4AL6A

Crystal structure of the s148acsy4-crrna complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
189
structure length
157
Chain Sequence
FTMDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAALDLPFVTLRAQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSY4 ENDORIBONUCLEASE
publication title Csy4 Relies on an Unusual Catalytic Dyad to Position and Cleave Crispr RNA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/rna
total genus 32
structure length 157
sequence length 189
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09618 Cas_Csy4 CRISPR-associated protein (Cas_Csy4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2540 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4al6A00
2XLJA 2XLKA 4AL7A 4AL6A 4AL5A 2XLIA
chains in the Genus database with same CATH superfamily
2LU1A 2ADCA 5J2QA 1T0TV 3MECB 2HPUA 1JKHB 1RQ0A 2DH8A 2BM0A 3HSDA 1WC0A 4DJBA 4J9SA 5IT9U 2L9WA 3CVKA 2VG5A 1Q5VA 4GO5X 5EN1A 3U02A 4ZCKA 4ES1A 1EQ0A 3CJKA 2JZ5A 3UD5A 1A0OB 5AXMA 1YJ7A 2KFZA 1XWLA 1P8GA 4ZIVA 2DGOA 5C2CA 2RDJA 1N36F 3W2VA 4FBTA 2X1GA 1Q78A 4ZLNA 1CEZA 3QBCA 2C3OA 1FVQA 2J6UA 2ERRA 4LVNP 1UA0A 3BSCA 4C8OA 1FHTA 2QL9B 1RACB 2J5AA 2OTLS 1HW8A 4B3SF 1HD1A 4CYUA 2A3JA 1U1RA 5KFMA 1R0CB 2PMWA 2B6AA 3R2CJ 4ZKAA 4M1KA 2H48B 4RL1A 4JYAF 3EPIA 1JLCA 3G9CA 5HMYA 1IN0A 3BKTA 3KHGA 1FKOA 2ASLA 4Y0FA 2QEXS 2CJ9A 3THVA 4IOBA 3KG4A 4X4VA 5CD4H 3L7UA 1WI6A 3NOCA 2NUUG 4AUKA 1UEKA 1AFIA 2YKNA 3QIDA 4K4XA 5KT2A 4RUBA 2J6TA 3D67A 2JHEA 2WVFA 3KJVB 1EKRA 3UDEA 1Y4ZB 2W7AA 3R97A 3TZXA 4IFVB 4GVLA 1X4FA 2CNKB 3D6MB 1OYDA 3HT3A 4ZVPB 1MWQA 3CDAA 4WZMA 5H1SV 4WTOB 3VCDA 5HLFA 4C8YA 1NSQA 4K4UA 1NDCA 2W7PA 4C9DA 4X2BA 3HFKA 3KFWX 1QAJA 2BABA 3OHBA 3KLFB 4G3IA 1VC0A 1Y00A 2MMYA 2Z2LA 1XTZA 4DR2J 5C2GA 1YJ9S 3LPYA 4CO2A 4PYDA 3HMJG 3D7SB 4USUA 3MAHA 5GAEI 4UY85 2EKNA 2VJUA 2B8QA 2KFYA 1LWEA 5IWAJ 1KC8T 4RW4B 4MK7A 5KFRA 4YR0A 3P8BB 1RTJB 3I5CA 3AJDA 1EARA 4ZA1A 5IC6B 1QVFR 1H38A 5ETSA 2QMWA 2RRAA 1RSCA 4B9MA 2VU5A 3HHLC 4NXNJ 1T9XA 4TVAB 5LJ5Y 4WP3A 1HNXJ 1P6TA 5D15A 3HSJA 5K8OA 4OJHA 2LEPA 5I42A 4DV7F 1R8CA 5LMUF 3CCWA 1UVIA 1CBKA 2NZ4A 1CQMA 2OO4A 1IKVA 2J76E 3JS9A 4CLUA 1TL1B 3IC1A 3IGNA 3PKMA 2E7WA 3H8YA 4EZ6A 3ENAA 2ZZNA 2PSZA 1OSCA 1C0TB 1KOOA 1ZOTA 2W2PP 2DCUB 3OVAA 5IT4A 4TKTA 4LSLB 1LQ9A 3GSDA 3CCZA 1LW0B 3FBFA 2P9GA 3NGSA 3SDEA 1HWJA 3BM7A 5KG4A 4F0HA 3FEYB 2R3VA 3QJJA 3Q8SB 2SXLA 4JI7F 1M1HA 3JSRA 3GIRA 3L95X 4B02A 3W8GA 1SV5A 4H4MA 3BBFA 2RIJA 1YRUA 2HG4A 2HZCA 1V3SA 5LSLA 1KRPA 1YRTA 2YX7A 2X3DA 4NOHA 1T9WA 5CYMA 2YVSA 2JFDA 4H4KA 3GFZA 3W3SA 1MSWD 3HHEA 3CJ3A 1FTRA 3DOMB 3PG9A 4R0JA 4MFBA 1HKAA 5CXTA 2W9BB 3RGIA 3TZWA 3HM9A 2GFFA 4NRUA 4L73A 2FHJD 1K9MT 1CS4A 4KV8A 4RNMA 1KS2A 1ELOA 1Q0NA 3E3XA 2RRNA 2XMVA 2AJFE 2HEKA 1EZZB 4OYBA 1M5VC 3EUNA 4KPCA 1I6JA 3H25A 2BKPA 4MYTA 2Q79A 1WC4A 4Z7CA 4NXMJ 2KU7A 2VFUA 2GMLA 3P45B 1RZMA 4KHMA 3MMBA 2VQEJ 1S1UA 4DQIA 2RNEA 5GAGU 1U25A 4ELVA 4OZ5A 4OHVA 1YWXA 3HVRA 5KFNA 2HNYB 1HIYA 5F8IA 1Y9OA 4AYBD 3KHHA 1W25A 1OQ3A 4NWBA 4WYLA 1PJ5A 1W26A 4K4WA 2G4BA 2EBGA 3FRZA 4O44A 4R5PB 3P96A 4RWXA 1MW7A 1S6PB 2ZNYA 3JQKA 1X60A 5GADI 4DOZA 3D68A 3SFGA 3MM5B 5HJYA 4RZRA 4ZLJA 2Q6CA 1S6OA 4TQSA 3TANA 3O3LA 5J2PB 1RWXB 3I56S 1ICEB 3MM8A 5HL7Q 2NCKL 3WHIA 4CQ1A 2WAQD 3CWJA 1VQ7S 1NZ8A 1MNEA 2J9EA 4NYZA 5DQHA 2HAIA 4AQYJ 4H54A 5AT1B 2PIIA 3OFHA 4LRDA 4ED8A 2V8GA 3A1YG 2BKNA 4N7TA 5AE1A 1N5VA 3IXQA 2NQPA 4C0BA 4KJIA 2L9DA 2K3IA 1Y5LB 2JEJA 2XTJP 2V8HA 2AT1B 4X4OA 2ROPA 1FRLA 2VKZG 3TAQA 3J81U 2W9CA 1QY7A 3MECA 1C2PA 3V6HA 1NB7A 1JKHA 1F3VA 2V4RA 4PR6A 2Y3YA 2DIVA 2VQFF 2KFNA 3QGGA 3VAJA 1X31C 3GIMA 4ZN3A 2CZVC 2A18A 1REGX 4JV5F 4NYOA 3AODA 2H3EB 2OPSB 1URNA 4ELUA 2WONB 3KMSA 1U6FA 4ZPDA 5ETPA 4YB5A 2QA4S 2A10A 4URGA 2V4QA 1FX4A 1CPZA 2DNGA 2MKIA 1TV6A 3BR9A 3VR1A 1JX4A 1WWHA 4K2XA 2E5HA 4CM2A 2QZ8A 4B3RF 4DX8H 1RKJA 1OQ6A 2F8HA 2W2QP 3P4UB 3SQGB 1T03B 4DR3F 1UVKA 1FNOA 1RTDB 1RHMB 3QJLA 2HFNA 3MPYA 3MCNA 4USIA 2QFJA 3OFEA 1XNQJ 1Y5NB 2QSFA 3LTOA 4QW9A 2XHWA 5DRKA 2NZCA 4P71A 4DR6F 1FK9A 1FVSA 4EEYA 1ZBTA 4NZ7A 2V8VA 1FTCA 2VFRA 1XMBA 2EEYA 4NLTA 2PI4A 4B3MJ 1WDTA 1DJ0A 1L3VA 1BLUA 2BW2A 4K0KF 4DR1J 5KG5A 1H7XA 1U0HB 2OP5A 5ETMA 1UAWA 1OPZA 2HS4A 2YNFB 3J7YU 1B64A 4EO6A 4LF5F 5B0GA 5JVHQ 1FERA 1YRXA 4ES2A 1WHWA 3KJVA 5B09A 2VBZA 3W62A 2UUBF 1KTQA 2IYIA 5DDOC 5DDQC 1UVJA 1NK0A 1S0VA 1QD1A 4KGXB 1X4CA 4NLUA 4LF6J 3KJFB 3UW1A 2CIMA 1VBYA 5DLGA 4GKJJ 4GKKJ 3V2UC 2NS1B 2HHXA 1GEHA 1JJCB 5LL6d 1S59A 3TA0A 3A3OB 1N54B 1AT1B 5K14A 4FXVA 2YX4A 4F3OA 4O3RA 1NKCA 2GA7A 2FVQA 3T1HJ 4NA2A 2HHSA 1WOPA 4EUVA 1R8PA 3DNCA 4CLYA 1YG0A 1FEEA 3D6FB 5HMWA 2ZHAA 3IWXA 1VBXA 4CO4A 1HI1A 2MQLA 4WYWA 4HYKA 3KNAA 3HCXA 2DYAA 1CG2A 4B9LA 1XNRF 5T41A 3V81A 3VVUA 4RW4A 2PE8A 1RTJA 4Q8FA 3OT9A 4DL4A 2XSJA 4ZP7A 1TUWA 4NEYA 4P2XA 1X5OA 2J9DE 2G2OA 3I96A 3N28A 5ETOA 3CD6S 4P2MA 3J7A1 4HVZA 2DNQA 2KI2A 4RW9B 2ZH9A 2CKWA 3A12A 5J2NB 1PAEX 4PG8A 4UUWA 2GJ2A 3MF5A 4RUHA 5FDLB 1P9QC 3MAAB 2V94A 1TL1A 3NCQA 3RJMB 3B82A 2DEIA 3MCSA 4DLGA 2MZ1A 3SXLA 1TKTB 4LIWA 3RBZA 4FS1A 2VA3A 2OPQB 2BEFA 4JOUA 1S76D 5CZXA 2AHOB 1NEEA 1JJ4A 5KT4A 4LFCF 3OQ2A 1TP7A 2B4UA 3U1LA 1C0TA 4LRBA 4I2PB 4LSLA 5DGAA 4WCEQ 3CCLS 3NRBA 2VPWB 1LW0A 3WZ0A 2UXBJ 4HH1A 3T6BA 1U24A 4ZJLA 4DPWA 1RLCL 3Q86A 2HGMA 4NZ0A 1ZM3A 1J5EJ 4C4WA 4ECRA 3EGNA 4K50A 4MTPA 5B0BA 2MY7A 3DFEA 1RE1B 4CM0A 3JTPA 2LDYA 2VBWA 2C28A 3M05A 2HFUA 2KXNB 2MKSA 2XM3A 1QJHA 2O66A 1T02A 1IR0A 4K59A 4UQGA 2W9BA 2AEFA 2VDHA 5D0HA 3P49B 1FA0A 1JJHA 4O4GA 2AMCB 1XIQA 3PRVA 3BZQA 2ZVSA 1NK8A 3C2PA 4NLXA 1XR6A 2IVYA 5D0GA 4DR4F 1VRTA 2Q3PA 1UETA 2GNKA 3K5MA 2L48A 1WNEA 1H3DA 4I6AA 2GIFA 1S48A 2UXCF 5D8HB 4ES3A 3Q2SC 1QAIA 4KFBA 4JP8A 4CLSA 3KG0A 3TQ1A 1BD6A 5L1KA 2HNYA 1NJIT 4UF4A 1JB0C 2LECA 1YITS 3M1VB 1JIHA 4YEAA 1EP4A 1GMVA 4C97A 2IVMA 2C3UA 2P9EA 1KDNA 3G6XA 4IRKA 1RXOB 1GTHA 1RT2A 1G4CA 2KG0A 2FGOA 3MDFA 1HI8A 1MMDA 4OYXA 3NKYA 1T9YA 2ZNZA 2VPYB 1WEZA 1S6PA 2OIHA 1U4BA 3MM5A 4C0HA 1IJEB 1L3KA 3GQCA 4V19J 1IBKJ 4LBIA 5E5NA 3GSIA 4Y2CA 2XMWA 3S6EA 2GQCA 5J2PA 1KVKA 2AKWB 1TKXB 4B9VA 2G9OA 5ETLA 1YIJS 3R1HA 4I67A 2E1MC 3I9ZA 5C42A 4JI2J 3FUYA 1VGYA 4YFUA 5IV3A 2FJAB 2H5JB 1S0OA 4QR0A 2BJ1A 2H65B 5G0RB 2L3MA 3ISND 1G3OA 3W64A 4OI2A 4UW2A 4U7CA 3CT9A 1TL3B 4Y34A 2V50A 2KXHA 1SH3A 1X9WA 3WC0A 3X1LB 2DNOA 5F41A 3L9ZA 1UL3A 2DIUA 2FLOA 4LRFA 3TA1A 3EVWA 2RS8A 1M1KT 2UU9J 1R8AA 2OEJA 2F3JA 2MYFA 4ZHRB 1TK8A 2RUSA 3MPDA 3RR8A 1P27B 4NLSA 3CIZA 2EFNA 3S7RA 2MQQA 3TAPA 1R0AA 1FDNA 5HN0A 2VF3A 2ASYA 2V4JB 4LF8J 2GVDA 2OPSA 5A6PA 2WONA 1BUXA 1NO8A 4MKBA 3CC4S 3D66A 5KFQA 2IVFB 1Z2ZA 2ASDA 1FNMA 2Y9HA 4P10A 4K8RA 2H54B 1U2FA 4PG5A 1R31A 2NREA 1TAQA 2B3TB 2MSTA 3SQGA 1DRZA 3JAMU 5LMNJ 3CMES 4I69A 4ZMMA 3BO4A 1RTDA 3E01B 4E98A 3QWPA 2W8LA 3G8TA 1VQ4S 5A8RB 1QSLA 4TYAA 3OUYB 3Q89A 3GLJA 4HHUA 1B4SA 1VBZA 5D3GB 2HQCA 3IG1B 5L1LA 1O6XA 4WU2A 2ZOMA 4OZ3A 4IQMA 4DSKA 4DG1A 4X4UA 3MR7A 4A8KA 1X4DA 2X7IA 1H6KX 2HHPA 2P6TA 3Q8RB 1PGZA 4LSZB 2R7RA 2M70A 4EZ9A 4I7FB 1U0HA 1T94A 1S7HA 2HBQB 4DFJA 4PRFA 2HS3A 5I3UA 1V5VA 2NXCA 4EWTA 4FYVB 1HNIB 4P52A 4I6YA 2YNFA 2C2RA 1JLQB 3J7ZT 3DGVA 1XMOF 5HJXA 1G7CB 4QR2A 2DHXA 2A6OA 5BJRA 5D6GA 1KWMA 3HFZB 4FXWA 3I4PA 3AJ2A 2HVEA 3T1YF 3C19A 4OFZA 2OH2A 4X65F 4RNOA 1KONA 2FLLA 2ZWPA 5HVGA 2GV1A 2ROEA 2YX1A 1ITPA 1GX5A 2IFXA 5KT3A 2OAUA 3R7BB 1VQNS 1Y3KA 3FBCA 4JI4J 3DRYA 2BQ3A 1VHFA 2NXEA 2FQQB 1VR6A 4J37A 2RF2A 4P2SA 1MLAA 3BN7A 3D9BA 2KXFA 4ZVEA 2CDRB 4DR5J 4I1TA 2QV6A 1DLOB 2K7JA 3GV7B 1WHXA 3WDOA 5A0YB 3IS9A 3CCTA 1NM2A 2OPPB 3J80U 2WRMA 3R5GA 2XYPB 1N34J 1GAOA 2HQDA 4NRTA 1MN7A 2R4FA 3HHKA 3EGWB 3NS6A 4DV4F 3W9IA 1VK8A 2JLGA 1HWKA 4N47A 3DCAA 3HVWA 1JWWA 5F0UA 2FDNA 2DVIA 1PCAA 1IKYB 3KK1A 2M2BA 1EX8A 4RW9A 3LA0A 2N3LA 2WVEA 5J2NA 4DF4A 4NCAA 3PHEA 2NPFA 1HNVB 3L7OA 1QSYA 3MM7B 3MAAA 1NH7A 1YJWS 1S1VB 2ATLA 2F8MA 4ENOA 4MT1A 1MMNA 1TKTA 4RUAA 1X7VA 2ZD1B 4WBFA 2OPQA 4TNOA 3AQPA 4E0DA 2CQ1A 2YXLA 4YUDA 4G65A 1ZAXA 4M95A 4I2PA 3GFXA 3R5AA 4DX5A 3OTBA 2OMOA 1LWCB 4FVMA 3PO4A 8RUCA 2CFXA 5D0RA 1X9MA 2YKPA 2NSCA 2MKHA 3BKUA 3OFGA 1VQ8S 4Z7YA 3HHNB 1RYSA 4M63A 4J7CA 4ER8A 1SJQA 3VV2B 2BACA 4LT6A 1QTNB 2AZ3A 1QSSA 3Q8YA 1S9EB 2Y1IA 1SJ4P 4ED7A 2WB1D 2JL9A 4YMEA 1IUJA 3RTVA 3D6HB 5HSPA 2MY8A 3SSSA 4F4ZA 1Q7LB 3CDBA 4WKYA 2UVWA 1MWZA 4DQSA 2DBBA 3H5SA 5EDWA 2CQ2A 4N5SA 5F9LA 2JEFA 2B9WA 1FWKA 2MKKA 1RWVB 1UWAA 1VRUA 4M5LA 4A47A 1N36J 2Q43A 3C3LA 3D0HE 1P1TA 2XMJA 2LEAA 5K8NA 2RQMA 4DF8A 5EWFA 4RW6B 1OMSA 4LVOP 3G82B 3ISZA 1VI7A 3F44A 4B3SJ 2F8EX 4F4AA 3M1VA 3PX6A 2J0WA 1IBMF 3CCJS 4WF9Q 1WG4A 3OR1B 1WHYA 4JYAJ 4KH0B 4DQPA 3G2XA 4NLRA 5C25B 4Y2KA 2YNHB 4QYZJ 4M5DB 4NZ6A 3PJ9A 5A76A 2KVIA 3M8ZA 1RA6A 4IO9Q 2W7OA 5DM6Q 3CULA 2FLNA 3MFHA 1VQ6S 3KHLA 4B08A 4DCJB 3LUYA 1HMVA 3M30B 2E44A 1UEVA 2IJFA 2EI5A 2ZH7A 2OLWA 3ZFVA 2G2YA 3CJRA 2XB2D 1TKXA 3DDIA 2IA6A 4Q2MA 4ALZA 2F9DA 3BH6B 2HQGA 2K06A 1ACMB 1TUGB 3A8JA 3TARA 2C3YA 3Q2TC 3MXHP 4R0EA 1TK5A 3DRXA 1L3TA 1QLNA 1JJ2R 4FNIA 2XMUA 1WKKA 5G0RA 3MD1A 4ETZA 3CCSS 4CH0S 1TL3A 2YPZA 2HHVA 2QTWA 3H5XA 1RHKB 1OY6A 2VG7B 3ILJA 3J81j 4C3MA 4MKYA 4QU7A 2OELA 2OSQA 4BLGA 5B0DA 1SC3B 1E6VB 4Y2AA 5EGYA 4MYUA 1VS3A 3W60A 3N6MA 3M2UB 3W9JA 5JVGQ 3GJRB 2XC9A 4C3KA 4E2FB 2YWHA 4R25A 2UP1A 1IXKA 4HR2A 2I5JB 1SJ3P 2FHKA 3VWSA 1JXEA 1RWMB 2MZJA 3ITHB 4DI6A 3BGRB 1OWXA 5LXYA 1UCNA 4IRCA 3S1TA 4USMA 1SUQB 4KGZB 1RUSA 3SYZA 1S97A 4A8QA 3E01A 1KD1T 1Q8BA 2R7XA 3AHPA 1OO0B 2HK3A 2ASJA 3MM9B 1OS5A 1HHTP 5AXLA 4DV7J 2DEJA 2K8GA 5LMUJ 3OUYA 4A8SA 1Q5YA 3CEDA 3HSZA 2RUGA 3N79A 4KB7A 5LJ3Y 3WX8A 3JSYA 1HWUA 1PSDA 3OL7A 3W61A 4J9QA 4ZITA 1RWOB 2BA9A 2FJDB 3ULHA 1ZH5A 4OI6A 4X64F 4X4QA 1Q1KA 4J9KA 4DL7A 3BS9A 2QL7B 4NMXA 5DQIA 3DLBA 5HANA 5DM7Q 1HBMA 1RT3B 4I7FA 3SCJE 3QGPA 3VQTA 1HNIA 1DTQA 4RNHA 1JLQA 2ROGA 4WJBA 1VQ9S 4UUXA 4DSIA 5F3TA 4JI7J 1S72S 3PYDA 2E5JA 2XZWA 5H9FJ 1ZTTA 5KG6A 1WOSA 1CLFA 4K2JA 3LP2A 1RAOA 3R5CA 2EK6A 3H98A 3K2YA 1CJKA 3VZIA 3PDNA 3KLIB 2BYCA 2J7KA 2CPIA 4CLZA 4J9LA 4WU3A 5SUHA 2LDIA 2AYEA 1K0TA 2HLUA 3OXGA 1KLMA 2R2UA 1J27A 3DOLB 4ERDA 3E2EA 3KJNB 2COLA 2AJ4A 1R8BA 2C3PA 5J1NA 3V5RA 2H4WB 2GMHA 3KK3B 4G1IA 3KUHA 4ITSA 2R9LA 3GU0A 3EM1A 3MFIA 3A3NB 3NMAA 1P9YA 2IRYA 2PGCA 4F02A 1F9EB 3IAM9 5A0YA 2OPPA 2CQCA 1DZ5A 1FCAA 3KMQA 2VONA 4XPEA 4KYZA 4ICLB 1VQYA 4QCLA 1BWVA 1CULB 3L4BC 1B7YB 3RB3A 2ZKTA 3IRXB 2JNJA 2NXUA 2MPUA 5GAEU 3IGVA 3K8VA 4CCHA 1XERA 2XG8A 2GVZB 4RO0A 3C16A 1S77D 2P8IA 3DLEB 1U45A 3L7PA 4P74A 4GC7A 1WF2A 2WBMA 4RR5A 4EBCA 2KYXA 3QLHB 3LGMA 4Z37A 4TLRA 2GO8A 1RT7B 1LK5A 1SB6A 4LRCA 2R8JA 5CCLA 3U1MA 4KBIA 3VGTA 3MM7A 2BRLA 4P7TA 3UQSA 1QAYA 3NS7B 1NNDA 1PJ7A 3JYTB 4ZVSB 2XMKA 1RTHB 2DPJA 2HURA 3PV8A 2HSEB 4J9PA 2ZZMA 2RVJA 3VZHA 1RT5B 3MD3A 2CYYA 4MIBA 1HNWF 1LWCA 1LWFB 4QYRA 1PKUA 2PA8D 3X3UA 4IQXA 3KDOA 3LP0B 1SC4B 2HFSA 1FDBA 3TNVA 1HQUB 3RBXA 3I4HX 2P9CA 2QG9B 3A13A 4EI2A 2IM1A 3QPIA 3ZTOA 2IAJB 4D3HA 3PKYA 2UXDF 1S9EA 2VQFJ 4QWEA 2HQIA 2X3GA 4URSA 1SIWB 4JV5J 3LF0A 4NLQA 4QWDA 3K8WA 2DY1A 2WCXA 2RS2A 1IBLF 3ZO7A 2BJDA 2FZKB 5F3ZA 4LFBF 3HDSA 3PX4A 4ZVRB 4RUCA 1HFEL 3MR6A 3GJQB 3VTIA 1RABB 4OMFG 4B3RJ 2L9NA 4LR7A 2AJ2A 2VFVA 1OYEA 4I2QB 2OEMA 4DR3J 1RP5A 2QGFB 3ZZUA 2W2NP 2VBYA 2HHHF 3O2IA 4RW6A 2BE7D 1GMWA 2AF6A 3DDKA 3SSQA 1RWWB 1RAGB 3G82A 5CAAA 4S0MA 1OSDA 3MI7X 5L39A 1KOHA 1RAAB 1WTBA 3UN3A 4DR6J 3IR7B 3OR1A 2J9CA 1WHVA 2VZ9A 1RKIA 1J5OB 5C25A 1KQSR 3ISNC 4M5DA 4DL6A 4GO7X 3H0PA 1XQIA 4NE9C 2DNPA 4QZVB 3UD3P 3EPGA 4ZPCA 2JVRA 5KFKA 1Q8KA 2EFVA 2AX1A 4K0KJ 1FEHA 4F2SA 1DBDA 2IC3B 3M30A 1B0TA 4OJGA 3VVTA 1KFSA 4M5KA 4HT5A 4DCPB 1FRIA 3VF0B 2DXFA 3SSRA 1U26A 2MSSA 4ID5B 4LF5J 3GCWP 2DITA 5GADU 4I68A 4IH5A 3QRQA 2DR5A 2UUBJ 1HYSA 1S7IA 1JLEA 3Q8PB 3MURP 3Q8VA 4NLWA 4GVBB 4CIOA 3D1HA 2WSEC 2G1DA 3R7NB 3VQSA 2J0QD 1AFJA 1AW0A 2F63A 3CIMA 3IBFB 4EMDA 2R7VA 1ROFA 1TL7B 1S5ZA 2JFKA 3K5LA 3M8YA 3T5LA 2ZBRA 1GXLA 1HPZB 1KFDA 2MZRA 3US5A 4ZVHA 2ZE2B 2VG7A 5K20B 1RYRA 3UN2A 4DUYF 3ENVA 3LP1B 5KFHA 4FVCA 5BYQA 1D9AA 2ZJQQ 2ZH2A 2WW4A 2MQOA 2WVCA 1TU0B 3JQJA 1FJCA 3ZXWA 1PIEA 3M2UA 1S1XB 3FCVA 4C8LA 5L46A 2KZMA 2DGUA 2R2TA 2RE1A 1XNRJ 2BVZA 2XNRA 2GAHC 2FHMA 3OSPA 5I3QA 2CA9A 1U1PA 4UZBA 3KLEB 3EX7B 2I5JA 3AJ1A 3UO0A 1SL1A 4JI3F 3R3TA 2C2DA 2C3MA 4U8YA 3ZNJ1 4QU6A 1QE1B 3EZOA 3BGRA 3RB0A 1YBAA 1WEYA 3NCPA 4ZPAA 3FZBA 4Q7AA 1SUQA 1NDKA 2FVSA 1RAFB 3JTNA 3QSIA 5D4OA 2CPZA 2O01C 2HNDB 2DH7A 1QDUB 4FKYA 1VK3A 3U27A 3G87A 4P9SA 1DAXA 4HL9A 4C0OC 3IM8A 4QW8A 2ABYA 2HVZA 1X5SA 3AOBA 5KT6A 2OTJS 5CYQB 4C11A 1VQMS 3RZAA 1Q8IA 4DV3F 4LFCJ 1FJ7A 1R7IA 5KT7A 5GMKa 1Y5IB 1RT3A 5IT9Y 4A46A 4A8FA 3ETOA 3TUZC 2AYMA 3RAMA 4B3OB 2FUG9 1RBAA 2KT2A 1JLAA 3MCOA 1T3OA 1B0VA 2QA4G 2CAJA 2F4FA 2V5HG 1NDLA 1U1QA 2BZ2A 1S9FA 3KUEA 3PEJA 3V4IB 4CLWA 4U6PA 3DRSA 3QMQA 3MMCB 3KLIA 2AP6A 3NGUA 3CF5Q 1S9GB 2Q1LA 2H5IB 1L3SA 3SV4A 4BC9A 1PYSB 1RTIB 2NUHA 4OI3A 2XLKA 4NA1A 2E66A 2OHDA 3KK3A 4OIXA 3C6TB 4LIRA 2FGCA 2AV5A 2ZM6F 3JB9k 1ZPVA 4DR4J 5HO4A 1R27B 3C15B 4Y2IA 3THPA 5IM0B 4PABA 7AT1B 2A1BA 3OLAA 2UXCJ 4ICLA 1CULA 1WJ9A 2BM1A 1FXRA 2WHOA 4FYYB 3IRXA 4MK9A 2CJBA 3VGUA 3BGLA 2IHR1 3HT0A 4YS2A 3F73A 2L08A 3V4MA 2M7SA 2HS0A 3D0GE 2IBOA 3DLEA 2H5EA 2CXEA 2AW0A 2LQ8A 3NS5A 4W92B 4DN0A 4NLYA 3PJWA 3QLHA 2GHVC 1X5TA 1S49A 2CADA 2IA0A 3MCMA 4IH7A 4LRAA 5A8KB 2DY9A 1H2TZ 1FNXH 4ELTA 1RT7A 1M5HA 4U96A 2GC8A 1WDDA 2JEGA 1WELA 1U2RA 1U8SA 3Q23A 1S6UA 2L41A 3ILLA 4AL6A 3I5BA 2ZHOA 3DOKA 4QIEA 3NWRA 2C2ZB 3H40A 3JYTA 2LYVA 4P2FA 5RUBA 2BV3A 3DKDA 1TKZB 1WSRA 1BQMB 4LUBA 4IOAQ 3H20A 3DLKB 3EGZA 4B9UA 4ANCA 3H5UA 5CHCB 1F3FA 1S4EA 2QA2A 3ICLA 3LP0A 4WFZA 3R5BA 3MR2A 3SCLE 4IYQA 1HQUA 2VC1A 4L76A 1Q7YT 1AROP 2ZEJA 4DWIA 1REVB 1N5SA 2DNKA 2E1AA 2IAJA 4W98A 3AB4B 3CO0P 1DY3A 5KFSA 4QPXA 2R7UA 2DHAA 2H1YA 3NNHA 4ILLA 2ZHBA 1H2VZ 4M5NA 2OFHX 1CC7A 1CJVB 2AU0A 2MKJA 2DRAA 4ZVOB 5HMXA 1VLYA 1KHWA 1YLXA 3GFHA 2RD5C 2ZWOA 2ZOFA 2RILA 2WK4A 4ZJOA 2E1RA 4W4MA 1RT1B 3MPWA 1D0EA 2FB0A 1UVNA 2HZVA 4Y28C 3KHRA 1RI7A 4I2QA 3TW0A 2EG1A 5E41A 1CQNA 2R7WA 5KFLA 3UWTA 2VB6A 3G71S 1O51A 2ZH8A 4L75A 3RRHA 5EWGA 4NLVA 3AB2B 2E9TA 1IR1A 5ETTA 1NCLA 3V6DA 5E3RA 1KKHA 4AXJA 2AWZA 3PHTA 3K0JA 4HDHA 3NMRA 2ZDPA 1KTVA 2BDPA 1RU1A 4ED3A 1HW9A 3WIUA 4F36A 1BQXA 2CQBA 2NSBA 1UFLA 2IC3A 3RBDA 2ZKUA 1WG1A 1NSKL 4PYAA 2YKMB 3BV8A 2LQ5A 3DDNA 2KH9A 2E1PA 2GCFA 1XMOJ 3OTDA 4ID5A 3ZZYA 2GW8A 5THWA 4E8UA 5JXSA 5BR8F 2HYIB 3K5OA 4PXEA 3G8QA 2X1BA 2ILYA 3A4TA 4KGKA 4CLFA 4KO0B 2WOMB 1PO6A 3T1YJ 4FS2A 3CCMS 1R0BG 4X65J 2ACYA 1TFWA 2KL8A 4CT9A 1HQEB 2VICA 1AZSA 1R89A 1TL7A 1V3RA 3AQOA 3MM6A 2PT0A 4F2RA 3HHDA 1IR2A 1MROB 2DR7A 1HPZA 3M8SA 2ZE2A 4RBTA 3LP1A 1RWKB 5DG9A 2MGZA 3A3PB 5SZTA 4TU8A 5AJ3F 3IA0A 4YB7A 5IQ6A 2OFGX 1VFJA 2KYZA 3UD4P 1N0UA 2BXJA 1S4FA 2IMOA 1C1BB 1S1XA 4KR0B 1TAUA 5JJBA 2V2KA 4UOCA 3PYFA 3CDWA 1M5SA 5DG7A 1YQHA 2HHUA 1VQSA 2U2FA 4DFMA 4YR3A 4DV4J 1TELA 2GMJA 1QE1A 4ED2A 1N33F 4P73A 1RT4B 3GYGA 3NAHA 2O67A 1UVMA 3CW2C 4ZCIA 5EHHA 1RAHB 3UDVA 1LK7A 4JI0F 1Z4UA 3H4BA 5A8WB 1AA1B 1HARA 4K4VA 1SQFA 3W5ZA 1DHMA 3T5HA 2VODA 2KVQE 5GAHI 1IM4A 2M3DA 3PRBA 3J81Y 4X62F 2XSFA 2DNMA 1UVLA 2EW9A 1NK9A 2BE2A 4H4KC 3CJQA 4B3OA 2MLYA 2ZH5A 5K8PA 1GT8A 2CDQA 4N41A 1IKXB 1PBUA 2AEMA 3M8RA 3TJ8A 2CG4A 2HQ3A 2N3OA 4PG4A 1K0VA 3ZTSA 3EZUA 4Q2LA 3V4IA 1D1UA 1FRXA 2HKEA 1DQ8A 1KN6A 3VGVA 5KG1A 5KG0A 2B51A 5B0AA 3NBPB 3DLLQ 1M5OC 3DRPA 4GRSA 1S9GA 2UV8G 3MOZA 2BOPA 5HROB 4DV2F 3L3CA 1RTIA 2DB1A 2KT5A 4WFYA 1IVZA 3O5TB 1K47A 2GX8A 4K4TA 4RKUC 1RBLA 4G1QB 4QWCA 2J0SD 4OHYA 3QYYA 1HBOB 3HXMA 3D4JA 3M2RB 1RAJA 5IM0A 4OL8A 5KFJA 1H2UX 4C98A 2RSQA 3LAMA 4NX9A 2XO6A 1WC3A 3N0VA 1IBMJ 4IG3B 2POKA 3U7JA 2QIFA 4N8NA 1FWPA 4JV1A 1RGVA 3C66A 5K5MA 4HTIA 1UW4A 2GJFA 5FJ4A 3BQ1A 1PC5A 2BKOA 4F25A 5D4LA 5A8KA 4FPRA 1U47A 2D7SA 4YP3A 4M5JA 1LOUA 1F60B 4HKQA 4DU8A 8ATCB 1S0MA 2DRBA 1B70B 1YX2A 1FXLA 2FVRA 5J2MB 5F8NA 5D4NA 3BPSP 2R8IA 5CABA 4WP9A 2V9KA 4DQRA 1U6BA 3KYLA 5J1PA 5J1EA 4NMLA 3UI3A 3I55S 2ZFHA 4PXBA 3KK2B 1BQMA 1FDAA 2M4MA 3DLKA 1W7WA 1F9FA 2V2QA 1RHJB 3B4MA 1MU2B 5E3CA 2FJBB 1WUUA 1KR4A 4OZLA 2AJ0A 3T41A 2GQ2A 1UJ5A 3T9NA 2B7CB 2AGPA 1KLNA 2V8DA 4OZJA 2K2PA 4A48A 4ID8A 3DYAA 4OYZA 1REVA 5CA5A 3T9ZA 1T05B 1V3ZA 1H7WA 1ULRA 3QSYB 4CLLA 5CCMA 3W1YC 4HHJA 1ZZNA 4B17A 4ZPVR 1WF1A 3A8IA 2WTFA 5T7LA 1NBEB 4EO8A 1LWXA 1QTMA 1JLBA 2GHPA 2IJRA 3C6UB 2CJQA 4PUOB 2XI3A 1RT1A 1PC4A 3VALA 2CPYA 4ZP9A 2E5GA 1UEUA 1K44A 2QLBB 4C6AA 3PW7A 3TOQA 4O3PA 3EXYA 1JLGB 2CVIA 3PZPA 2VG5B 5KG3A 2RMLA 4URQU 3C14B 3ONQA 3OXFA 4BWMA 4J90A 3K57A 3FFIB 4IG0A 5F8MA 4HDGA 2JSXA 3T6JA 1AXQA 2UUTA 2G2ZA 3LQVA 2HRTA 4AXIA 1PG5B 3ILIA 3DLJA 2VUGA 3W2VB 4C8MA 4X64J 3KUGA 1RJJA 2RB7A 3CE8A 3R5DA 4ED5A 4A8WA 4YB6A 3ELHA 1UPPA 2YKOA 1WSVA 4ZPWR 2A2DA 1T11A 4ED6A 3AOAA 2YKMA 4K4ZA 1JLFB 1TTHB 3TEHB 4PQAA 4C2MA 1TQLA 1FF2A 3MEGB 3GIKA 4LFAF 4Q45A 3FC9A 3M9OB 1IKWB 1RB0A 2MKYA 2FHOB 1JLCB 1U1LA 4USWA 3DRRB 2DGSA 4AFFA 2OKQA 3RUBL 1N88A 4RWWA 2D9PA 2HGNA 1GFWB 2AQ4A 5KFVA 1HQEA 2Z2YB 5HQMA 2UUCF 2CQGA 3EDQB 1SJ1A 2C2OB 2IDLA 3HX9A 3O1LA 4U7UD 3KLHB 2QMUB 3TVKA 3CCVS 2X51A 3GP9A 2YKNB 3DM2B 1KBRA 1RCXB 2MJNA 3S01A 2D3O1 1RK8A 1M0SA 2PFFB 5DS7A 4OX6A 2IJNA 1C1BA 3NGRA 2EKYA 5ETRA 1BY9A 3G96A 4NLOA 5T14A 5HLFB 4ANEA 2MTLA 3CDEA 2E5IA 3NL0A 3CJ4A 4DZ6A 2XGPA 2YPYA 3KWMA 4DU7A 4CO3A 5E3PA 3OTOF 3DXBA 4YQWA 4TLQA 2J7WA 1YI2S 4QPTA 1GTEA 2ALZA 2V68A 4IFVA 3GG0A 1SCJB 3CCQS 4FPIA 2RHQB 4KC5A 4MAKA 2HWIA 5EX0A 5A8WA 4A8XA 1WACA 2W2MP 6FDRA 1NZAA 1F6TA 4CLKA 1RWUA 4F26A 4JI6F 2GO9A 4UY8T 2I9SA 3NWGA 2HGLA 4LQ9A 1DARA 2E1CA 5JUMA 3KLFA 2BJ8A 3PX0A 2ZH1A 1AYEA 2ZITA 5ETKA 3D6TB 2JX2A 4H4OB 2XMMA 1WORA 1HNWJ 2AZ1A 2HVDA 2XS7A 2QSWA 4WFBQ 3DI6B 2KJVA 4Y65A 4FF3A 2DGWA 2RU3A 1IKVB 1RAIB 1KEKA 1NKEA 4IRDA 3NBPA 2IM3A 2UXDJ 1YDLA 2LXUA 3JAMY 2F65A 4DDFA 2DR6A 3UNYA 1C1CB 5HROA 3MMAB 3CTRA 2E5LF 2DNRA 3CJ5A 2YWWA 4USKA 2H4YB 2DT9A 4YN3B 3RAQA 1IBLJ 2B9YA 4LFBJ 3GB0A 6AT1B 3W2WB 2IIHA 1R8HA 5KFPA 1Q86T 1HBOA 1JXVA 4H4MB 3H90A 2CRLA 3N9UC 2VFTA 3M2RA 1N48A 2QA1A 2B9XA 3BB5A 5CYMB 5D4PA 4AE5A 3BH7B 3B6BA 2RJZA 4YR2A 4DL2A 2J8AA 2HHHJ 3B8HA 3H2UB 1WC5A 4UQTA 4J9RA 2GGPB 4J91A 3BQ2A 4XDCA 4FDFA 3K5NA 2LEBA 3NG8A 4IG3A 3LALA 5I3PA 2GIRA 4OX7A 1NJWA 3AAWB 1FT8A 2Y1LB 3M6VA 4KV8B 1GMWD 3OL8A 4QR1A 3GJSB 3MPUB 4F04B 1IM6A 4DSJA 4ZCLA 5AE2A 1RAEB 3VHQA 2DD8S 2MQNA 5L9XA 3UCUP 2YTCA 4FYWB 3CCRS 3HHLB 2M0GB 1CVJA 1HI0P 4DUZJ 1NHUA 3WBZA 1OPIA 2PI5A 5M2RA 3WX4A 1S1UB 2B43A 3DOMA 5J2MA 1D9DA 2M88A 3PY8A 4DV5F 2M52A 4JV0A 2XCPA 2GAGC 4JBCA 2CWKA 3QT5A 3S8SA 3CXCR 1RDRA 2YNIB 1UP1A 2FYXA 2OEKA 1I51B 4ZP6A 2DKOB 3ET6B 5A2QU 4M5GA 3QRPA 3KK2A 1TMMA 4M5HA 3NGTA 3I0RB 2Y1RI 3R6GB 3PJXA 3OJSA 1YJNS 5B0CA 4TU7A 3KDNA 3J80Y 5F0WA 2WBRA 1YGYA 4NI2B 4XO0A 3TJAA 3OVSA 3TX8A 2FZGB 3RU0A 4B9NA 1VDHA 2UZAA 2EFGA 4DUYJ 3SZ2A 3ZC4A 4F0MA 5EX3A 3FMBA 3K17A 1N0VC 2QLJB 1T05A 2XLJA 4CO0A 4CH1A 4FF1A 2W24A 2HK2A 2V2ZA 2X1AA 1WF0A 2FVPA 5KFTA 4R5PA 1YZ7A 2LKZA 3BKFA 1DFDA 2UVVA 2O5DA 4F4KA 1NSAA 2IMWP 1LW2B 2QX0A 3ZZTA 4USHA 5B0FA 1UFWA 5KOXA 4JI3J 4B9SA 4RJVA 1SL0A 4OYIA 1RTZA 2W9CB 3SMZA 2VD3A 4OYWA 1TFYA 3CJ8A 5E33A 1EETB 1JLGA 1LEOA 2BANB 3QT8A 3BSOA 3C14A 1VQLS 3POTB 1WEXA 4XTTA 1U6ZA 2CPHA 2FC9A 3FFIA 1A6LA 2GQQA 1RCOB 3CMAS 4G1PA 2C22A 3I5AA 3GV5B 3CC7S 4G6VB 1N5TA 1TV6B 2VFSA 1LNQA 3FQLA 1UZHA 5GVQA 4LJMA 3EVMA 2BX6A 4XK8C 1CJUB 3M4XA 5LSOA 2VASA 3FDSA 3NNCA 4DV3J 2AYGA 3K89A 1X0PA 2W4DA 4DV6F 4ZPTR 1AB8A 3G6VA 4RU2A 3W7BA 1SQGA 5KAKA 1JLFA 2YBVA 2KZZA 2BR0A 3BBCA 2DR9A 3MEGA 4X84A 2MZQA 1FK9B 1IKWA 2CNNB 3M9MB 2BUNA 2APOA 2PMZD 3DRRA 1SIZA 4OV6A 3T3FA 2UVRA 4CNZA 1T03A 2CJYB 3M8PB 3GG1A 3W66A 4P72A 1WKJA 3HULA 2XS2A 3KLVA 1RISA 3KLHA 1ZM4A 3MEKA 4QYZK 1T9VA 3JSBA 1F5AA 3DM2A 5KTQA 2VPZB 3FEXB 9ATCB 4BWJA 2DHGA 3EVOA 5KFEA 1FXDA 2ZM6J 2CJAA 2K1RB 2R7QA 4OQJA 1H73A 2NXJA 3CDUA 3UN5A 1FESA 4DFKA 1XK8A 5E2QA 5F8GA 3D54A 3OL6A 3H5YA 4BC7A 2U1AA 2LCWA 2WVDA 3TVYA 2W8KA 3HJFA 4ZOSA 3EICA 2F4VF 3D1OA 1KHVA 4WTYA 3KLGB 2UUAF 1WOOA 2MB0B 1I94F 5K14B 3AD9C 2DXEA 2GS8A 2B5JB 1RHRB 2MJUA 2KHDA 2D74B 1B99A 2HIQA 2G0CA 2FPHX 2HMIB 4F50A 2EFOA 3ILOA 3V81B 2XZTB 2M5YA 3F41A 2B8PA 4HACB 2LVWA 4JI5F 3MEEB 2PO4A 2XSJB 4CT8A 2PEHA 3IBCB 1FFGB 3PVXA 4ZK7M 2ZH6A 2G13A 2AX0A 5H9EJ 4BDPA 4C3LA 2PDAA 3BQ0A 4H4OA 4C8ZA 1JK9B 1RBOB 3T19A 4MIWA 1B7FA 3DI6A 3NAIA 1APSA 4LSNB 1C4CA 1S1WB 2I8EA 3HZGA 2B4VA 2W2OP 2QFIA 4DL3A 3F56A 4HT7A 5B08A 1XMQF 3Q8UA 4X4RA 1HL6A 2HVIA 3O8WA 2UUWA 2KKHA 1GH8A 1C1CA 3MMAA 1FJEB 2VBXA 2LP4A 5KFXA 3LW5C 5KFZA 3DN9A 5KFDA 3SCKE 4N77A 1ZM9A 2RH3A 5FDLA 4OHXA 3PYGA 5HATA 2QE5A 2MZSA 3BSNA 1H98A 3W2WA 2WSFC 3UDLA 2R8KA 2Z8QA 1G2EA 2LXIA 3PW0A 3UR3C 1HLWA 3ZZ0A 3KNGA 3GPAA 1Q82T 2XHCA 5H9FK 3EZ5A 3I9V9 4CTAB 2DH9A 2EC2A 3HSGA 2GGPA 4OJ3A 2PFDA 2IPOB 3UVJB 2KJWA 3GCXP 3QFWA 4DSFA 4USVA 4ZVUB 4O4GB 2FJXA 3O6QA 1KVJA 2PN6A 3NGDA 1VRTB 2K7KA 3MUMP 3DXSX 1EQMA 3HHLA 4DV1F 1BMQB 5A6WA 1VMBA 3OSNA 4KFBB 3D0IE 5F9NA 4DPTA 4MJKA 4K5RA 4AD6A 5BR8J 2YNIA 3ZZRA 1SC1B 4LF1A 3R8YA 4ZPBA 4DCOB 3OJUA 1EP4B 3LO3A 2R7OA 3ET6A 3FZ2A 1S79A 1RT2B 4Y6IA 2CPXA 3THTA 2AD9A 3I0RA 1VQPS 4ECTA 1X4EA 1PAUB 1TZ0A 4DR7F 4KHPF 4I4BA 3QQCD 1VOMA 4NI2A 4KRWA 1K73T 1F2HA 3PW4A 5B0EA 4FKXA 3Q8QB 2RQ4A 1NPKA 2J8SA 5CD4A 3ZZOA 4FZVA 4I6WA 1IWAA 1S1TB 3ZNUA 2JOQA 4WKRA 3RRKA 3OTEA 5AJ3J 1SBRA 3K58A 1PBAA 4ANDA 3EXCX 3P5TL 5C42B 3ETMA 3R5JB 5CYJA 2FVCA 2PC6A 2W01A 2R7TA 5DJBA 4PPDA 5L8RC 4D3GA 5CQGA 3VAFA 1YKWA 3BF4A 4QIGA 4MIAA 2H9ZA 2RDIA 4WIIA 1S99A 4XPCA 4UZCA 2VOPA 3NNAA 1LW2A 3PR4A 1N32F 5IV4A 2HBRB 3UPFA 4ECSA 3DC2A 1N33J 3W9HA 1EETA 1FD8A 2BANA 2VOOA 1ZS6A 3EDRB 2KTQA 3H42A 1R0AB 1FDDA 2HFVA 4MKVA 3IMQJ 2I6WA 2VA2A 4AL5A 3IFEA 4JI0J 3POTA 2GVDB 4CWBA 2FZCB 3TO8A 2CWXA 1WI8A 4NA3A 2W25A 3OL9A 3WC2A 2NYIA 1CJUA 4PXCA 1XBWA 2D3OR 2ILZA 4X62J 4ZHRA 5LXRA 2MLZA 1Y10A 2YWEA 3TUIC 3F0NA 1HNZF 3GTYX 3HD1A 1VJWA 1Y7PA 5DLFA 1YBUA 4KGVB 2D41A 3GIJA 5E3AA 2ZJRQ 2LQBA 2Z2MA 4LR8A 4DL5A 1HWIA 2V4JA 1F2GA 4ZVGA 4YY3F 3SEOA 3EMTA 2Y0SD 3HO1A 2D9OA 1N5YB 4OX9F 3HK2A 3E51A 3VAHA 5HQLA 2DRDA 2YNGB 2B56A 2CQ0A 1NUEA 4Z2XA 5C5JA 3PCOB 4DXLA 2XS5A 4PXDA 1N6QB 4QBUA 4DG1B 4F8RA 1Q81T 1VQOS 4KE5A 5L9NA 1D9FA 3W5XA 3PIPQ 5GMEA 4L72B 3C46A 1VRQC 3IBWA 3V6JA 3M8PA 3I87A 1T9UA 4Y00A 3UCZP 1IQTA 4DV2J 2Y0BB 1C0UB 5KFGA 5I3UB 2CQHA 2MKCA 5A8RA 4EFAC 5KT5A 2XY5A 2CQ3A 4KIAA 2RAQA 4F4YA 5D3GA 2HHWA 1U48A 1I3OB 3IG1A 4DUTA 2K1RA 1QUVA 4M94A 4V19X 5KG7A 1WKLA 1FE4A 3G8SA 1CC8A 2NR0A 3J7Z5 2LLZA 2KB2A 1KQKA 3PACA 2KT3A 5IXUA 3H4DA 4XIUA 3FKBA 3KLGA 3AOCA 3B78A 4FNHA 1NPPA 2VL1A 1OIAA 2RF2B 2BJ7A 3MOJB 1Q53A 2B5JA 3TAMB 6FD1A 1O8BA 5AXKA 1T7PA 3B4DA 2RU9A 2X1FA 1AUDA 3FSXA 3IS9B 2QO3A 1CJTB 3UFCX 1O0PA 3WIVA 2HMIA 3H59A 5EWEA 5L38A 1Y0HA 4ILRA 4OYMA 1NRKA 2MZTA 2YWGA 4HACA 2ZH4A 3MEEA 3FQKA 4JI1F 2DNZA 5G4DA 2EFQA 1F1BB 5BXIA 2IDEA 4NYPA 3Q24A 3VAKA 4DFPA 1DLOA 4YHHF 1ZETA 5GAHU 1WG5A 1OY9A 3KK1B 3AA9A 2DR8A 3BGUA 3M2VB 2RRBA 3SQOP 1Q4RA 2ACMA 2A2CA 4TU9A 1SI9A 2C2MB 4LF7F 2Z30B 5HAOA 3VAIA 5MLCV 4YOEA 4LSNA 4C7QA 1S1WA 4U8VA 2XCAA 4ZS6A 2VPXB 1F5BA 4N56A 2HVHA 2B0GA 1WD6A 1CSJA 1U1MA 3PTWA 3N4WA 1UMJA 3AA8A 4KPYA 1IKYA 3ZZZA 1LXJA 4PWDB 1RWPB 3DU5A 3W8PA 5FIIA 4O3QA 1S6QB 4IUFA 1X4HA 3I6PA 1HNVA 2QLWA 2BOAA 4LBPA 4X66F 3PXGa 1S1VA 4PZVA 2YY3A 1QM9A 3QO9B 1T8EA 1BHNA 1VCTA 1GXTA 2BQRA 2ZD1A 1RHUB 4USJC 1VISA 2HLTA 3BJYA 1LFWA 1S0NA 2FJWA 2AYBA 1KVIA 2BBEA 5HMZA 1LFPA 3G6YA 5FLXY 2C2KB 2MXYA 2C2EA 1NKBA 4WK1A 2GZOA 4CTAA 4KQZA 3BDPA 4PAAA 1NXIA 2MEWA 3DHWC 3OPKA 2E9RX 2EG2A 4DSEA 2ZUGA 1NJYA 2F9JA 3UVJA 1DTTB 3R2DJ 4TYBA 2ZBCA 2HRYA 3HJVA 2I2YA 1VRUB 4TY8B 3AFGA 4K4YA 2A0FB 4EYHB 3J7AN 2V63A 5HVFA 1VBKA 2XMAA 3V6KA 1PILA 1X4AA 3ZTQA 4DV0F 2Y8YA 3AXMA 3ENWA 5F8JA 4ED1A 2JLFA 3TQEA 3D5MA 4DQQA 5HP1B 2JEIA 3CJTA 4HLBA 3CGIA 4O3OA 4DSLA 4LFAJ 2YKQA 2DNNA 4PCQA 3HI9A 3CD0A 4WXWA 2DNHA 3MWBA 3TA2A 1F0XA 3GONA 4WFNQ 2OUGA 4ZIWA 5KFOA 4IOCQ 4PG7A 3MHYA 1M90T 2UUCJ 3FBBA 2ALYB 5KFAA 1FJGF 5BYSA 2XY6A 4B3TF 4YDXA 2NYHA 3BO3A 1HMVB 4Q43A 5FD1A 2G0JA 4F67A 1S1TA 1ZZFA 1YVFA 3TZZA 2ATCB 2CZ9A 5L1IA 3GFYA 5D0EA 2YNHA 4CRJA 5DDPC 4O0IA 1ZYQA 3PYEA 4HI2A 2M8HA 3HPOA 3GILA 2IBKA 2DK2A 3NGKA 1NK7A 1MMLA 4NCGB 4LF9F 1NH8A 3TVZA 3GIIA 3OTOJ 1XR5A 2XMTA 3ZTRA 4JV2A 4OI0A 4NLDA 3BDEA 2KO1A 2JJ4D 1FKPB 2W1BA 4LF4F 1GMUA 1SVDA 5DO2A 4EGLA 2OPRB 4NLGA 1G1XA 2EC0A 2VKRA 2E9ZA 1NK4A 5IQQA 1IJFB 4DPUA 3I0SB 3HKWA 1ZTWA 3BGOP 3CCUS 3OD2A 4JI6J 3QZ8A 3HFVA 1HQ2A 4JI8F 3N5FA 4QIFA 3P6YC 3MGJA 3HF5A 2G0IA 1E6VA 1HR0F 2XWXA 4EBEA 1A9NB 1TKDA 3M9NB 3LWMA 4N76A 3UDCA 1D09B 3QJPA 1VLOA 4J5OA 2LA6A 5F8LA 3IRWP 5L1JA 4CI0B 2HZAA 1L5UA 2EK1A 4UTGA 4DL0C 1N5YA 3R6LB 1EKSA 2MHEA 1VYAA 2UVUA 2YNGA 4NEZA 2RKIB 2ZOGA 4DEZA 3KJQB 3QFHA 3RYLA 2JRSA 1N6QA 1D3WA 3ITHA 4C48A 4P7VA 4IH6A 5MAOA 3EE3A 3MTJA 4Y3CA 1V6HA 5CZVA 2PEBA 2IYGA 4BCAA 4HH0A 2E5LJ 1HBMB 2DHSA 3C8YA 2ZVIA 3MM9A 1C0UA 2FIUA 5KFBA 1NLKL 2ADBA 3NLCA 2FY8A 1ZAVA 1DTQB 4CLTA 2E29A 2NXNA 1URRA 2HIYA 3LGNA 2V67A 2W9AA 2DCLA 2F7VA 2V34A 3D1QA 1R6YA 1B0PA 2QT7A 5F8HA 4WE1B 4EYIB 2B9EA 4UOGA 3LP2B 3PW5A 3NEKA 3A8KA 2BE9B 4WIQA 1TUVA 4AL7A 3W65A 1NSPA 1CJKB 1YBTA 2HHTA 2YKAA 2EWHA 5IZHA 2R8HA 4DX6A 1IWGA 4OYPA 4FF2A 1SKUB 1KLMB 1NDPA 4FXDA 1FRKA 1YK9A 5ITHA 2DO4A 2VIHA 2KHCA 4A8OA 3NCRA 3TP2A 1SJRA 3PRDA 1HBUB 1MN9A 2FLPA 1YZ6A 7FDRA 2M9KA 1SKWA 1JNZB 2Q66A 3TAMA 1ZA1B 4HI1A 1MG7A 4LF2A 2KRBA 4GC6A 1CJTA 3R27A 1SKRA 1RADB 1PYTA 1R6VA 4L3NA 2J0XA 4LBHA 3DOLA 4DV5J 2VG6B 1X4BA 3FSIA 1RWNB 3LANA 1MWYA 1X5PA 3KKFA 3SFUA 5DG8A 3C16B 1ZPWX 5IT0A 2ZBPA 1UPMB 3M32B 4QJVA 2OGUA 5GMDA 1VIXA 1E6YB 3EYZA 5DQGA 4ECVA 2EXUA 3M2VA 3QZ7A 1BQNB 4HEA9 1PJ6A 1SC6A 3TWZA 4WZQA 1PYOB 1VHIA 4CP5A 3N6NA 3PW2A 1F5CA 5KG2A 2C42A 4X4PA 2GVZA 3MR5A 1FE0A 4U7UK 1FRHA 2KM8C 2YH1A 2HWTA 2LA4A 3MPVA 4O3NA 4PWDA 4DR2F 5GAGI 4OLPA 2DXDA 3PIOQ 3BSAA 2JDJA 1S6QA 2GIQA 3AT1B 1U8WA 2OMLA 5IWAF 2FTRA 3AXKA 1U1NA 3QO9A 4F0KA 2N7CA 1UA1A 2W4PA 1SH2A 4L6V3 5E7OB 3UCGA 1RTHA 2CNLB 5HBMB 3QAEA 2F5GA 4IO1A 4F3QA 3TYTA 2JC1A 4ECZA 5KFYA 2CG8A 5JMNA 1RT5A 5C24B 3RW6A 2VV5A 4NXNF 4OZ2A 1HD0A 4TN2A 1NU4A 3JXOA 4CO5A 1HNXF 1Y3JA 5DDRC 4M8LA 4PWUA 1LWFA 3PEHA 2ZH3A 4U95A 1DTTA 2DGVA 1HBNB 2ZC3A 3NXZA 3OVBA 4LR9A 1G6BA 1VIOA 3MEDB 4ZLPA 1NJXA 3G4SS 2D3ZA 3TI0A 4TY8A 3LAKA 3UR0A 3CD7A 4Q0BB 5LM7E 4QQBA 4U9RA 3FCHA 1X4GA 2BQUA 4CO1A 5DZ6A 1JXLA 3G86A 1YJTA 2Y1JA 2FY1A 4DV6J 3AY0A 5IC4B 3RRGA 3HVTB 2CPJA 3GR1A 3MMJA 4U67Q 1RT6B 5HP1A 3L09A 1LKZA 1KQFB 4RPFA 4F4XA 3IM9A 4NASA 4RNFA 4I0WA 1I1GA 3M6WA 1UW9A 2RT3A 5HVHA 1GQEA 4AT1B 3CO9A 5KOWA 1FI4A 5K8MA 3P3DA 2HBZB 2I38A 4WFXA 2WW8A 2DNYA 2XEXA 5I4MA 2N4CA 5CH7B 1NJZA 1UFKA 3QT7A 2FHJA 4ECXA 2AIRB 2OJ3A 5C7PA 4KAIA 3R7SB 1ZAWA 3HLUA 4MKAA 2R2SA 4C8NA 4RU9A 5ADZA 1GXUA 3H2VE 3U1NA 1UTAA 2CQ4A 2HBYB 3OXLA 2CVEA 2Z57B 2VH7A 3RBEA 4DMZA 4OLOA 4KGMA 1J5OA 2ZBQA 4TXSA 1HYSB 1SJFA 1JLEB 2N7YA 1F9HA 3Q0AA 2GHWA 3JQMA 4UOFA 1O5JA 2LMIA 5K9FA 2P2CB 4HHHA 4PQUB 2Z4PA 1NMEB 4NCGA 4NXMF 3DLGB 3DMJB 3QT6A 4WFAQ 3IAS9 1Q79A 2QN6B 2VQEF 1JMTA 2F4VJ 3CNQP 2DJWA 5LSRA 2CPEA 2V69A 3GZ7A 5HK4A 1AUSL 3PO5A 4IDKB 2UUAJ 3CJ0A 1I94J 1P1LA 3O44A 1BC6A 1FKPA 5AXNA 1SKSA 2EBEA 2ZBIA 4GVBA 2P6SA 2DO0A 3QIPB 2OPRA 2KG1A 2H51B 1UWBB 2XGQA 4K5SA 2E7VA 3MAQA 3J7YI 3D3BJ 3RW7A 4A8MP 5B7WA 4ECUA 3I0SA 3TR5A 2QYCA 1UKUA 4DHVA 2D69A 2DNLA 4JI5J 2XWYA 5KFFA 2V2VA 2IY5B 4ZP8A 4LQ3A 4O4RA 2XQCA 4P75A 5LOQA 2AGOA 4ETXA 3OLBA 4RNNA 4DS4A 4ZDNA 1DQ9A 1KSPA 4FBUA 2ZC4A 1NK5A 4RW8B 4DBQA 3W63A 2DGXA 2V9WA 2E7XA 1Z2LA 4NLPA 2MDAA 5IS2A 4AQYF 4DX7A 1U7LA 5M2UA 4OI4A 4LMZA 4RBVA 3RB6A 3QRRA 3KLEA 5ETVA 2RKIA 2QMXA 1YHQS 1UJ6A 3M6UA 4K7QA 1XMQJ 4CNYA 2M8DB 1VQKS 4C11B 3SBMA 4Q44A 4LREA 3JSMB 1U2CA 1Q95G 1VJQA 2MHNA 2F1FA 4R8UB 2LU2A 4J9VA 2VC0A 2CPFA 3M8WA 5IOLA 2HNDA 1NB2A 3CJ2A 2OSRA 1JLAB 1KP6A 3N01A 2HFZA 3EWGA 3GWCA 1EJ7L 4BBYA 2WSCC 2QL5B 1TVRB 4OZ1A 4L3KA 1V5IB 3QAUA 4WE1A 1FX2A 3NP5A 4X4TA 4MMOA 3DRSB 2V0NA 5CYQA 3OHAA 1SXLA 1FO1A 4ATNA 1EB0A 2KRRA 1L3UA 4MH8A 2FC8A 4NL5A 1T9TA 3ZTPA 1HA1A 1FD2A 3G6ES 5KFUA 3BN4A 4F4WA 1KQGB 1FFWB 3OFFA 1XNQF 2HNZB 1FFSB 3K7RA 1YSJA 1HBUA 1LV5A 2GJIA 3OW2R 5HQ8A 3CCES 1H0HB 3K5PA 1HWLA 4ILMA 3MTKA 4FF4A 4O3SA 1K8AT 3MMCA 3D2WA 2UV8A 2J6SA 4DV1J 1XJWB 1I5OB 4B3MF 4Q8EA 1NPRA 1WC1A 4DR1F 2BRKA 3ENQA 4V1Ak 3ADAC 2VG6A 4M5IA 1A7GE 1W2IA 3HHLD 1K1SA 3OR2B 3C6TA 4JUZA 2O3DA 1BE4A 2JVOA 2P5VA 1U02A 2XBPA 3M32A 4OZ0A 3PFOA 1X0FA 4DPOA 1FRJA 4ECYA 2ZJPQ 1E6YA 3C15A 3I82A 1GNKA 3SI8A 3R1LA 4DR7J 4KHPJ 1BQNA 4YB1P 1H72C 4QWAA 2MQMA 4LF6F 1TL5A 3W5YA 4GKJF 4GKKF 4ZVTB 2NPIA 1U1OA 2JWNA 4DPYA 2IRUA 1BWEA 3DOKB 4PEOA 5HI7A 4RW7B 3SCIE 3P5BP 2AGQA 3PM9A 2MQ8A 2FJVA 3NY0A 4KSEB 3T1HF 3BGFA 3MZIA 4P6QA 2F40A 1D8YA 3FRYA 2DTJA 1XR7A 2OI2A 3HP6A 1N32J 4W90B 4IFYB 1JNRB 4ED0A 2QC3A 1T95A 3CMQA 3DGPB 2WZ1A 2XZDB 2HQFA 4KKOB 1U0SA 5HBMA 3TZYA 4K4SA 2WB4A 1TKZA 2CPDA 3QWUA 1DURA 1VQ5S 1X9SA 2MQPA 1B3TA 3ZZPA 5E3QA 5C24A 3BREA 2EVZA 3DLHA 2I1RA 5KFWA 3DU6A 1X8DA 2QLFB 4RLEA 4ZVQB 3RB4A 4DN9A 1XC9A 2QRRA 5AE3A 2JLEA 3PR5B 4B9TA 1HBNA 3FCWA 1SQEA 5KFIA 1HHSA 4RBUA 3MEDA 1XN9A 2KM8B 4Q0BA 3PNIA 4WXOA 3IWNC 2OD6A 3QNWB 3TX0A 4QWBA 4KY3A 1HNZJ 3HVAA 3N5BA 3M8QB 1NHKL 3MR3A 5BYRA 4KTQA 3HVTA 1N4LA 3GJTB 4XAKA 3GYNA 1RHQB 2IM0A 3FGVA 1RT6A 1W2BR 1M5PC 1M5KC 3FEZA 1CJVA 4YY3J 4EBDA 1BXNA 2UXBF 2PMHA 1R3NA 4OX9J 3AH6A 2VHGA 4X4SA 4ZVFA 3V6DB 2BMBA 4KHRA 2B4OA 3VAGA 1J5EF 3GR0A 1U49A 5J2QB 2FD2A 3T1AA 4USTA 3CB4A 2CJXB 1D8ZA 2CJKA 3NOGA 3CJSA 4WPAA 2HW3A 3LOUA 4OI1A 5DZ7A 4F7VA 3QGHA 1SH0A 1N5QA 3GE9A 4DUZF 1EAYC 2ZUAA 2AJ1A 2J9DA 3UNGC 1FKAF 2LFVA 3IR5B 2ZZTA 2FJEB 3QGIA 3CJKB 4YDDB 2BW7A 4I64A 3LPEA 2R7SA 3IWLA 3JTOA 2WVBA 2LQJA 3HD2A 1HHQA 3MUTP 4UT4A 1T3NA 5ETNA 1IQZA 3CUNA 2BJ9A 2VDIA 4TQRA 1S12A 2HRUA 2CUYA 2JC0A 4PQUA 3DLGA 3DMJA 4IR9A 1AZSB 3MM6B 4O0NA 3VAMA 3AD7C 1R43A 2V6AA 1Z1ZA 4IDKA 3BEGB 4CYUB 4PKDB 4MK8A 2B6AB 1TMJA 2LQ9A 2YQ3A 2MGZB 3IO1A 2DGQA 1QAXA 4KO0A 4BS2A 4FYXB 4FN5A 2WOMA 2BJ3A 3HZEA 2IM2A 3VGSA 5A2QY 1M1GA 3LGHA 1FKOB 3QIPA 3FBEA 4DS5A 4QIVA 2CQDA 4OV1A 3T5JA 1UWBA 5M2PA 3OTCA 1TR0A 1Q16B 3IP0A 1VC6A 1RU2A 3GYXB 3IN5A 2XULA 4KH1B 1RA7A 1MROA 2YQ1A 4NCBA 2YQ0A 4OHZA 2G1HA 1EIYB 4J9MA 2HAFA 1IBKF 3GV8B 1Y11A 3E8OA 2NLWA 3CSKA 3D3CJ 4JI1J 3RAXA 3PFEA 1K1QA 3M6XA 2HHQA 1N8RT 2XI2A 2Z0GA 4J9UE 4WK3A 3OBIA 4YHHJ 4JI2F 1SL2A 4RW8A 3D28A 2KN4A 4ECWA 1J2VA 3GMGA 5LT5A 4GMKA 4LF7J 2PD1A 2XNQA 4OYAA 3H2LA 2V8PA 4WP8A 2XYHB 1NK6A 4EU0A 4FP9A 4HTJA 1V9OA 3MUVP 2YWFA 2UU9F 3QATA 4X4NA 3JSMA 2DGTA 1RT4A 5FLXU 3BR8A 8AT1B 3T5KA 2W4CA 4R8UA 3CPWR 1ZA2B 3K59A 2BE2B 3BPDA 4CZCA 4CDIA 4NPOA 2KDOA 3FNNA 4LF8F 4I56A 2I0XA 2CQPA 1NHVA 1LWEB 4O23A 4JB8B 1LXNA 4X66J 2XY7A 1TVRA 5U47A 3BO2A 3EGVA 4ED4A 3UE2A 2RQKA 2R2RA 1FWLA 2EFPA 1KNZA 2AEJA 2CNOB 5ETQA 1BGXT 2IRXA 1C4AA 2JH3A 4M5MA 4PWWA 3DHXA 3DRPB 4Y2MA 1QVGR 5LMNF 3KG1A 2XO7A 1U1KA 3FMWA 4F3MA 2Z56B 4UOHA 5I42B 1VC5A 2HNZA 1IKXA 5KFCA 4OHWA 3LWLA 4Q5VA 1XEZA 1N56A 1YJVA 3TJ9A 2N82B 4C8KA 2C2NA 1FRMA 3TRGA 3FVYA 3CD5A 2XYGB 3R9LA 1S10A 4TY9A 2B4PA 5D78A 2VJVA 4ECQA 4DV0J 2YH0A 3A8EA 4PPZA 1NAQA 3SDEB 4G1QA 3FK4A 2QLXA 2CQIA 4KT0C 2OD4A 1U09A 3OR2A 3KTQA 2Y8WA 2A6MA 2LXFA 1YJRA 4J9OA 3M7VA 1SV5B 1S57A 2YWKA 4CLPA 4J9NA 2Z2ZA 2DISA 1FJGJ 1N52B 4B3TJ 1WC6A 1QUPA 4L74A 1Q8LA 2QYGA 5D77A 3EJMA 1JQGA 4MFBB 5DETA 1TL4A 1WTFA 3TUPA 2EPIA 4JI4F 4A8YA 4RW7A 3Q22A 5J1EB 1CS4B 3FJ2A 4IR1A 2R42A 3SIPB 3WQPA 1IBCB 1EHWA 1OJ4A 4DPXA 1GK8A 5DGBA 4DR5F 4WWSA 1SPBP 2K3KA 4ZLLA 2DPIA 4LF9J 2DHHA 3AD8C 3FSYA 1RLDA 3SV3A 1N34F 3LH2S 2HWHA 2RHSB 3MMBB 1OY8A 4IFYA 4QIWD 4OYOA 5H9EK 2J7UA 4IKAA 1UZDA 4RX6A 2RQCA 2RDDA 2Z58B 2N4DA 3DGPA 2AJQA 3DYAB 1UJ4A 4KKOA 4QOTA 2XLIA 2B7BB 1YTYA 7FD1A 3BYRA 4LF4J 2ZDOA 4A4JA 4OJ1A 3H7HB 3CC2S 4N8OA 1MU2A 4CH7A 4O44B 3TUJC 1YJUA 3N6LA 3IR6B 5T7LB 4OZNA 1DQAA 3I32A 2BJEA 2MLXA 3OV7A 1GX6A 1JLBB 2R8GA 4EK2A 1H74A 2PA3A 2QJ3A 4JI8J 3KXDA 3TEGA 2O1PA 4OX8A 5E0OA 5IFMA 5EUHA 4FYDA 1HR0J 3B54A 3MM8B 2Q6BA 3BBBA 3Q83A 3RR7A 3BYPA 3M8QA 3KOAA 3RG6A 2HFOA 4PG6A 3I31A 2C1EB 4ZCMA 3HKZD 4ZN1A 4IG0B 3C6UA 4BHQA 1ZM2A 2D1CA 1TK0A 4XDDA 4PUOA 9RUBA 2CZ4A 4DLEA 4DZDA 2D3UA 4ZJQA
chains in the Genus database with same CATH topology
2RMLA 4HI2A 4URQU 2LU1A 2M8HA 5J2QA 3HPOA 2ADCA 2XB2D 3ONQA 3GILA 2IBKA 2DK2A 3OXFA 4BWMA 3MECB 2HPUA 1TKXA 3NGKA 1NK7A 1JKHB 1MMLA 1RQ0A 3K57A 2DH8A 2IA6A 4Q2MA 2BM0A 4NCGB 3FFIB 4ALZA 2F9DA 4DJBA 4IG0A 4LF9F 5F8MA 4J9SA 2L9WA 4HDGA 2JSXA 3CVKA 1AXQA 3T6JA 2UUTA 1NH8A 2VG5A 3TVZA 3LQVA 3TARA 4AXIA 2C3YA 3GIIA 4GO5X 3Q2TC 5EN1A 3MXHP 4R0EA 1TK5A 3U02A 3DLJA 3DRXA 4ZCKA 4ES1A 2VUGA 3W2VB 4C8MA 1L3TA 1QLNA 1RJJA 1XR5A 2RB7A 1JJ2R 4FNIA 2XMUA 2XMTA 3CE8A 3R5DA 3CJKA 5G0RA 3MD1A 4ED5A 4ETZA 4JV2A 3CCSS 4NXNF 4OI0A 4A8WA 2JZ5A 4YB6A 4NLDA 4CH0S 3BDEA 2KO1A 5AXMA 1TL3A 2KFZA 2JJ4D 1FKPB 1XWLA 2YKOA 4ZPWR 1P8GA 2HHVA 2A2DA 4LF4F 4ED6A 2YKMA 2DGOA 3H5XA 4K4ZA 5DO2A 4EGLA 2RDJA 1JLFB 2OPRB 1N36F 4NLGA 2VG7B 1G1XA 3W2VA 4FBTA 2VKRA 2X1GA 4PQAA 2EC0A 1Q78A 4C3MA 4C2MA 1TQLA 4MKYA 2E9ZA 1FF2A 3MEGB 3GIKA 4LFAF 4QU7A 1CEZA 2OSQA 1NK4A 2C3OA 1FVQA 2J6UA 5IQQA 1IJFB 2ERRA 5B0DA 4Q45A 4LVNP 1E6VB 3M9OB 1IKWB 1UA0A 3BSCA 4C8OA 3I0SB 1FHTA 3HKWA 1ZTWA 2FHOB 1JLCB 4Y2AA 3CCUS 5EGYA 4MYUA 1VS3A 1U1LA 3QZ8A 3N6MA 2J5AA 3M2UB 3DRRB 2OTLS 2DGSA 1HW8A 4AFFA 2OKQA 4JI8F 3N5FA 4B3SF 1HD1A 1N88A 2A3JA 4QIFA 5JVGQ 1U1RA 5KFMA 2XC9A 2B6AA 2D9PA 2HGNA 4RWWA 3P6YC 2AQ4A 4ZKAA 3MGJA 4M1KA 5KFVA 1HQEA 3HF5A 2UUCF 4C3KA 1E6VA 1HR0F 2CQGA 2YWHA 2XWXA 4R25A 2UP1A 4JYAF 3EPIA 1IXKA 4EBEA 1SJ1A 1JLCA 1A9NB 1TKDA 3M9NB 2I5JB 3HX9A 3LWMA 1SJ3P 4N76A 3G9CA 3UDCA 5HMYA 2FHKA 3O1LA 3VWSA 3KLHB 1JXEA 1IN0A 2MZJA 3QJPA 3KHGA 1FKOA 3TVKA 2ASLA 3ITHB 3CCVS 2X51A 4Y0FA 2QEXS 2YKNB 3DM2B 2CJ9A 3THVA 4J5OA 3BGRB 2LA6A 5F8LA 4IOBA 3IRWP 1OWXA 5L1JA 3KG4A 5LXYA 4CI0B 4X4VA 4IRCA 1L5UA 3S1TA 2EK1A 4DL0C 5CD4H 1N5YA 2MHEA 1SUQB 2UVUA 2MJNA 3S01A 3SYZA 1WI6A 2YNGA 1RK8A 4A8QA 1S97A 2NUUG 2RKIB 2ZOGA 3E01A 4DEZA 1M0SA 2PFFB 5DS7A 4OX6A 1KD1T 2IJNA 4AUKA 1Q8BA 2R7XA 3AHPA 1OO0B 3RYLA 2JRSA 1N6QA 2ASJA 3MM9B 1D3WA 3ITHA 1AFIA 1C1BA 1OS5A 1HHTP 2YKNA 5AXLA 3QIDA 4K4XA 5KT2A 2K8GA 2J6TA 2EKYA 3OUYA 4P7VA 4IH6A 4A8SA 5MAOA 3MTJA 4Y3CA 1V6HA 1BY9A 3G96A 4NLOA 5CZVA 5T14A 2JHEA 3CEDA 5HLFB 3KJVB 2RUGA 3N79A 4KB7A 2IYGA 4BCAA 5LJ3Y 3JSYA 1HWUA 4HH0A 1PSDA 3CDEA 1Y4ZB 2E5IA 3NL0A 3CJ4A 1HBMB 2DHSA 3OL7A 2W7AA 3C8YA 4IFVB 4J9QA 3MM9A 1C0UA 2FIUA 5KFBA 2BA9A 2XGPA 2FJDB 1X4FA 3ULHA 3KWMA 2ADBA 3NLCA 1ZAVA 1ZH5A 4CO3A 1DTQB 2E29A 5E3PA 4OI6A 3OTOF 3DXBA 4X64F 4YQWA 3HT3A 1URRA 3LGNA 4TLQA 2W9AA 3CDAA 4WZMA 5H1SV 3VCDA 4X4QA 1Q1KA 2DCLA 5HLFA 4J9KA 4DL7A 2F7VA 3BS9A 3D1QA 1R6YA 4C8YA 5DQIA 2J7WA 1B0PA 3DLBA 5DM7Q 1YI2S 4QPTA 2QT7A 5F8HA 4WE1B 4EYIB 1HBMA 1GTEA 1RT3B 4K4UA 2ALZA 4I7FA 4IFVA 3GG0A 3SCJE 3CCQS 3PW5A 3LP2B 3QGPA 3VQTA 1HNIA 2W7PA 1DTQA 4RNHA 1TUVA 4AL7A 1JLQA 2ROGA 4KC5A 4WJBA 4C9DA 4X2BA 3HFKA 4MAKA 3KFWX 2HWIA 5EX0A 1VQ9S 4UUXA 2HHTA 5A8WA 1QAJA 4DSIA 2YKAA 5F3TA 2BABA 2EWHA 4A8XA 5IZHA 1WACA 3OHBA 3KLFB 2R8HA 1S72S 4G3IA 1VC0A 1Y00A 2E5JA 6FDRA 2MMYA 2XZWA 1NZAA 5H9FJ 2Z2LA 1XTZA 1ZTTA 4FF2A 5KG6A 1RWUA 1YJ9S 1KLMB 4FXDA 1CLFA 3LPYA 3LP2A 1FRKA 4CO2A 4F26A 4JI6F 2GO9A 3HMJG 3R5CA 2EK6A 3H98A 4UY8T 3K2YA 5ITHA 3MAHA 5GAEI 2I9SA 4UY85 3NWGA 2HGLA 2DO4A 3PDNA 3VZIA 3KLIB 2KHCA 2BYCA 4LQ9A 2J7KA 1DARA 4A8OA 5JUMA 2E1CA 2KFYA 2CPIA 3NCRA 3TP2A 1SJRA 3KLFA 3PRDA 1HBUB 1LWEA 4J9LA 2FLPA 4WU3A 5SUHA 2LDIA 2AYEA 3PX0A 1KC8T 4RW4B 4MK7A 7FDRA 5KFRA 2ZH1A 2HLUA 2M9KA 3OXGA 4YR0A 1JNZB 1SKWA 3TAMA 2Q66A 1K0TA 1KLMA 4HI1A 2R2UA 1RTJB 2ZITA 3DOLB 2JX2A 4ERDA 3I5CA 4H4OB 3E2EA 2COLA 2XMMA 2KRBA 4ZA1A 2AJ4A 1R8BA 4GC6A 2C3PA 2XS7A 5J1NA 3R27A 3V5RA 1QVFR 2QSWA 1SKRA 1H38A 2QMWA 4WFBQ 2GMHA 3KK3B 4G1IA 2RRAA 3DI6B 4ITSA 4L3NA 2R9LA 2J0XA 2KJVA 4Y65A 3MFIA 4FF3A 2DGWA 4B9MA 2RU3A 3NMAA 1IKVB 2IRYA 3HHLC 3DOLA 2PGCA 4F02A 1KEKA 2VG6B 3IAM9 1X4BA 5LJ5Y 1NKEA 1P6TA 4IRDA 5A0YA 3FSIA 2OPPA 5K8OA 4OJHA 3LANA 2LEPA 1MWYA 2CQCA 5I42A 1X5PA 3NBPA 1DZ5A 1FCAA 3KKFA 3SFUA 5DG8A 2IM3A 4DV7F 1R8CA 5LMUF 2VONA 3KMQA 4XPEA 1ZPWX 4ICLB 1VQYA 4QCLA 5IT0A 3CCWA 1UVIA 2NZ4A 3M32B 1CQMA 2OO4A 3RB3A 1IKVA 2LXUA 4QJVA 2J76E 2ZKTA 3IRXB 1TL1B 3JAMY 4DDFA 2NXUA 1VIXA 1C1CB 5HROA 2MPUA 3MMAB 3CTRA 5GAEU 2DNRA 3IC1A 3IGVA 2E5LF 3K8VA 1E6YB 3CJ5A 3EYZA 3IGNA 5DQGA 4CCHA 1XERA 3PKMA 2DT9A 2XG8A 2E7WA 4ECVA 3H8YA 3RAQA 4EZ6A 3M2VA 3QZ7A 1BQNB 4HEA9 1SC6A 1S77D 2ZZNA 2B9YA 3DLEB 1U45A 4WZQA 2PSZA 3L7PA 3GB0A 1OSCA 3W2WB 1C0TB 4GC7A 1R8HA 1WF2A 1KOOA 1ZOTA 2WBMA 5KFPA 1Q86T 2DCUB 3OVAA 5IT4A 4TKTA 4LSLB 1HBOA 4H4MB 1LQ9A 2KYXA 2CRLA 3N6NA 3GSDA 3LGMA 3QLHB 4EBCA 1F5CA 3PW2A 3N9UC 5KG2A 2C42A 2VFTA 3M2RA 3CCZA 4TLRA 4Z37A 2GO8A 4X4PA 1LW0B 2P9GA 3SDEA 3MR5A 1HWJA 1N48A 3BM7A 1FE0A 2QA1A 5KG4A 1RT7B 1LK5A 1FRHA 2B9XA 3BB5A 4U7UK 2KM8C 5CYMB 5D4PA 2HWTA 4AE5A 2YH1A 1SB6A 3FEYB 2LA4A 3QJJA 3Q8SB 2SXLA 2RJZA 2R8JA 4YR2A 4JI7F 5CCLA 4DL2A 2J8AA 3JSRA 3MPVA 4KBIA 4O3NA 3U1MA 3L95X 4B02A 3B8HA 3MM7A 2BRLA 4P7TA 1SV5A 3H2UB 4H4MA 3UQSA 4PWDA 4DR2F 2RIJA 4UQTA 4J9RA 1YRUA 2HG4A 2HZCA 1QAYA 1V3SA 5GAGI 5LSLA 1NNDA 2GGPB 1KRPA 1YRTA 3BQ2A 2YX7A 4OLPA 4XDCA 3JYTB 4NOHA 3K5NA 2LEBA 3NG8A 4IG3A 5CYMA 3PIOQ 2XMKA 2YVSA 1RTHB 3BSAA 3LALA 2JDJA 1S6QA 5I3PA 2GIQA 2GIRA 4OX7A 2JFDA 1NJWA 2DPJA 3AAWB 3PV8A 4H4KA 3GFZA 3W3SA 1FT8A 3M6VA 1MSWD 4KV8B 2OMLA 5IWAF 3HHEA 2FTRA 1U1NA 3CJ3A 4J9PA 3OL8A 2ZZMA 1FTRA 3QO9A 4QR1A 2RVJA 4R0JA 4MFBA 3VZHA 4ZCLA 2N7CA 1RT5B 4DSJA 5CXTA 1UA1A 5AE2A 2W4PA 2W9BB 2DD8S 1SH2A 3MD3A 2MQNA 2GFFA 5L9XA 3HM9A 3UCUP 2CYYA 4MIBA 4NRUA 4L6V3 5E7OB 3UCGA 1HNWF 2YTCA 1RTHA 2FHJD 3CCRS 3HHLB 1K9MT 1LWCA 5HBMB 1LWFB 2M0GB 3QAEA 4QYRA 4IO1A 4F3QA 1CVJA 1HI0P 4KV8A 1NHUA 2PA8D 1OPIA 3WBZA 3X3UA 4RNMA 3TYTA 2PI5A 5M2RA 4IQXA 2JC1A 3LP0B 4ECZA 1KS2A 1ELOA 1S1UB 3WX4A 2B43A 3E3XA 1FDBA 2RRNA 3DOMA 5KFYA 3TNVA 2XMVA 5J2MA 1HQUB 1RT5A 5C24B 2AJFE 2M88A 4DV5F 3I4HX 2VV5A 1M5VC 2P9CA 2M52A 1D9DA 3PY8A 1HD0A 3EUNA 4TN2A 1NU4A 4JV0A 4CO5A 1I6JA 3H25A 2XCPA 4JBCA 1HNXF 2IM1A 3QPIA 1Y3JA 3S8SA 5DDRC 3CXCR 1RDRA 2YNIB 4MYTA 4M8LA 2Q79A 4PWUA 1UP1A 1LWFA 2IAJB 4D3HA 3PKYA 3PEHA 2KU7A 2ZH3A 2UXDF 1S9EA 2VFUA 2GMLA 4QWEA 2HQIA 2X3GA 4URSA 1DTTA 2DGVA 4KHMA 4ZP6A 1HBNB 3MMBA 1SIWB 2ZC3A 3OVBA 1S1UA 4DQIA 2RNEA 1G6BA 1VIOA 5GAGU 1U25A 3KK2A 4ELVA 4OZ5A 3MEDB 1YWXA 4OHVA 3HVRA 4ZLPA 1NJXA 3G4SS 2D3ZA 5KFNA 3TI0A 4TY8A 3LAKA 3LF0A 4NLQA 3UR0A 4QWDA 3CD7A 3I0RB 4Q0BB 4QQBA 2Y1RI 2HNYB 4U9RA 3K8WA 3PJXA 3OJSA 3FCHA 2WCXA 1X4GA 5F8IA 1Y9OA 4AYBD 5B0CA 3KHHA 1YJNS 2RS2A 4CO1A 2BQUA 1IBLF 4TU7A 3J80Y 5F0WA 1W25A 2WBRA 1JXLA 1YGYA 3G86A 2BJDA 1YJTA 5F3ZA 2Y1JA 2FY1A 1OQ3A 3HDSA 4XO0A 4LFBF 3PX4A 4NWBA 3AY0A 3RRGA 3OVSA 3HVTB 2CPJA 1HFEL 4WYLA 3TX8A 3VTIA 3RU0A 4RUCA 3GR1A 3MMJA 3MR6A 4K4WA 4B9NA 2G4BA 2UZAA 4OMFG 4U67Q 2EFGA 2L9NA 1RT6B 2EBGA 3FRZA 5HP1A 4O44A 3L09A 3SZ2A 1LKZA 2VFVA 3ZC4A 4R5PB 1KQFB 3P96A 4RWXA 5EX3A 4F4XA 4I2QB 3FMBA 1RP5A 1T05A 1N0VC 4RNFA 4I0WA 1I1GA 1MW7A 1S6PB 2ZNYA 3M6WA 3ZZUA 2XLJA 4CO0A 2VBYA 5GADI 4CH1A 4FF1A 2RT3A 4DOZA 3SFGA 1GQEA 3MM5B 3CO9A 2HHHF 3O2IA 5KOWA 4RW6A 5K8MA 2W24A 3P3DA 4RZRA 2AF6A 2Q6CA 3DDKA 3SSQA 1S6OA 2I38A 4WFXA 4TQSA 2WW8A 2X1AA 3TANA 1WF0A 2DNYA 3O3LA 5J2PB 2XEXA 3I56S 2FVPA 1OSDA 3MI7X 5KFTA 2N4CA 5I4MA 4R5PA 5CH7B 2LKZA 1NJZA 5L39A 1KOHA 1WTBA 1DFDA 2UVVA 2FHJA 3MM8A 2O5DA 3IR7B 3OR1A 4F4KA 4ECXA 2IMWP 2J9CA 2OJ3A 1WHVA 5HL7Q 1LW2B 4KAIA 2VZ9A 3ZZTA 1RKIA 4CQ1A 1J5OB 1ZAWA 3HLUA 4MKAA 4USHA 5B0FA 2WAQD 5C25A 1UFWA 3CWJA 5KOXA 1KQSR 3ISNC 1VQ7S 4M5DA 4DL6A 4B9SA 2R2SA 4GO7X 1SL0A 4C8NA 1MNEA 2J9EA 4NYZA 5ADZA 1GXUA 5DQHA 3H2VE 3U1NA 4RU9A 2CQ4A 2DNPA 2HAIA 3OXLA 2CVEA 2W9CB 2VH7A 4QZVB 3UD3P 3RBEA 4H54A 3EPGA 3SMZA 4DMZA 2VD3A 2PIIA 3OFHA 4ZPCA 2JVRA 1TFYA 4ED8A 5KFKA 2V8GA 4OLOA 5E33A 3A1YG 2EFVA 2AX1A 4KGMA 1FEHA 5AE1A 4F2SA 1EETB 1N5VA 1DBDA 2IC3B 3IXQA 1J5OA 1JLGA 2BANB 4TXSA 2L9DA 4C0BA 4KJIA 2NQPA 3M30A 1B0TA 4OJGA 1HYSB 2K3IA 1JLEB 1Y5LB 2N7YA 3Q0AA 1SJFA 1KFSA 2JEJA 4HT5A 2GHWA 1FRIA 3VF0B 3BSOA 2V8HA 3SSRA 4X4OA 2ROPA 1U26A 1FRLA 1VQLS 2VKZG 3TAQA 1O5JA 2MSSA 2LMIA 4ID5B 5K9FA 3POTB 2W9CA 1WEXA 1QY7A 3MECA 1C2PA 3V6HA 1NB7A 2DITA 1JKHA 4PQUB 2V4RA 2Z4PA 5GADU 1U6ZA 2CPHA 4PR6A 2FC9A 4NCGA 3FFIA 4NXMF 4I68A 1A6LA 3DLGB 3DMJB 4IH5A 2DIVA 2GQQA 2VQFF 2KFNA 3CMAS 3QGGA 4WFAQ 3IAS9 4G1PA 1Q79A 3GIMA 3VAJA 2C22A 2DR5A 2CZVC 1HYSA 2A18A 1JLEA 3I5AA 3Q8PB 3GV5B 2VQEF 3CC7S 4G6VB 1JMTA 3MURP 1N5TA 2DJWA 5LSRA 4JV5F 2CPEA 3GZ7A 4NLWA 1TV6B 2VFSA 3FQLA 4CIOA 3PO5A 4NYOA 5GVQA 4LJMA 3D1HA 4IDKB 2WSEC 3CJ0A 4XK8C 2G1DA 3M4XA 5LSOA 2OPSB 2VASA 1URNA 3FDSA 3VQSA 2J0QD 4ELUA 3NNCA 2WONB 1AFJA 1P1LA 1AW0A 2AYGA 3CIMA 3KMSA 1U6FA 2R7VA 4ZPDA 1ROFA 1X0PA 3O44A 4YB5A 2QA4S 2A10A 2JFKA 4URGA 3K5LA 1BC6A 1FKPA 5AXNA 1SKSA 2V4QA 2EBEA 2W4DA 1CPZA 2ZBIA