4AKVA

Crystal structure of human sorting nexin 33 (snx33)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
363
structure length
345
Chain Sequence
MYSIEMGPRGPQWKANPHPFACSVEDPISYKLTPTHAASPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSAFQAISHSFQMDPPFCSEALNSAISHTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMYDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Sorting Nexin 33
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords SORTING NEXIN-33
total genus 140
structure length 345
sequence length 363
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4akvA02
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 4akvA01
1ZWWA 4FZSA 1H6HA 3HPBA 4H8SA 3SOGA 4AVMA 4OXWA 2V0OA 2REAA 4AZ9A 2C08A 3LUIA 3G9GA 2ELBA 4DYLA 4NSWA 3ABHA 2AR5A 2X3VA 3ACOA 2EFLA 4DCNC 3FOGA 3HAHA 1OCUA 3QWEA 2IWLX 4BGJA 2Q12A 1I4LA 4WPCA 2L73A 4P2JA 2V6VA 4P2IA 4WPEA 1KQ6A 2X3WA 4IKBA 2WWEA 5C5BB 3QNIA 3HAIA 2EFKA 3I2WA 1X03A 1GD5A 1I49A 3OK8A 2REDA 1XTNA 1WDZA 4NQIA 2X3XA 1I4DA 1OCSA 1XTEA 2Z0OA 3Q84A 4AKVA 3LLLA 5C5BA 2V14A 3M3WA 3IQ2A 2D4CA 3PLTA 4ON3A 3HAJA 4ATMA 2Q13A 2RAIA 4HASA 1URUA 1KMDA 3DYTA 4BNEA 2YKTA 2Z0VA 4IKDA 2D1LA 2RAKA 3SYVA 4I1QA 2I4KA 4IKBB 4PZGA 1O7KA 3HPCX 3P0CA 2RAJA 3QE6A 4PQPA 2DYBA 4PQOA 2CZOA 2ETTA 2FICA 1Y2OA 1I4TA 2Z0NA 2CSKA 2YPSA 3Q0KA 3CAZA 1X04A
chains in the Genus database with same CATH superfamily
2LXYA 3HPBA 4R5JA 1TQWA 2ZXQA 4R5KA 1U00A 2REAA 3KAVA 4AZ9A 3UITA 4R5GA 4B9QA 3T46A 2RT6A 4DYLA 4EZQA 4NSWA 4AZ7A 2YIVX 2EWFA 3DPPA 4HY9A 3LMFA 3BVUA 3ACOA 3HAHA 3KDRA 4HR1B 1OCUA 3CVRA 1OAOA 3QWEA 2IWLX 4KIKB 3CKDA 4JWCA 4EZRA 2L73A 2OBMA 3D52A 4EZVA 1KQ6A 2O0I1 3DDGA 4AZBA 3QNIA 2EFKA 1GD5A 1TQUA 2OW6A 1QX1A 1WDZA 2EX3B 3D2FA 3BVVA 5FLEX 2F7PA 1GNTA 4EZYA 2KHOA 4IWQA 3HAJA 4ATMA 2PY6A 4UDXX 4HASA 3CV5A 4HR1A 4FM3A 3RV1A 2YKTA 4IWPA 2MI7A 1SUFA 2YI9A 3SYVA 4I1QA 3T4AG 4PZGA 3P0CA 2OZNB 3T48A 5FIGA 1Y2OA 1I4TA 4AZCA 3I39X 3Q0KA 1X04A 2D4CA 4FZSA 3I01A 2V0OA 2C08A 4AZIA 3EJRA 4EZXA 1HTYA 2AR5A 4HYBA 3QA8A 2F7RA 2EFLA 2ND0A 4H6HA 4DCNC 3RPMA 1MJGA 3DPQA 3DX0A 4G6QA 4EZOA 2PMRA 3VEBA 3DDFA 2Z8YA 3D4ZA 2WWEA 1X03A 4M0MA 3D50A 3OK8A 2QFFA 1W9MA 2NCZA 2GA9D 2QXLA 1SU6A 4NQIA 2X3XA 1I4DA 3BVXA 1JQKA 3Q84A 4EZWA 3VEAA 3DX1A 3BUIA 4E81A 4IW0A 3O3OB 2RAIA 3F7WA 1E1DA 1URUA 3DX3A 4D8JA 1YWMA 3DYTA 4JWIA 4BNEA 4EZUA 5E84A 2D1LA 1R33A 3C7NA 2RAKA 3QNJA 2I4KA 1OA0A 2ND1A 3L3PA 2DYBA 4IM3A 2ETTA 1GN9A 4JWEA 2WYIA 2YLAA 3A98A 3BUBA 1H6HA 2F1AA 4H8SA 4JWDA 2FYVA 3SOGA 1E9VA 2LM0A 3EJPA 4JL9A 3OHXM 4F00A 2YL9A 1PS3A 4AZCB 3LUIA 3B53X 3G9GA 2ELBA 3CZNA 1TQTA 3EJSA 3EJQA 2X3VA 2F18A 2JNSA 1SU7A 4EZTA 3VKHA 3RV0A 3FOGA 4BGJA 3BLBA 2Q12A 3B52X 2F7QA 4P2JA 2GF4A 1QWNA 1TQSA 3T47A 4P2IA 4FZPA 5TKYA 1O7DB 4IKBA 5C5BB 3I2WA 1I49A 3BUPA 4R5IA 4H6IA 2YIBA 2REDA 1XTNA 1XTEA 3KAWA 3GI7A 4AKVA 2V14A 3M3WA 3IQ2A 4AZGA 4ON3A 4JLCA 2Q13A 3CZSA 1R34A 2YI8A 2YL5A 4AZ6A 1DKYA 2Z0VA 3LVTA 3DX2A 2WYHA 4IKBB 1O7KA 1R5EA 3HPCX 5KBPA 3QE6A 4PQPA 4PQOA 1HWWA 1UPXA 2CZOA 3O3MB 4AZHA 2Z0NA 4IWOA 3B51X 2YPSA 4PO2A 4EZZA 4FZOA 3CAZA 1DKXA 1ZWWA 3D4YA 4F01A 4IM0A 4AVMA 4OXWA 1E2UA 3DPOA 1QWUA 1LQ7A 1HXKA 4AZ5A 3I04A 2F1BA 2GAFD 3ABHA 2F7OA 4JN4A 4EZNA 2OO2A 1O7DC 2YL8A 3EJTA 1DKZA 2X5CA 1I4LA 4WPCA 3ER9B 2V6VA 3BVTA 3FD9A 4WPEA 4EZSA 1SU8A 2X3WA 2WINM 2N3KA 4JNFA 3ZEDA 3HAIA 3BUQA 2YIAA 4UDYX 1OA1A 2ALWA 3OWGA 1GNLA 2QKWA 3D2EA 4KIKA 1OCSA 2Z0OA 1TQVA 3BUDA 3LLLA 5C5BA 2YLLA 3ERCC 3PLTA 3D51A 3L3OM 4IM2A 4NPHA 4E3CA 1KMDA 3BVWA 4R5LA 2JNKA 4IKDA 2RAJA 3O3NB 2YL6A 4JNEA 2FICA 4EZPA 2OBLA 2OW7A 2CSKA 3T49A 3EJUA 3ER8C 1ZYLA 3DX4A
chains in the Genus database with same CATH topology
1ZWWA 4FZSA 1H6HA 3HPBA 4H8SA 3SOGA 4AVMA 4OXWA 2V0OA 2REAA 4AZ9A 2C08A 3LUIA 3G9GA 2ELBA 4DYLA 4NSWA 3ABHA 2AR5A 2X3VA 3ACOA 2EFLA 4DCNC 3FOGA 3HAHA 1OCUA 3QWEA 2IWLX 4BGJA 2Q12A 1I4LA 4WPCA 2L73A 4P2JA 2V6VA 4P2IA 4WPEA 1KQ6A 2X3WA 4IKBA 2WWEA 5C5BB 3QNIA 3HAIA 2EFKA 3I2WA 1X03A 1GD5A 1I49A 3OK8A 2REDA 1XTNA 1WDZA 4NQIA 2X3XA 1I4DA 1OCSA 1XTEA 2Z0OA 3Q84A 4AKVA 3LLLA 5C5BA 2V14A 3M3WA 3IQ2A 2D4CA 3PLTA 4ON3A 3HAJA 4ATMA 2Q13A 2RAIA 4HASA 1URUA 1KMDA 3DYTA 4BNEA 2YKTA 2Z0VA 4IKDA 2D1LA 2RAKA 3SYVA 4I1QA 2I4KA 4IKBB 4PZGA 1O7KA 3HPCX 3P0CA 2RAJA 3QE6A 4PQPA 2DYBA 4PQOA 2CZOA 2ETTA 2FICA 1Y2OA 1I4TA 2Z0NA 2CSKA 2YPSA 3Q0KA 3CAZA 1X04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZWW A;  4FZS A;  1H6H A;  3HPB A;  4H8S A;  3SOG A;  4AVM A;  4OXW A;  2V0O A;  2REA A;  4AZ9 A;  2C08 A;  3LUI A;  3G9G A;  2ELB A;  4DYL A;  4NSW A;  3ABH A;  2AR5 A;  2X3V A;  3ACO A;  2EFL A;  4DCN C;  3FOG A;  3HAH A;  1OCU A;  3QWE A;  2IWL X;  4BGJ A;  2Q12 A;  1I4L A;  4WPC A;  2L73 A;  4P2J A;  2V6V A;  4P2I A;  4WPE A;  1KQ6 A;  2X3W A;  4IKB A;  2WWE A;  5C5B B;  3QNI A;  3HAI A;  2EFK A;  3I2W A;  1X03 A;  1GD5 A;  1I49 A;  3OK8 A;  2RED A;  1XTN A;  1WDZ A;  4NQI A;  2X3X A;  1I4D A;  1OCS A;  1XTE A;  2Z0O A;  3Q84 A;  4AKV A;  3LLL A;  5C5B A;  2V14 A;  3M3W A;  3IQ2 A;  2D4C A;  3PLT A;  4ON3 A;  3HAJ A;  4ATM A;  2Q13 A;  2RAI A;  4HAS A;  1URU A;  1KMD A;  3DYT A;  4BNE A;  2YKT A;  2Z0V A;  4IKD A;  2D1L A;  2RAK A;  3SYV A;  4I1Q A;  2I4K A;  4IKB B;  4PZG A;  1O7K A;  3HPC X;  3P0C A;  2RAJ A;  3QE6 A;  4PQP A;  2DYB A;  4PQO A;  2CZO A;  2ETT A;  2FIC A;  1Y2O A;  1I4T A;  2Z0N A;  2CSK A;  2YPS A;  3Q0K A;  3CAZ A;  1X04 A; 
#chains in the Genus database with same CATH topology
 2LXY A;  3HPB A;  4R5J A;  1TQW A;  2ZXQ A;  4R5K A;  1U00 A;  2REA A;  3KAV A;  4AZ9 A;  3UIT A;  4R5G A;  4B9Q A;  3T46 A;  2RT6 A;  4DYL A;  4EZQ A;  4NSW A;  4AZ7 A;  2YIV X;  2EWF A;  3DPP A;  4HY9 A;  3LMF A;  3BVU A;  3ACO A;  3HAH A;  3KDR A;  4HR1 B;  1OCU A;  3CVR A;  1OAO A;  3QWE A;  2IWL X;  4KIK B;  3CKD A;  4JWC A;  4EZR A;  2L73 A;  2OBM A;  3D52 A;  4EZV A;  1KQ6 A;  2O0I 1;  3DDG A;  4AZB A;  3QNI A;  2EFK A;  1GD5 A;  1TQU A;  2OW6 A;  1QX1 A;  1WDZ A;  2EX3 B;  3D2F A;  3BVV A;  5FLE X;  2F7P A;  1GNT A;  4EZY A;  2KHO A;  4IWQ A;  3HAJ A;  4ATM A;  2PY6 A;  4UDX X;  4HAS A;  3CV5 A;  4HR1 A;  4FM3 A;  3RV1 A;  2YKT A;  4IWP A;  2MI7 A;  1SUF A;  2YI9 A;  3SYV A;  4I1Q A;  3T4A G;  4PZG A;  3P0C A;  2OZN B;  3T48 A;  5FIG A;  1Y2O A;  1I4T A;  4AZC A;  3I39 X;  3Q0K A;  1X04 A;  2D4C A;  4FZS A;  3I01 A;  2V0O A;  2C08 A;  4AZI A;  3EJR A;  4EZX A;  1HTY A;  2AR5 A;  4HYB A;  3QA8 A;  2F7R A;  2EFL A;  2ND0 A;  4H6H A;  4DCN C;  3RPM A;  1MJG A;  3DPQ A;  3DX0 A;  4G6Q A;  4EZO A;  2PMR A;  3VEB A;  3DDF A;  2Z8Y A;  3D4Z A;  2WWE A;  1X03 A;  4M0M A;  3D50 A;  3OK8 A;  2QFF A;  1W9M A;  2NCZ A;  2GA9 D;  2QXL A;  1SU6 A;  4NQI A;  2X3X A;  1I4D A;  3BVX A;  1JQK A;  3Q84 A;  4EZW A;  3VEA A;  3DX1 A;  3BUI A;  4E81 A;  4IW0 A;  3O3O B;  2RAI A;  3F7W A;  1E1D A;  1URU A;  3DX3 A;  4D8J A;  1YWM A;  3DYT A;  4JWI A;  4BNE A;  4EZU A;  5E84 A;  2D1L A;  1R33 A;  3C7N A;  2RAK A;  3QNJ A;  2I4K A;  1OA0 A;  2ND1 A;  3L3P A;  2DYB A;  4IM3 A;  2ETT A;  1GN9 A;  4JWE A;  2WYI A;  2YLA A;  3A98 A;  3BUB A;  1H6H A;  2F1A A;  4H8S A;  4JWD A;  2FYV A;  3SOG A;  1E9V A;  2LM0 A;  3EJP A;  4JL9 A;  3OHX M;  4F00 A;  2YL9 A;  1PS3 A;  4AZC B;  3LUI A;  3B53 X;  3G9G A;  2ELB A;  3CZN A;  1TQT A;  3EJS A;  3EJQ A;  2X3V A;  2F18 A;  2JNS A;  1SU7 A;  4EZT A;  3VKH A;  3RV0 A;  3FOG A;  4BGJ A;  3BLB A;  2Q12 A;  3B52 X;  2F7Q A;  4P2J A;  2GF4 A;  1QWN A;  1TQS A;  3T47 A;  4P2I A;  4FZP A;  5TKY A;  1O7D B;  4IKB A;  5C5B B;  3I2W A;  1I49 A;  3BUP A;  4R5I A;  4H6I A;  2YIB A;  2RED A;  1XTN A;  1XTE A;  3KAW A;  3GI7 A;  4AKV A;  2V14 A;  3M3W A;  3IQ2 A;  4AZG A;  4ON3 A;  4JLC A;  2Q13 A;  3CZS A;  1R34 A;  2YI8 A;  2YL5 A;  4AZ6 A;  1DKY A;  2Z0V A;  3LVT A;  3DX2 A;  2WYH A;  4IKB B;  1O7K A;  1R5E A;  3HPC X;  5KBP A;  3QE6 A;  4PQP A;  4PQO A;  1HWW A;  1UPX A;  2CZO A;  3O3M B;  4AZH A;  2Z0N A;  4IWO A;  3B51 X;  2YPS A;  4PO2 A;  4EZZ A;  4FZO A;  3CAZ A;  1DKX A;  1ZWW A;  3D4Y A;  4F01 A;  4IM0 A;  4AVM A;  4OXW A;  1E2U A;  3DPO A;  1QWU A;  1LQ7 A;  1HXK A;  4AZ5 A;  3I04 A;  2F1B A;  2GAF D;  3ABH A;  2F7O A;  4JN4 A;  4EZN A;  2OO2 A;  1O7D C;  2YL8 A;  3EJT A;  1DKZ A;  2X5C A;  1I4L A;  4WPC A;  3ER9 B;  2V6V A;  3BVT A;  3FD9 A;  4WPE A;  4EZS A;  1SU8 A;  2X3W A;  2WIN M;  2N3K A;  4JNF A;  3ZED A;  3HAI A;  3BUQ A;  2YIA A;  4UDY X;  1OA1 A;  2ALW A;  3OWG A;  1GNL A;  2QKW A;  3D2E A;  4KIK A;  1OCS A;  2Z0O A;  1TQV A;  3BUD A;  3LLL A;  5C5B A;  2YLL A;  3ERC C;  3PLT A;  3D51 A;  3L3O M;  4IM2 A;  4NPH A;  4E3C A;  1KMD A;  3BVW A;  4R5L A;  2JNK A;  4IKD A;  2RAJ A;  3O3N B;  2YL6 A;  4JNE A;  2FIC A;  4EZP A;  2OBL A;  2OW7 A;  2CSK A;  3T49 A;  3EJU A;  3ER8 C;  1ZYL A;  3DX4 A; 
#chains in the Genus database with same CATH homology
 1ZWW A;  4FZS A;  1H6H A;  3HPB A;  4H8S A;  3SOG A;  4AVM A;  4OXW A;  2V0O A;  2REA A;  4AZ9 A;  2C08 A;  3LUI A;  3G9G A;  2ELB A;  4DYL A;  4NSW A;  3ABH A;  2AR5 A;  2X3V A;  3ACO A;  2EFL A;  4DCN C;  3FOG A;  3HAH A;  1OCU A;  3QWE A;  2IWL X;  4BGJ A;  2Q12 A;  1I4L A;  4WPC A;  2L73 A;  4P2J A;  2V6V A;  4P2I A;  4WPE A;  1KQ6 A;  2X3W A;  4IKB A;  2WWE A;  5C5B B;  3QNI A;  3HAI A;  2EFK A;  3I2W A;  1X03 A;  1GD5 A;  1I49 A;  3OK8 A;  2RED A;  1XTN A;  1WDZ A;  4NQI A;  2X3X A;  1I4D A;  1OCS A;  1XTE A;  2Z0O A;  3Q84 A;  4AKV A;  3LLL A;  5C5B A;  2V14 A;  3M3W A;  3IQ2 A;  2D4C A;  3PLT A;  4ON3 A;  3HAJ A;  4ATM A;  2Q13 A;  2RAI A;  4HAS A;  1URU A;  1KMD A;  3DYT A;  4BNE A;  2YKT A;  2Z0V A;  4IKD A;  2D1L A;  2RAK A;  3SYV A;  4I1Q A;  2I4K A;  4IKB B;  4PZG A;  1O7K A;  3HPC X;  3P0C A;  2RAJ A;  3QE6 A;  4PQP A;  2DYB A;  4PQO A;  2CZO A;  2ETT A;  2FIC A;  1Y2O A;  1I4T A;  2Z0N A;  2CSK A;  2YPS A;  3Q0K A;  3CAZ A;  1X04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...