO A;  2R88 A;  2UUB T;  4E7S A;  4OX9 T;  2CMR A;  4U9C A;  4YXD A;  2LKG A;  2V7M A;  1MIW A;  1GFO A;  3JTY A;  2LRK A;  2WMO A;  5JRC A;  3ZN0 B;  1ZEE A;  3MXZ A;  1D0X A;  4DND A;  4DV1 T;  4UVC B;  3JAD A;  1S94 A;  4COF A;  3PGU A;  4PJL A;  3LK4 2;  1D0Z A;  1THQ A;  3MA9 A;  3CX7 B;  3C64 A;  2JMK A;  3FB2 A;  4XNL A;  2XJ7 A;  4LF6 T;  2X68 A;  2BVL A;  1US7 B;  5LA6 E;  4NPP A;  4I4T E;  4PNI A;  5HXC A;  5F3J A;  1YS5 A;  2XY8 B;  2GK9 A;  4Z90 A;  4J2C A;  3AEF A;  4AYN A;  3ZC1 A;  1GFQ A;  4P0A A;  5EK3 A;  4H63 H;  3UU2 A;  5FP3 A;  2L9Q A;  5G38 A;  2FJD A;  4AIU A;  4TN7 B;  2NW8 A;  2DL1 A;  3I9W A;  4ZI3 D;  2Y7S A;  2BS3 A;  3FBL A;  2NP9 A;  4U74 A;  4BA9 A;  4U7Y A;  4FRX A;  2CCQ A;  3R84 B;  1I6Z A;  1XWM A;  4U33 A;  1KNR A;  3PRN A;  3JC6 D;  4GYR A;  3VZU X;  3KVB A;  4NXN T;  3FHN A;  1KNZ A;  3AB3 B;  4D64 A;  4IST A;  1KNP A;  1Z0P A;  4AKL A;  2WS3 A;  4H9Q C;  2JQ9 A;  2V5D A;  1NEK A;  4DBR A;  2KLQ A;  5M4Y A;  5A1L A;  5L3C B;  3ANW B;  2V5C A;  2QRX A;  1VRB A;  1ZKE A;  3IBP A;  4JI0 T;  3Q5D A;  4MAL A;  4UXN B;  4O3Y A;  4ZS3 A;  2W80 C;  2FUP A;  4YJ2 E;  1ZHC A;  4O4J E;  4KR4 A;  4ZHQ E;  2D5U A;  2V26 A;  4FI5 A;  5GV0 A;  2RPA A;  5FXW A;  3PJA J;  4U7I A;  2W81 C;  1W0A A;  4QH4 A;  3JAF A;  4DMV A;  5DL8 A;  2E8I A;  2AXT O;  2BG9 A;  2H89 A;  2OLT A;  5L3B B;  4ERR A;  3M65 A;  3BRZ A;  1ZP0 A;  2X9W A;  3RIA A;  4YHJ A;  2X9Y A;  5IYU A;  3JC6 C;  3B57 A;  5HXR A;  1SA0 E;  2F1T A;  3PDY A;  2BG9 B;  4IE0 A;  5JDL A;  3TZG A;  2QGS A;  3F57 A;  2D2S A;  5ABG A;  3K8P C;  1HG5 A;  4EED A;  2LOS A;  2AXD S;  2R4P A;  1OWA A;  2XE5 A;  4LML A;  2PTF A;  3TLU A;  2ODV A;  3K3N A;  4IE7 A;  3PUX F;  5FMN A;  2XM1 A;  2L3L A;  1L0V A;  3WU2 O;  4AFK A;  2W67 A;  3LG7 A;  5DJQ C;  3BRY A;  5LYJ E;  4QX7 B;  2Q9Q A;  4TV9 E;  3NWI A;  1T72 A;  4FJO A;  1S5L O;  2XAS B;  2XTQ A;  2HPL A;  2NR4 A;  2A9U A;  5JRE A;  4EIW A;  4N78 D;  5L47 A;  2Q9Q B;  3RF1 A;  3POX A;  2XQ8 A;  4B3M T;  4LFC T;  4F4B A;  4PW8 A;  4AQF A;  3AE8 A;  1BXW A;  5L3E B;  3ZMZ B;  5LNK A;  4A98 A;  3VE1 A;  2WDR A;  1CHU A;  3DA3 A;  2NTX A;  2PFV A;  2YIN A;  1BT9 A;  4C90 A;  5JDM A;  2N2N A;  4XBF B;  1AJ3 A;  2MBG A;  2XQ5 A;  5BMV E;  5JTG A;  4DV6 T;  2DWK A;  3RC3 A;  2N9D A;  2M6B A;  4O3Z A;  3ZMS B;  4CTD A;  2WAU A;  2C5I T;  3B13 A;  1E54 A;  4JLE A;  3RBH A;  5FXV A;  3AE4 A;  4HFE A;  4PJ0 O;  3ONL C;  1ZV4 X;  3PUZ F;  3FZL B;  3KFW X;  3TKL B;  4JI1 T;  4LF9 T;  3T24 A;  1T1L A;  3WI3 A;  3GWH A;  1MMG A;  2X0H A;  3PQS A;  4YSY A;  3AA1 B;  3DP7 A;  3ESL A;  2VAS A;  4KRA A;  1Y64 B;  1HNW T;  4RJX A;  4JI2 T;  1WCR A;  1HTJ F;  2E2A A;  3VU7 H;  1N33 T;  3POU A;  4DMW A;  5BR8 T;  2R4O A;  3Q9D A;  4UVB B;  5L2L A;  1JNZ A;  1HF8 A;  3AAE A;  2NWB A;  2XUE A;  1UUR A;  5DL7 A;  2LKH A;  4C69 X;  2N1G A;  4ILU A;  2V7K A;  2YU1 A;  1HR0 T;  2XZE A;  3IA3 A;  2DWG A;  2J1N A;  2BKO A;  5AQS B;  1EZ3 A;  4EYU A;  5ABF B;  3AA7 A;  2W62 A;  2LSJ A;  2YDR A;  3HI2 A;  5JR9 B;  3UQ7 A;  3R6N A;  1FMV A;  3N9M A;  4IL9 A;  4PK6 A;  3EDU A;  4FRT A;  3SZV A;  5AQG B;  1WYB A;  2VB6 A;  4A5X A;  3AA7 B;  4HKA A;  4HFD A;  2JJ9 A;  3AE3 A;  3RYF E;  3ZT5 A;  3CK6 A;  4AUI A;  3HWB A;  2LHR A;  4NXM T;  4HFH A;  4ZI2 C;  1HX1 B;  1QUU A;  2QYW A;  4IDQ A;  3FZH B;  2MAW A;  4AKM A;  4LSF A;  5LJN A;  2H88 A;  1U5P A;  2LSI A;  4DV7 T;  4JFB A;  4X5T A;  2I6H A;  2ZLY A;  4EB6 E;  3RHW A;  4FZN A;  2V7J A;  4ASK A;  4EEB A;  2WBL A;  3QK6 A;  3ZMT B;  4UF0 A;  2IAK A;  4HN9 A;  2ZFG A;  3KV4 A;  4Z3T A;  2LLY A;  3HKB E;  5AQT B;  3DZM A;  3ZCJ A;  5FY1 A;  4CI3 B;  4UV8 B;  2FBW A;  4K0U A;  4UF0 B;  1JNR A;  1NAF A;  4FSO A;  1LRZ A;  4CN6 A;  5EZY E;  4FQE A;  2DLR A;  3VKG A;  4C00 A;  5L3F B;  3J7Y q;  2Y0K A;  3HOL A;  2M06 A;  2K0L A;  4PR7 A;  1U4Q A;  3H3M A;  1OPF A;  2B76 A;  3KV9 A;  4I50 E;  3SZD A;  1T7S A;  4JI3 T;  4O49 A;  4YJ3 E;  3C4W A;  3AEE A;  4HWC A;  3E08 A;  5LGN B;  3OYZ A;  4YSZ A;  2IC6 A;  2ZM6 T;  3VZT X;  4RL9 A;  4O2B E;  1W9R A;  3VY9 X;  4CQI A;  4JI6 T;  3D0T A;  5HXE A;  2XAF B;  2RA1 A;  4A97 A;  3OTO T;  4N58 A;  3PGS A;  3N2O A;  5KMG P;  4H9S E;  2IIU A;  4P0B A;  1HFA A;  2POR A;  4ILB A;  4JYA T;  2ODU A;  3UUL A;  5LGU B;  4X66 T;  3PUG A;  2YNK A;  5L4H A;  5AQN B;  3NKZ A;  1D1B A;  3RKG A;  2HN1 A;  2LHF A;  3SRZ A;  3PF1 A;  3ZJ2 A;  2WJQ A;  3UUN A;  2CEA A;  3PUV F;  2WQY A;  4UIG A;  3EAB A;  2KZ7 A;  2AE9 A;  2FJB A;  4OYJ A;  4P09 A;  4GOU A;  4KMC A;  2QA7 A;  2XQA A;  2BKN A;  4HFI A;  3POR A;  3P7I A;  2P9B A;  3QRC A;  1OED B;  3DTO A;  2EHO A;  3K3Q C;  3GN5 A;  3I9Y A;  5IHY A;  4I0U A;  2WZI A;  2CXL A;  3NVO A;  5H6Q B;  3CVR A;  4MBQ A;  1LKX A;  2MHL A;  2XE1 A;  3LFM A;  2EHO B;  4DR2 T;  5AQR B;  1MIV A;  4O8S A;  4YHH T;  3O0E A;  5AQH B;  5ADX K;  2VKJ A;  5HEU A;  3A5X A;  4GCS A;  2CA5 A;  1MND A;  4IT4 A;  1G73 A;  4QH5 A;  5JRC B;  4IL6 O;  1XMO T;  4O4I E;  3KBU A;  3PUA A;  5EE2 A;  4MFR A;  3AE2 A;  3OYX A;  3LK3 A;  2IW5 B;  4WW0 A;  3QC9 A;  5LBM A;  2ZLD A;  3UU4 A;  3VY8 X;  2I0M A;  3MK7 C;  4PFO A;  1ZHT A;  2XSA A;  3V5U A;  3AAA A;  4IHJ E;  2N2M A;  4CN1 A;  2X9X A;  3UU5 A;  5FXX A;  2QVA A;  3IF8 B;  1SHZ C;  4TWD A;  1WLX A;  3AAA B;  1Q9G A;  2CWO A;  2A3D A;  3N9Q A;  7PRN A;  2KXP A;  2VK9 A;  2XG6 A;  3ZYL A;  2Z6E A;  2FJE A;  5ABH A;  4PJM A;  4D65 A;  3GA8 A;  3DWO X;  1XZY A;  4X20 E;  2XSB A;  4GK0 E;  2D9D A;  5FY7 A;  4B3S T;  4AZL A;  2KXP B;  3EUH A;  5CJ5 A;  5FL0 A;  1E1H B;  5HXH A;  4WBO A;  2NTY A;  4TNV A;  5CB4 E;  4DV2 T;  5IWA T;  2BBH A;  2WDQ A;  4L5G A;  5AQK B;  1D1C A;  4M1P A;  2JPF A;  5AQL B;  5AQQ B;  2CE7 A;  4UB8 O;  4JCH A;  2H7O A;  4IIJ E;  5ADX L;  3P4S A;  1R8I A;  5DAB A;  4JI4 T;  3RQW A;  2BZB A;  3CML A;  2V7L A;  4KHZ F;  2K3W A;  4LMJ A;  3S4U A;  2CXF A;  4DUY T;  3TLT A;  2B1E A;  4FOZ A;  3P8C D;  3C51 A;  3ZSS A;  5LOV E;  1D1A A;  1MMN A;  1J5E T;  3U3I A;  2J4U P;  5LG3 A;  2DI4 A;  2UXC T;  4OFZ A;  2K9A A;  4UEL A;  1FIO A;  4AYM C;  1I94 T;  4TWF A;  5CGM A;  4CXW A;  4UV9 B;  3RRW A;  3Q5X A;  2WU2 A;  4EOZ B;  3KVD D;  3FXD B;  3VR9 A;  2CHN A;  1IBL T;  3HA4 A;  1LVF A;  3VHL A;  2X67 A;  2LSY A;  2V1D B;  1ZOY A;  1XNR T;  5EK2 A;  3DA4 A;  4IDO A;  4KHP T;  2ES0 A;  1IZN A;  4O3X B;  3RYC E;  2WCA A;  4O4L E;  3ZT7 A;  3RX6 A;  4ZEY A;  3RGL A;  2YPV A;  5L3G B;  5FVK A;  2DCF A;  3H37 A;  3LDQ B;  1IZN B;  4V1A v;  5TIS O;  2JQY A;  2J62 A;  5D5D A;  5J2U E;  3POQ A;  5HWY A;  2ZM8 A;  2WWU A;  2KMF A;  3VRA A;  1CUN A;  1P4T A;  4AYD C;  1OED E;  3ZT6 A;  4CXX A;  3EI0 A;  1IBK T;  1HNX T;  4AIS A;  2OV9 A;  1XNQ T;  4ILC A;  4JBW F;  4O4H E;  4AKR A;  2BVM A;  1SUM B;  2MTQ A;  3QOF A;  2CLY C;  2BKP A;  4IDZ A;  3SFD A;  2J4G A;  5G3A A;  4NUU A;  2XQ4 A;  2FJA A;  1HNZ T;  5C2T A;  4KBM B;  4HWF A;  2YU2 A;  3ZEF B;  3A0H O;  5CA1 E;  5FXZ A;  2Y2X A;  3PUQ A;  4DR5 T;  3IHR A;  4WBN E;  3O1I A;  1MM5 A;  5GTH O;  2JMH A;  1XMQ T;  4RLC A;  2XQ3 A;  1J1J A;  5LXT E;  1M7K A;  1OSM A;  2CPT A;  2ERV A;  4FZM A;  2D0T A;  1WR6 A;  3JCF A;  2LSK A;  3P4Q A;  4IE6 A;  3PU3 A;  4LSI A;  3L09 A;  3VKH A;  3UU6 A;  3CQG B;  4DVD A;  2FGR A;  3EDV A;  4QH1 A;  2BDE A;  3E22 E;  5HXS A;  5HWX A;  2UU9 T;  4YTP A;  4DR6 T;  1SE7 A;  2W63 A;  2MOZ A;  1WR0 A;  4ZI2 D;  1HCI A;  4U31 A;  3ZMV B;  1OXZ A;  3RLF F;  1X9B A;  3Q2M A;  3ETV A;  4FMS A;  3NBX X;  3TLS A;  5F5W A;  3OVU A;  2R89 A;  4Z8X A;  2ODJ A;  2BBJ A;  2PG8 A;  3UQ4 A;  3B5M A;  2D0U A;  5PRN A;  2YK0 A;  3EHZ A;  4G63 A;  2X51 A;  2M07 A;  2XMX A;  2VVS A;  2LFU A;  4LF4 T;  4QQ1 A;  4L9I A;  3BS0 A;  3E0Z A;  3AVR A;  4GK5 E;  2JQQ A;  4PUX A;  3VR8 A;  3UUM A;  1B7T A;  2Y0L A;  5LMN T;  2W66 A;  1YD8 G;  3ZLI A;  2E9X C;  3ZC0 A;  1T16 A;  2VKD A;  4DV3 T;  1V9D A;  3I0O A;  4TV8 E;  3EVY A;  3NZP A;  3PE0 A;  2JIW A;  4OHF A;  4HE8 A;  3TLW A;  4PFP A;  4DID B;  2CRB A;  1BH3 A;  3BQI A;  2IC9 A;  3AAE B;  4IE4 A;  5FVN A;  2XHE B;  5LHG B;  1N36 T;  4AI6 A;  2XQY A;  5AQV B;  2UXN B;  2M6I A;  2X27 X;  2CM0 A;  5LP6 E;  2IWW A;  3NJT A;  5GON E;  2QTK A;  1E7P A;  3OKQ A;  4AKG A;  3ZN1 B;  2W00 A;  3H3A A;  3CX6 B;  2Y0H A;  4HWD A;  3C5O A;  2J47 A;  5KAF O;  5J2T E;  4DV0 T;  3I0Q A; 
#chains in the Genus database with same CATH homology
 4KMC A;  4H9Q C;  2QA7 A;  3O1J A;  4H9O C;  3A2S X;  3FYX A;  2HPJ A;  3KV6 A;  4DBR A;  2KLQ A;  3K19 A;  2M67 A;  1UCU A;  4QXH B;  5TAO A;  4E7Z A;  4IGU A;  5M4Y A;  3POR A;  3P7I A;  5A1L A;  4QHO A;  2P9B A;  5LHI B;  3QRC A;  5L3C B;  2F1V A;  3O4X E;  4GCQ A;  4HGA A;  5FYM A;  3N2G E;  1H6S 1;  3ANW B;  4UVA B;  4O2A E;  3DTO A;  1VRB A;  1ZKE A;  1WYC A;  2EHO A;  3IBP A;  3PTR B;  4NUV A;  1FEW A;  2LEH A;  3K3Q C;  3AAI A;  3SYB A;  3GN5 A;  4EAH A;  4OYK A;  3I9Y A;  4MAL A;  1YW0 A;  4UXN B;  5IHY A;  3UUX B;  3G7G A;  2CXL A;  4ZS3 A;  5H6Q B;  2W80 C;  4O3Y A;  3CVR A;  4MBQ A;  1LKX A;  1UX5 A;  2HH7 A;  1MM4 A;  2W0G A;  4L0R A;  2MHL A;  2XE1 A;  3BK9 A;  4YJ2 E;  3LFM A;  1G8X A;  2EHO B;  1ZHC A;  1HG2 A;  3HL6 A;  3T8O A;  1MIV A;  4O8S A;  4O4J E;  4PAG A;  5DQW A;  4FUV A;  4CZZ B;  3QUJ A;  3CQX C;  2G0U A;  5JQG E;  1QJ8 A;  3O0E A;  3VZW X;  2VKJ A;  5ADX K;  2LM9 A;  3A5X A;  4MLK A;  2CA5 A;  4GCS A;  4KR4 A;  2K4T A;  1MND A;  2A72 A;  3WAK A;  1KK7 A;  4ZHQ E;  2D5U A;  1G73 A;  2V26 A;  4CI2 B;  4X1K E;  4G2A A;  3NRY A;  1ORM A;  4FI5 A;  5JRC B;  5GV0 A;  5FXW A;  3HR0 A;  4O4U A;  3AA1 A;  2XAG B;  3QRA A;  2W81 C;  3F2E A;  5DL5 A;  4O4I E;  3ZCI A;  3KBU A;  3PUA A;  3O1H A;  4MFR A;  4DMV A;  3BQL A;  3ZJ1 A;  4RLB A;  5EE2 A;  5DL8 A;  2E8I A;  3OYX A;  3LK3 A;  4O3W A;  2CXD A;  2IW5 B;  4WW0 A;  5JDF A;  4AYE C;  4JEU B;  3N5L A;  2XAQ B;  5L3B B;  3QC9 A;  5LBM A;  4AKI A;  3MZK B;  2ZLD A;  4ERR A;  3M65 A;  2X9W A;  4YHJ A;  2X9Y A;  5IYU A;  1MMA A;  3KVA A;  3PU8 A;  3JC6 C;  2K5B B;  3VY8 X;  3B57 A;  3C50 A;  4KP3 C;  3PQU A;  3MK7 C;  4PFO A;  1ZHT A;  3AAA A;  3V5U A;  4IHJ E;  5HXR A;  1SA0 E;  2F1T A;  2N2M A;  2KT9 A;  3PDY A;  5JR9 C;  3LK2 A;  1MPF A;  4GHB A;  4IE0 A;  5JDL A;  2X9X A;  3TZG A;  4ANJ A;  2O4V A;  3AVS A;  3MJX A;  4KR8 A;  2QGS A;  1BR2 A;  3FBZ A;  3F57 A;  4FZL A;  3T0S A;  2D2S A;  4EZH A;  5FXX A;  3K8P C;  2LHN A;  4OYJ A;  1HG5 A;  2FGQ X;  3IF8 B;  4EZ4 A;  3CPZ A;  2LOS A;  3U78 A;  1Q9F A;  3V5S A;  5T5F A;  3UT5 E;  1SHZ C;  1OWA A;  1WLX A;  3AAA B;  5FNV E;  4EXT A;  1Q9G A;  1ZHX A;  2CWO A;  2XE5 A;  5G26 A;  4DBQ A;  2A3D A;  2ODV A;  3K3N A;  3LK2 B;  3N9Q A;  7PRN A;  4IE7 A;  2KXP A;  2VK9 A;  3KDS E;  2XG6 A;  1MIY A;  3ZYL A;  1ZHY A;  3CX8 B;  2Z6E A;  3C4Z A;  5FMN A;  3AA0 A;  1IJ6 A;  3N2K E;  2E9X A;  2XTL A;  2L3L A;  4PJM A;  4QX8 B;  3GA8 A;  4LSE A;  4AQG A;  4AFK A;  5JR9 A;  4D65 A;  1WRD A;  3LG7 A;  4I43 B;  4F6R C;  5DJQ C;  4X20 E;  2X0L B;  2H7V C;  2VWA A;  4GK0 E;  5LYJ E;  5FY7 A;  3AA6 A;  1ZHW A;  4AZL A;  4QX7 B;  4B61 A;  3ZYK A;  2KXP B;  2Q9Q A;  4TV9 E;  3EUH A;  2E9X B;  4FJO A;  1E1H B;  2XAH B;  5HXH A;  2XAS B;  2XTQ A;  2HPL A;  5LBQ B;  3ZYM A;  5HYA A;  4WBO A;  5JRE A;  4ZS2 A;  1LVK A;  4IE5 A;  3SS1 A;  3VE2 A;  2JMM A;  3UPG A;  5AFU K;  4EIW A;  2LJL A;  2NTY A;  4N78 D;  5JH7 E;  2Q9Q B;  5CB4 E;  5JDP A;  1PRN A;  3POX A;  5DL6 A;  4F4B A;  2UXX B;  4PW8 A;  4AQF A;  5JDN A;  4O4X A;  4L5G A;  4XZC A;  1D1C A;  4M1P A;  2JPF A;  1ZHZ A;  1BXW A;  2CE7 A;  5L3E B;  3ZMZ B;  5LNK A;  4JCH A;  2H7O A;  4EYY R;  3VE1 A;  4JEH B;  3GP6 A;  3NZQ A;  3J9X 1;  2SPC A;  2KZ7 B;  4IIJ E;  5ADX L;  5DAB A;  5L3D B;  4G76 A;  3BQK A;  5FY0 A;  3F31 A;  1G90 A;  3DA3 A;  3UFE A;  2YEV C;  2NTX A;  2PFV A;  3L3P A;  1BR0 A;  2BZB A;  2YIN A;  1BT9 A;  4JUY A;  4C90 A;  3CML A;  2V7L A;  5JDM A;  1MMD A;  2N2N A;  3C4X A;  4RJW A;  4XBF B;  1AJ3 A;  2PBI A;  3OJA A;  2MBG A;  5BMV E;  5CA0 E;  3S4U A;  1HX8 A;  4TZ4 C;  2I59 A;  2CXF A;  2XTR A;  2KDY A;  2B1E A;  2DWK A;  2N9D A;  3P8C D;  3C51 A;  3PUR A;  3RC3 A;  4FOZ A;  3T20 A;  2LE8 A;  4O3Z A;  5LOV E;  3ZMS B;  1D1A A;  1MMN A;  4AKH A;  5LCY A;  1MNE A;  2WAU A;  2C5I T;  3B13 A;  5H6R B;  1S35 A;  3U3I A;  2DI4 A;  4BJM A;  1E54 A;  4OFZ A;  3WI5 A;  2J4U P;  2K9A A;  4UEL A;  3GN5 B;  1FIO A;  3SYS A;  4AYM C;  4JLE A;  3RBH A;  1GFP A;  4QKN A;  5PRN A;  2C5J A;  5JDH A;  2ACX A;  3RH3 A;  3V8U A;  3LK4 1;  4CXW A;  3CKD A;  2ZMA A;  5FXV A;  5HAX A;  4WNK A;  2NOX A;  4UV9 B;  3RRW A;  2ZM2 A;  3Q5X A;  3HKD E;  1ZV4 X;  3TKL B;  5LJM A;  3KFW X;  4EOZ B;  3KVD D;  3T24 A;  3FXD B;  4TX5 A;  2H3R A;  3WI3 A;  3GWH A;  3HA4 A;  1GFN A;  2EHO D;  2KWI B;  3CQC B;  1LVF A;  1MMG A;  2X67 A;  4XAX B;  3VHL A;  8PRN A;  2LSY A;  2K48 A;  2V1D B;  2W61 A;  2L8K A;  4H9R C;  4FSP A;  3ZPO A;  2VL8 A;  2WMN A;  3PQS A;  5EK2 A;  1YKE B;  3AA1 B;  4H9N C;  4I55 E;  3DP7 A;  3ESL A;  3DA4 A;  2A2F X;  2VAS A;  4KRA A;  2NW7 A;  1Y64 B;  1O3X A;  2ES0 A;  1IZN A;  1T98 A;  3RYH E;  4O3X B;  3RYC E;  4O4L E;  2V7I A;  3N9P A;  5J1G A;  3LK3 B;  3RX6 A;  4RJX A;  4D5U A;  1HTJ F;  4H63 V;  2VKH A;  3KIN B;  1BR4 A;  3VU7 H;  2WM9 A;  1IAP A;  2YPV A;  5L3G B;  4PJN A;  3HKE E;  2DCF A;  3H37 A;  2PRN A;  3POU A;  1IZN B;  5IYZ E;  1IJ5 A;  4V1A v;  4DMW A;  5D5D A;  3Q9D A;  5J2U E;  3Q5W A;  4UVB B;  4QXC B;  2VKO A;  5HWY A;  5L2L A;  2ZM8 A;  2WWU A;  1HF8 A;  2XAJ B;  3WI4 A;  3AAE A;  2KMF A;  2NWB A;  1CUN A;  1P4T A;  2XUE A;  5AFU L;  5DL7 A;  4AYD C;  1UX4 A;  5ETW A;  3O9X A;  3N9O A;  2XE2 A;  2JRK A;  4C69 X;  4CXX A;  2N2L A;  2N1G A;  4ILU A;  4N59 A;  3FXE B;  2V7K A;  2YU1 A;  1QJP A;  2DWG A;  2DHR A;  5DQV A;  4O4H E;  4AKR A;  5LG4 A;  2BVM A;  2MTQ A;  3GMI A;  2CLY C;  2J1N A;  1X79 A;  4IDZ A;  1EZ3 A;  4EYU A;  4NUU A;  3AA7 A;  3RRC A;  3AA0 B;  2W62 A;  2XE3 A;  2LSJ A;  3IEE A;  3HI2 A;  4HFV A;  4QXB B;  5F8P A;  4KBM B;  4DO0 A;  5JR9 B;  2MYS A;  2OA5 A;  2PJQ A;  3R6N A;  2YU2 A;  2K24 A;  3ZEF B;  1FMV A;  2X66 A;  4GIW A;  3N9M A;  4PK6 A;  5CA1 E;  4HTE A;  3AA6 B;  3EDU A;  4BJN A;  5FXZ A;  4FRT A;  5EK4 A;  3SZV A;  2KIN B;  3NRX A;  1WYB A;  2Y2X A;  3ONX A;  3LBX A;  3CWZ B;  2VB6 A;  4FT6 A;  4CXY A;  3MKD A;  3PUQ A;  5KX5 E;  3AA7 B;  4HKA A;  2JJ9 A;  3IHR A;  4X1I E;  4PJJ A;  4PK4 A;  3I1A A;  5LGT B;  2OMF A;  3RYF E;  4GF4 A;  1HS7 A;  2KC0 A;  4AYI D;  4WBN E;  3O1I A;  1MM5 A;  4AUI A;  3MAC A;  3HWB A;  2LHR A;  3PUS A;  5LHH B;  2JMH A;  3HW9 A;  3HKC E;  3ETU A;  4TUY E;  2X9H A;  1QUU A;  4ZI2 C;  4RLC A;  2Y48 B;  4BUM X;  5JDG A;  4H9P C;  4ZI7 E;  5LXT E;  2KND A;  1OSM A;  3LBX B;  2EHO C;  4UEM A;  2J1D G;  2ERV A;  3ANW A;  4AKM A;  2C0S A;  4LSF A;  4E1T A;  2Q9Q D;  3KV5 A;  5LJN A;  4FZM A;  2D0T A;  3KBT A;  4U72 A;  1WR6 A;  3RKO A;  1U5P A;  2LSI A;  2LSK A;  1HXX A;  3OBV E;  2LSG A;  1QJ9 A;  4IE6 A;  4A56 A;  5C8Y E;  4JFB A;  6PRN A;  3PU3 A;  4LSI A;  3RPU A;  3L09 A;  3VKH A;  3NSG A;  3CQG B;  3UTK A;  2ZLY A;  4EB6 E;  4DVD A;  2FGR A;  3EDV A;  4C91 A;  4FZN A;  2BDE A;  3E22 E;  2V7J A;  1HXU A;  5HXS A;  5HWX A;  3UAQ A;  1PHO A;  3WAJ A;  4ASK A;  4E7S A;  4OK0 A;  2WBL A;  2CMR A;  3QK6 A;  4YLH A;  3ZMT B;  4HEA A;  4UF0 A;  2LT3 A;  2V7M A;  4U9C A;  2IAK A;  4HN9 A;  1MIW A;  2W63 A;  2NW9 A;  2Y6X A;  1BR1 A;  1GFO A;  3JTY A;  2ZFG A;  3KV4 A;  4Z3T A;  2MOZ A;  2DNX A;  2WMO A;  4ZI2 D;  3SWH A;  1HCI A;  3EMN X;  5JRC A;  3HKB E;  3ZMV B;  3ZN0 B;  4E1S A;  1ZEE A;  1OXZ A;  3MXZ A;  5FY1 A;  3ZCJ A;  4CI3 B;  1D0X A;  3Q2M A;  4UV8 B;  4DND A;  4BAY B;  4UVC B;  1NWM X;  1S94 A;  3ETV A;  4K0U A;  4YFS A;  4FMS A;  3NBX X;  4UF0 B;  1NAF A;  4FSO A;  1LRZ A;  4QWN B;  5EZY E;  4PJL A;  3LK4 2;  1D0Z A;  1THQ A;  2DLR A;  4Z8X A;  5KDM C;  3MA9 A;  4PK5 A;  2WSS V;  3VKG A;  5L3F B;  2ODJ A;  3J7Y q;  3CX7 B;  2Y0K A;  2PG8 A;  3HOL A;  3C64 A;  2D0U A;  1HXT A;  2JMK A;  3FB2 A;  4ZI3 C;  2M06 A;  2K0L A;  4LSH A;  2YK0 A;  4XNL A;  3ZMU B;  1U4Q A;  4G63 A;  2X51 A;  1OPF A;  2M07 A;  2XMX A;  2CWY A;  1D0Y A;  2X68 A;  4KUM B;  4FES A;  2LFU A;  2BVL A;  3KV9 A;  4QQ1 A;  1US7 B;  4L9I A;  5LA6 E;  3HOE A;  1QSD A;  3E0Z A;  3AVR A;  4GK5 E;  4I4T E;  2JQQ A;  1YKH B;  5JVD E;  4PUX A;  4PNI A;  2C5K T;  4I50 E;  5HXC A;  5F3J A;  3W15 B;  3RC8 A;  3SY9 A;  3SZD A;  4AXP A;  1YS5 A;  3UUM A;  1B7T A;  2GK9 A;  4O49 A;  4YJ3 E;  4J2C A;  3C4W A;  2GE4 A;  2Y0L A;  3LJC A;  4AYN A;  1H7C A;  3ZC1 A;  1YD8 G;  3E08 A;  3ZLI A;  5LGN B;  3OYZ A;  4G75 A;  4GCP A;  2E9X C;  3ZC0 A;  1GFQ A;  2KWH A;  2IC6 A;  2VKD A;  3SOL A;  4P0A A;  3VZT X;  1V9D A;  4O2B E;  3I0O A;  4TV8 E;  5EK3 A;  4RL9 A;  4H63 H;  3EVY A;  4GYS A;  3UU2 A;  3C98 B;  3NZP A;  3PE0 A;  5FP3 A;  2L9Q A;  2RP4 A;  4OHF A;  4HE8 A;  1FMW A;  4PFP A;  4TN7 B;  2NW8 A;  1BH3 A;  3VY9 X;  3BQI A;  2Q9Q C;  1GFM A;  4CQI A;  2IC9 A;  4ZOL E;  3I9W A;  3AAE B;  3D0T A;  4IE4 A;  5FVN A;  4ZI3 D;  2Y7S A;  5HXE A;  2XHE B;  2XAF B;  4X1Y E;  2RA1 A;  5LHG B;  4N58 A;  2MNH A;  4AI6 A;  3FBL A;  5JDQ A;  3N2O A;  2NP9 A;  5KMG P;  4U74 A;  4BA9 A;  2XQY A;  4H9S E;  2UXN B;  4FRX A;  2CCQ A;  4XNK A;  4AKR B;  3R84 B;  2X27 X;  3POQ A;  1VOM A;  4P0B A;  5E0O A;  2CM0 A;  1HFA A;  4ISS A;  4MHC A;  4CI1 B;  2POR A;  5LP6 E;  4AQF C;  2ODU A;  4ADZ A;  3PRN A;  5GON E;  3UUL A;  2LOP A;  2QTK A;  5LGU B;  3OKQ A;  3DJB A;  4AKG A;  3SY7 A;  3ZN1 B;  3JC6 D;  3K3O A;  4GYR A;  3PUG A;  2W00 A;  2YNK A;  3VZU X;  3H3A A;  1D1B A;  2E9X D;  3KVB A;  3N9L A;  3FHN A;  1KNZ A;  3AB3 B;  2LHF A;  3SRZ A;  3CX6 B;  4D64 A;  3ZJ2 A;  2Y0H A;  3RYI E;  2CEA A;  4IST A;  3UUN A;  2Y8D A;  4UIG A;  3C5O A;  3N9N A;  2KZ7 A;  5J2T E;  1Z0P A;  2CLY B;  4B6X A;  4AKL A;  2ZM0 A;  3I0Q A;  4P09 A;  4GOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...