4AKRB

Crystal structure of the cytoplasmic actin capping protein cap32_34 from dictyostelium discoideum
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
245
Chain Sequence
TEKQLSCCLDLMRRLPPSQIEDNLAGLLDLVPDLTEDLLSSIDQPLKVAYDAVSKKDYLLCDYNRDADSYRSPWSNKYDPPLSGACYPSSKLRDIEVQANEIFEIYLNLYFEGGVSSVYCWDLDDNFAAVVLMKKTQDPMRGTWDSIHVVEVKLGKKDKAVYKLTSTVMLSIETDNDNTGKVNLAGSLTRQDEKEYTFNEVDTHCVNIGKMVEDMESKLRQTLETIYFGKTKEVVNTLRNATGNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation and Divergence between Cytoplasmic and Muscle-Specific Actin Capping Proteins: Insights from the Crystal Structure of Cytoplasmic CAP32/34 from Dictyostelium Discoideum.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Actin-binding protein
molecule keywords F-ACTIN-CAPPING PROTEIN SUBUNIT ALPHA
total genus 71
structure length 245
sequence length 251
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4akrB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 4akrB02
2KXPB 3AA6B 3AAEA 5AFUK 2KZ7A 3AA0B 3LK3A 4AKRB 3AA7B 3LK3B 1IZNA 2KXPA 3AAEB 4AKRA 3LK41 5AFUL 3LK42 3AAAA 1IZNB 3AA1B 3LK2B 3AA7A 5ADXK 2KZ7B 3AAAB 3AA1A 3AA0A 5ADXL 3LK2A 3AA6A
chains in the Genus database with same CATH superfamily
4FZLA 2CXFA 5AQHB 2JJ9A 3FZMB 2EHOC 3POUA 3C5OA 3C64A 2HN2A 5AQRB 4LSEA 3IEEA 1SHZC 4JBWF 2ZM2A 4CI1B 2SPCA 1BR1A 2XQ7A 2Y2XA 3PU8A 2WQYA 4L5GA 5FYMA 5G38A 2XE1A 1KNZA 5FKYA 4TNVA 5AFUK 3AA6B 4YSXA 2A72A 3ZJ2A 2YN6A 4HGAA 1H7CA 3KDSE 4D65A 2MYSA 3VKHA 4AISA 2CMRA 3JAFA 4BUMX 4PK4A 1MMNA 4ILCA 2E2AA 4G2AA 3SRZA 3AE1A 1N34T 2YOEA 2MTQA 5KAFO 1YKHB 4FMSA 4DO0A 5IHYA 2VVNA 2MHLA 3AEAA 1MM4A 3I1AA 4IDOA 4P0BA 3EMNX 4EEBA 3WU2O 3AE2A 1J1JA 3LBXA 1WLXA 2WJRA 3PUAA 2DNXA 2R6GF 4DIDB 3HKEE 3V5SA 2K3WA 2XQ6A 3LSVA 2V6XA 2E9XB 4NUVA 3ZC1A 4JCHA 4LF8T 4AQFC 1V9DA 2LSGA 1W0AA 4BA9A 1HXXA 3N9NA 4ZZCA 4DVDA 4GYSA 4AYMC 5LMNT 3P4WA 3LFMA 2LRKA 2XUEA 4HWIB 2UUBT 1MNEA 3BK9A 4KX6A 1I6ZA 4CN4A 2H3RA 4LFAT 2BVLA 4C90A 2G0UA 4B3ST 4FSOA 2LJLA 3SY9A 2C5JA 4RJXA 4IDZA 4MBQA 2XJ7A 3VRBA 1OWAA 4NPPA 2JQ9A 3UULA 2CRBA 3UT5E 1B7TA 1YQ3A 4ZI3D 2V7MA 4MALA 5IYZE 2CM0A 4JI3T 2FGRA 2WBLA 2Q9QD 1WR6A 4AYEC 1U5PA 2W0GA 2B1EA 4DR3T 1MMGA 3I9YA 2XM1A 4UB8O 1QJPA 4U2ZA 3N2KE 3O1JA 3SOLA 1PRNA 2V5CA 5AQSB 1OXZA 3P4SA 5EK4A 4PK6A 4EYYR 5HEHA 5L3GB 4V1Av 3N9LA 3AEBA 3WAJA 4A98A 1HR0T 2UXXB 2ZFGA 3HI2A 1E1HB 4EB6E 1HX1B 3PV0F 4K0UA 2QTKA 3QRCA 2CLYB 3AE9A 3ETUA 2BS4A 3UTKA 1NWMX 2CXLA 3ESLA 3AA0A 5LGUB 5AQJB 2UUAT 5PRNA 2UUCT 4X65T 2XM2A 2BBJA 4NUUA 2BKOA 3BQLA 5JDNA 5LNKA 4KHZF 1W0BA 1X9BA 5JRCA 2KSRA 4I0UA 4KR8A 5T5FA 4FZNA 1OPFA 4UV9B 3ZSSA 3TLWA 2E5LT 5LB7B 3E22E 5LBMA 3AA7A 5ADXK 4DV2T 3ZYLA 2H89A 3PGSA 1MMAA 3J9X1 3UQ7A 3H37A 1M62A 1KNPA 5DQVA 2UXNB 4CXXA 2D0UA 5JDLA 3O1HA 2VL8A 3HA4A 2NW7A 4BJMA 2K0LA 2N2MA 4JI2T 3PF1A 3RGLA 1BR0A 2OMFA 1UX5A 3RRWA 3A5XA 3JC6C 4GOUA 1NAFA 4JI5T 2F1VA 3PQSA 4JI1T 2XQAA 4CI3B 3ZMUB 2BG9A 3C4XA 3RRCA 3NRXA 2XAQB 2K4TA 2LOSA 3AAEB 3ZC0A 2LRLA 4AYNA 3K19A 3ZLIA 2W81C 2NTYA 2YDSA 5FY1A 4HE8A 1OSMA 5JDMA 1WYBA 5A1LA 3QC9A 3SWHA 2DCFA 2Q9QB 5LYJE 2YNKA 2KNDA 1HXTA 2JQQA 2BG9B 8PRNA 2PORA 2UU9T 4DV3T 2Y48B 4KI0F 2B76A 1UX4A 4YXDA 2F1TA 1S35A 1IJ5A 1IJ6A 2X9WA 4GK5E 2LSIA 2WDRA 4H63V 4UIGA 4AQFA 1CHUA 3PUZF 1MIWA 3ONXA 4UF0B 4YHHT 3AAAA 3EVYA 4IDNA 4XAXB 5C8YE 3AE5A 5J2UE 2X9YA 4ANJA 4DMVA 2WZHA 3N2GE 3UAQA 2VASA 4AKRB 5FVLA 5E79O 3A0BO 3R84B 4RL9A 5CB4E 3J7Yq 3DA3A 4TWDA 2DWGA 2Y0LA 4AZLA 4QHOA 4UXNB 4X1YE 3POXA 2M67A 4E7ZA 4Z90A 3ZCIA 3DWNA 3OYZA 2LSJA 4FRXA 2LLYA 3KBTA 4EYUA 2M06A 4EEDA 4Z8XA 2XQ9A 3WI4A 4HWDA 4QH5A 3ZMZB 3PJAJ 4HN9A 2GK9A 3PORA 4A56A 4QX7B 4EV6A 3AB3B 1SUMB 3RYIE 2BS3A 5JR9B 2WWVA 1HG2A 2HHHT 4U2YA 4TNWA 2XE2A 3LK41 1UURA 3UFEA 4PJLA 3RLFF 1HNZT 4IDPA 3PE0A 4U3CA 3M3ZB 4DV0T 5H2FO 5LBQB 5LHIB 4ISTA 4KMCA 2ZM6T 4NIQA 2N9DA 2XG6A 4ILAA 3SZDA 4ZEYA 3QNUA 5LG3A 4RLBA 3SFDA 2R4OA 4LF4T 1ZOYA 3UU4A 4U31A 5AQTB 2IUBA 2FJAA 1MPFA 4PK5A 3EAMA 4BJNA 4FI5A 1G90A 2ODVA 3K3OA 3AE3A 4EOZB 1KEYA 1Z8UA 3CPZA 4AI6A 4KP3C 1WRDA 4HFDA 3U3IA 4KR4A 2XY8B 2BG9C 2JQHA 4H9NC 5LHHB 1YD8G 2DLRA 3K3QC 3L3PA 3CX6B 5HCMA 5TAOA 2LFUA 3HR0A 4UELA 4MHCA 4LMLA 2YDRA 2Y6XA 4JEHB 5CJ5A 3ZPOA 4L9IA 1UUSA 2X51A 3OBVE 5KX5E 3GWHA 1IBKT 5LJMA 3HL6A 2RP4A 3AE4A 5BMVE 5LGNB 2J4GA 4X1KE 1HTJF 2JPFA 5EK2A 3MACA 2XAFB 3POQA 1HF8A 4GIWA 2QRXA 3K1SA 5KAIO 1YQ4A 3F57A 2PG8A 5ABHA 3UUMA 4PJJA 1WYCA 4AKHA 4ZI2D 4LSHA 3ONLC 2JMKA 1XNRT 2LEHA 2QA7A 5DJQC 1N36T 2XAJB 3T20A 3G7GA 5CA0E 4K3BA 5DQWA 3T0SA 2VWAA 4O3ZA 1THQA 5ETWA 1KNRA 2E9XC 2XQ8A 4GCSA 3VY9X 1M7KA 2XHEB 1GQEA 4I55E 2D2SA 1X79A 4MFRA 1J5ET 4CN1A 3DTOA 3HWBA 1HX8A 1HNWT 2CHNA 4YSYA 5L2LA 1US7B 5FXXA 2N2LA 3ZEFB 3P8CD 3PJAA 2ZLDA 2XTQA 3PU3A 3FZKB 1AJ3A 2AXTO 3QB5K 3LBXB 2CXDA 3CX7B 2HPJA 1ZHCA 2CE7A 4QH1A 2O4VA 4G63A 4IE0A 1HFAA 4IE6A 3R6NA 4ILUA 4GKKT 5EE2A 3HOLA 1T7SA 2YU2A 5LMUT 4K3CA 1FEWA 4CTDA 2XZEA 1XNQT 2MNHA 5LP6E 4P1NA 2WMNA 5HYAA 2AE9A 5DL8A 5LGTB 2K24A 3LK3A 2R4PA 2OA5A 3VHLA 4HWCA 4H9QC 2WM9A 3C50A 2FGQX 4AIUA 4YTPA 1BT9A 3RQUA 3KINB 3NKZA 3X1DA 3AVRA 2WB5A 3EUHA 5IUXA 2EHOB 4GCPA 4TWHA 4F6RC 2FJBA 5L4HA 2YKSA 5F8PA 4PR7A 1IZNB 4UVAB 3RYHE 3AE6A 3VR9A 2Y0KA 1XDOA 2X9HA 5ADXL 4PJ0O 1S5LO 2R89A 2XQYA 2YEVC 3ZT6A 5JDQA 1PHOA 4AUIA 5FL0A 4OK0A 4HFCA 4DUYT 3CK6A 3V8UA 2VKOA 4WZXA 3ZJ1A 4U7YA 1QJ9A 2H88A 5FL1A 1VOMA 1BXWA 1XWMA 4FT6A 4UR9A 3VZTX 2BZBA 2C5IT 3SFEA 5EK3A 3AA7B 2W4XA 4DBRA 3DA4A 3N2OA 4CXWA 2DI4A 1E54A 2P9BA 5KXJA 3O9XA 2VVSA 4JI4T 4PNIA 2LOPA 3VU7H 2WVPA 4AFKA 4FZMA 4AKLA 4C4VA 3ZYMA 3RBHA 4B3MT 3ANWA 4QXBB 3RC3A 4CXYA 3ZCJA 5CFBA 5LG4A 4IE7A 4PFPA 3PGRA 3M65A 3AE7A 3LK3B 4DV1T 3EHZA 2V6YA 5AQMB 5HEUA 3FZHB 3PUVF 5LJNA 3MA9A 4J2CA 4UVBB 2DL1A 4JI7T 5LXTE 3VR8A 3EI0A 2V7JA 1GFNA 4O49A 2DWKA 4CN6A 5L3CB 1YKEB 3PDYA 3CIRA 4TUYE 2KLQA 2JQKA 2I6HA 3IHRA 2WSSV 3A8YC 3F2EA 4DV4T 3VE2A 2KT9A 2LM2A 2W67A 3B57A 3KBUA 3RQWA 4TZ4C 3UUNA 4AYDC 1Q9GA 4EZ4A 4O4XA 2FJDA 3PRNA 2BS2A 4IHJE 3FBLA 4I50E 4F4BA 4N78D 4XBFB 4HFEA 2XMXA 2V7KA 3FB2A 3DJBA 3KV4A 2X66A 2C5KT 3ABVA 5B5EO 2HN1A 4C00A 3LJCA 2X67A 2OV9A 4DV5T 5JDHA 2D5UA 3JC6D 1N33T 2KMFA 5AQNB 4ZXLA 1LRZA 2FBWA 2X0LB 2R4NA 1NEKA 5JQGE 4AKMA 3KV5A 4C69X 3T1HT 3N9MA 3UFGA 3AAIA 2AXDS 5DL6A 2V26A 3CVRA 3WI3A 3ZMVB 3K3NA 4LMJA 4AKGA 3C98B 5AQPB 5ABFB 4JI0T 3BQKA 5AFUL 3PUQA 3AA1B 3KVAA 4X66T 1JNZA 5L3FB 4G76A 3RF1A 3RYFE 3RKGA 3KV9A 1IZNA 4PW8A 3QOFA 3OTOT 5B66O 3ZSTA 3RIFA 5IYUA 3PUWF 4X20E 5AQUB 2X0YA 5GTHO 3TLVA 1HS7A 4YTNA 1XDPA 2M6IA 2CHOA 3KVDD 4GHBA 2XAGB 1ZHYA 3MKDA 3MK7C 4JV5T 2HH7A 1LVFA 2IW5B 1OEDB 2IWVA 3I0QA 2MAWA 3BS0A 4ZHQE 2UXBT 1ZP0A 3AECA 1J5WA 3NSGA 5FXVA 2IMLA 2KWHA 2XQ5A 4DNDA 4JUYA 4I4TE 2ODUA 4CI2B 2D0TA 5AQQB 4LF9T 2ZM8A 1L0VA 3IF8B 4IL6O 7PRNA 5G3AA 4FJOA 3BRYA 5ABFA 3FZFB 2XE3A 1O3XA 3UU6A 5FVNA 3ZN1B 3B13A 2W00A 4H9OC 1ZHZA 4O4JE 2OLTA 2H7VC 3TZGA 4HFHA 3V5UA 2X68A 3T24A 3PQUA 4AKIA 4LFBT 5GTIO 1P4TA 5AQVB 1MMDA 4FESA 4IT4A 4CZZB 1H6S1 1BR2A 1QSDA 2ZM0A 5FXWA 2WZIA 3RIAA 2LHNA 2K5BB 4NXMT 1S94A 5HAXA 5JTGA 2JQYA 2CLYC 2FUPA 3LK42 1HXUA 4C4VB 2R4LA 2J1DG 3PGUA 3VZUX 1ZEEA 2MBGA 2QGSA 3TLTA 3W15B 2NTXA 2WU2A 5JR9C 2LM9A 2JMMA 4B61A 3LK2B 1FIOA 4ZS3A 4JI6T 3WAKA 4N74A 3GN5B 5FVKA 2X0HA 3AA6A 1LKXA 4DV6T 1CUNA 2LT3A 3C51A 4TN7B 4FOZA 2VB6A 2BKPA 5E0OA 4LMKA 4QWNB 3CKDA 4JFBA 2PJQA 3QK6A 5FY0A 4TV8E 1T8BA 3HOEA 5L3EB 4PUXA 4LF7T 2VK9A 5KMGP 4WNKA 3E08A 4QKNA 3JCUO 1ZV4X 1ZKEA 1G8XA 1E7PA 1BH3A 1QLBA 5FNVE 4PJNA 2JRKA 3H3MA 2E9XA 2LKHA 3N5LA 3PUGA 4N59A 3SYBA 2V6YB 4OHFA 1IBLT 3RH3A 4U9CA 4O3WA 5ABEA 2VKHA 4IL4A 5IWAT 3AAAB 4TWFA 2WU5A 3N9PA 1WFDA 1BR4A 2L3LA 2J1NA 1FJGT 4TX5A 3D0TA 3P4QA 3O4XE 1MIVA 3P4PA 2CPTA 5GV0A 2A2FX 3GMIA 3T8OA 4A5XA 3Q9DA 2WY2A 3JCFA 4ERRA 4G75A 5HEJA 2J47A 2ERVA 4NXNT 5FY7A 2YPVA 3OYXA 3PUSA 3UUXB 5G39A 2KDYA 2X27X 2IAKA 1VRBA 4M1PA 3PTRB 4JEUB 4X1IE 3I0OA 5HEOA 4HKAA 5JDFA 4B3RT 4DMWA 2DHRA 2Q9QC 3ZN0B 1T1LA 3LK2A 3IBPA 4GKJT 4KRAA 1YW0A 4E1SA 4DR6T 4LFCT 1W09A 4YHJA 5F3JA 5AQKB 3SY7A 2KXPA 2M6BA 4UEMA 4KUMB 3Q5XA 4LSIA 2PFVA 4QXCB 4OYKA 2XTRA 3LG7A 3P7IA 4I43B 2CBJA 1JNRA 3AVSA 4ZZBA 5L3DB 2A9UA 1XMQT 4HEAA 4KHPT 2Y7SA 4HTEA 5L3BB 3BRZA 4JI8T 3NVOA 3AAEA 3C4ZA 1GFPA 3Q5EA 3A2SX 2CWOA 3GN5A 4WBOA 4FSPA 3CMLA 4OFZA 5CGMA 4DR7T 2NW8A 2V7IA 2YINA 4UV8B 2WDVA 5HXSA 1MNDA 3OPCA 1VCSA 3S4UA 5LA6E 4FUVA 1QUUA 2IC6A 2FJEA 4EZHA 4DBQA 2QVAA 1UCUA 2IIUA 2QYWA 5H6QB 4AQYT 4OYJA 1W9RA 1KFYA 2WWUA 3QUJA 3AE8A 4DR5T 1FMWA 4QXHB 2NWBA 4IDQA 1SE7A 3UU2A 1QJ8A 3ZMTB 2KZ7B 3AXJB 3P50A 3N9OA 2V7LA 4ILBA 3OVUA 1T72A 5JVDE 3IA3A 4N75A 3DP7A 3RX6A 2ZMAA 2L9QA 3NZQA 3UPGA 4O4UA 5JREA 1Y01A 1FMVA 2XTLA 1DU2A 2N1GA 3ONJA 1D0YA 2W61A 2LKGA 5AQOB 2W63A 2R88A 3AA1A 4XNLA 4H63H 3A7MA 3OJAA 1HNXT 3G06A 2W66A 2WS3A 4CQIA 3VY8X 3TLUA 3RKOA 4WBNE 1Y64B 2W80C 4IE4A 4IE5A 2PBIA 3MZKB 5HXRA 4HFIA 3FHNA 5AQLB 3O1IA 2UXDT 2ODJA 5JDGA 4YFSA 5GONE 3WI5A 3AA0B 4GCQA 1ZHTA 4WYVA 3AEGA 2A3DA 4HWHA 4ZI3C 3ANWB 3RYCE 3RI5A 3EDVA 2E8IA 3T1YT 4LSFA 3AEEA 4IGUA 1U4QA 1D0XA 5J0ZA 2BVMA 1OEDA 3L09A 1R8IA 4H9SE 4PAGA 2CA5A 3F31A 4Z3TA 1LVKA 3RIUA 4GK0E 2K48A 2L8KA 1VCTA 1N32T 3PUXF 2XPKA 3VRAA 3MJXA 4P09A 5JDPA 5DL5A 2Y8DA 4GYRA 4JLEA 2RA1A 4E1TA 2HPLA 1GFQA 2XQ4A 3QRAA 3SYSA 4YT0A 3FXDB 1SA0E 2J4UP 2IDOB 1T98A 4PJMA 4ZOLE 4IL9A 5D5DA 2NP9A 4FRTA 3DWOX 3UU3A 4Q25A 2CEAA 3UU5A 2I0MA 5HCJA 5AQGB 1OEDE 4JYAT 4AKRA 5H6RB 4N58A 4ZI7E 2E5VA 3RC8A 2LHFA 2D9DA 4XNKA 2RPAA 2XASB 5HWYA 4O3YA 3A0HO 4L0RA 2BKNA 2KZ7A 2CCQA 3AXJA 5C3JA 4X5TA 2JIWA 3Q5DA 1KK7A 1HCIA 4B3TT 3ETVA 4AXPA 4D5UA 5LOVE 2BBHA 4YTMA 2YDQA 3P4RA 2K9AA 2UXCT 5F5WA 4O8SA 5AQIB 2KXPB 1YXRA 4O2AE 5FP3A 5JR9A 2KINB 1WR0A 2WMOA 3QB5A 3MXZA 5L47A 3AEFA 4DV7T 4QQ1A 2MOZA 4XZCA 4HFVA 3CWZB 3NRYA 4B6XA 3ZMSB 4E7SA 4AYID 4QH4A 1OEDC 2V1DB 2NR4A 4U72A 2M07A 4U33A 2XSAA 4O4IE 3N9QA 3CX8B 3L8RA 4YJ3E 1D1BA 5EZYE 2CBIA 1MIYA 4YY3T 2XE5A 2XAHB 4F8HA 4A97A 4K0KT 2ZLYA 2F4VT 3CQGB 3UUBA 3CQCB 1UK5A 2V8SV 4ASKA 4EIWA 1GFOA 4LF6T 4U7IA 3B5MA 3PUYF 4YSZA 2W2UA 3VE1A 4TV9E 1HG5A 4PFOA 5DL7A 3NWIA 3C4WA 4D64A 2WJQA 5G26A 3NZPA 4DR4T 1Q9FA 2YK0A 2N2NA 5M4YA 5BR8T 2LSKA 5ABGA 3TLSA 4ADZA 2C0SA 3HKCE 2VKJA 4EGWA 5HXHA 1Z0PA 3EDUA 3JADA 4GF4A 2X9KA 1T16A 3UU8A 4UF0A 4DR1T 2VQET 2X9XA 4UB6O 4UVCB 2E9XD 5FMNA 4O3XB 5C2TA 4EAHA 1XZYA 2WP9A 5TISO 3HKBE 3FXEB 2CWYA 3U78A 4IREA 2LE8A 3ZKRA 2H7OA 2NOXA 5DABA 2NW9A 1D1CA 3H3AA 4OX9T 1IBMT 3PURA 5LCYA 2VL0A 4EXTA 6PRNA 3AEDA 2LSYA 4HFBA 1EZ3A 4O2BE 3O0EA 4AQGA 4FQEA 2EHOD 2LHRA 2MPKA 3HW9A 3VZWX 3K8PC 3JAEA 2F1CX 3NJTA 3RIUC 5JH7E 2I59A 3CQXC 3ZT7A 3DZMA 3Q2MA 3GP6A 4Z91A 4C91A 2ACXA 4WW0A 1GFMA 5LHGB 3SS1A 5J1GA 4O4HE 4H9PC 3EABA 1D1AA 3LDQB 2ES0A 2R8AA 3FBZA 3KVBA 4LF5T 3FZLB 5HXCA 4ISSA 3ZT5A 2KWIB 4HWFA 3RPUA 2KC0A 3SZVA 2XQ3A 2IHR1 2Z6EA 3KV6A 3UQ4A 2IC9A 1MM5A 1KF6A 5HWXA 2JMHA 4QX8B 1E2AA 3L39A 2Q9QA 1ZHXA 2J62A 4P0AA 2Y0HA 5AQFB 3BQIA 5CA1E 4DUZT 1D0ZA 4MLKA 3OKQA 2PRNA 1WCRA 2VQFT 1UGOA 4X64T 1ORMA 3NBXX 3VKGA 4YJ2E 3Q5WA 3JTYA 2GE4A 1ZHWA 2WCAA 4RJWA 1G73A 2WDQA 4IIJE 3ZYKA 4YLHA 5KDMC 2BG9E 4X62T 1I94T 4COFA 2EHOA 2W62A 1YS5A 4KBMB 2XSBA 4ZI2C 5L4EA 3E0ZA 3KZIO 4H9RC 2PTFA 2BDEA 3FYXA 3KFWX 3RHWA 3HKDE 3I9WA 2WAUA 3GA8A 2IWWA 3TKLB 5HXEA 1IAPA 5JRCB 5J2TE 4DR2T 2V5DA 1XMOT 5FXZA 2VKDA 1NENA 2YU1A 4ZS2A 4O4LE 2VURA 2ACZA 4BAYB 5HEGA 4RLCA 4U74A
chains in the Genus database with same CATH topology
4FZLA 2CXFA 3O1IA 2ODJA 5JDGA 4YFSA 2JJ9A 4BJNA 4FI5A 5GONE 1G90A 1HS7A 3WI5A 2EHOC 3POUA 3AA0B 4GCQA 1ZHTA 2ODVA 3C5OA 3C64A 3K3OA 3KVDD 4EOZB 4GHBA 2A3DA 4LSEA 3IEEA 1SHZC 2XAGB 3CPZA 2ZM2A 4CI1B 4AI6A 4KP3C 2SPCA 1WRDA 4ZI3C 1ZHYA 3MKDA 1BR1A 3ANWB 3MK7C 3RYCE 2HH7A 3U3IA 2Y2XA 3PU8A 4L5GA 3EDVA 2E8IA 1LVFA 2IW5B 5FYMA 4KR4A 2XE1A 1KNZA 4LSFA 4IGUA 1U4QA 1D0XA 3I0QA 4H9NC 5LHHB 2BVMA 1YD8G 2DLRA 3L09A 3AA6B 3K3QC 3L3PA 5AFUK 3CX6B 4ZHQE 5TAOA 2LFUA 4H9SE 2A72A 3HR0A 4PAGA 4UELA 2CA5A 3F31A 4Z3TA 3ZJ2A 1LVKA 4MHCA 4GK0E 2K48A 1H7CA 4HGAA 2L8KA 3KDSE 4D65A 2MYSA 3VKHA 2CMRA 3NSGA 4BUMX 4PK4A 5FXVA 1MMNA 3MJXA 2Y6XA 2KWHA 4P09A 4JEHB 5JDPA 5DL5A 2Y8DA 4G2AA 3SRZA 3ZPOA 4DNDA 4GYRA 4L9IA 4JUYA 2X51A 4I4TE 2MTQA 2ODUA 3OBVE 4JLEA 1YKHB 2RA1A 4CI2B 2D0TA 4E1TA 2HPLA 5KX5E 3GWHA 4FMSA 1GFQA 2ZM8A 4DO0A 5IHYA 5LJMA 1GFMA 3HL6A 3QRAA 3SYSA 2MHLA 3FXDB 2RP4A 5BMVE 1MM4A 5LGNB 4X1KE 3IF8B 1HTJF 1SA0E 2JPFA 3I1AA 5EK2A 4FZMA 3MACA 2J4UP 2XAFB 4P0BA 7PRNA 1T98A 3EMNX 4FJOA 3POQA 1HF8A 4GIWA 4PJMA 2XE3A 1O3XA 4ZOLE 3LBXA 2NP9A 4FRTA 3F57A 5D5DA 2PG8A 5FVNA 3ZN1B 3B13A 2W00A 4H9OC 2CEAA 1ZHZA 3UUMA 1WLXA 4JFBA 4O4JE 3PUAA 2DNXA 2H7VC 4PJJA 1WYCA 3HKEE 4AKHA 4ZI2D 4LSHA 3TZGA 3V5SA 3V5UA 2JMKA 2LEHA 2QA7A 5DJQC 3T20A 2XAJB 3G7GA 2X68A 2E9XB 4NUVA 3ZC1A 3T24A 4JCHA 3PQUA 4AKRA 5H6RB 4N58A 5CA0E 4AKIA 4AQFC 5DQWA 1V9DA 2LSGA 3T0SA 2VWAA 4ZI7E 4O3ZA 4BA9A 1HXXA 3N9NA 1P4TA 3RC8A 1THQA 1MMDA 4DVDA 2LHFA 4FESA 5ETWA 4CZZB 4GYSA 4XNKA 1H6S1 1BR2A 4AYMC 2E9XC 2XASB 2ZM0A 1QSDA 4GCSA 3LFMA 5HWYA 3VY9X 4O3YA 5FXWA 4L0RA 2XUEA 2XHEB 2KZ7A 2CCQA 2LHNA 2K5BB 4I55E 1MNEA 3BK9A 2D2SA 1S94A 1X79A 5HAXA 2H3RA 4MFRA 4AFKA 3DTOA 1KK7A 1HCIA 2BVLA 2CLYC 4C90A 3HWBA 2G0UA 4FSOA 1HX8A 3LK42 1HXUA 2LJLA 3SY9A 3ETVA 2C5JA 4AXPA 5L2LA 4RJXA 1US7B 5LOVE 4D5UA 4IDZA 4MBQA 2J1DG 5FXXA 2N2LA 3ZEFB 3P8CD 2K9AA 1OWAA 2XTQA 2ZLDA 3PU3A 3UULA 3HOLA 4O8SA 1AJ3A 3VZUX 3UT5E 2KXPB 4O2AE 1B7TA 3LBXB 4ZI3D 2CXDA 5FP3A 1ZEEA 3CX7B 2HPJA 2V7MA 4MALA 5IYZE 2CM0A 2QGSA 2MBGA 5JR9A 2FGRA 2WBLA 1ZHCA 2KINB 3W15B 2WMOA 2CE7A 2NTXA 2Q9QD 1WR6A 3MXZA 2O4VA 4AYEC 4G63A 4IE0A 1U5PA 2W0GA 1HFAA 4QQ1A 2B1EA 2MOZA 4IE6A 2LM9A 4HFVA 4ILUA 4XZCA 3R6NA 1MMGA 3I9YA 5JR9C 3CWZB 3NRYA 3LK2B 1FIOA 4B6XA 1QJPA 4ZS3A 2JMMA 4B61A 2YU2A 3ZMSB 3N2KE 3O1JA 3SOLA 3WAKA 4E7SA 1PRNA 1FEWA 4AYID 1OXZA 5EK4A 4PK6A 3GN5B 2V1DB 4EYYR 3AA6A 1LKXA 5L3GB 2MNHA 4U72A 1CUNA 4V1Av 2M07A 3N9LA 5LP6E 2WMNA 2LT3A 3C51A 4TN7B 5HYAA 3WAJA 2VB6A 4FOZA 5DL8A 4O4IE 3N9QA 5E0OA 5LGTB 2K24A 3CX8B 2UXXB 4QWNB 2ZFGA 3CKDA 3LK3A 2OA5A 3HI2A 2PJQA 1E1HB 3QK6A 4YJ3E 5FY0A 4TV8E 3VHLA 4EB6E 1D1BA 5EZYE 4K0UA 2QTKA 3HOEA 3QRCA 2CLYB 5L3EB 4H9QC 4PUXA 2WM9A 3C50A 1MIYA 2VK9A 2FGQX 2XE5A 3ETUA 5KMGP 1BT9A 3UTKA 4WNKA 1NWMX 2CXLA 3E08A 3ESLA 3KINB 4QKNA 3AA0A 1ZV4X 1ZKEA 1G8XA 1BH3A 3AVRA 5LGUB 2XAHB 5PRNA 2ZLYA 3CQGB 3EUHA 5FNVE 4PJNA 2EHOB 2JRKA 3CQCB 2E9XA 3PUGA 3N5LA 4NUUA 4GCPA 4N59A 3BQLA 4F6RC 5JDNA 4ASKA 4EIWA 5LNKA 1GFOA 3SYBA 5JRCA 4KR8A 5T5FA 4OHFA 4FZNA 1OPFA 4UV9B 5F8PA 3RH3A 4U9CA 3E22E 1IZNB 4O3WA 4UVAB 2VKHA 5LBMA 3RYHE 3AA7A 2Y0KA 5ADXK 2X9HA 3AAAB 3ZYLA 1MMAA 3N9PA 3J9X1 5ADXL 3VE1A 3H37A 4TV9E 1BR4A 2L3LA 5DQVA 1HG5A 2J1NA 2UXNB 4PFOA 5DL7A 4CXXA 3C4WA 4TX5A 3D0TA 2XQYA 3O4XE 2D0UA 1MIVA 2YEVC 5JDLA 3O1HA 4D64A 2VL8A 3HA4A 5G26A 5JDQA 2NW7A 5GV0A 3NZPA 4BJMA 2K0LA 2N2MA 2A2FX 1Q9FA 3GMIA 3T8OA 1BR0A 2YK0A 1PHOA 2OMFA 2N2NA 5M4YA 4AUIA 1UX5A 2LSKA 4OK0A 3RRWA 3V8UA 3A5XA 4ADZA 2C0SA 2VKOA 3Q9DA 3JC6C 4GOUA 1NAFA 3HKCE 2VKJA 3ZJ1A 4ERRA 5HXHA 2F1VA 4G75A 1Z0PA 3EDUA 1QJ9A 3PQSA 4GF4A 2ERVA 5FY7A 1VOMA 1BXWA 4CI3B 2YPVA 4FT6A 3OYXA 4UF0A 3ZMUB 3PUSA 3VZTX 2BZBA 3UUXB 3C4XA 2C5IT 3RRCA 2X9XA 5EK3A 3NRXA 2KDYA 2X27X 2IAKA 1VRBA 3AA7B 4M1PA 4UVCB 3PTRB 4JEUB 2E9XD 4X1IE 5FMNA 2XAQB 3I0OA 4DBRA 2K4TA 3DA4A 2LOSA 3AAEB 4O3XB 3ZC0A 4HKAA 3N2OA 4AYNA 4CXWA 2DI4A 3K19A 5JDFA 4EAHA 3ZLIA 1E54A 2W81C 2P9BA 2NTYA 5FY1A 4DMWA 3O9XA 4HE8A 2DHRA 1OSMA 2Q9QC 1WYBA 3ZN0B 4PNIA 2LOPA 3VU7H 5A1LA 5JDMA 3HKBE 3QC9A 3SWHA 2DCFA 3FXEB 2CWYA 3U78A 2Q9QB 5LYJE 2YNKA 2KNDA 3IBPA 3ZYMA 4AKLA 2JQQA 1HXTA 4KRAA 2LE8A 3ANWA 2H7OA 2NOXA 4QXBB 5DABA 2NW9A 3RBHA 8PRNA 3RC3A 1YW0A 1D1CA 4E1SA 4CXYA 3ZCJA 3H3AA 5LG4A 2PORA 4IE7A 4PFPA 3M65A 3PURA 5LCYA 4EXTA 6PRNA 2LSYA 2Y48B 4YHJA 5F3JA 3LK3B 1EZ3A 3SY7A 2KXPA 1UX4A 4O2BE 3O0EA 4UEMA 4AQGA 2EHOD 4KUMB 2LHRA 5LJNA 3MA9A 3Q5XA 2F1TA 4LSIA 3HW9A 2PFVA 3VZWX 1S35A 4QXCB 3K8PC 5EE2A 1IJ5A 4J2CA 1IJ6A 2X9WA 4OYKA 2XTRA 4UVBB 4GK5E 2LSIA 3LG7A 5JH7E 2I59A 4H63V 3CQXC 3P7IA 4I43B 4UIGA 3Q2MA 5LXTE 4AQFA 3GP6A 3AVSA 2V7JA 4C91A 1GFNA 4O49A 2DWKA 2ACXA 4WW0A 1MIWA 3ONXA 4UF0B 1YKEB 3PDYA 3SS1A 5L3CB 5J1GA 5LHGB 4O4HE 5L3DB 4TUYE 3AAAA 2KLQA 3EVYA 4H9PC 4HEAA 1D1AA 3IHRA 2ES0A 2WSSV 4XAXB 3F2EA 3FBZA 3VE2A 3KVBA 5C8YE 2Y7SA 2KT9A 4HTEA 5HXCA 5L3BB 5J2UE 2X9YA 3B57A 4ANJA 3KBUA 4ISSA 4TZ4C 3UUNA 4DMVA 1Q9GA 4EZ4A 3AAEA 3C4ZA 4AYDC 4O4XA 3PRNA 2KWIB 3N2GE 1GFPA 3A2SX 2CWOA 3GN5A 4WBOA 4FSPA 3RPUA 2VASA 3CMLA 4OFZA 4AKRB 2KC0A 3UAQA 4IHJE 3FBLA 3SZVA 4I50E 4F4BA 2NW8A 2V7IA 2YINA 4N78D 3R84B 5CB4E 3J7Yq 2Z6EA 3KV6A 4UV8B 2DWGA 3DA3A 4RL9A 4XBFB 2Y0LA 2IC9A 5HXSA 2XMXA 1MM5A 2V7KA 4AZLA 4QHOA 3FB2A 1MNDA 3DJBA 3S4UA 5LA6E 4UXNB 4X1YE 3POXA 4FUVA 3KV4A 2X66A 1QUUA 2IC6A 2JMHA 2M67A 4QX8B 5HWXA 4E7ZA 3ZCIA 2C5KT 2Q9QA 4EZHA 1ZHXA 4DBQA 3OYZA 2LSJA 1UCUA 3LJCA 2X67A 4P0AA 2Y0HA 4FRXA 5JDHA 2D5UA 3BQIA 3JC6D 4OYJA 5H6QB 5CA1E 3KBTA 4EYUA 2KMFA 1D0ZA 4MLKA 2M06A 3OKQA 2PRNA 1LRZA 2WWUA 3QUJA 1ORMA 1FMWA 2X0LB 4QXHB 2NWBA 3NBXX 4Z8XA 5JQGE 3ZMTB 3VKGA 1QJ8A 3UU2A 3WI4A 4AKMA 4YJ2E 3ZMZB 3KV5A 4C69X 3Q5WA 4HN9A 2KZ7B 2GK9A 3PORA 3N9OA 2V7LA 4A56A 3N9MA 4QX7B 3AB3B 3AAIA 5JVDE 3JTYA 2GE4A 3DP7A 1ZHWA 3RX6A 5DL6A 2ZMAA 4RJWA 2L9QA 2V26A 1G73A 3RYIE 4IIJE 3NZQA 5JR9B 3CVRA 3WI3A 3ZYKA 4YLHA 3ZMVB 3UPGA 4O4UA 1HG2A 5KDMC 3K3NA 5JREA 1FMVA 2XTLA 2N1GA 4AKGA 2EHOA 2W62A 2XE2A 3C98B 3BQKA 4KBMB 1YS5A 3LK41 1D0YA 5AFUL 2W61A 3UFEA 4PJLA 4ZI2C 3PUQA 3AA1B 3E0ZA 4H9RC 2W63A 2BDEA 3LK2A 3PE0A 3FYXA 3KFWX 3AA1A 4XNLA 4H63H 3HKDE 3OJAA 5LBQB 5LHIB 4ISTA 4KMCA 3KVAA 3I9WA 2N9DA 2XG6A 5L3FB 4G76A 2WAUA 4CQIA 3RYFE 3VY8X 3GA8A 3KV9A 3SZDA 4RLBA 1IZNA 3TKLB 5HXEA 4PW8A 1IAPA 3RKOA 4WBNE 1Y64B 5JRCB 5J2TE 2W80C 4IE4A 5IYUA 5FXZA 4IE5A 2PBIA 2VKDA 3MZKB 2YU1A 4ZS2A 5HXRA 4O4LE 3FHNA 4X20E 1MPFA 4BAYB 4RLCA 4U74A 4PK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXP B;  3AA6 B;  3AAE A;  5AFU K;  2KZ7 A;  3AA0 B;  3LK3 A;  4AKR B;  3AA7 B;  3LK3 B;  1IZN A;  2KXP A;  3AAE B;  4AKR A;  3LK4 1;  5AFU L;  3LK4 2;  3AAA A;  1IZN B;  3AA1 B;  3LK2 B;  3AA7 A;  5ADX K;  2KZ7 B;  3AAA B;  3AA1 A;  3AA0 A;  5ADX L;  3LK2 A;  3AA6 A; 
#chains in the Genus database with same CATH topology
 4FZL A;  2CXF A;  5AQH B;  2JJ9 A;  3FZM B;  2EHO C;  3POU A;  3C5O A;  3C64 A;  2HN2 A;  5AQR B;  4LSE A;  3IEE A;  1SHZ C;  4JBW F;  2ZM2 A;  4CI1 B;  2SPC A;  1BR1 A;  2XQ7 A;  2Y2X A;  3PU8 A;  2WQY A;  4L5G A;  5FYM A;  5G38 A;  2XE1 A;  1KNZ A;  5FKY A;  4TNV A;  5AFU K;  3AA6 B;  4YSX A;  2A72 A;  3ZJ2 A;  2YN6 A;  4HGA A;  1H7C A;  3KDS E;  4D65 A;  2MYS A;  3VKH A;  4AIS A;  2CMR A;  3JAF A;  4BUM X;  4PK4 A;  1MMN A;  4ILC A;  2E2A A;  4G2A A;  3SRZ A;  3AE1 A;  1N34 T;  2YOE A;  2MTQ A;  5KAF O;  1YKH B;  4FMS A;  4DO0 A;  5IHY A;  2VVN A;  2MHL A;  3AEA A;  1MM4 A;  3I1A A;  4IDO A;  4P0B A;  3EMN X;  4EEB A;  3WU2 O;  3AE2 A;  1J1J A;  3LBX A;  1WLX A;  2WJR A;  3PUA A;  2DNX A;  2R6G F;  4DID B;  3HKE E;  3V5S A;  2K3W A;  2XQ6 A;  3LSV A;  2V6X A;  2E9X B;  4NUV A;  3ZC1 A;  4JCH A;  4LF8 T;  4AQF C;  1V9D A;  2LSG A;  1W0A A;  4BA9 A;  1HXX A;  3N9N A;  4ZZC A;  4DVD A;  4GYS A;  4AYM C;  5LMN T;  3P4W A;  3LFM A;  2LRK A;  2XUE A;  4HWI B;  2UUB T;  1MNE A;  3BK9 A;  4KX6 A;  1I6Z A;  4CN4 A;  2H3R A;  4LFA T;  2BVL A;  4C90 A;  2G0U A;  4B3S T;  4FSO A;  2LJL A;  3SY9 A;  2C5J A;  4RJX A;  4IDZ A;  4MBQ A;  2XJ7 A;  3VRB A;  1OWA A;  4NPP A;  2JQ9 A;  3UUL A;  2CRB A;  3UT5 E;  1B7T A;  1YQ3 A;  4ZI3 D;  2V7M A;  4MAL A;  5IYZ E;  2CM0 A;  4JI3 T;  2FGR A;  2WBL A;  2Q9Q D;  1WR6 A;  4AYE C;  1U5P A;  2W0G A;  2B1E A;  4DR3 T;  1MMG A;  3I9Y A;  2XM1 A;  4UB8 O;  1QJP A;  4U2Z A;  3N2K E;  3O1J A;  3SOL A;  1PRN A;  2V5C A;  5AQS B;  1OXZ A;  3P4S A;  5EK4 A;  4PK6 A;  4EYY R;  5HEH A;  5L3G B;  4V1A v;  3N9L A;  3AEB A;  3WAJ A;  4A98 A;  1HR0 T;  2UXX B;  2ZFG A;  3HI2 A;  1E1H B;  4EB6 E;  1HX1 B;  3PV0 F;  4K0U A;  2QTK A;  3QRC A;  2CLY B;  3AE9 A;  3ETU A;  2BS4 A;  3UTK A;  1NWM X;  2CXL A;  3ESL A;  3AA0 A;  5LGU B;  5AQJ B;  2UUA T;  5PRN A;  2UUC T;  4X65 T;  2XM2 A;  2BBJ A;  4NUU A;  2BKO A;  3BQL A;  5JDN A;  5LNK A;  4KHZ F;  1W0B A;  1X9B A;  5JRC A;  2KSR A;  4I0U A;  4KR8 A;  5T5F A;  4FZN A;  1OPF A;  4UV9 B;  3ZSS A;  3TLW A;  2E5L T;  5LB7 B;  3E22 E;  5LBM A;  3AA7 A;  5ADX K;  4DV2 T;  3ZYL A;  2H89 A;  3PGS A;  1MMA A;  3J9X 1;  3UQ7 A;  3H37 A;  1M62 A;  1KNP A;  5DQV A;  2UXN B;  4CXX A;  2D0U A;  5JDL A;  3O1H A;  2VL8 A;  3HA4 A;  2NW7 A;  4BJM A;  2K0L A;  2N2M A;  4JI2 T;  3PF1 A;  3RGL A;  1BR0 A;  2OMF A;  1UX5 A;  3RRW A;  3A5X A;  3JC6 C;  4GOU A;  1NAF A;  4JI5 T;  2F1V A;  3PQS A;  4JI1 T;  2XQA A;  4CI3 B;  3ZMU B;  2BG9 A;  3C4X A;  3RRC A;  3NRX A;  2XAQ B;  2K4T A;  2LOS A;  3AAE B;  3ZC0 A;  2LRL A;  4AYN A;  3K19 A;  3ZLI A;  2W81 C;  2NTY A;  2YDS A;  5FY1 A;  4HE8 A;  1OSM A;  5JDM A;  1WYB A;  5A1L A;  3QC9 A;  3SWH A;  2DCF A;  2Q9Q B;  5LYJ E;  2YNK A;  2KND A;  1HXT A;  2JQQ A;  2BG9 B;  8PRN A;  2POR A;  2UU9 T;  4DV3 T;  2Y48 B;  4KI0 F;  2B76 A;  1UX4 A;  4YXD A;  2F1T A;  1S35 A;  1IJ5 A;  1IJ6 A;  2X9W A;  4GK5 E;  2LSI A;  2WDR A;  4H63 V;  4UIG A;  4AQF A;  1CHU A;  3PUZ F;  1MIW A;  3ONX A;  4UF0 B;  4YHH T;  3AAA A;  3EVY A;  4IDN A;  4XAX B;  5C8Y E;  3AE5 A;  5J2U E;  2X9Y A;  4ANJ A;  4DMV A;  2WZH A;  3N2G E;  3UAQ A;  2VAS A;  4AKR B;  5FVL A;  5E79 O;  3A0B O;  3R84 B;  4RL9 A;  5CB4 E;  3J7Y q;  3DA3 A;  4TWD A;  2DWG A;  2Y0L A;  4AZL A;  4QHO A;  4UXN B;  4X1Y E;  3POX A;  2M67 A;  4E7Z A;  4Z90 A;  3ZCI A;  3DWN A;  3OYZ A;  2LSJ A;  4FRX A;  2LLY A;  3KBT A;  4EYU A;  2M06 A;  4EED A;  4Z8X A;  2XQ9 A;  3WI4 A;  4HWD A;  4QH5 A;  3ZMZ B;  3PJA J;  4HN9 A;  2GK9 A;  3POR A;  4A56 A;  4QX7 B;  4EV6 A;  3AB3 B;  1SUM B;  3RYI E;  2BS3 A;  5JR9 B;  2WWV A;  1HG2 A;  2HHH T;  4U2Y A;  4TNW A;  2XE2 A;  3LK4 1;  1UUR A;  3UFE A;  4PJL A;  3RLF F;  1HNZ T;  4IDP A;  3PE0 A;  4U3C A;  3M3Z B;  4DV0 T;  5H2F O;  5LBQ B;  5LHI B;  4IST A;  4KMC A;  2ZM6 T;  4NIQ A;  2N9D A;  2XG6 A;  4ILA A;  3SZD A;  4ZEY A;  3QNU A;  5LG3 A;  4RLB A;  3SFD A;  2R4O A;  4LF4 T;  1ZOY A;  3UU4 A;  4U31 A;  5AQT B;  2IUB A;  2FJA A;  1MPF A;  4PK5 A;  3EAM A;  4BJN A;  4FI5 A;  1G90 A;  2ODV A;  3K3O A;  3AE3 A;  4EOZ B;  1KEY A;  1Z8U A;  3CPZ A;  4AI6 A;  4KP3 C;  1WRD A;  4HFD A;  3U3I A;  4KR4 A;  2XY8 B;  2BG9 C;  2JQH A;  4H9N C;  5LHH B;  1YD8 G;  2DLR A;  3K3Q C;  3L3P A;  3CX6 B;  5HCM A;  5TAO A;  2LFU A;  3HR0 A;  4UEL A;  4MHC A;  4LML A;  2YDR A;  2Y6X A;  4JEH B;  5CJ5 A;  3ZPO A;  4L9I A;  1UUS A;  2X51 A;  3OBV E;  5KX5 E;  3GWH A;  1IBK T;  5LJM A;  3HL6 A;  2RP4 A;  3AE4 A;  5BMV E;  5LGN B;  2J4G A;  4X1K E;  1HTJ F;  2JPF A;  5EK2 A;  3MAC A;  2XAF B;  3POQ A;  1HF8 A;  4GIW A;  2QRX A;  3K1S A;  5KAI O;  1YQ4 A;  3F57 A;  2PG8 A;  5ABH A;  3UUM A;  4PJJ A;  1WYC A;  4AKH A;  4ZI2 D;  4LSH A;  3ONL C;  2JMK A;  1XNR T;  2LEH A;  2QA7 A;  5DJQ C;  1N36 T;  2XAJ B;  3T20 A;  3G7G A;  5CA0 E;  4K3B A;  5DQW A;  3T0S A;  2VWA A;  4O3Z A;  1THQ A;  5ETW A;  1KNR A;  2E9X C;  2XQ8 A;  4GCS A;  3VY9 X;  1M7K A;  2XHE B;  1GQE A;  4I55 E;  2D2S A;  1X79 A;  4MFR A;  1J5E T;  4CN1 A;  3DTO A;  3HWB A;  1HX8 A;  1HNW T;  2CHN A;  4YSY A;  5L2L A;  1US7 B;  5FXX A;  2N2L A;  3ZEF B;  3P8C D;  3PJA A;  2ZLD A;  2XTQ A;  3PU3 A;  3FZK B;  1AJ3 A;  2AXT O;  3QB5 K;  3LBX B;  2CXD A;  3CX7 B;  2HPJ A;  1ZHC A;  2CE7 A;  4QH1 A;  2O4V A;  4G63 A;  4IE0 A;  1HFA A;  4IE6 A;  3R6N A;  4ILU A;  4GKK T;  5EE2 A;  3HOL A;  1T7S A;  2YU2 A;  5LMU T;  4K3C A;  1FEW A;  4CTD A;  2XZE A;  1XNQ T;  2MNH A;  5LP6 E;  4P1N A;  2WMN A;  5HYA A;  2AE9 A;  5DL8 A;  5LGT B;  2K24 A;  3LK3 A;  2R4P A;  2OA5 A;  3VHL A;  4HWC A;  4H9Q C;  2WM9 A;  3C50 A;  2FGQ X;  4AIU A;  4YTP A;  1BT9 A;  3RQU A;  3KIN B;  3NKZ A;  3X1D A;  3AVR A;  2WB5 A;  3EUH A;  5IUX A;  2EHO B;  4GCP A;  4TWH A;  4F6R C;  2FJB A;  5L4H A;  2YKS A;  5F8P A;  4PR7 A;  1IZN B;  4UVA B;  3RYH E;  3AE6 A;  3VR9 A;  2Y0K A;  1XDO A;  2X9H A;  5ADX L;  4PJ0 O;  1S5L O;  2R89 A;  2XQY A;  2YEV C;  3ZT6 A;  5JDQ A;  1PHO A;  4AUI A;  5FL0 A;  4OK0 A;  4HFC A;  4DUY T;  3CK6 A;  3V8U A;  2VKO A;  4WZX A;  3ZJ1 A;  4U7Y A;  1QJ9 A;  2H88 A;  5FL1 A;  1VOM A;  1BXW A;  1XWM A;  4FT6 A;  4UR9 A;  3VZT X;  2BZB A;  2C5I T;  3SFE A;  5EK3 A;  3AA7 B;  2W4X A;  4DBR A;  3DA4 A;  3N2O A;  4CXW A;  2DI4 A;  1E54 A;  2P9B A;  5KXJ A;  3O9X A;  2VVS A;  4JI4 T;  4PNI A;  2LOP A;  3VU7 H;  2WVP A;  4AFK A;  4FZM A;  4AKL A;  4C4V A;  3ZYM A;  3RBH A;  4B3M T;  3ANW A;  4QXB B;  3RC3 A;  4CXY A;  3ZCJ A;  5CFB A;  5LG4 A;  4IE7 A;  4PFP A;  3PGR A;  3M65 A;  3AE7 A;  3LK3 B;  4DV1 T;  3EHZ A;  2V6Y A;  5AQM B;  5HEU A;  3FZH B;  3PUV F;  5LJN A;  3MA9 A;  4J2C A;  4UVB B;  2DL1 A;  4JI7 T;  5LXT E;  3VR8 A;  3EI0 A;  2V7J A;  1GFN A;  4O49 A;  2DWK A;  4CN6 A;  5L3C B;  1YKE B;  3PDY A;  3CIR A;  4TUY E;  2KLQ A;  2JQK A;  2I6H A;  3IHR A;  2WSS V;  3A8Y C;  3F2E A;  4DV4 T;  3VE2 A;  2KT9 A;  2LM2 A;  2W67 A;  3B57 A;  3KBU A;  3RQW A;  4TZ4 C;  3UUN A;  4AYD C;  1Q9G A;  4EZ4 A;  4O4X A;  2FJD A;  3PRN A;  2BS2 A;  4IHJ E;  3FBL A;  4I50 E;  4F4B A;  4N78 D;  4XBF B;  4HFE A;  2XMX A;  2V7K A;  3FB2 A;  3DJB A;  3KV4 A;  2X66 A;  2C5K T;  3ABV A;  5B5E O;  2HN1 A;  4C00 A;  3LJC A;  2X67 A;  2OV9 A;  4DV5 T;  5JDH A;  2D5U A;  3JC6 D;  1N33 T;  2KMF A;  5AQN B;  4ZXL A;  1LRZ A;  2FBW A;  2X0L B;  2R4N A;  1NEK A;  5JQG E;  4AKM A;  3KV5 A;  4C69 X;  3T1H T;  3N9M A;  3UFG A;  3AAI A;  2AXD S;  5DL6 A;  2V26 A;  3CVR A;  3WI3 A;  3ZMV B;  3K3N A;  4LMJ A;  4AKG A;  3C98 B;  5AQP B;  5ABF B;  4JI0 T;  3BQK A;  5AFU L;  3PUQ A;  3AA1 B;  3KVA A;  4X66 T;  1JNZ A;  5L3F B;  4G76 A;  3RF1 A;  3RYF E;  3RKG A;  3KV9 A;  1IZN A;  4PW8 A;  3QOF A;  3OTO T;  5B66 O;  3ZST A;  3RIF A;  5IYU A;  3PUW F;  4X20 E;  5AQU B;  2X0Y A;  5GTH O;  3TLV A;  1HS7 A;  4YTN A;  1XDP A;  2M6I A;  2CHO A;  3KVD D;  4GHB A;  2XAG B;  1ZHY A;  3MKD A;  3MK7 C;  4JV5 T;  2HH7 A;  1LVF A;  2IW5 B;  1OED B;  2IWV A;  3I0Q A;  2MAW A;  3BS0 A;  4ZHQ E;  2UXB T;  1ZP0 A;  3AEC A;  1J5W A;  3NSG A;  5FXV A;  2IML A;  2KWH A;  2XQ5 A;  4DND A;  4JUY A;  4I4T E;  2ODU A;  4CI2 B;  2D0T A;  5AQQ B;  4LF9 T;  2ZM8 A;  1L0V A;  3IF8 B;  4IL6 O;  7PRN A;  5G3A A;  4FJO A;  3BRY A;  5ABF A;  3FZF B;  2XE3 A;  1O3X A;  3UU6 A;  5FVN A;  3ZN1 B;  3B13 A;  2W00 A;  4H9O C;  1ZHZ A;  4O4J E;  2OLT A;  2H7V C;  3TZG A;  4HFH A;  3V5U A;  2X68 A;  3T24 A;  3PQU A;  4AKI A;  4LFB T;  5GTI O;  1P4T A;  5AQV B;  1MMD A;  4FES A;  4IT4 A;  4CZZ B;  1H6S 1;  1BR2 A;  1QSD A;  2ZM0 A;  5FXW A;  2WZI A;  3RIA A;  2LHN A;  2K5B B;  4NXM T;  1S94 A;  5HAX A;  5JTG A;  2JQY A;  2CLY C;  2FUP A;  3LK4 2;  1HXU A;  4C4V B;  2R4L A;  2J1D G;  3PGU A;  3VZU X;  1ZEE A;  2MBG A;  2QGS A;  3TLT A;  3W15 B;  2NTX A;  2WU2 A;  5JR9 C;  2LM9 A;  2JMM A;  4B61 A;  3LK2 B;  1FIO A;  4ZS3 A;  4JI6 T;  3WAK A;  4N74 A;  3GN5 B;  5FVK A;  2X0H A;  3AA6 A;  1LKX A;  4DV6 T;  1CUN A;  2LT3 A;  3C51 A;  4TN7 B;  4FOZ A;  2VB6 A;  2BKP A;  5E0O A;  4LMK A;  4QWN B;  3CKD A;  4JFB A;  2PJQ A;  3QK6 A;  5FY0 A;  4TV8 E;  1T8B A;  3HOE A;  5L3E B;  4PUX A;  4LF7 T;  2VK9 A;  5KMG P;  4WNK A;  3E08 A;  4QKN A;  3JCU O;  1ZV4 X;  1ZKE A;  1G8X A;  1E7P A;  1BH3 A;  1QLB A;  5FNV E;  4PJN A;  2JRK A;  3H3M A;  2E9X A;  2LKH A;  3N5L A;  3PUG A;  4N59 A;  3SYB A;  2V6Y B;  4OHF A;  1IBL T;  3RH3 A;  4U9C A;  4O3W A;  5ABE A;  2VKH A;  4IL4 A;  5IWA T;  3AAA B;  4TWF A;  2WU5 A;  3N9P A;  1WFD A;  1BR4 A;  2L3L A;  2J1N A;  1FJG T;  4TX5 A;  3D0T A;  3P4Q A;  3O4X E;  1MIV A;  3P4P A;  2CPT A;  5GV0 A;  2A2F X;  3GMI A;  3T8O A;  4A5X A;  3Q9D A;  2WY2 A;  3JCF A;  4ERR A;  4G75 A;  5HEJ A;  2J47 A;  2ERV A;  4NXN T;  5FY7 A;  2YPV A;  3OYX A;  3PUS A;  3UUX B;  5G39 A;  2KDY A;  2X27 X;  2IAK A;  1VRB A;  4M1P A;  3PTR B;  4JEU B;  4X1I E;  3I0O A;  5HEO A;  4HKA A;  5JDF A;  4B3R T;  4DMW A;  2DHR A;  2Q9Q C;  3ZN0 B;  1T1L A;  3LK2 A;  3IBP A;  4GKJ T;  4KRA A;  1YW0 A;  4E1S A;  4DR6 T;  4LFC T;  1W09 A;  4YHJ A;  5F3J A;  5AQK B;  3SY7 A;  2KXP A;  2M6B A;  4UEM A;  4KUM B;  3Q5X A;  4LSI A;  2PFV A;  4QXC B;  4OYK A;  2XTR A;  3LG7 A;  3P7I A;  4I43 B;  2CBJ A;  1JNR A;  3AVS A;  4ZZB A;  5L3D B;  2A9U A;  1XMQ T;  4HEA A;  4KHP T;  2Y7S A;  4HTE A;  5L3B B;  3BRZ A;  4JI8 T;  3NVO A;  3AAE A;  3C4Z A;  1GFP A;  3Q5E A;  3A2S X;  2CWO A;  3GN5 A;  4WBO A;  4FSP A;  3CML A;  4OFZ A;  5CGM A;  4DR7 T;  2NW8 A;  2V7I A;  2YIN A;  4UV8 B;  2WDV A;  5HXS A;  1MND A;  3OPC A;  1VCS A;  3S4U A;  5LA6 E;  4FUV A;  1QUU A;  2IC6 A;  2FJE A;  4EZH A;  4DBQ A;  2QVA A;  1UCU A;  2IIU A;  2QYW A;  5H6Q B;  4AQY T;  4OYJ A;  1W9R A;  1KFY A;  2WWU A;  3QUJ A;  3AE8 A;  4DR5 T;  1FMW A;  4QXH B;  2NWB A;  4IDQ A;  1SE7 A;  3UU2 A;  1QJ8 A;  3ZMT B;  2KZ7 B;  3AXJ B;  3P50 A;  3N9O A;  2V7L A;  4ILB A;  3OVU A;  1T72 A;  5JVD E;  3IA3 A;  4N75 A;  3DP7 A;  3RX6 A;  2ZMA A;  2L9Q A;  3NZQ A;  3UPG A;  4O4U A;  5JRE A;  1Y01 A;  1FMV A;  2XTL A;  1DU2 A;  2N1G A;  3ONJ A;  1D0Y A;  2W61 A;  2LKG A;  5AQO B;  2W63 A;  2R88 A;  3AA1 A;  4XNL A;  4H63 H;  3A7M A;  3OJA A;  1HNX T;  3G06 A;  2W66 A;  2WS3 A;  4CQI A;  3VY8 X;  3TLU A;  3RKO A;  4WBN E;  1Y64 B;  2W80 C;  4IE4 A;  4IE5 A;  2PBI A;  3MZK B;  5HXR A;  4HFI A;  3FHN A;  5AQL B;  3O1I A;  2UXD T;  2ODJ A;  5JDG A;  4YFS A;  5GON E;  3WI5 A;  3AA0 B;  4GCQ A;  1ZHT A;  4WYV A;  3AEG A;  2A3D A;  4HWH A;  4ZI3 C;  3ANW B;  3RYC E;  3RI5 A;  3EDV A;  2E8I A;  3T1Y T;  4LSF A;  3AEE A;  4IGU A;  1U4Q A;  1D0X A;  5J0Z A;  2BVM A;  1OED A;  3L09 A;  1R8I A;  4H9S E;  4PAG A;  2CA5 A;  3F31 A;  4Z3T A;  1LVK A;  3RIU A;  4GK0 E;  2K48 A;  2L8K A;  1VCT A;  1N32 T;  3PUX F;  2XPK A;  3VRA A;  3MJX A;  4P09 A;  5JDP A;  5DL5 A;  2Y8D A;  4GYR A;  4JLE A;  2RA1 A;  4E1T A;  2HPL A;  1GFQ A;  2XQ4 A;  3QRA A;  3SYS A;  4YT0 A;  3FXD B;  1SA0 E;  2J4U P;  2IDO B;  1T98 A;  4PJM A;  4ZOL E;  4IL9 A;  5D5D A;  2NP9 A;  4FRT A;  3DWO X;  3UU3 A;  4Q25 A;  2CEA A;  3UU5 A;  2I0M A;  5HCJ A;  5AQG B;  1OED E;  4JYA T;  4AKR A;  5H6R B;  4N58 A;  4ZI7 E;  2E5V A;  3RC8 A;  2LHF A;  2D9D A;  4XNK A;  2RPA A;  2XAS B;  5HWY A;  4O3Y A;  3A0H O;  4L0R A;  2BKN A;  2KZ7 A;  2CCQ A;  3AXJ A;  5C3J A;  4X5T A;  2JIW A;  3Q5D A;  1KK7 A;  1HCI A;  4B3T T;  3ETV A;  4AXP A;  4D5U A;  5LOV E;  2BBH A;  4YTM A;  2YDQ A;  3P4R A;  2K9A A;  2UXC T;  5F5W A;  4O8S A;  5AQI B;  2KXP B;  1YXR A;  4O2A E;  5FP3 A;  5JR9 A;  2KIN B;  1WR0 A;  2WMO A;  3QB5 A;  3MXZ A;  5L47 A;  3AEF A;  4DV7 T;  4QQ1 A;  2MOZ A;  4XZC A;  4HFV A;  3CWZ B;  3NRY A;  4B6X A;  3ZMS B;  4E7S A;  4AYI D;  4QH4 A;  1OED C;  2V1D B;  2NR4 A;  4U72 A;  2M07 A;  4U33 A;  2XSA A;  4O4I E;  3N9Q A;  3CX8 B;  3L8R A;  4YJ3 E;  1D1B A;  5EZY E;  2CBI A;  1MIY A;  4YY3 T;  2XE5 A;  2XAH B;  4F8H A;  4A97 A;  4K0K T;  2ZLY A;  2F4V T;  3CQG B;  3UUB A;  3CQC B;  1UK5 A;  2V8S V;  4ASK A;  4EIW A;  1GFO A;  4LF6 T;  4U7I A;  3B5M A;  3PUY F;  4YSZ A;  2W2U A;  3VE1 A;  4TV9 E;  1HG5 A;  4PFO A;  5DL7 A;  3NWI A;  3C4W A;  4D64 A;  2WJQ A;  5G26 A;  3NZP A;  4DR4 T;  1Q9F A;  2YK0 A;  2N2N A;  5M4Y A;  5BR8 T;  2LSK A;  5ABG A;  3TLS A;  4ADZ A;  2C0S A;  3HKC E;  2VKJ A;  4EGW A;  5HXH A;  1Z0P A;  3EDU A;  3JAD A;  4GF4 A;  2X9K A;  1T16 A;  3UU8 A;  4UF0 A;  4DR1 T;  2VQE T;  2X9X A;  4UB6 O;  4UVC B;  2E9X D;  5FMN A;  4O3X B;  5C2T A;  4EAH A;  1XZY A;  2WP9 A;  5TIS O;  3HKB E;  3FXE B;  2CWY A;  3U78 A;  4IRE A;  2LE8 A;  3ZKR A;  2H7O A;  2NOX A;  5DAB A;  2NW9 A;  1D1C A;  3H3A A;  4OX9 T;  1IBM T;  3PUR A;  5LCY A;  2VL0 A;  4EXT A;  6PRN A;  3AED A;  2LSY A;  4HFB A;  1EZ3 A;  4O2B E;  3O0E A;  4AQG A;  4FQE A;  2EHO D;  2LHR A;  2MPK A;  3HW9 A;  3VZW X;  3K8P C;  3JAE A;  2F1C X;  3NJT A;  3RIU C;  5JH7 E;  2I59 A;  3CQX C;  3ZT7 A;  3DZM A;  3Q2M A;  3GP6 A;  4Z91 A;  4C91 A;  2ACX A;  4WW0 A;  1GFM A;  5LHG B;  3SS1 A;  5J1G A;  4O4H E;  4H9P C;  3EAB A;  1D1A A;  3LDQ B;  2ES0 A;  2R8A A;  3FBZ A;  3KVB A;  4LF5 T;  3FZL B;  5HXC A;  4ISS A;  3ZT5 A;  2KWI B;  4HWF A;  3RPU A;  2KC0 A;  3SZV A;  2XQ3 A;  2IHR 1;  2Z6E A;  3KV6 A;  3UQ4 A;  2IC9 A;  1MM5 A;  1KF6 A;  5HWX A;  2JMH A;  4QX8 B;  1E2A A;  3L39 A;  2Q9Q A;  1ZHX A;  2J62 A;  4P0A A;  2Y0H A;  5AQF B;  3BQI A;  5CA1 E;  4DUZ T;  1D0Z A;  4MLK A;  3OKQ A;  2PRN A;  1WCR A;  2VQF T;  1UGO A;  4X64 T;  1ORM A;  3NBX X;  3VKG A;  4YJ2 E;  3Q5W A;  3JTY A;  2GE4 A;  1ZHW A;  2WCA A;  4RJW A;  1G73 A;  2WDQ A;  4IIJ E;  3ZYK A;  4YLH A;  5KDM C;  2BG9 E;  4X62 T;  1I94 T;  4COF A;  2EHO A;  2W62 A;  1YS5 A;  4KBM B;  2XSB A;  4ZI2 C;  5L4E A;  3E0Z A;  3KZI O;  4H9R C;  2PTF A;  2BDE A;  3FYX A;  3KFW X;  3RHW A;  3HKD E;  3I9W A;  2WAU A;  3GA8 A;  2IWW A;  3TKL B;  5HXE A;  1IAP A;  5JRC B;  5J2T E;  4DR2 T;  2V5D A;  1XMO T;  5FXZ A;  2VKD A;  1NEN A;  2YU1 A;  4ZS2 A;  4O4L E;  2VUR A;  2ACZ A;  4BAY B;  5HEG A;  4RLC A;  4U74 A; 
#chains in the Genus database with same CATH homology
 4FZL A;  2CXF A;  3O1I A;  2ODJ A;  5JDG A;  4YFS A;  2JJ9 A;  4BJN A;  4FI5 A;  5GON E;  1G90 A;  1HS7 A;  3WI5 A;  2EHO C;  3POU A;  3AA0 B;  4GCQ A;  1ZHT A;  2ODV A;  3C5O A;  3C64 A;  3K3O A;  3KVD D;  4EOZ B;  4GHB A;  2A3D A;  4LSE A;  3IEE A;  1SHZ C;  2XAG B;  3CPZ A;  2ZM2 A;  4CI1 B;  4AI6 A;  4KP3 C;  2SPC A;  1WRD A;  4ZI3 C;  1ZHY A;  3MKD A;  1BR1 A;  3ANW B;  3MK7 C;  3RYC E;  2HH7 A;  3U3I A;  2Y2X A;  3PU8 A;  4L5G A;  3EDV A;  2E8I A;  1LVF A;  2IW5 B;  5FYM A;  4KR4 A;  2XE1 A;  1KNZ A;  4LSF A;  4IGU A;  1U4Q A;  1D0X A;  3I0Q A;  4H9N C;  5LHH B;  2BVM A;  1YD8 G;  2DLR A;  3L09 A;  3AA6 B;  3K3Q C;  3L3P A;  5AFU K;  3CX6 B;  4ZHQ E;  5TAO A;  2LFU A;  4H9S E;  2A72 A;  3HR0 A;  4PAG A;  4UEL A;  2CA5 A;  3F31 A;  4Z3T A;  3ZJ2 A;  1LVK A;  4MHC A;  4GK0 E;  2K48 A;  1H7C A;  4HGA A;  2L8K A;  3KDS E;  4D65 A;  2MYS A;  3VKH A;  2CMR A;  3NSG A;  4BUM X;  4PK4 A;  5FXV A;  1MMN A;  3MJX A;  2Y6X A;  2KWH A;  4P09 A;  4JEH B;  5JDP A;  5DL5 A;  2Y8D A;  4G2A A;  3SRZ A;  3ZPO A;  4DND A;  4GYR A;  4L9I A;  4JUY A;  2X51 A;  4I4T E;  2MTQ A;  2ODU A;  3OBV E;  4JLE A;  1YKH B;  2RA1 A;  4CI2 B;  2D0T A;  4E1T A;  2HPL A;  5KX5 E;  3GWH A;  4FMS A;  1GFQ A;  2ZM8 A;  4DO0 A;  5IHY A;  5LJM A;  1GFM A;  3HL6 A;  3QRA A;  3SYS A;  2MHL A;  3FXD B;  2RP4 A;  5BMV E;  1MM4 A;  5LGN B;  4X1K E;  3IF8 B;  1HTJ F;  1SA0 E;  2JPF A;  3I1A A;  5EK2 A;  4FZM A;  3MAC A;  2J4U P;  2XAF B;  4P0B A;  7PRN A;  1T98 A;  3EMN X;  4FJO A;  3POQ A;  1HF8 A;  4GIW A;  4PJM A;  2XE3 A;  1O3X A;  4ZOL E;  3LBX A;  2NP9 A;  4FRT A;  3F57 A;  5D5D A;  2PG8 A;  5FVN A;  3ZN1 B;  3B13 A;  2W00 A;  4H9O C;  2CEA A;  1ZHZ A;  3UUM A;  1WLX A;  4JFB A;  4O4J E;  3PUA A;  2DNX A;  2H7V C;  4PJJ A;  1WYC A;  3HKE E;  4AKH A;  4ZI2 D;  4LSH A;  3TZG A;  3V5S A;  3V5U A;  2JMK A;  2LEH A;  2QA7 A;  5DJQ C;  3T20 A;  2XAJ B;  3G7G A;  2X68 A;  2E9X B;  4NUV A;  3ZC1 A;  3T24 A;  4JCH A;  3PQU A;  4AKR A;  5H6R B;  4N58 A;  5CA0 E;  4AKI A;  4AQF C;  5DQW A;  1V9D A;  2LSG A;  3T0S A;  2VWA A;  4ZI7 E;  4O3Z A;  4BA9 A;  1HXX A;  3N9N A;  1P4T A;  3RC8 A;  1THQ A;  1MMD A;  4DVD A;  2LHF A;  4FES A;  5ETW A;  4CZZ B;  4GYS A;  4XNK A;  1H6S 1;  1BR2 A;  4AYM C;  2E9X C;  2XAS B;  2ZM0 A;  1QSD A;  4GCS A;  3LFM A;  5HWY A;  3VY9 X;  4O3Y A;  5FXW A;  4L0R A;  2XUE A;  2XHE B;  2KZ7 A;  2CCQ A;  2LHN A;  2K5B B;  4I55 E;  1MNE A;  3BK9 A;  2D2S A;  1S94 A;  1X79 A;  5HAX A;  2H3R A;  4MFR A;  4AFK A;  3DTO A;  1KK7 A;  1HCI A;  2BVL A;  2CLY C;  4C90 A;  3HWB A;  2G0U A;  4FSO A;  1HX8 A;  3LK4 2;  1HXU A;  2LJL A;  3SY9 A;  3ETV A;  2C5J A;  4AXP A;  5L2L A;  4RJX A;  1US7 B;  5LOV E;  4D5U A;  4IDZ A;  4MBQ A;  2J1D G;  5FXX A;  2N2L A;  3ZEF B;  3P8C D;  2K9A A;  1OWA A;  2XTQ A;  2ZLD A;  3PU3 A;  3UUL A;  3HOL A;  4O8S A;  1AJ3 A;  3VZU X;  3UT5 E;  2KXP B;  4O2A E;  1B7T A;  3LBX B;  4ZI3 D;  2CXD A;  5FP3 A;  1ZEE A;  3CX7 B;  2HPJ A;  2V7M A;  4MAL A;  5IYZ E;  2CM0 A;  2QGS A;  2MBG A;  5JR9 A;  2FGR A;  2WBL A;  1ZHC A;  2KIN B;  3W15 B;  2WMO A;  2CE7 A;  2NTX A;  2Q9Q D;  1WR6 A;  3MXZ A;  2O4V A;  4AYE C;  4G63 A;  4IE0 A;  1U5P A;  2W0G A;  1HFA A;  4QQ1 A;  2B1E A;  2MOZ A;  4IE6 A;  2LM9 A;  4HFV A;  4ILU A;  4XZC A;  3R6N A;  1MMG A;  3I9Y A;  5JR9 C;  3CWZ B;  3NRY A;  3LK2 B;  1FIO A;  4B6X A;  1QJP A;  4ZS3 A;  2JMM A;  4B61 A;  2YU2 A;  3ZMS B;  3N2K E;  3O1J A;  3SOL A;  3WAK A;  4E7S A;  1PRN A;  1FEW A;  4AYI D;  1OXZ A;  5EK4 A;  4PK6 A;  3GN5 B;  2V1D B;  4EYY R;  3AA6 A;  1LKX A;  5L3G B;  2MNH A;  4U72 A;  1CUN A;  4V1A v;  2M07 A;  3N9L A;  5LP6 E;  2WMN A;  2LT3 A;  3C51 A;  4TN7 B;  5HYA A;  3WAJ A;  2VB6 A;  4FOZ A;  5DL8 A;  4O4I E;  3N9Q A;  5E0O A;  5LGT B;  2K24 A;  3CX8 B;  2UXX B;  4QWN B;  2ZFG A;  3CKD A;  3LK3 A;  2OA5 A;  3HI2 A;  2PJQ A;  1E1H B;  3QK6 A;  4YJ3 E;  5FY0 A;  4TV8 E;  3VHL A;  4EB6 E;  1D1B A;  5EZY E;  4K0U A;  2QTK A;  3HOE A;  3QRC A;  2CLY B;  5L3E B;  4H9Q C;  4PUX A;  2WM9 A;  3C50 A;  1MIY A;  2VK9 A;  2FGQ X;  2XE5 A;  3ETU A;  5KMG P;  1BT9 A;  3UTK A;  4WNK A;  1NWM X;  2CXL A;  3E08 A;  3ESL A;  3KIN B;  4QKN A;  3AA0 A;  1ZV4 X;  1ZKE A;  1G8X A;  1BH3 A;  3AVR A;  5LGU B;  2XAH B;  5PRN A;  2ZLY A;  3CQG B;  3EUH A;  5FNV E;  4PJN A;  2EHO B;  2JRK A;  3CQC B;  2E9X A;  3PUG A;  3N5L A;  4NUU A;  4GCP A;  4N59 A;  3BQL A;  4F6R C;  5JDN A;  4ASK A;  4EIW A;  5LNK A;  1GFO A;  3SYB A;  5JRC A;  4KR8 A;  5T5F A;  4OHF A;  4FZN A;  1OPF A;  4UV9 B;  5F8P A;  3RH3 A;  4U9C A;  3E22 E;  1IZN B;  4O3W A;  4UVA B;  2VKH A;  5LBM A;  3RYH E;  3AA7 A;  2Y0K A;  5ADX K;  2X9H A;  3AAA B;  3ZYL A;  1MMA A;  3N9P A;  3J9X 1;  5ADX L;  3VE1 A;  3H37 A;  4TV9 E;  1BR4 A;  2L3L A;  5DQV A;  1HG5 A;  2J1N A;  2UXN B;  4PFO A;  5DL7 A;  4CXX A;  3C4W A;  4TX5 A;  3D0T A;  2XQY A;  3O4X E;  2D0U A;  1MIV A;  2YEV C;  5JDL A;  3O1H A;  4D64 A;  2VL8 A;  3HA4 A;  5G26 A;  5JDQ A;  2NW7 A;  5GV0 A;  3NZP A;  4BJM A;  2K0L A;  2N2M A;  2A2F X;  1Q9F A;  3GMI A;  3T8O A;  1BR0 A;  2YK0 A;  1PHO A;  2OMF A;  2N2N A;  5M4Y A;  4AUI A;  1UX5 A;  2LSK A;  4OK0 A;  3RRW A;  3V8U A;  3A5X A;  4ADZ A;  2C0S A;  2VKO A;  3Q9D A;  3JC6 C;  4GOU A;  1NAF A;  3HKC E;  2VKJ A;  3ZJ1 A;  4ERR A;  5HXH A;  2F1V A;  4G75 A;  1Z0P A;  3EDU A;  1QJ9 A;  3PQS A;  4GF4 A;  2ERV A;  5FY7 A;  1VOM A;  1BXW A;  4CI3 B;  2YPV A;  4FT6 A;  3OYX A;  4UF0 A;  3ZMU B;  3PUS A;  3VZT X;  2BZB A;  3UUX B;  3C4X A;  2C5I T;  3RRC A;  2X9X A;  5EK3 A;  3NRX A;  2KDY A;  2X27 X;  2IAK A;  1VRB A;  3AA7 B;  4M1P A;  4UVC B;  3PTR B;  4JEU B;  2E9X D;  4X1I E;  5FMN A;  2XAQ B;  3I0O A;  4DBR A;  2K4T A;  3DA4 A;  2LOS A;  3AAE B;  4O3X B;  3ZC0 A;  4HKA A;  3N2O A;  4AYN A;  4CXW A;  2DI4 A;  3K19 A;  5JDF A;  4EAH A;  3ZLI A;  1E54 A;  2W81 C;  2P9B A;  2NTY A;  5FY1 A;  4DMW A;  3O9X A;  4HE8 A;  2DHR A;  1OSM A;  2Q9Q C;  1WYB A;  3ZN0 B;  4PNI A;  2LOP A;  3VU7 H;  5A1L A;  5JDM A;  3HKB E;  3QC9 A;  3SWH A;  2DCF A;  3FXE B;  2CWY A;  3U78 A;  2Q9Q B;  5LYJ E;  2YNK A;  2KND A;  3IBP A;  3ZYM A;  4AKL A;  2JQQ A;  1HXT A;  4KRA A;  2LE8 A;  3ANW A;  2H7O A;  2NOX A;  4QXB B;  5DAB A;  2NW9 A;  3RBH A;  8PRN A;  3RC3 A;  1YW0 A;  1D1C A;  4E1S A;  4CXY A;  3ZCJ A;  3H3A A;  5LG4 A;  2POR A;  4IE7 A;  4PFP A;  3M65 A;  3PUR A;  5LCY A;  4EXT A;  6PRN A;  2LSY A;  2Y48 B;  4YHJ A;  5F3J A;  3LK3 B;  1EZ3 A;  3SY7 A;  2KXP A;  1UX4 A;  4O2B E;  3O0E A;  4UEM A;  4AQG A;  2EHO D;  4KUM B;  2LHR A;  5LJN A;  3MA9 A;  3Q5X A;  2F1T A;  4LSI A;  3HW9 A;  2PFV A;  3VZW X;  1S35 A;  4QXC B;  3K8P C;  5EE2 A;  1IJ5 A;  4J2C A;  1IJ6 A;  2X9W A;  4OYK A;  2XTR A;  4UVB B;  4GK5 E;  2LSI A;  3LG7 A;  5JH7 E;  2I59 A;  4H63 V;  3CQX C;  3P7I A;  4I43 B;  4UIG A;  3Q2M A;  5LXT E;  4AQF A;  3GP6 A;  3AVS A;  2V7J A;  4C91 A;  1GFN A;  4O49 A;  2DWK A;  2ACX A;  4WW0 A;  1MIW A;  3ONX A;  4UF0 B;  1YKE B;  3PDY A;  3SS1 A;  5L3C B;  5J1G A;  5LHG B;  4O4H E;  5L3D B;  4TUY E;  3AAA A;  2KLQ A;  3EVY A;  4H9P C;  4HEA A;  1D1A A;  3IHR A;  2ES0 A;  2WSS V;  4XAX B;  3F2E A;  3FBZ A;  3VE2 A;  3KVB A;  5C8Y E;  2Y7S A;  2KT9 A;  4HTE A;  5HXC A;  5L3B B;  5J2U E;  2X9Y A;  3B57 A;  4ANJ A;  3KBU A;  4ISS A;  4TZ4 C;  3UUN A;  4DMV A;  1Q9G A;  4EZ4 A;  3AAE A;  3C4Z A;  4AYD C;  4O4X A;  3PRN A;  2KWI B;  3N2G E;  1GFP A;  3A2S X;  2CWO A;  3GN5 A;  4WBO A;  4FSP A;  3RPU A;  2VAS A;  3CML A;  4OFZ A;  4AKR B;  2KC0 A;  3UAQ A;  4IHJ E;  3FBL A;  3SZV A;  4I50 E;  4F4B A;  2NW8 A;  2V7I A;  2YIN A;  4N78 D;  3R84 B;  5CB4 E;  3J7Y q;  2Z6E A;  3KV6 A;  4UV8 B;  2DWG A;  3DA3 A;  4RL9 A;  4XBF B;  2Y0L A;  2IC9 A;  5HXS A;  2XMX A;  1MM5 A;  2V7K A;  4AZL A;  4QHO A;  3FB2 A;  1MND A;  3DJB A;  3S4U A;  5LA6 E;  4UXN B;  4X1Y E;  3POX A;  4FUV A;  3KV4 A;  2X66 A;  1QUU A;  2IC6 A;  2JMH A;  2M67 A;  4QX8 B;  5HWX A;  4E7Z A;  3ZCI A;  2C5K T;  2Q9Q A;  4EZH A;  1ZHX A;  4DBQ A;  3OYZ A;  2LSJ A;  1UCU A;  3LJC A;  2X67 A;  4P0A A;  2Y0H A;  4FRX A;  5JDH A;  2D5U A;  3BQI A;  3JC6 D;  4OYJ A;  5H6Q B;  5CA1 E;  3KBT A;  4EYU A;  2KMF A;  1D0Z A;  4MLK A;  2M06 A;  3OKQ A;  2PRN A;  1LRZ A;  2WWU A;  3QUJ A;  1ORM A;  1FMW A;  2X0L B;  4QXH B;  2NWB A;  3NBX X;  4Z8X A;  5JQG E;  3ZMT B;  3VKG A;  1QJ8 A;  3UU2 A;  3WI4 A;  4AKM A;  4YJ2 E;  3ZMZ B;  3KV5 A;  4C69 X;  3Q5W A;  4HN9 A;  2KZ7 B;  2GK9 A;  3POR A;  3N9O A;  2V7L A;  4A56 A;  3N9M A;  4QX7 B;  3AB3 B;  3AAI A;  5JVD E;  3JTY A;  2GE4 A;  3DP7 A;  1ZHW A;  3RX6 A;  5DL6 A;  2ZMA A;  4RJW A;  2L9Q A;  2V26 A;  1G73 A;  3RYI E;  4IIJ E;  3NZQ A;  5JR9 B;  3CVR A;  3WI3 A;  3ZYK A;  4YLH A;  3ZMV B;  3UPG A;  4O4U A;  1HG2 A;  5KDM C;  3K3N A;  5JRE A;  1FMV A;  2XTL A;  2N1G A;  4AKG A;  2EHO A;  2W62 A;  2XE2 A;  3C98 B;  3BQK A;  4KBM B;  1YS5 A;  3LK4 1;  1D0Y A;  5AFU L;  2W61 A;  3UFE A;  4PJL A;  4ZI2 C;  3PUQ A;  3AA1 B;  3E0Z A;  4H9R C;  2W63 A;  2BDE A;  3LK2 A;  3PE0 A;  3FYX A;  3KFW X;  3AA1 A;  4XNL A;  4H63 H;  3HKD E;  3OJA A;  5LBQ B;  5LHI B;  4IST A;  4KMC A;  3KVA A;  3I9W A;  2N9D A;  2XG6 A;  5L3F B;  4G76 A;  2WAU A;  4CQI A;  3RYF E;  3VY8 X;  3GA8 A;  3KV9 A;  3SZD A;  4RLB A;  1IZN A;  3TKL B;  5HXE A;  4PW8 A;  1IAP A;  3RKO A;  4WBN E;  1Y64 B;  5JRC B;  5J2T E;  2W80 C;  4IE4 A;  5IYU A;  5FXZ A;  4IE5 A;  2PBI A;  2VKD A;  3MZK B;  2YU1 A;  4ZS2 A;  5HXR A;  4O4L E;  3FHN A;  4X20 E;  1MPF A;  4BAY B;  4RLC A;  4U74 A;  4PK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...