4AKVA

Crystal structure of human sorting nexin 33 (snx33)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
363
structure length
345
Chain Sequence
b'MYSIEMGPRGPQWKANPHPFACSVEDPISYKLTPTHAASPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSAFQAISHSFQMDPPFCSEALNSAISHTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMYDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SORTING NEXIN-33
publication title Structure of Human Sorting Nexin 33
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 140
structure length 345
sequence length 363
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4akvA02
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 4akvA01
4AVMA 1ZWWA 2CSKA 2ELBA 4DCNC 1I4DA 4PZGA 2DYBA 4I1QA 3HAJA 2Z0NA 1I4TA 3PLTA 2V6VA 2L73A 1I49A 1Y2OA 5C5BB 3P0CA 3HAIA 2RAIA 3M3WA 1GD5A 3QE6A 1XTEA 3SYVA 3LLLA 2X3XA 1URUA 2C08A 1I4LA 3IQ2A 1X03A 1X04A 4IKBB 2D4CA 4H8SA 1KMDA 1XTNA 2EFLA 4OXWA 1OCUA 3OK8A 2EFKA 4PQPA 2REAA 3FOGA 4ON3A 4FZSA 2V14A 3G9GA 2X3WA 4PQOA 3LUIA 2Z0OA 2I4KA 4AZ9A 3Q84A 2CZOA 4NQIA 3SOGA 4P2JA 1OCSA 1WDZA 3I2WA 3QWEA 3CAZA 5C5BA 2D1LA 3QNIA 2Z0VA 4DYLA 2WWEA 4WPCA 4AKVA 2FICA 4BGJA 2X3VA 3Q0KA 3HPBA 2Q12A 4BNEA 2IWLX 4ATMA 2RAJA 3DYTA 2Q13A 3HPCX 1H6HA 4IKBA 2YKTA 2V0OA 4P2IA 3ABHA 2RAKA 2ETTA 2AR5A 2REDA 4HASA 4NSWA 1O7KA 4WPEA 3ACOA 4IKDA 1KQ6A 2YPSA 3HAHA
chains in the Genus database with same CATH superfamily
2OBLA 2CSKA 4I1QA 1YWMA 3HAJA 3DX4A 3PLTA 3B52X 2EX3B 3P0CA 1E9VA 2FYVA 1UPXA 3L3OM 2Z8YA 3QE6A 2RT6A 4UDXX 1TQWA 2ALWA 4IWOA 3C7NA 3D50A 1URUA 4FM3A 3ERCC 3BUDA 3BLBA 2X5CA 2EFLA 3BVWA 4OXWA 1OCUA 3O3OB 3ER9B 4FZPA 3CV5A 4PQOA 2PY6A 4R5JA 1OAOA 3D51A 4AZ9A 3DX3A 5TKYA 3FD9A 4IWQA 4NQIA 3LVTA 4P2JA 1GNTA 1WDZA 2F1AA 3EJQA 5KBPA 5E84A 1R34A 3ER8C 4F00A 2Z0VA 4EZRA 1SU7A 4H6HA 4JL9A 4EZTA 2X3VA 4AZ5A 4HR1B 3HPCX 3L3PA 1H6HA 3OWGA 3ABHA 3RV0A 2PMRA 4NSWA 4UDYX 1MJGA 4EZZA 3DPPA 2YL5A 4AZBA 1O7DB 2DYBA 3BVVA 3DPOA 1I4TA 3BUBA 5C5BB 3HAIA 2RAIA 3M3WA 4AZ6A 4JWDA 3EJTA 4IM0A 3D4ZA 3IQ2A 3F7WA 2YL6A 2ZXQA 3D52A 4JN4A 3T46A 1KMDA 4IM2A 1DKZA 4AZCA 3LMFA 3DDFA 3T48A 4AZIA 4NPHA 4JWIA 3KAVA 2REAA 4R5IA 4ON3A 2OW7A 4FZSA 3G9GA 3DX2A 4IWPA 2YLLA 1OA1A 2OZNB 3OHXM 3Q84A 4AZHA 4M0MA 4HY9A 3I04A 1O7DC 3SOGA 1OA0A 4IM3A 2GF4A 4EZQA 3O3MB 2GA9D 2F18A 4AZ7A 1E1DA 2LXYA 2OW6A 3BVUA 3QNIA 5FIGA 4JWEA 2YLAA 2F7RA 1QX1A 1U00A 2FICA 4AKVA 3Q0KA 3VEAA 2JNSA 2QXLA 2YL8A 4IKBA 4P2IA 3I39X 2ETTA 2YIBA 2F7OA 2GAFD 4WPEA 2KHOA 3ACOA 4IKDA 4JNEA 3DX0A 4EZOA 1ZWWA 1TQSA 2N3KA 4DCNC 1GN9A 2EWFA 1HXKA 2Z0NA 2L73A 1Y2OA 2OO2A 3BUPA 3BVXA 1XTEA 3BVTA 3SYVA 1GNLA 3VEBA 3LLLA 4EZWA 3KDRA 1E2UA 3KAWA 2C08A 1X03A 2D4CA 1XTNA 3OK8A 2YI9A 3D2EA 3I01A 1TQVA 4PQPA 4JLCA 4B9QA 2WYHA 4EZSA 3FOGA 2F7QA 4PO2A 1QWUA 3CZSA 4R5KA 3RV1A 3DDGA 3LUIA 4FZOA 2Z0OA 4F01A 2I4KA 2YIAA 4D8JA 2CZOA 2O0I1 4H6IA 4EZXA 3T4AG 1OCSA 1PS3A 3UITA 3A98A 2OBMA 3I2WA 3B53X 4KIKA 2WINM 2QFFA 1LQ7A 3QWEA 4G6QA 3QNJA 3CAZA 1R33A 2D1LA 2LM0A 3BUIA 4AZCB 3QA8A 2WWEA 3T49A 4BGJA 3EJRA 4KIKB 3D2FA 4ATMA 2RAJA 1TQTA 3DYTA 2F7PA 3O3NB 2YKTA 3EJUA 4HYBA 2AR5A 1W9MA 1O7KA 3T47A 2ND0A 2JNKA 1SU6A 2YPSA 2NCZA 4R5GA 4AVMA 1SU8A 2ELBA 4PZGA 1I4DA 4EZVA 2YIVX 2V6VA 1I49A 1JQKA 4E81A 1GD5A 1SUFA 3CVRA 2X3XA 1I4LA 3B51X 4AZGA 1X04A 4IKBB 1HWWA 4H8SA 4EZPA 3EJPA 3CKDA 2EFKA 3EJSA 4E3CA 3VKHA 3D4YA 4HR1A 4EZUA 2MI7A 4JWCA 2V14A 2F1BA 4JNFA 5FLEX 2X3WA 1QWNA 2YL9A 2YI8A 4EZNA 4R5LA 2ND1A 3RPMA 2WYIA 3GI7A 1TQUA 1ZYLA 5C5BA 2QKWA 4DYLA 3DPQA 1DKYA 4IW0A 4WPCA 4EZYA 3ZEDA 1HTYA 3HPBA 2Q12A 3CZNA 4BNEA 2IWLX 3DX1A 2Q13A 1R5EA 3BUQA 2V0OA 1DKXA 2RAKA 2REDA 4HASA 1KQ6A 3HAHA
chains in the Genus database with same CATH topology
4AVMA 1ZWWA 2CSKA 2ELBA 4DCNC 1I4DA 4PZGA 2DYBA 4I1QA 3HAJA 2Z0NA 1I4TA 3PLTA 2V6VA 2L73A 1I49A 1Y2OA 5C5BB 3P0CA 3HAIA 2RAIA 3M3WA 1GD5A 3QE6A 1XTEA 3SYVA 3LLLA 2X3XA 1URUA 2C08A 1I4LA 3IQ2A 1X03A 1X04A 4IKBB 2D4CA 4H8SA 1KMDA 1XTNA 2EFLA 4OXWA 1OCUA 3OK8A 2EFKA 4PQPA 2REAA 3FOGA 4ON3A 4FZSA 2V14A 3G9GA 2X3WA 4PQOA 3LUIA 2Z0OA 2I4KA 4AZ9A 3Q84A 2CZOA 4NQIA 3SOGA 4P2JA 1OCSA 1WDZA 3I2WA 3QWEA 3CAZA 5C5BA 2D1LA 3QNIA 2Z0VA 4DYLA 2WWEA 4WPCA 4AKVA 2FICA 4BGJA 2X3VA 3Q0KA 3HPBA 2Q12A 4BNEA 2IWLX 4ATMA 2RAJA 3DYTA 2Q13A 3HPCX 1H6HA 4IKBA 2YKTA 2V0OA 4P2IA 3ABHA 2RAKA 2ETTA 2AR5A 2REDA 4HASA 4NSWA 1O7KA 4WPEA 3ACOA 4IKDA 1KQ6A 2YPSA 3HAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVM A;  1ZWW A;  2CSK A;  2ELB A;  4DCN C;  1I4D A;  4PZG A;  2DYB A;  4I1Q A;  3HAJ A;  2Z0N A;  1I4T A;  3PLT A;  2V6V A;  2L73 A;  1I49 A;  1Y2O A;  5C5B B;  3P0C A;  3HAI A;  2RAI A;  3M3W A;  1GD5 A;  3QE6 A;  1XTE A;  3SYV A;  3LLL A;  2X3X A;  1URU A;  2C08 A;  1I4L A;  3IQ2 A;  1X03 A;  1X04 A;  4IKB B;  2D4C A;  4H8S A;  1KMD A;  1XTN A;  2EFL A;  4OXW A;  1OCU A;  3OK8 A;  2EFK A;  4PQP A;  2REA A;  3FOG A;  4ON3 A;  4FZS A;  2V14 A;  3G9G A;  2X3W A;  4PQO A;  3LUI A;  2Z0O A;  2I4K A;  4AZ9 A;  3Q84 A;  2CZO A;  4NQI A;  3SOG A;  4P2J A;  1OCS A;  1WDZ A;  3I2W A;  3QWE A;  3CAZ A;  5C5B A;  2D1L A;  3QNI A;  2Z0V A;  4DYL A;  2WWE A;  4WPC A;  4AKV A;  2FIC A;  4BGJ A;  2X3V A;  3Q0K A;  3HPB A;  2Q12 A;  4BNE A;  2IWL X;  4ATM A;  2RAJ A;  3DYT A;  2Q13 A;  3HPC X;  1H6H A;  4IKB A;  2YKT A;  2V0O A;  4P2I A;  3ABH A;  2RAK A;  2ETT A;  2AR5 A;  2RED A;  4HAS A;  4NSW A;  1O7K A;  4WPE A;  3ACO A;  4IKD A;  1KQ6 A;  2YPS A;  3HAH A; 
#chains in the Genus database with same CATH topology
 2OBL A;  2CSK A;  4I1Q A;  1YWM A;  3HAJ A;  3DX4 A;  3PLT A;  3B52 X;  2EX3 B;  3P0C A;  1E9V A;  2FYV A;  1UPX A;  3L3O M;  2Z8Y A;  3QE6 A;  2RT6 A;  4UDX X;  1TQW A;  2ALW A;  4IWO A;  3C7N A;  3D50 A;  1URU A;  4FM3 A;  3ERC C;  3BUD A;  3BLB A;  2X5C A;  2EFL A;  3BVW A;  4OXW A;  1OCU A;  3O3O B;  3ER9 B;  4FZP A;  3CV5 A;  4PQO A;  2PY6 A;  4R5J A;  1OAO A;  3D51 A;  4AZ9 A;  3DX3 A;  5TKY A;  3FD9 A;  4IWQ A;  4NQI A;  3LVT A;  4P2J A;  1GNT A;  1WDZ A;  2F1A A;  3EJQ A;  5KBP A;  5E84 A;  1R34 A;  3ER8 C;  4F00 A;  2Z0V A;  4EZR A;  1SU7 A;  4H6H A;  4JL9 A;  4EZT A;  2X3V A;  4AZ5 A;  4HR1 B;  3HPC X;  3L3P A;  1H6H A;  3OWG A;  3ABH A;  3RV0 A;  2PMR A;  4NSW A;  4UDY X;  1MJG A;  4EZZ A;  3DPP A;  2YL5 A;  4AZB A;  1O7D B;  2DYB A;  3BVV A;  3DPO A;  1I4T A;  3BUB A;  5C5B B;  3HAI A;  2RAI A;  3M3W A;  4AZ6 A;  4JWD A;  3EJT A;  4IM0 A;  3D4Z A;  3IQ2 A;  3F7W A;  2YL6 A;  2ZXQ A;  3D52 A;  4JN4 A;  3T46 A;  1KMD A;  4IM2 A;  1DKZ A;  4AZC A;  3LMF A;  3DDF A;  3T48 A;  4AZI A;  4NPH A;  4JWI A;  3KAV A;  2REA A;  4R5I A;  4ON3 A;  2OW7 A;  4FZS A;  3G9G A;  3DX2 A;  4IWP A;  2YLL A;  1OA1 A;  2OZN B;  3OHX M;  3Q84 A;  4AZH A;  4M0M A;  4HY9 A;  3I04 A;  1O7D C;  3SOG A;  1OA0 A;  4IM3 A;  2GF4 A;  4EZQ A;  3O3M B;  2GA9 D;  2F18 A;  4AZ7 A;  1E1D A;  2LXY A;  2OW6 A;  3BVU A;  3QNI A;  5FIG A;  4JWE A;  2YLA A;  2F7R A;  1QX1 A;  1U00 A;  2FIC A;  4AKV A;  3Q0K A;  3VEA A;  2JNS A;  2QXL A;  2YL8 A;  4IKB A;  4P2I A;  3I39 X;  2ETT A;  2YIB A;  2F7O A;  2GAF D;  4WPE A;  2KHO A;  3ACO A;  4IKD A;  4JNE A;  3DX0 A;  4EZO A;  1ZWW A;  1TQS A;  2N3K A;  4DCN C;  1GN9 A;  2EWF A;  1HXK A;  2Z0N A;  2L73 A;  1Y2O A;  2OO2 A;  3BUP A;  3BVX A;  1XTE A;  3BVT A;  3SYV A;  1GNL A;  3VEB A;  3LLL A;  4EZW A;  3KDR A;  1E2U A;  3KAW A;  2C08 A;  1X03 A;  2D4C A;  1XTN A;  3OK8 A;  2YI9 A;  3D2E A;  3I01 A;  1TQV A;  4PQP A;  4JLC A;  4B9Q A;  2WYH A;  4EZS A;  3FOG A;  2F7Q A;  4PO2 A;  1QWU A;  3CZS A;  4R5K A;  3RV1 A;  3DDG A;  3LUI A;  4FZO A;  2Z0O A;  4F01 A;  2I4K A;  2YIA A;  4D8J A;  2CZO A;  2O0I 1;  4H6I A;  4EZX A;  3T4A G;  1OCS A;  1PS3 A;  3UIT A;  3A98 A;  2OBM A;  3I2W A;  3B53 X;  4KIK A;  2WIN M;  2QFF A;  1LQ7 A;  3QWE A;  4G6Q A;  3QNJ A;  3CAZ A;  1R33 A;  2D1L A;  2LM0 A;  3BUI A;  4AZC B;  3QA8 A;  2WWE A;  3T49 A;  4BGJ A;  3EJR A;  4KIK B;  3D2F A;  4ATM A;  2RAJ A;  1TQT A;  3DYT A;  2F7P A;  3O3N B;  2YKT A;  3EJU A;  4HYB A;  2AR5 A;  1W9M A;  1O7K A;  3T47 A;  2ND0 A;  2JNK A;  1SU6 A;  2YPS A;  2NCZ A;  4R5G A;  4AVM A;  1SU8 A;  2ELB A;  4PZG A;  1I4D A;  4EZV A;  2YIV X;  2V6V A;  1I49 A;  1JQK A;  4E81 A;  1GD5 A;  1SUF A;  3CVR A;  2X3X A;  1I4L A;  3B51 X;  4AZG A;  1X04 A;  4IKB B;  1HWW A;  4H8S A;  4EZP A;  3EJP A;  3CKD A;  2EFK A;  3EJS A;  4E3C A;  3VKH A;  3D4Y A;  4HR1 A;  4EZU A;  2MI7 A;  4JWC A;  2V14 A;  2F1B A;  4JNF A;  5FLE X;  2X3W A;  1QWN A;  2YL9 A;  2YI8 A;  4EZN A;  4R5L A;  2ND1 A;  3RPM A;  2WYI A;  3GI7 A;  1TQU A;  1ZYL A;  5C5B A;  2QKW A;  4DYL A;  3DPQ A;  1DKY A;  4IW0 A;  4WPC A;  4EZY A;  3ZED A;  1HTY A;  3HPB A;  2Q12 A;  3CZN A;  4BNE A;  2IWL X;  3DX1 A;  2Q13 A;  1R5E A;  3BUQ A;  2V0O A;  1DKX A;  2RAK A;  2RED A;  4HAS A;  1KQ6 A;  3HAH A; 
#chains in the Genus database with same CATH homology
 4AVM A;  1ZWW A;  2CSK A;  2ELB A;  4DCN C;  1I4D A;  4PZG A;  2DYB A;  4I1Q A;  3HAJ A;  2Z0N A;  1I4T A;  3PLT A;  2V6V A;  2L73 A;  1I49 A;  1Y2O A;  5C5B B;  3P0C A;  3HAI A;  2RAI A;  3M3W A;  1GD5 A;  3QE6 A;  1XTE A;  3SYV A;  3LLL A;  2X3X A;  1URU A;  2C08 A;  1I4L A;  3IQ2 A;  1X03 A;  1X04 A;  4IKB B;  2D4C A;  4H8S A;  1KMD A;  1XTN A;  2EFL A;  4OXW A;  1OCU A;  3OK8 A;  2EFK A;  4PQP A;  2REA A;  3FOG A;  4ON3 A;  4FZS A;  2V14 A;  3G9G A;  2X3W A;  4PQO A;  3LUI A;  2Z0O A;  2I4K A;  4AZ9 A;  3Q84 A;  2CZO A;  4NQI A;  3SOG A;  4P2J A;  1OCS A;  1WDZ A;  3I2W A;  3QWE A;  3CAZ A;  5C5B A;  2D1L A;  3QNI A;  2Z0V A;  4DYL A;  2WWE A;  4WPC A;  4AKV A;  2FIC A;  4BGJ A;  2X3V A;  3Q0K A;  3HPB A;  2Q12 A;  4BNE A;  2IWL X;  4ATM A;  2RAJ A;  3DYT A;  2Q13 A;  3HPC X;  1H6H A;  4IKB A;  2YKT A;  2V0O A;  4P2I A;  3ABH A;  2RAK A;  2ETT A;  2AR5 A;  2RED A;  4HAS A;  4NSW A;  1O7K A;  4WPE A;  3ACO A;  4IKD A;  1KQ6 A;  2YPS A;  3HAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...