4AKVA

Crystal structure of human sorting nexin 33 (snx33)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
363
structure length
345
Chain Sequence
MYSIEMGPRGPQWKANPHPFACSVEDPISYKLTPTHAASPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSAFQAISHSFQMDPPFCSEALNSAISHTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMYDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SORTING NEXIN-33
publication title Structure of Human Sorting Nexin 33
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 140
structure length 345
sequence length 363
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4akvA02
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 4akvA01
1H6HA 4ATMA 2RAJA 4AKVA 1URUA 5C5BA 2ETTA 2V14A 4P2JA 3HAHA 4DCNC 2Q12A 1XTNA 4P2IA 2REAA 2Z0OA 2RAKA 1KMDA 2YPSA 3Q0KA 2L73A 1I4TA 1WDZA 4AZ9A 1I4LA 3HPCX 3LLLA 2D1LA 2EFLA 1I49A 2IWLX 3IQ2A 3ABHA 4H8SA 3LUIA 3P0CA 4ON3A 4IKBB 2I4KA 2V6VA 2C08A 2DYBA 1ZWWA 2CZOA 2Z0VA 3HPBA 2X3WA 1XTEA 2FICA 3CAZA 1OCSA 4WPCA 4WPEA 1GD5A 2X3VA 3ACOA 4PQOA 3QWEA 4DYLA 4IKDA 4OXWA 2Z0NA 3M3WA 1OCUA 2X3XA 2ELBA 4NSWA 3OK8A 3PLTA 4NQIA 2WWEA 2EFKA 3SOGA 4IKBA 1O7KA 2REDA 2D4CA 4FZSA 3DYTA 3SYVA 4I1QA 1I4DA 3HAJA 1X04A 4PZGA 2V0OA 3QE6A 3G9GA 3Q84A 3QNIA 2YKTA 4AVMA 2AR5A 4HASA 3I2WA 2CSKA 4BNEA 1Y2OA 2Q13A 2RAIA 1KQ6A 3FOGA 4BGJA 4PQPA 5C5BB 3HAIA 1X03A
chains in the Genus database with same CATH superfamily
1H6HA 2F1AA 4AKVA 4E3CA 4AZHA 2WYHA 4JL9A 4P2JA 4DCNC 2Q12A 3CKDA 4AZGA 4KIKA 4P2IA 2OBLA 1TQVA 2WYIA 4AZBA 2RAKA 4EZUA 4H6IA 1OA1A 2X5CA 4R5IA 3DX0A 3DPOA 3RV1A 2PY6A 4FZPA 3CV5A 3IQ2A 3ABHA 3B51X 1R33A 1GN9A 3DDFA 4AZ7A 1GNLA 3D50A 2OO2A 4UDYX 1UPXA 1XTEA 4JWEA 3CAZA 1OCSA 4HY9A 4PQOA 3UITA 4EZSA 3OHXM 3O3NB 3QWEA 4AZIA 4DYLA 4IKDA 5FIGA 4EZPA 1OCUA 5FLEX 4M0MA 1TQWA 1GNTA 1QWNA 3BUQA 4IKBA 4FZSA 4AZ6A 3SYVA 1X04A 2YI8A 2V0OA 2AR5A 1HXKA 3D51A 4EZQA 2EWFA 2CSKA 2GAFD 4R5KA 4PQPA 4UDXX 4R5JA 3KAVA 2RT6A 3BVTA 4ATMA 4IW0A 4F01A 3T48A 4EZRA 4E81A 5C5BA 4IM2A 4D8JA 1XTNA 2F7QA 4H6HA 3C7NA 3EJTA 2YPSA 2OZNB 2L73A 3CZSA 2YIAA 3EJQA 1I4LA 3LMFA 1SU7A 1OAOA 1DKZA 2N3KA 3LLLA 3RPMA 3DX4A 4IWPA 1I49A 1U00A 4H8SA 3P0CA 3VKHA 2NCZA 2I4KA 3EJUA 3VEAA 3HPBA 2X3WA 3D2FA 2F18A 4R5LA 2YLLA 4WPCA 1DKYA 1YWMA 3DX1A 4AZ5A 3VEBA 1HTYA 4EZOA 1PS3A 1SU8A 3M3WA 1ZYLA 3EJPA 4NSWA 3OK8A 2OBMA 2Z8YA 1E9VA 2YL6A 4EZWA 3DPQA 3BUIA 3ZEDA 1R5EA 2F7RA 3I2WA 4BNEA 2Q13A 3BVWA 2RAIA 3FOGA 4IWOA 5KBPA 2FYVA 2YL5A 4R5GA 3I04A 1X03A 4AZCB 2YIVX 2ETTA 5TKYA 3DPPA 3D4ZA 3LVTA 4HR1B 2REAA 4JWCA 2MI7A 2Z0OA 3DX3A 4IWQA 1KMDA 3D4YA 3BUPA 1WDZA 3HPCX 2WINM 3D52A 2OW7A 2EFLA 1QX1A 2F1BA 3GI7A 3B52X 3LUIA 2YL8A 4IKBB 1DKXA 3FD9A 2V6VA 2C08A 4JWDA 2DYBA 3BVVA 2PMRA 2QFFA 2ZXQA 1LQ7A 2JNSA 4JNFA 4NPHA 3ACOA 4EZTA 3KDRA 3I39X 2YIBA 2GF4A 4FZOA 4IM3A 2Z0NA 3DDGA 2X3XA 2ELBA 2KHOA 2YL9A 3QNJA 3ER8C 2WWEA 2EFKA 4EZVA 1O7KA 2YLAA 1TQUA 1SUFA 2YI9A 3CVRA 1O7DB 3T46A 5E84A 4EZYA 4HYBA 2ND1A 3G9GA 3Q84A 3QNIA 2QXLA 4AVMA 4HASA 4IM0A 1E2UA 4EZXA 3O3MB 1Y2OA 3EJSA 4BGJA 1O7DC 1QWUA 2EX3B 4KIKB 3DX2A 2RAJA 3CZNA 3EJRA 3BVUA 1URUA 2O0I1 3RV0A 2V14A 3HAHA 4EZZA 3BLBA 1SU6A 4AZCA 3QA8A 3BUDA 3Q0KA 4HR1A 2QKWA 1I4TA 4AZ9A 1E1DA 3ERCC 2ND0A 1W9MA 2F7OA 2D1LA 3OWGA 3B53X 4JNEA 1HWWA 2IWLX 3F7WA 4JN4A 4ON3A 2OW6A 4EZNA 1ZWWA 4B9QA 4G6QA 2CZOA 3T4AG 2Z0VA 3O3OB 2FICA 3ER9B 4WPEA 1GD5A 2X3VA 3KAWA 2ALWA 4JWIA 1OA0A 3BUBA 1MJGA 3I01A 1TQTA 3A98A 2LXYA 4OXWA 2LM0A 3L3OM 3PLTA 4NQIA 3SOGA 2REDA 2D4CA 1R34A 3DYTA 3T49A 4I1QA 1I4DA 3HAJA 4PZGA 3L3PA 4JLCA 3QE6A 2YKTA 2F7PA 2JNKA 4PO2A 2GA9D 3T47A 3BVXA 1KQ6A 5C5BB 3D2EA 4F00A 1TQSA 4FM3A 1JQKA 3HAIA
chains in the Genus database with same CATH topology
1H6HA 4ATMA 2RAJA 4AKVA 1URUA 5C5BA 2ETTA 2V14A 4P2JA 3HAHA 4DCNC 2Q12A 1XTNA 4P2IA 2REAA 2Z0OA 2RAKA 1KMDA 2YPSA 3Q0KA 2L73A 1I4TA 1WDZA 4AZ9A 1I4LA 3HPCX 3LLLA 2D1LA 2EFLA 1I49A 2IWLX 3IQ2A 3ABHA 4H8SA 3LUIA 3P0CA 4ON3A 4IKBB 2I4KA 2V6VA 2C08A 2DYBA 1ZWWA 2CZOA 2Z0VA 3HPBA 2X3WA 1XTEA 2FICA 3CAZA 1OCSA 4WPCA 4WPEA 1GD5A 2X3VA 3ACOA 4PQOA 3QWEA 4DYLA 4IKDA 4OXWA 2Z0NA 3M3WA 1OCUA 2X3XA 2ELBA 4NSWA 3OK8A 3PLTA 4NQIA 2WWEA 2EFKA 3SOGA 4IKBA 1O7KA 2REDA 2D4CA 4FZSA 3DYTA 3SYVA 4I1QA 1I4DA 3HAJA 1X04A 4PZGA 2V0OA 3QE6A 3G9GA 3Q84A 3QNIA 2YKTA 4AVMA 2AR5A 4HASA 3I2WA 2CSKA 4BNEA 1Y2OA 2Q13A 2RAIA 1KQ6A 3FOGA 4BGJA 4PQPA 5C5BB 3HAIA 1X03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6H A;  4ATM A;  2RAJ A;  4AKV A;  1URU A;  5C5B A;  2ETT A;  2V14 A;  4P2J A;  3HAH A;  4DCN C;  2Q12 A;  1XTN A;  4P2I A;  2REA A;  2Z0O A;  2RAK A;  1KMD A;  2YPS A;  3Q0K A;  2L73 A;  1I4T A;  1WDZ A;  4AZ9 A;  1I4L A;  3HPC X;  3LLL A;  2D1L A;  2EFL A;  1I49 A;  2IWL X;  3IQ2 A;  3ABH A;  4H8S A;  3LUI A;  3P0C A;  4ON3 A;  4IKB B;  2I4K A;  2V6V A;  2C08 A;  2DYB A;  1ZWW A;  2CZO A;  2Z0V A;  3HPB A;  2X3W A;  1XTE A;  2FIC A;  3CAZ A;  1OCS A;  4WPC A;  4WPE A;  1GD5 A;  2X3V A;  3ACO A;  4PQO A;  3QWE A;  4DYL A;  4IKD A;  4OXW A;  2Z0N A;  3M3W A;  1OCU A;  2X3X A;  2ELB A;  4NSW A;  3OK8 A;  3PLT A;  4NQI A;  2WWE A;  2EFK A;  3SOG A;  4IKB A;  1O7K A;  2RED A;  2D4C A;  4FZS A;  3DYT A;  3SYV A;  4I1Q A;  1I4D A;  3HAJ A;  1X04 A;  4PZG A;  2V0O A;  3QE6 A;  3G9G A;  3Q84 A;  3QNI A;  2YKT A;  4AVM A;  2AR5 A;  4HAS A;  3I2W A;  2CSK A;  4BNE A;  1Y2O A;  2Q13 A;  2RAI A;  1KQ6 A;  3FOG A;  4BGJ A;  4PQP A;  5C5B B;  3HAI A;  1X03 A; 
#chains in the Genus database with same CATH topology
 1H6H A;  2F1A A;  4AKV A;  4E3C A;  4AZH A;  2WYH A;  4JL9 A;  4P2J A;  4DCN C;  2Q12 A;  3CKD A;  4AZG A;  4KIK A;  4P2I A;  2OBL A;  1TQV A;  2WYI A;  4AZB A;  2RAK A;  4EZU A;  4H6I A;  1OA1 A;  2X5C A;  4R5I A;  3DX0 A;  3DPO A;  3RV1 A;  2PY6 A;  4FZP A;  3CV5 A;  3IQ2 A;  3ABH A;  3B51 X;  1R33 A;  1GN9 A;  3DDF A;  4AZ7 A;  1GNL A;  3D50 A;  2OO2 A;  4UDY X;  1UPX A;  1XTE A;  4JWE A;  3CAZ A;  1OCS A;  4HY9 A;  4PQO A;  3UIT A;  4EZS A;  3OHX M;  3O3N B;  3QWE A;  4AZI A;  4DYL A;  4IKD A;  5FIG A;  4EZP A;  1OCU A;  5FLE X;  4M0M A;  1TQW A;  1GNT A;  1QWN A;  3BUQ A;  4IKB A;  4FZS A;  4AZ6 A;  3SYV A;  1X04 A;  2YI8 A;  2V0O A;  2AR5 A;  1HXK A;  3D51 A;  4EZQ A;  2EWF A;  2CSK A;  2GAF D;  4R5K A;  4PQP A;  4UDX X;  4R5J A;  3KAV A;  2RT6 A;  3BVT A;  4ATM A;  4IW0 A;  4F01 A;  3T48 A;  4EZR A;  4E81 A;  5C5B A;  4IM2 A;  4D8J A;  1XTN A;  2F7Q A;  4H6H A;  3C7N A;  3EJT A;  2YPS A;  2OZN B;  2L73 A;  3CZS A;  2YIA A;  3EJQ A;  1I4L A;  3LMF A;  1SU7 A;  1OAO A;  1DKZ A;  2N3K A;  3LLL A;  3RPM A;  3DX4 A;  4IWP A;  1I49 A;  1U00 A;  4H8S A;  3P0C A;  3VKH A;  2NCZ A;  2I4K A;  3EJU A;  3VEA A;  3HPB A;  2X3W A;  3D2F A;  2F18 A;  4R5L A;  2YLL A;  4WPC A;  1DKY A;  1YWM A;  3DX1 A;  4AZ5 A;  3VEB A;  1HTY A;  4EZO A;  1PS3 A;  1SU8 A;  3M3W A;  1ZYL A;  3EJP A;  4NSW A;  3OK8 A;  2OBM A;  2Z8Y A;  1E9V A;  2YL6 A;  4EZW A;  3DPQ A;  3BUI A;  3ZED A;  1R5E A;  2F7R A;  3I2W A;  4BNE A;  2Q13 A;  3BVW A;  2RAI A;  3FOG A;  4IWO A;  5KBP A;  2FYV A;  2YL5 A;  4R5G A;  3I04 A;  1X03 A;  4AZC B;  2YIV X;  2ETT A;  5TKY A;  3DPP A;  3D4Z A;  3LVT A;  4HR1 B;  2REA A;  4JWC A;  2MI7 A;  2Z0O A;  3DX3 A;  4IWQ A;  1KMD A;  3D4Y A;  3BUP A;  1WDZ A;  3HPC X;  2WIN M;  3D52 A;  2OW7 A;  2EFL A;  1QX1 A;  2F1B A;  3GI7 A;  3B52 X;  3LUI A;  2YL8 A;  4IKB B;  1DKX A;  3FD9 A;  2V6V A;  2C08 A;  4JWD A;  2DYB A;  3BVV A;  2PMR A;  2QFF A;  2ZXQ A;  1LQ7 A;  2JNS A;  4JNF A;  4NPH A;  3ACO A;  4EZT A;  3KDR A;  3I39 X;  2YIB A;  2GF4 A;  4FZO A;  4IM3 A;  2Z0N A;  3DDG A;  2X3X A;  2ELB A;  2KHO A;  2YL9 A;  3QNJ A;  3ER8 C;  2WWE A;  2EFK A;  4EZV A;  1O7K A;  2YLA A;  1TQU A;  1SUF A;  2YI9 A;  3CVR A;  1O7D B;  3T46 A;  5E84 A;  4EZY A;  4HYB A;  2ND1 A;  3G9G A;  3Q84 A;  3QNI A;  2QXL A;  4AVM A;  4HAS A;  4IM0 A;  1E2U A;  4EZX A;  3O3M B;  1Y2O A;  3EJS A;  4BGJ A;  1O7D C;  1QWU A;  2EX3 B;  4KIK B;  3DX2 A;  2RAJ A;  3CZN A;  3EJR A;  3BVU A;  1URU A;  2O0I 1;  3RV0 A;  2V14 A;  3HAH A;  4EZZ A;  3BLB A;  1SU6 A;  4AZC A;  3QA8 A;  3BUD A;  3Q0K A;  4HR1 A;  2QKW A;  1I4T A;  4AZ9 A;  1E1D A;  3ERC C;  2ND0 A;  1W9M A;  2F7O A;  2D1L A;  3OWG A;  3B53 X;  4JNE A;  1HWW A;  2IWL X;  3F7W A;  4JN4 A;  4ON3 A;  2OW6 A;  4EZN A;  1ZWW A;  4B9Q A;  4G6Q A;  2CZO A;  3T4A G;  2Z0V A;  3O3O B;  2FIC A;  3ER9 B;  4WPE A;  1GD5 A;  2X3V A;  3KAW A;  2ALW A;  4JWI A;  1OA0 A;  3BUB A;  1MJG A;  3I01 A;  1TQT A;  3A98 A;  2LXY A;  4OXW A;  2LM0 A;  3L3O M;  3PLT A;  4NQI A;  3SOG A;  2RED A;  2D4C A;  1R34 A;  3DYT A;  3T49 A;  4I1Q A;  1I4D A;  3HAJ A;  4PZG A;  3L3P A;  4JLC A;  3QE6 A;  2YKT A;  2F7P A;  2JNK A;  4PO2 A;  2GA9 D;  3T47 A;  3BVX A;  1KQ6 A;  5C5B B;  3D2E A;  4F00 A;  1TQS A;  4FM3 A;  1JQK A;  3HAI A; 
#chains in the Genus database with same CATH homology
 1H6H A;  4ATM A;  2RAJ A;  4AKV A;  1URU A;  5C5B A;  2ETT A;  2V14 A;  4P2J A;  3HAH A;  4DCN C;  2Q12 A;  1XTN A;  4P2I A;  2REA A;  2Z0O A;  2RAK A;  1KMD A;  2YPS A;  3Q0K A;  2L73 A;  1I4T A;  1WDZ A;  4AZ9 A;  1I4L A;  3HPC X;  3LLL A;  2D1L A;  2EFL A;  1I49 A;  2IWL X;  3IQ2 A;  3ABH A;  4H8S A;  3LUI A;  3P0C A;  4ON3 A;  4IKB B;  2I4K A;  2V6V A;  2C08 A;  2DYB A;  1ZWW A;  2CZO A;  2Z0V A;  3HPB A;  2X3W A;  1XTE A;  2FIC A;  3CAZ A;  1OCS A;  4WPC A;  4WPE A;  1GD5 A;  2X3V A;  3ACO A;  4PQO A;  3QWE A;  4DYL A;  4IKD A;  4OXW A;  2Z0N A;  3M3W A;  1OCU A;  2X3X A;  2ELB A;  4NSW A;  3OK8 A;  3PLT A;  4NQI A;  2WWE A;  2EFK A;  3SOG A;  4IKB A;  1O7K A;  2RED A;  2D4C A;  4FZS A;  3DYT A;  3SYV A;  4I1Q A;  1I4D A;  3HAJ A;  1X04 A;  4PZG A;  2V0O A;  3QE6 A;  3G9G A;  3Q84 A;  3QNI A;  2YKT A;  4AVM A;  2AR5 A;  4HAS A;  3I2W A;  2CSK A;  4BNE A;  1Y2O A;  2Q13 A;  2RAI A;  1KQ6 A;  3FOG A;  4BGJ A;  4PQP A;  5C5B B;  3HAI A;  1X03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...