4AL6A

Crystal structure of the s148acsy4-crrna complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
189
structure length
157
Chain Sequence
FTMDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAALDLPFVTLRAQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSY4 ENDORIBONUCLEASE
publication title Csy4 Relies on an Unusual Catalytic Dyad to Position and Cleave Crispr RNA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/rna
total genus 32
structure length 157
sequence length 189
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09618 Cas_Csy4 CRISPR-associated protein (Cas_Csy4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2540 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4al6A00
4AL6A 4AL7A 2XLIA 4AL5A 2XLJA 2XLKA
chains in the Genus database with same CATH superfamily
1WG1A 4ECRA 1UFWA 5LL6d 5GMDA 2FHMA 1WG5A 1F6TA 3GPAA 4ZVHA 2C2NA 2MPUA 5J2MB 3MPUB 3M7VA 4DS4A 2BKOA 5DLFA 3LO3A 2IMWP 1EKSA 4RW6B 3ZZPA 2MHEA 2AD9A 1VQSA 4MK9A 4FKYA 4IH6A 2Q3PA 3G82B 4TQSA 4CM2A 1Y5NB 2CQ3A 1EQMA 2DNHA 2PD1A 4WP8A 1MROA 2HZVA 1JMTA 2ZBQA 1LW0B 1IKWB 4FYYB 3C14A 4DWIA 4WXOA 2LQ8A 2J7UA 4DFKA 1RTHB 2WBRA 3MM5B 1N32F 4QWEA 5D4LA 2ZD1B 3BKUA 3NNCA 1FO1A 1NXIA 2CRLA 4B9VA 4LRCA 4I0WA 1HWIA 5FDLA 1KBRA 3D4JA 1FD2A 3QT5A 2R8KA 1T03B 4OYMA 4IOBA 4ELUA 2JX2A 4DG1B 2R7WA 2MQQA 1QAXA 1FK9B 3T3FA 3G6YA 3I0SB 2MDAA 1OIAA 3SCLE 4JI2F 1HBUA 4CQ1A 1RCXB 3RAQA 2ILYA 2RHSB 3R1HA 1NDPA 3CDBA 1WD6A 2XYHB 3ZZYA 4M5HA 5HROB 2E1CA 4P2SA 3CJTA 1HNZF 3Q8QB 1NHUA 1BQNA 4X66J 5KOWA 4YMEA 1S9FA 3MM9A 4DX7A 1RHRB 2JOQA 1IBKF 3KXDA 2VB6A 4ZA1A 4F4WA 2NUHA 2DNPA 2F9JA 2X7IA 3MAAB 4BDPA 2KTQA 1YRXA 5HK4A 3BYRA 1YRUA 5ETTA 1IN0A 1F0XA 2JZ5A 3TQEA 1T05B 2JLFA 1NJWA 4OV6A 2PIIA 1LWXA 5CA5A 2VJUA 3QO9B 3I96A 2BKNA 3ITHA 1ZZNA 2X1AA 2W2MP 3N9UC 3CIZA 1MWQA 4YY3F 1CS4B 3DRSA 4TY9A 2YNGA 1EETA 2ZBPA 2GV1A 4AQYF 5IM0B 2LEPA 4LF8F 2EBEA 3DLEA 3NOGA 4LF9F 2CDRB 5D0HA 3W60A 1QE1A 2UV8A 1J5EJ 1NDCA 5T7LA 2UXDJ 4B9SA 1Y00A 4HL9A 1QLNA 3G96A 2H1YA 2Q79A 4F04B 1VRQC 3FNNA 1VK8A 2B4UA 1HQEB 5BXIA 4NA1A 4PKDB 3OTOF 3R5BA 5E5NA 2VPYB 4ELVA 2IRXA 3QT8A 1XN9A 2Y8YA 2KO1A 4KHPJ 2LEBA 2J9DE 3K5LA 4MIWA 1N36J 3PR4A 2XC9A 3HSDA 5A0YB 5A2QU 2PI5A 2ZH7A 4OYAA 2WK4A 2E5LF 1YQHA 4DV0J 4OYWA 2KHDA 2O3DA 4FBUA 2M8DB 3H5XA 1Q8BA 4PCQA 2LCWA 2V6AA 4WU2A 3NL0A 3OHBA 2DGSA 3M2RB 1TL3B 2D9OA 4WZQA 2F8EX 1TV6A 2VG6A 2D74B 1R0AB 2OPPA 1XMOJ 4FF3A 4KPCA 4GVLA 1RHUB 1UEUA 5DM7Q 3HHLC 1IR2A 3W62A 3D6HB 3RJMB 3PW5A 2QL5B 3DOMA 2BM1A 3AOBA 1NSPA 5E0OA 1T9UA 2XQCA 1FWLA 2F9DA 1ZPWX 2I1RA 2G13A 2LA6A 5JJBA 1K0TA 1T8EA 1Y9OA 1X4HA 1U09A 4DX6A 2HFVA 1S1XB 2VC1A 4NLPA 3UDEA 2DR6A 3U1NA 3WDOA 3M8RA 4AL6A 3HVTB 3A1YG 1D0EA 4J91A 4O0IA 3CCUS 3M30B 2GIFA 3W61A 4DV4F 4F2RA 5ETMA 4YHHJ 2CG4A 5AXMA 4NEYA 2O66A 3DCAA 1UFKA 5E2QA 1VQNS 1XR6A 4HYKA 4EU0A 3AHPA 4GKKJ 1FNXH 2GCFA 2P6SA 3RBXA 2MB0B 1H6KX 2V2VA 3I4HX 2DO0A 4DR4J 4U8YA 2YTCA 1WSRA 3E01B 3BN7A 4AL7A 4LRAA 1NK5A 3ENWA 4X62J 1M90T 2GVZA 1FFWB 4MAKA 3IAM9 2ZDPA 4R0JA 3LGNA 3KMSA 3PG9A 4I64A 1FTRA 3VF0B 2PMWA 2DY1A 4R8UA 1XEZA 3MAHA 1Q81T 1FKPA 1W7WA 1KP6A 2MQMA 5KFKA 3H42A 1JLFB 4E2FB 3OXGA 3V6DA 2G2OA 2CJ9A 3H98A 1TUWA 3OVBA 2HHSA 3GB0A 4I7FA 2EEYA 4U7UK 4NLGA 2EW9A 4X84A 1WC1A 2DR5A 1S6PA 4G65A 1L3UA 1I94F 1J27A 1KVJA 2WZ1A 3KK2A 3H7HB 4UOFA 5AXNA 1IJEB 3K2YA 2EBGA 1DTQA 4RUHA 1N4LA 3BH7B 1U1RA 3PY8A 4JI8J 1NK0A 4OI3A 1GK8A 5ETSA 3DGVA 4DU8A 3NLCA 3GJRB 1L3TA 1Y3KA 4KKOA 4LQ3A 3R7BB 4I6WA 1JK9B 1K1SA 5KFCA 4C3KA 4M5KA 2B8PA 2UP1A 4XK8C 2B9WA 4K4XA 2CQHA 2C3OA 3D67A 1WC4A 5SZTA 2MQOA 5ETLA 1VK3A 1RSCA 1S4FA 2YWHA 2RE1A 2RQ4A 2V9WA 3E2EA 3NGDA 4FN5A 4DV0F 4RO0A 1T7PA 2OJ3A 4OYXA 5G0RB 2VOPA 2YKMA 1NK6A 1NB7A 2FY1A 4I56A 1B0VA 1QTNB 5LSRA 1SQEA 3M9MB 4WFAQ 3SV3A 5K14A 4ER8A 5KFYA 1RABB 2KG0A 3QIDA 4NL5A 2E1RA 2YWWA 5KFRA 1UKUA 3EM1A 1XMOF 1H73A 4I4BA 2V68A 1U1LA 2ZH6A 5K5MA 2UV8G 2D3O1 2QLJB 3ZZOA 4LREA 5HO4A 4J9SA 3R5CA 1HNWJ 1I3OB 5BYQA 3ZXWA 2DRBA 4J9VA 3ZNJ1 4Y2MA 1RTIA 4OJGA 1VYAA 3M8QB 3ZC4A 3C19A 4FYDA 1IBLJ 1Z2ZA 1RWVB 1EP4B 3LAMA 3TEHB 1N6QA 2ROEA 2VKZG 3IGVA 5L9XA 2VBWA 2BE2B 4YHHF 1VQ8S 1XMQJ 2LQ9A 1OQ6A 3TUJC 4WU3A 2VG5B 3CPWR 2EFNA 3BGLA 1SL1A 1LV5A 2RB7A 1TVRB 1I6JA 1GX6A 1ROFA 1RT5B 2ZZNA 2QLXA 1K73T 3MR7A 3BS9A 1HHQA 4DPXA 2U2FA 2DNMA 4TNOA 1X5PA 1UP1A 1RT2B 4X62F 1VC5A 3CC4S 2DNZA 5IQ6A 2OPQA 3M8WA 2EXUA 4AYBD 1S1TA 4MYTA 4IO9Q 3QLHB 1NEEA 3LP0A 4CO0A 4F25A 4DR6J 3TUPA 2RDDA 4OZ3A 5AXKA 4OZNA 4K5RA 4G6VB 3Q8VA 2HEKA 1S79A 2BJ9A 1AUDA 2E29A 3LPEA 1A6LA 3R9LA 3HJVA 3VAMA 1L3KA 1PBUA 2H51B 3CO9A 2H3EB 1GEHA 3AH6A 3D6MB 5HMWA 3DHXA 3O8WA 3A3PB 3GG1A 2DNOA 2AWZA 3OTCA 4JI8F 4DL0C 3AXKA 3K57A 4UUWA 2AJ1A 2W2NP 4P71A 3T9ZA 2L9WA 2XYPB 2HHHJ 3C15A 2KYZA 4QWCA 1NK7A 3PX4A 4ZPBA 4DN9A 3RBZA 1T3OA 3EXYA 1VMBA 2J7KA 3JSMA 4RW4A 3V2UC 3QWPA 4MMOA 3FEXB 3CC2S 2ACYA 3EZOA 1SH2A 1TKZB 3H8YA 2OELA 3JAMU 4Q2MA 2ZHOA 5HI7A 3I32A 2FVPA 4DV6J 3W2VB 1NRKA 3TUZC 1HI0P 3OTBA 1GFWB 2DB1A 3MPVA 1VS3A 5D0RA 3ILIA 4YN3B 2MZQA 2RH3A 3HT3A 3TYTA 2CPYA 2W9CA 5EX3A 3T6BA 3W65A 4RWXA 2M0GB 3HCXA 4K50A 1PIEA 4K4VA 2VFUA 2YBVA 2YNIA 1FKOA 2J9CA 4RUCA 2HLTA 3GJSB 1YBUA 3HHLA 5KFBA 1JLAA 3AQPA 4G1IA 3P96A 5E3QA 3BBCA 3C16B 5EN1A 5IFMA 1WELA 1KR4A 5M2UA 4LF5J 1PC4A 2VH7A 2MLYA 2NR0A 2K1RA 4USUA 4Y00A 2EK1A 4ZPVR 5GADI 1SC6A 5CAAA 1RT4B 3DU5A 3BJYA 1E6VA 4ZITA 3NBPA 2MQPA 2MSTA 4LVOP 4GKJJ 5KAKA 4O44B 4USHA 3DLGB 3X3UA 3NCPA 3DMJB 3G8SA 1FRKA 2MZRA 2HVEA 3PX6A 2G1DA 1OQ3A 4DSEA 3LPYA 2BQUA 1IBLF 2Y3YA 2IJFA 4ZJLA 2EC0A 2GZOA 2QJ3A 5EHHA 4ZJOA 4C8KA 2YQ0A 4DI6A 2D3UA 1T3NA 5HBMB 4ZP6A 5KFSA 1SL2A 4FPIA 3OL8A 1URRA 1F5AA 1CJKB 2IM2A 2A3JA 5IWAF 5F8MA 4AL5A 2GHPA 4RW9A 3AD7C 2R2UA 2YXLA 1U47A 1JJCB 2O67A 2EPIA 2FHJA 2Y1RI 4JV5F 1LK7A 5BR8J 2G1HA 3DI6B 1JLEB 1EQ0A 1REVA 2BDPA 1HQ2A 3B4MA 2KRBA 2WAQD 1O0PA 1U25A 2HK2A 2IRUA 3R7SB 2IC3B 1S0NA 4DLEA 2DHXA 1HBOA 1XBWA 2CADA 2ZH3A 2B6AA 2Z30B 3DOKB 3VQTA 3BSCA 2FVSA 2R3VA 4C11A 1XJWB 1MNEA 1LEOA 1LWCA 5F3TA 2RUSA 2RKIA 4RNHA 3MZIA 1KLNA 2VIHA 2GIQA 2H9ZA 2KFZA 3KK1A 3HXMA 2KJWA 2F1FA 4IG0B 2EFOA 5LXYA 2C2ZB 2HHHF 4LF7J 1LQ9A 4MKYA 2CUYA 3PR5B 4P6QA 1P8GA 3GJTB 5HLFB 2RVJA 1RADB 4M5DA 1S1UA 4OX9J 2OPSA 1JLGB 3S6EA 2UUCF 3TX0A 3QT7A 3PO4A 1GAOA 3IRWP 1P1TA 1D8YA 2ROPA 5HVFA 1YK9A 1LOUA 1Y4ZB 3RBEA 5A76A 4YFUA 4NXMF 3U27A 1IUJA 1LWEA 2I5JB 3ZZ0A 4IUFA 2XMUA 4K4ZA 1VJQA 2W4PA 1JJ2R 4XTTA 3DYAB 5I3PA 4A8MP 1T9VA 4FF1A 4QJVA 2YX7A 1QM9A 5J2PB 1KRPA 4JI0J 4ZMMA 1DTTB 2RQCA 4LT6A 1U24A 2QE5A 1U0HB 4OI4A 4JV0A 5GAHU 3G2XA 2ZH9A 3RB3A 4QWDA 4HTJA 4LF5F 3R2DJ 4LSZB 5A8RB 1IKYB 3TAMB 2H4YB 4F0HA 4KH1B 3KJFB 3PX0A 1Q8LA 3PHEA 1C1BA 3OR2A 2JVOA 2VF3A 4GKJF 1N5TA 1VRUA 5HMXA 1PAUB 1KQSR 3SXLA 6AT1B 4CNYA 4F4ZA 4EYHB 1RT6B 2MKSA 3GZ7A 4NLSA 3V4IB 1EARA 1ELOA 3MMAB 3RW7A 1RZMA 4CLWA 3MPWA 4X4RA 2DIUA 1KOHA 4UOHA 5IT0A 3ULHA 3SSQA 4DV5J 4N41A 1FE0A 2QFIA 4DV2J 1S9GA 3UR0A 4XPEA 1NJZA 1DQ9A 4B9UA 4WYWA 2YX4A 1RE1B 1D9DA 3OV7A 4KGXB 4P9SA 4WFXA 2J7WA 2EC2A 1F3VA 1RKIA 4NI2B 1XNRF 4HI2A 3D1HA 1N34J 4CTAA 2JH3A 3TA1A 4DL4A 1DJ0A 3DNCA 2O5DA 3MM6B 2LXIA 2P9GA 2CNLB 2NSBA 3FCHA 2EKNA 1X5TA 4C8MA 2D3OR 2V2ZA 2MKHA 3MM8A 5GMKa 1KTQA 3FCWA 5D0EA 3MTJA 4B3RJ 1UZDA 2CPIA 1B7YB 4WXWA 4O3RA 2KZZA 5B08A 1I51B 1JLCA 3BGFA 4YB1P 3ZZUA 3Q23A 2R2RA 2OEKA 4LF1A 1KKHA 1WC6A 1P1LA 2IM3A 2HQ3A 5J2NB 2FPHX 5I42A 4RNOA 3L9ZA 4N77A 2XTJP 2J0QD 3Q22A 1KSPA 4E0DA 3T1HJ 3N5BA 4HT5A 4YEAA 4C8NA 2QA4G 1JNRB 3T5LA 4LRDA 3CXCR 1FE4A 5C42A 4B9LA 2QV6A 1SUQB 3GP9A 3PACA 4X4PA 4DUYF 3KHRA 4I2PA 2HVHA 3ET6B 2XMVA 3A8KA 1N5VA 2HRYA 5KFTA 3KFWX 3GLJA 1YBTA 2DNKA 3W2WA 3P4UB 2BRKA 1HNIB 4M94A 2ZOFA 1UFLA 2OH2A 1U02A 2MKCA 3EE3A 1AZSB 2N4CA 4GVBA 2XMMA 3RB0A 4J90A 4LMZA 3DN9A 5CYQA 3IRXB 1VISA 4RNMA 1WDTA 3GIMA 3UWTA 1S6QA 4TQRA 1UVNA 3L95X 5D6GA 4RKUC 4LF6J 3NY0A 4ED0A 1L3VA 2WRMA 1NMEB 4HKQA 4JI0F 3RGIA 1Q7YT 2JNJA 2WVDA 2YWGA 5DDRC 2JEFA 1S0OA 1NSAA 1OJ4A 2K7JA 1ZAVA 3KLIA 3SYZA 1K44A 3EZ5A 3CCTA 4KH0B 3N01A 5C24A 1SVDA 3JB9k 1GXUA 1CJVA 3RZAA 4CLYA 4JYAJ 3QSYB 4LBHA 1SQGA 3J80Y 3T1AA 2C3PA 1FF2A 4CDIA 2ZH1A 1BQMB 1S72S 3IM8A 3GR1A 3IS9B 1P9YA 3FBEA 1SKRA 4MTPA 2MZ1A 5IT9Y 4WP3A 3I31A 4J9MA 2H5IB 4USWA 1DLOA 3FMBA 3AAWB 1V3SA 4RUAA 1JXLA 3IM9A 2LXFA 4ZKAA 1UTAA 4RW8B 4X4NA 1Q82T 3OL7A 4IDKB 2VFVA 2KRRA 2FGCA 3TO8A 5GMEA 4X4UA 2L41A 4BCAA 1YJ7A 4LFBF 1WHYA 4QPXA 3OW2R 4DV2F 2IAJA 1KHWA 1UJ6A 1QD1A 4YP3A 1MWZA 3FBCA 2CPFA 1CJUB 2RJZA 2E5IA 4DQRA 2XSFA 4NX9A 3BYPA 4KY3A 4ECVA 1TK0A 4DUZJ 5DGAA 1N34F 3R5DA 1IR0A 1D1UA 1VQ7S 2LU2A 3OL6A 1FT8A 2F63A 3LOUA 5KFNA 2M88A 3IC1A 3W5XA 2X3GA 3EJMA 1C0UA 1QVGR 2G0IA 2XO6A 4B3RF 2DNYA 1IBMJ 1UVLA 4EFAC 2VV5A 3MURP 5M2RA 1ZH5A 4DCPB 4ZVTB 3GMGA 1VCTA 5HP1A 2BJ1A 3B8HA 4MFBA 3KJNB 2YKAA 4K4TA 1VRTA 3R1LA 1N0UA 3IBWA 4FYXB 3BO3A 2ZUAA 1DQ8A 4Q2LA 3OLBA 3GIKA 3Q2TC 3UR3C 3UN3A 4M95A 5CYJA 2RU9A 2WSEC 3SQOP 3FQKA 4DU7A 1GH8A 2VD3A 2XS2A 3MMCB 1G1XA 3MHYA 3I9ZA 2MSSA 2OPRA 4Y2KA 4V1Ak 4E8UA 4Q0BA 4DQPA 1UWBA 5KT2A 3NP5A 8AT1B 2M4MA 3D6TB 4C8YA 4WE1B 3TWZA 3DDNA 3DOLB 4OZ5A 2WB1D 2V4QA 4XO0A 1SJ3P 2DYAA 4A48A 4J9QA 1HWUA 3P8BB 5E3AA 2KZMA 1WF2A 1EX8A 3OR1A 2ASDA 5IT4A 6FD1A 5AE1A 1M0SA 3ZO7A 3AA9A 4CH0S 4ZPWR 2HNDA 3FMWA 2PFDA 4KB7A 3D1OA 2I8EA 2XI3A 2W8KA 1QSYA 2P6TA 4ID5A 2B4PA 4DPTA 2MTLA 4DR3J 3QIPA 4LF6F 5KFXA 3DRPB 4KC5A 4HACA 2HS0A 5EDWA 4EWTA 1UVMA 5B0FA 3MM7A 2GX8A 5LMUJ 5KFLA 1J5OA 5KFMA 3WZ0A 3NOCA 4OZ2A 1C0TA 1LFWA 2YNHB 3SQGA 3Q24A 5K20B 4AUKA 5E3CA 1TUVA 2AEJA 2Y0SD 4JYAF 1U26A 4KV8B 4UY85 3HVAA 2ATCB 2VQEJ 1RKJA 2NXJA 1RT3B 1WOPA 4CO4A 1J2VA 4DSLA 3HHNB 2RQKA 3BGUA 3DM2B 3MGJA 3MEDA 2R7UA 3IXQA 1HD1A 5J1EA 4PWUA 1CC7A 4H4MA 2WOMA 2ATLA 2RF2B 1PC5A 1AA1B 2NPIA 3K7RA 2X1BA 5D4NA 1RWXB 4YQWA 3QJJA 1Q5VA 1PYTA 1CJTB 1JB0C 1RWUA 4ECTA 4B3OB 2FD2A 2P5VA 1Y5IB 4KO0B 1LWFA 4JV1A 4R5PA 1AROP 1TELA 3KHLA 4MKVA 3H40A 4DUZF 4Z2XA 2NLWA 5EWGA 5L1KA 1HW9A 4ENOA 4IG3B 1D9AA 4N7TA 3O3LA 2CIMA 5JVHQ 3CJQA 4Y2AA 2LA4A 4URQU 5B0DA 3H90A 1WEYA 2IHR1 3EVWA 2BW2A 2V5HG 2AIRB 3DDKA 3HI9A 2JSXA 5D3GB 1KQKA 1O6XA 2YWKA 1IBMF 2KM8B 5DS7A 3QRPA 1ICEB 2ZNYA 2RHQB 4I2QB 3MUMP 4FXWA 3IBCB 1CPZA 1HFEL 2CJQA 3CCQS 2HW3A 2DGUA 3PJWA 3TR5A 1N54B 1WF1A 2I2YA 1NZ8A 3K59A 4RUBA 1P9QC 1VBKA 5J2MA 3BM7A 4PABA 1TKDA 3VQSA 3IFEA 2ZC4A 4RW6A 1TFYA 2XO7A 3JSYA 5BJRA 3DRXA 3AFGA 5KFUA 2ZKTA 1VQ9S 2RILA 3IN5A 3SDEB 4XDDA 4RNNA 2LDYA 3QNWB 1LW0A 1IKWA 7AT1B 5KFPA 3M6UA 3CJ2A 2BOPA 2BZ2A 4WFNQ 4NWBA 4HH0A 4P2FA 4BC9A 3ISND 1RTHA 1X8DA 3CCES 2CWXA 2G0JA 3MM5A 1UVKA 2NYIA 4B3TJ 2ZD1A 2FLOA 1X5SA 2QSFA 4S0MA 2H65B 2XZTB 1YKWA 2PGCA 3EDRB 3FEZA 2AJ0A 2AQ4A 1T03A 2BBEA 1Q95G 2DRDA 1HR0F 4LF2A 4DG1A 3DRRB 2YKNB 3CDEA 1FK9A 4NLDA 3I0SA 2V67A 1RYSA 2RDJA 1KLMB 3GONA 2Z0GA 1RGVA 5LMUF 2SXLA 4FVMA 5HROA 2UZAA 4ED4A 2XLJA 3QAEA 3ETOA 5D0GA 2MLZA 4LSNB 1X9WA 2PE8A 3OTDA 1NHVA 2VQEF 3POTB 4FYVB 3DLKB 2J0XA 1IWAA 3MAAA 3THTA 3OUYB 1ZM2A 2VFTA 2Q6BA 3KDOA 2QEXS 5JXSA 1T05A 2N82B 2BMBA 1RTZA 5KG2A 3WBZA 3QO9A 2RNEA 1NLKL 1QUVA 3F0NA 5KG0A 4NZ6A 2DNGA 3MTKA 1VQOS 2J9DA 1JXEA 3CD0A 5LT5A 3CDUA 1CS4A 3QQCD 1RBOB 1BC6A 1SCJB 2DHHA 3KK3B 2LQJA 4OI0A 2HRUA 2N3LA 4PYDA 1XNQF 4TYBA 3CCRS 2QFJA 2UUAF 5IM0A 4QR1A 2ROGA 3J80U 4Z37A 4DFJA 2NPFA 3PW7A 3BQ0A 1F60B 3BEGB 3NG8A 1Q8KA 2CFXA 3HSGA 3W9IA 1HI8A 4NCBA 3C8YA 1VQYA 3M8YA 1T02A 4LRBA 1HYSB 4WWSA 3IR5B 3A8IA 3VVUA 1HQEA 2FJVA 3OFEA 5ETPA 4DOZA 4JI1F 3HPOA 1MG7A 2IA6A 4C8LA 4B08A 3ZZZA 1URNA 3H2UB 3UDCA 3HSJA 5AE2A 4DSKA 3KLVA 3VALA 4YB7A 4O3SA 1WOSA 3K0JA 5K8PA 1VQPS 5A0YA 4QYZJ 4RL1A 2ZH5A 1YBAA 2G9OA 1IXKA 4X65J 3NS6A 2GAHC 5A6PA 1NSQA 2CZ4A 1G2EA 1NPPA 4L74A 1TKTB 1N56A 4WBFA 4DPYA 3BR9A 3VAGA 3B82A 1MSWD 5CXTA 1QSLA 3AQOA 3OD2A 4JI3J 2APOA 2V2KA 3M2RA 1TL3A 3EX7B 2W01A 3PYFA 1FWKA 1R0AA 1N0VC 1I1GA 4H4KC 4DHVA 2QA4S 1CQMA 2ALZA 4UY8T 4B3TF 4TU7A 1F1BB 3BSAA 4ZCLA 1RB0A 3OXFA 4B9MA 4X4QA 2OGUA 2Z2LA 1S1XA 4LFCJ 2COLA 3HVTA 3RG6A 3BQ1A 4YOEA 2E1PA 2VONA 2MZJA 1W26A 5DM6Q 1EAYC 2GO8A 2HRTA 3CJ8A 4F8RA 3M30A 2JLGA 1FJEB 3S8SA 2LVWA 5KG3A 4J9NA 1D9FA 1CVJA 3UI3A 1SB6A 4ES3A 3PRDA 4ZCIA 4DPUA 2AYMA 2BM0A 1TL5A 4QU6A 3PJXA 1GQEA 3SMZA 3E01A 2YVSA 1FX4A 2D9PA 1M5PC 3QATA 5A2QY 2XYGB 1TMJA 3IBFB 1FRJA 3MR5A 2ZE2B 3AODA 4P75A 3PW2A 2YKQA 1W2IA 4MKAA 2CQCA 5J1PA 1RK8A 3ZTQA 4U7CA 1E6YB 5CCLA 3FJ2A 5IC6B 3KLEB 1JLFA 1HQUB 4ZVRB 4IFYB 4WFZA 4JI6J 2BJ8A 4TU8A 4F3OA 2JDJA 2XMAA 4WP9A 5E3PA 2D1CA 1F9FA 2HVDA 1CQNA 1VQMS 3IG1B 5K9FA 5HJYA 3BPSP 3MEEB 4EZ9A 1OY6A 4WZMA 1B70B 1UA1A 5IZHA 3MD1A 2DPIA 1X7VA 1DAXA 2FLNA 4DUTA 2B9XA 3L7UA 4DS5A 4OQJA 1S48A 2XBPA 4G1QB 3GIIA 3KUGA 2V8VA 1C2PA 3DLBA 1MMDA 3TZZA 2J6SA 3H25A 3VGUA 5KFEA 1WF0A 1JKHB 4I1TA 3D3BJ 4ZIWA 1QDUB 2VJVA 3MMJA 1REGX 2F5GA 1OPZA 2M2BA 3IP0A 4UZCA 4DSFA 4I69A 1M5KC 2BE9B 1S1WB 1KONA 4PRFA 4FPRA 3RRHA 4X65F 1HIYA 4K7QA 2VPZB 1KOOA 4M5MA 2VASA 1WACA 1UEKA 5D8HB 5GVQA 4J9LA 4H54A 4IR9A 5KT6A 3TI0A 3RTVA 3FBBA 4NLYA 2IYIA 4M63A 3W9HA 3U7JA 5I3UB 4K2JA 3VZHA 4DL5A 3K5PA 4O3QA 2Y9HA 3PCOB 1W25A 1H2VZ 4LF4J 2BABA 3FK4A 1JQGA 3GYXB 2HNZB 1UVIA 2FJDB 3QGPA 1SIZA 2HBRB 4DJBA 2YQ3A 3PDNA 2XY5A 2MY7A 1R6YA 3SSSA 1TTHB 3SIPB 2HLUA 4JI4J 3GCXP 2HHQA 4K4UA 2LEAA 1ZYQA 3TVYA 4IH7A 1Q0NA 3M8QA 5EUHA 2BRLA 3PVXA 4LFCF 1IKVB 4KGMA 5RUBA 5H9EJ 2IMOA 2W2OP 1EP4A 3AJDA 2VA3A 3G8QA 2BE2A 3M4XA 4NXNJ 1EJ7L 1X4CA 4OX7A 2QSWA 4RPFA 3HMJG 1JLQB 2ERRA 2VG5A 4YS2A 2OTLS 3FRYA 2VODA 1TVRA 3T5KA 4B3SJ 1RT5A 3GILA 4CYUB 1VQ4S 2W2PP 3W3SA 2VBXA 3AB2B 1NKBA 1HHSA 2UXCJ 1RT2A 5FLXU 2HGNA 4ZPDA 1NNDA 4TVAB 2KL8A 4DDFA 3LWLA 4QR0A 1AB8A 3H4DA 4ECXA 3IMQJ 3OSNA 4KHMA 3QLHA 2KT3A 4DQQA 4E98A 1RAHB 1HNXF 3A3NB 1UPPA 4NZ0A 2DGTA 3DKDA 4B3MF 4X4OA 2R7TA 4MKBA 2B3TB 4WF9Q 4ZP9A 4JI6F 2ZDOA 4PG5A 4QIVA 2GIRA 2DXEA 1O8BA 2C2EA 5D77A 2LU1A 2W7AA 2RS2A 6FDRA 4R25A 5B7WA 2WSCC 1SC3B 4ZVOB 2WW8A 3G86A 3GIRA 3R27A 2QMWA 1HBMB 4OX6A 1VHFA 2W9BB 4MJKA 1FWPA 3WC2A 5HVHA 2MYFA 1T9WA 3M32B 1YDLA 5K8NA 3HHDA 1R8AA 2W24A 3A3OB 2KT2A 2W7PA 4P73A 2WONB 4OI6A 2X3DA 4PWDB 1RT1B 2RDIA 3SCIE 4KHRA 4NYOA 5DG7A 2NREA 4M5LA 2IA0A 4Y6IA 4F50A 1QAIA 2PEHA 3M8PB 3U1MA 3K5NA 2V4JB 1TKZA 3PYDA 4ANCA 2A10A 1G4CA 3DU6A 3GR0A 1SQFA 1WG4A 1RI7A 2C22A 1WSVA 3D2WA 2FC8A 3W2VA 2KHCA 3UVJB 5LOQA 2W8LA 5DDQC 4AE5A 4OJ1A 4RU2A 2GJFA 1RWMB 3MI7X 2Z2ZA 1H74A 2HBZB 4ECSA 4L3KA 3EPIA 3IWXA 1N5SA 2YH0A 2E1MC 2AGQA 1RT7B 2XSJB 2NXNA 4Y3CA 3KLFB 5KFZA 2BJDA 3D1QA 1HPZB 1BHNA 4P10A 3C16A 2V9KA 1XC9A 3C6UB 1AFIA 4GO7X 4HHJA 1RT4A 4WK3A 4X64J 1B0PA 3VGVA 4JI4F 1EB0A 5LSLA 4O44A 3DLGA 3DMJA 2NYHA 5F41A 1UA0A 2KYXA 2XMKA 4B02A 4C2MA 4O4GB 3J7YI 5DZ6A 3Q2SC 3GV8B 1RHKB 1K9MT 2QGFB 2ZM6F 2MKKA 5KFIA 1RTDA 1S76D 2BJ7A 2B0GA 4K5SA 2BJEA 3H2LA 1P27B 5HBMA 4UZBA 2XY6A 2V8PA 1FJGF 2FY8A 2E5JA 4M1KA 2GFFA 3MDFA 3PTWA 1CJKA 3JAMY 4JP8A 4QZVB 1SKSA 3P5TL 4RZRA 4U9RA 2MQ8A 1VOMA 5D15A 3TRGA 3VCDA 1W2BR 1T9XA 5GAEI 2VA2A 1FRXA 3CJ0A 5L39A 1S5ZA 3KOAA 1PKUA 3DI6A 4CT8A 2GGPB 1JLEA 4TU9A 2CJKA 2OD6A 4C8ZA 5KOXA 3G87A 1HD0A 1JXVA 3RBDA 4ILMA 3TA0A 2BXJA 4YR0A 1HBNB 1OYDA 3UO0A 2KFNA 4ECYA 4LIWA 2CJBA 4FVCA 3JQMA 3EGVA 2IC3A 4HLBA 4IFVB 2R7SA 3D6FB 3BKFA 4A8YA 4QW9A 3DOKA 1C1CB 2NS1B 3PKYA 3OJSA 1B99A 4JI7J 1S77D 2UUBJ 2DD8S 2M5YA 1DZ5A 1XWLA 2DT9A 3PEJA 3J7Z5 3HM9A 3RYLA 3OXLA 2GNKA 4OHVA 4PAAA 2VPXB 4QBUA 4G3IA 2B51A 1PO6A 1M5SA 3LALA 4Q8FA 8ATCB 2BQ3A 4IG0A 3VGSA 5D4PA 1HWLA 3NRBA 2ASJA 1Y10A 3K5OA 2XLKA 5F8IA 1UVJA 1FDBA 4QWBA 1O51A 3T19A 5HLFA 5B0AA 3GTYX 2GQCA 2EFVA 3A8JA 1MWYA 3LWMA 1JLGA 4ZPAA 1OO0B 2ABYA 5CCMA 3HLUA 4PXDA 4DZ6A 2CNKB 5DGBA 5HJXA 2C2DA 4TYAA 3QGGA 3K17A 1TL1B 2J8AA 2DTJA 5KT3A 2I5JA 1RLCL 5HSPA 1HL6A 2OFGX 4CCHA 2XM3A 2CQ0A 2J5AA 3TZXA 3DYAA 2QG9B 4NE9C 2ZVIA 3H5UA 5J2PA 1NAQA 3GE9A 1ZA2B 2FIUA 1NK4A 3RAMA 1KHVA 5T14A 2IPOB 1YLXA 2VZ9A 2KFYA 3C2PA 5L1IA 1X4EA 2AF6A 1DTTA 3N4WA 2B7CB 3SCJE 3ILOA 4JUZA 1U0HA 4ALZA 2UVWA 4BHQA 1YRTA 3LP1B 3THPA 2XCPA 1S12A 3OTEA 1RHQB 2ZJQQ 4OZ0A 3P49B 4DXLA 5A8RA 2RRBA 4WYLA 5HATA 1IKYA 3TAMA 4DBQA 4OIXA 3LW5C 1CG2A 1YITS 2W4DA 4X66F 1UEVA 2AHOB 3WX4A 1N88A 5C25B 2Y1IA 3RR8A 4H4OB 2W4CA 3CD5A 3BDPA 4OLPA 2KXHA 2JC0A 1U1NA 3QGHA 3MOJB 3HX9A 2MEWA 1RT6A 4EI2A 3V4IA 4KRWA 2HFSA 3MMAA 2E7XA 4RBTA 4M5NA 3N0VA 3CULA 5L1JA 3AT1B 4NA2A 2EVZA 4W92B 3T6JA 2D7SA 1ITPA 1FEHA 4A8SA 1IKXB 1L5UA 1SC1B 4Z7CA 3AB4B 4IOCQ 1BGXT 1JLCB 1MN9A 3CT9A 4ED2A 2HAFA 4NI2A 3HF5A 4YR2A 4UOCA 4CIOA 4ZCMA 2FZKB 2HQIA 4Q43A 3MM6A 1J5EF 2BQRA 2UXDF 2VL1A 1MU2B 2XHWA 2ZWOA 1X0PA 4C0HA 1Y11A 4ZDNA 3T9NA 1SBRA 4XDCA 3R5JB 1H7XA 2HBYB 3LH2S 5IS2A 3P6YC 3JSRA 2HAIA 3NGTA 2UUBF 2KM8C 4KHPF 1T0TV 1N36F 5LJ5Y 5J2NA 4JI5J 2CYYA 3PIPQ 3KHHA 4RX6A 4LVNP 2UU9J 1AUSL 2VG7B 3KDNA 2KH9A 2JLEA 2N7YA 3G71S 1S7IA 2ZVSA 2YNFB 4V19J 2FYXA 4CO1A 2CPHA 1V6HA 4Q44A 4DPOA 1SUQA 3MXHP 4B9TA 3FFIB 1V3ZA 3ET6A 4MT1A 1IQTA 1AYEA 2RSQA 3I6PA 2WVFA 3JQJA 3HD1A 1PGZA 3H0PA 1HNIA 1SV5B 4U67Q 2IDEA 3TJ8A 1AZSA 4QIFA 1X4DA 4EYIB 5KT5A 4IH5A 1NKEA 2R7OA 5J2QB 4QIEA 3OT9A 2MKIA 5F8HA 2PEBA 3IRXA 3Q83A 4N56A 2ZNZA 3BREA 3GQCA 3TOQA 4OFZA 1YJUA 5BYRA 1RU2A 1LXJA 2BW7A 4CH1A 1FNMA 2DRAA 3O5TB 1VQLS 3ETMA 1RLDA 2LKZA 2MQLA 5L46A 3TAPA 4K4SA 1X4FA 2XG8A 3R5GA 5A6WA 2HQCA 1B7FA 5L8RC 4ILRA 3IR6B 2ZH4A 1OY8A 2F8HA 4GKKF 2CVIA 1TL7B 1BQMA 2FUG9 3GWCA 4DR4F 4DR7J 3VV2B 2XI2A 3E51A 1Q1KA 2Q43A 3A8EA 3S7RA 3IS9A 5FJ4A 3BSOA 3A4TA 4IO1A 5LSOA 2D69A 4OV1A 3HP6A 2EFGA 3G4SS 4RW8A 2IVMA 3R97A 1PJ7A 3GFXA 3CE8A 2IY5B 1S1VB 3CD7A 1BXNA 5LMNJ 1VR6A 4UOGA 2HPUA 4PZVA 1FRHA 3C6TB 1APSA 2NQPA 4XPCA 1K47A 1UCNA 1RTJB 3FUYA 1OY9A 2IRYA 2PA8D 1ULRA 3O44A 1UWAA 4KIAA 1V5IB 2RUGA 3J7ZT 1CJUA 2DGWA 3ZTRA 4PYAA 2GA7A 4B9NA 2YPYA 3CC7S 1CULB 2BACA 4P72A 5E3RA 1RA7A 5C7PA 3D0HE 1HNVB 2HURA 2BANB 4DL2A 1B3TA 1QAJA 4CI0B 4WKRA 1D3WA 4D3HA 4OX8A 2NZ4A 3KWMA 4F4XA 3FCVA 4A8OA 2IVYA 3W7BA 1UMJA 2L48A 4NCGB 4F7VA 2GMLA 1UETA 4KFBB 3OL9A 4CLZA 1NKCA 4WKYA 4LQ9A 2GMJA 1S59A 2R8GA 1DURA 1NSKL 1RQ0A 3DLLQ 4KAIA 1TP7A 4ED7A 3C46A 3PRBA 4UT4A 3PYGA 1U2CA 2J6TA 1FJ7A 3ADAC 2BV3A 5GAGU 4BWJA 4HDGA 2C3MA 3MAQA 3VAHA 2K06A 1VI7A 1VDHA 3C3LA 5F3ZA 4QYRA 1VQ6S 1Q8IA 3MMCA 3W5ZA 2WBMA 3ZNUA 2E5HA 2AJQA 1OS5A 2DGXA 4Q5VA 3WIUA 3NCQA 4WE1A 1WKKA 1FI4A 3T1YJ 3HHLD 4LJMA 2LQ5A 3DOLA 3JQKA 2LYVA 4DQIA 3ZFVA 3QRQA 3D0IE 1HNZJ 4EMDA 3F73A 2M9KA 4HTIA 1RAOA 2MY8A 2U1AA 3LP2B 5EWEA 1PYSB 1ZM3A 4ZN3A 2RRNA 1HNWF 1IBKJ 1GMWA 1G7CB 4TY8B 1RHJB 1GXLA 4USMA 3CJ4A 2HNYB 2ZJPQ 3LA0A 2XGPA 2A6OA 3UPFA 3DRPA 1WKJA 1X9SA 2ZEJA 4KBIA 4DFPA 1WDDA 2CJYB 2LMIA 1P6TA 3NGSA 3PNIA 3LUYA 2A18A 1R27B 2YNHA 3BO4A 3QMQA 2FJXA 1WC3A 1XMQF 5HQMA 1VIOA 4DSJA 4KV8A 2N7CA 3M9NB 3HFVA 1EKRA 3CJRA 4OI1A 5DQHA 4YR3A 1BD6A 2LLZA 1U45A 4BWMA 1LW2B 3OLAA 2XHCA 3ENVA 1XERA 1RT3A 2HQDA 4DZDA 4HDHA 4AQYJ 4NCAA 2FHJD 4OYIA 4ZS6A 4LF8J 3DM2A 4LF9J 1YJVA 3I87A 2R2TA 1JX4A 1ZOTA 2FC9A 1U8WA 1U1PA 5LM7E 4ANDA 2OD4A 4IOAQ 3NWRA 4USTA 2RF2A 1ZPVA 4A47A 2HIYA 1UAWA 4NPOA 1EZZB 3V81B 5LMNF 1WC0A 2QA2A 4DR6F 3FKBA 3ELHA 4P7TA 1CJTA 3CCWA 4B3OA 3M05A 4KO0A 5CZVA 4RWWA 2HFOA 4IYQA 2FGOA 1OSDA 1T9TA 2KT5A 3CCSS 2GJ2A 3JSBA 4PQUB 3TJAA 1YJWS 2B7BB 4P2MA 4YDXA 3CWJA 2DH9A 2A1BA 1UZHA 4IG3A 2E5LJ 1HMVB 4ZHRB 2CA9A 3K8VA 1UJ4A 1S6OA 3NWGA 1VLOA 3CCJS 1U1MA 4O3PA 5D3GA 4USVA 4P74A 2WB4A 2V4RA 3Q8RB 3SCKE 2D3ZA 5THWA 5I3QA 3O2IA 5HL7Q 3HSZA 1NO8A 2EFQA 3TVZA 4I2QA 3QAUA 3I56S 5ETQA 1Q16B 1IR1A 2Z4PA 3QSIA 1TL4A 3FVYA 3MECB 3CDAA 5A8KB 4DV6F 2FLPA 3GU0A 4UTGA 5H1SV 3ILJA 3D0GE 3GFZA 4UF4A 4EBDA 5K8OA 4X4TA 3W1YC 1U49A 4ES2A 2I6WA 3G6VA 3SDEA 3BGRB 4K8RA 1G6BA 2BKPA 3NAHA 3I0RB 3T1YF 1R8CA 4DV4J 2LFVA 4QW8A 1X5OA 1R8PA 2C2MB 5C2GA 1H7WA 1QY7A 3HVWA 2WCXA 3R3TA 4AD6A 3KLGB 4NYZA 4NRUA 3GG0A 3UCUP 2AYGA 1VIXA 5KFOA 1ZTWA 1KDNA 4NZ7A 3HD2A 4XAKA 2RQMA 1FXLA 2V8DA 3US5A 3DRRA 2YKNA 2FJBB 5IV4A 2O1PA 4OJHA 1KLMA 3L3CA 2RT3A 3ZTSA 3TVKA 3NEKA 2NCKL 4CRJA 1TU0B 1JWWA 1R7IA 1BQXA 5B0GA 3D54A 1BUXA 2DR7A 4LSNA 2QLFB 2WVBA 4ECZA 3PW4A 3POTA 3DLKA 3LANA 1OWXA 2ZFHA 2HWTA 3B78A 3IGNA 1I94J 3VR1A 3OUYA 4J9KA 2BR0A 5DETA 2HGLA 3KJVB 5A8WB 1WTFA 4BLGA 5BR8F 4X2BA 4J9PA 4ZVFA 2J0SD 1FXDA 5HQLA 7FD1A 4PPDA 3CGIA 1IM4A 5LXRA 1X9MA 2GQQA 1RA6A 2IJNA 2JVRA 2KN4A 3G6ES 1U6BA 1WI8A 3MMBB 3KK3A 1X31C 2UUTA 2OUGA 2Z2MA 2CZVC 5E33A 1GT8A 3O1LA 2FTRA 2RMLA 4DF4A 4I67A 2OSQA 4I6YA 2VFSA 4NLTA 2C1EB 1LK5A 2B4OA 3MF5A 5HQ8A 2YQ1A 3QZ7A 3VGTA 2C28A 1JLBB 4L72B 1HWJA 2QO3A 1Q5YA 4DN0A 3WIVA 3NNAA 1K8AT 2AMCB 2H4WB 4Y2CA 5KFVA 1HYSA 3MR3A 2L08A 2DXFA 4DV3J 3CMAS 4LF7F 2XWXA 3M2VB 5FD1A 5KT7A 2V50A 1SJ4P 1NJXA 4ICLB 2WVEA 3HHKA 4OX9F 3MCSA 2G0CA 3OFGA 3HZGA 5IOLA 4DFMA 4X4VA 5HAOA 1UW9A 2QT7A 1SJQA 4A46A 3MR6A 1CSJA 2AEFA 2AEMA 5F8GA 1WEZA 3L4BC 1L3SA 3MFIA 1TKTA 5B0EA 3FRZA 2KXNB 2B4VA 4CO2A 4YDDB 1VC6A 4TLRA 3EICA 2JC1A 3Q8PB 4XIUA 3R8YA 2BYCA 2R42A 4OHXA 1S10A 2E9RX 1TR0A 5IQQA 4ANEA 2HFZA 2K2PA 4WFBQ 1NU4A 3UQSA 1V3RA 5SUHA 2FJAB 1FFGB 2PO4A 1XR7A 2CQBA 4FXVA 1SJ1A 1WTBA 2Q66A 2WTFA 2DCUB 2AKWB 3B54A 2CAJA 4O4RA 3GJQB 2OEJA 4J9UE 1XR5A 1YX2A 1FA0A 2V63A 1N5YB 2CZ9A 1S9EB 4CLSA 3CB4A 1ZAXA 2Z8QA 2MQNA 1BLUA 2FZGB 3G9CA 3KNGA 3CVKA 1N48A 5HN0A 1NH7A 2KB2A 3DDIA 2JEJA 1H3DA 2LDIA 4TN2A 3H5YA 4DV5F 3VVTA 1A7GE 2ZITA 3CJKB 2K8GA 5KFHA 4QQBA 3EYZA 2RRAA 2CJAA 4I68A 3Q86A 2ZE2A 1F5CA 4K59A 1FKAF 1BY9A 2QMXA 2MGZB 1X4AA 3BB5A 1YSJA 3SI8A 1PBAA 3FC9A 4ZPCA 1F9HA 1U8SA 1E6YA 3N6NA 2XNQA 3KLEA 3MEGB 7FDRA 3RB4A 4LIRA 3KG0A 1IWGA 1HQUA 1NH8A 4IFYA 4U6PA 4PG4A 3CMQA 2DNQA 4ZVPB 2PN6A 4PUOB 2VFRA 3W8PA 1FHTA 4WFYA 1VQ5S 3K58A 3D3CJ 4QU7A 1RWNB 3MUTP 4DR5J 2X1GA 4F0MA 3PO5A 4ZVSB 4TKTA 3TW0A 2HHWA 3IG1A 4HH1A 5EWFA 1GMUA 1IJFB 2VHGA 3B6BA 3MEEA 3BDEA 5EGYA 3NMAA 3JYTB 4URGA 4GMKA 3T41A 4ZOSA 2QIFA 4QCLA 3DGPB 2XCAA 2OAUA 4ED3A 1KFDA 2NXCA 1YG0A 3NNHA 3T1HF 1FJCA 1SC4B 2XMWA 2CQPA 4DV3F 4MH8A 4A8WA 4OJ3A 3BBBA 3QBCA 3WC0A 4G1QA 2KVIA 4MK7A 4OZJA 2QL7B 2CQ1A 2B9EA 2GAGC 1JJ4A 1OMSA 1JKHA 4ZLJA 3MEKA 3OPKA 2GJIA 3AA8A 3ONQA 4DL7A 2BX6A 1S1WA 3PJ9A 5JMNA 2H54B 3MFHA 2ZH8A 2FZCB 5BYSA 4LSLB 1XIQA 4PXEA 3M1VB 2DPJA 2C2KB 3UFCX 4U95A 3GFYA 4L73A 4WK1A 2KDOA 2MKJA 2ZOGA 4W4MA 3R5AA 2ASYA 2HBQB 3E3XA 5I3UA 1C4AA 1U1KA 4JBCA 4CLLA 2DR9A 2MHNA 2VQFJ 4ECWA 4OHWA 1PAEX 1JJHA 4C3MA 3V5RA 2E7WA 1UL3A 1FDAA 3H20A 4LR9A 3NS5A 3IAS9 1MW7A 2CQDA 1JNZB 2HNZA 2F65A 1YJRA 3OVAA 1NCLA 2HQGA 3P3DA 4DV1J 5ETKA 2IDLA 4CT9A 3NKYA 5IWAJ 2HS3A 2B5JB 4PG8A 2BA9A 1ZETA 2IVFB 1IKVA 4JV5J 3ENAA 1K1QA 2QLWA 4DPWA 1T11A 2M70A 3ILLA 2Q6CA 4Q8EA 4EO6A 1Y5LB 5F0UA 4GC7A 2DNRA 1JLQA 2HMIB 5AJ3J 2J9EA 5DG9A 5DG8A 3V6KA 3PIOQ 1ZA1B 2C3UA 2GVDB 2WSFC 2CPXA 4CYUA 4USIA 2ZZTA 3VAIA 4RW7A 1FESA 3M2UB 2NXEA 1TKXB 4ZVGA 5J1NA 4OHZA 4Y34A 5CYMB 1VQKS 5CD4A 2HFNA 3OHAA 2ASLA 3R6GB 3QZ8A 2P9EA 2HK3A 2HZCA 2OP5A 4RBUA 2BVZA 2V69A 1RU1A 4RLEA 4MIBA 1SL0A 4C0BA 2L9DA 4KGKA 2KVQE 3TAQA 1ZM4A 4JB8B 4KYZA 2UUCJ 4KGZB 4ED6A 4DR5F 3KLHA 2DKOB 2QX0A 3ZZTA 1MROB 1TQLA 2RU3A 4Y0FA 4O23A 5ETOA 4F67A 4WJBA 1HBMA 3C14B 3NGUA 4ZVQB 4TLQA 2W9BA 4NXMJ 3D68A 1K0VA 3M32A 2R4FA 1R31A 1YJTA 2Y1JA 4DL3A 1KWMA 1GNKA 2WONA 4PWDA 1TMMA 3U02A 1MN7A 1RT1A 2XLIA 3CCMS 2EWHA 5FDLB 3I5CA 2E66A 2H5EA 3F56A 3G82A 2I9SA 3TEGA 5DDOC 3G8TA 3M8PA 2ZUGA 1YIJS 2V4JA 4NLRA 3GYGA 3GSIA 5KFGA 1HHTP 1HBUB 4DCOB 4ES1A 3UVJA 2CVEA 4ED1A 1U7LA 3GSDA 4OYBA 3BGOP 1PILA 5FLXY 1B64A 5E7OB 4DL6A 1BQNB 1B0TA 2V0NA 3MM9B 1GMVA 1RT7A 3BO2A 2XSJA 3FQLA 1HW8A 2PMHA 2R7RA 5GAGI 2LP4A 3KLFA 4USJC 1CC8A 4DR3F 1PG5B 5CH7B 3MPDA 1ACMB 1HPZA 4U96A 3UN2A 3SEOA 2R8HA 2VQFF 4C9DA 2HG4A 2FVCA 2MJUA 2ADBA 3OJUA 3BZQA 3C6UA 5DQGA 4FS1A 4ILLA 4QYZK 1RTDB 4ZLNA 4FP9A 4K2XA 3QJPA 1U0SA 1R0BG 4EUVA 3ITHB 3GFHA 2VU5A 1EIYB 1N52B 3FZBA 3PYEA 4DV1F 3H2VE 4GRSA 4ECQA 2QMUB 3I9V9 4HHUA 3CNQP 1KVIA 3PM9A 3DRSB 4L3NA 2P8IA 2YNGB 3F44A 1XNRJ 1EETB 1NDLA 4JOUA 1ZTTA 4O4GA 4OMFG 1Z4UA 2POKA 2E44A 2NXUA 3MPYA 3DLEB 2VPWB 3CJ5A 1QE1B 1FERA 5T7LB 2XMTA 1QVFR 1LFPA 1V5VA 2UVRA 5KTQA 5AJ3F 5AE3A 2Y1LB 2HHPA 2HFUA 3MCMA 3CD6S 1XMBA 4DR2J 3N6LA 4NLWA 5CQGA 3CMES 1VLYA 4ZPTR 3NMRA 5LJ3Y 5F8LA 4FS2A 4KPYA 3J81Y 4KSEB 1TK8A 3EGZA 4NASA 2GGPA 1S0VA 2C2OB 2P9CA 3D5MA 3FEYB 1NB2A 2DNLA 2RS8A 1HBNA 4CZCA 1RP5A 2HQFA 3W9JA 3QT6A 2DHSA 4IFVA 2IBKA 4N8OA 3AOAA 3VAKA 4FNHA 4DUYJ 1C1CA 2HHVA 4WTYA 4EGLA 2XNRA 1IVZA 2Z57B 3K89A 1ZS6A 3RB6A 4LR7A 4Z7YA 1QJHA 3SSRA 1FDDA 4FF4A 3A13A 4NLOA 4J7CA 3SV4A 1TV6B 2W1BA 2VG6B 2OPPB 1KD1T 4C97A 5M2PA 1HKAA 3QFHA 3JS9A 3DOMB 4KT0C 3JTOA 5F9LA 2AX0A 2ZH2A 3D9BA 2ZWPA 3BKTA 2HVIA 4RU9A 4G1PA 3FSXA 5HANA 3K8WA 1Q4RA 3BBFA 1CEZA 3IWNC 2KKHA 2VICA 1X60A 3S01A 4WIQA 4CP5A 2XGQA 3Q8SB 4A8XA 1RAIB 1TL1A 2ZZMA 1Q79A 1S7HA 2N3OA 1IM6A 3BSNA 3QGIA 3W64A 4RBVA 2W9AA 4FKXA 1NPKA 3VWSA 3O6QA 3GIJA 5B0BA 3UD3P 2DCLA 1ZM9A 4GO5X 1Y7PA 1SXLA 2ACMA 1YI2S 1RAEB 4FDFA 1FEEA 4ZP8A 2GVZB 3CTRA 1Q7LB 1WORA 2M8HA 3BF4A 3GV7B 2F8MA 1OSCA 2CQ4A 2JL9A 3LP1A 3PHTA 1FNOA 4R8UB 1FKPB 5DJBA 4C6AA 4HT7A 2HVZA 4EBCA 3V6DB 1X0FA 3MD3A 3U1LA 3QYYA 2DHAA 4Y28C 3W63A 3W66A 4LFBJ 2IIHA 1D09B 4HEA9 5C25A 4H4OA 4I7FB 2CWKA 3L7OA 3VAJA 3CJSA 1RWWB 5KG7A 1XQIA 3FDSA 5GAHI 1S6PB 4NLVA 1M5HA 1H2UX 2FB0A 4CLUA 1VFJA 3M6VA 3KK2B 4ED5A 1YHQS 4R0EA 4ZLPA 2OIHA 1R8BA 3Q8UA 2KXFA 5MAOA 4DCJB 3M9OB 1AT1B 3KYLA 1DTQB 2ZHBA 3QJLA 1WKLA 1U4BA 3IWLA 3OBIA 2D41A 1FRIA 2R7XA 2JRSA 1IKXA 3CUNA 4DR2F 2CQ2A 2AJFE 4KKOB 1VBXA 2Z2YB 4M8LA 3H5SA 2DR8A 2ZBCA 5H9EK 3TNVA 3TARA 1NZAA 4QIWD 4PG6A 1F2GA 3CCLS 4O3NA 3CCZA 1RCOB 3NCRA 1S4EA 1MU2A 3BPDA 1NDKA 1RUSA 4C48A 4V19X 4J37A 2A6MA 4ED8A 1TK5A 3K5MA 5JVGQ 2YKMB 4QWAA 5B0CA 4OL8A 1WUUA 4F36A 5KFWA 4EO8A 3MWBA 4IQMA 2H48B 5K14B 4UUXA 3G6XA 4P7VA 5HMZA 3DC2A 2FQQB 2XY7A 3TX8A 5E41A 2PI4A 2OEMA 4URSA 2OLWA 1WHWA 4OYOA 2MKYA 1BWEA 1RBLA 1IBCB 3WX8A 1D8ZA 2Y8WA 2ZBIA 2XS7A 2VC0A 3X1LB 2AT1B 1H38A 2DO4A 3KUEA 2JFDA 2VG7A 3TQ1A 3ISNC 2YY3A 3HKZD 2YNFA 4ZN1A 5G0RA 2RD5C 3UNYA 2GMHA 3OQ2A 1RTIB 1R43A 3IO1A 4F26A 2PDAA 4QPTA 4JI3F 2DXDA 2Y0BB 3FFIA 4ZVUB 1RISA 5KFQA 3QRRA 1N6QB 2EK6A 2R8JA 3EZUA 2DH8A 1SV5A 3P45B 2XZDB 3UW1A 3EXCX 2K7KA 4ITSA 3VHQA 5J2QA 3OSPA 2QL9B 4FF2A 2V94A 1HLWA 4L76A 2EI5A 4KJIA 2V2QA 3J7A1 2WVCA 4MK8A 1LKZA 3CEDA 4AFFA 5C2CA 3EWGA 2HZAA 2OPQB 2AGOA 2VBZA 1KQFB 1S1TB 1NJIT 2MZSA 2YKOA 5HMYA 3M6WA 9RUBA 1WHVA 5DDPC 3LP0B 3DHWC 3TANA 4LR8A 2XEXA 2A0FB 2ZC3A 1M1GA 4FXDA 5DRKA 3UN5A 1RBAA 1TL7A 3NGKA 2AU0A 2F3JA 1FCAA 2Z58B 1T95A 2PFFB 2FDNA 1N5QA 1FTCA 2M7SA 4P2XA 1EHWA 3GV5B 4A8QA 4ZK7M 4ETXA 4X4SA 1RAJA 2ZOMA 4NA3A 3D28A 5KFFA 3MCNA 3W8GA 3LTOA 1TAQA 3CF5Q 3TA2A 3UD4P 4M5GA 3AJ1A 4PXBA 4OYPA 2OMLA 3HDSA 4OZLA 1VHIA 2V34A 1S1VA 1WEXA 3M8ZA 1TFWA 4AXJA 3S1TA 1KC8T 2VDHA 4KE5A 1Q78A 4ZJQA 3N5FA 3NAIA 3JXOA 3C6TA 3EUNA 2GW8A 3MUVP 3C15B 3CCVS 5U47A 1RTJA 1AXQA 3FBFA 1KN6A 2QYCA 3Q89A 1JIHA 3JSMB 4RW4B 1VC0A 3FZ2A 1VBYA 4NMLA 3SBMA 2FVRA 1CULA 2HGMA 3KG1A 1PYOB 1YVFA 5L9NA 1HNVA 2BANA 3AD9C 3EVOA 4OI2A 1RXOB 4N47A 4ECUA 3R7NB 1M5VC 4NCGA 4Q45A 2XWYA 3PXGa 4OLOA 4U7UD 4ZVEA 4DQSA 3E8OA 4KFBA 2W9CB 4K4WA 3THVA 4F4KA 1SIWB 3IR7B 3PW0A 3OFHA 1DHMA 1FRMA 1TZ0A 2PMZD 2YNIB 1FKOB 2AV5A 4WPAA 4LBPA 3FSIA 3HHLB 5F0WA 4DSIA 3FSYA 1JLAB 2AJ2A 2LQBA 2R8IA 1ZBTA 3NS7B 3PRVA 1S99A 1Z2LA 3MCOA 5G4DA 2CQGA 2PSZA 2R9LA 2DIVA 3J7YU 2K1RB 3VAFA 3KKFA 1OPIA 3J81U 1E6VB 1MLAA 3NBPB 3L7PA 3M8SA 2XULA 5ETRA 3UD5A 1FFSB 1NBEB 4IRDA 1RACB 2JEGA 5KT4A 1HR0J 2DISA 1GTHA 1PJ5A 3CJ3A 2M52A 4C4WA 1T9YA 1QAYA 2DNNA 5AT1B 2OI2A 4H4KA 2E9TA 1LNQA 5KFAA 4LF4F 2Q1LA 4WTOB 2CDQA 2GHWA 5CABA 3TZYA 4DV7J 1M1HA 5GAEU 2FLLA 4A8FA 5B09A 5CZXA 2O01C 2DVIA 2E7VA 3WHIA 3LP2A 4UQGA 5ETNA 3T5HA 1SJFA 4C3LA 4HI1A 2GO9A 2B56A 2DGQA 4TY8A 3JTNA 4KTQA 1S49A 2P2CB 4FZVA 2HNYA 3UDVA 2I0XA 2DHGA 2A2CA 2R7QA 4RW9B 5H9FK 1S0MA 4W90B 1DRZA 5K8MA 2V8GA 2QYGA 1KQGB 4RNFA 2GQ2A 4QR2A 2HYIB 3DLHA 2DK2A 4IRCA 1REVB 3H59A 4DEZA 4NXNF 4PWWA 4WCEQ 3PEHA 3H4BA 2MXYA 1U48A 3AD8C 1SH3A 2N4DA 3Q0AA 5L1LA 1YJ9S 1WHXA 3V6JA 4B3SF 2M3DA 4GC6A 1LW2A 1YTYA 3SFGA 1U2FA 2YX1A 1HBOB 2KI2A 4PEOA 3TUIC 2B6AB 1XNQJ 4ID8A 3UCGA 2UUAJ 4C11B 2UXCF 1WOOA 2JFKA 2RAQA 3SZ2A 4CO3A 1A9NB 1LWCB 2DBBA 4NRTA 2RKIB 2PA3A 1RDRA 3EMTA 3GCWP 2VOOA 5KG4A 3I82A 3BN4A 3V81A 3KK1B 3M6XA 2G2YA 1R6VA 3RW6A 3HK2A 3EGNA 1M5OC 3ENQA 1MMNA 4JI1J 5IC4B 2KJVA 2JJ4D 2JWNA 2YWEA 4AXIA 4M5DB 3UDLA 1S1UB 2OPSB 1H98A 1QUPA 1N8RT 1RHMB 5JUMA 4DX5A 1LXNA 2QC3A 5I4MA 1F5BA 3HFZB 3V4MA 1FXRA 2IM0A 3RAXA 4PQUA 1HI1A 1NUEA 3IA0A 1HMVA 4ZHRA 3T5JA 2G4BA 1DARA 1F9EB 1LWEB 3DFEA 4I6AA 3NGRA 2IBOA 2HHXA 5C5JA 3TP2A 1R89A 2PT0A 1WC5A 3AXMA 4ZIVA 2ADCA 5H9FJ 2GHVC 3BR8A 1DBDA 1FX2A 1NK9A 1H2TZ 4K4YA 3QWUA 3OFFA 2ZKUA 3MECA 2W25A 1OYEA 5A8KA 4CLPA 3ZTOA 9ATCB 3EPGA 2PC6A 1XK8A 2ZHAA 2NZCA 2EG2A 2E1AA 4RJVA 4MIAA 1WI6A 1GTEA 2B43A 2VUGA 2AZ3A 5T41A 2W7OA 1KVKA 1C1BB 2BE7D 2CJXB 3OR2B 2I38A 1VRUB 4USKA 2A2DA 3BGRA 3ISZA 2HSEB 4F02A 3I0RA 3BQ2A 4J9OA 3N28A 2OKQA 2B8QA 3EVMA 4KGVB 4DV7F 2HKEA 4KR0B 3MR2A 4J5OA 3RUBL 3KLGA 3HKWA 3RRGA 3QFWA 4HR2A 5KFDA 4OZ1A 4X64F 4C8OA 1O5JA 1S9GB 2LXUA 1SH0A 2XZWA 4A8KA 4CLKA 1I5OB 1VJWA 4C0OC 5DO2A 4Q7AA 5CHCB 1DQAA 5ADZA 4PG7A 3C66A 3A12A 1SPBP 4OYZA 4DF8A 4CTAB 2AGPA 1Y3JA 3CW2C 2WW4A 4K0KJ 1YGYA 5IV3A 2B9YA 2BJ3A 1Q86T 4F4YA 1SI9A 4LFAJ 1CLFA 2YH1A 2DITA 2OHDA 5CD4H 1MMLA 5IXUA 4N8NA 3KUHA 2CXEA 3HJFA 3MM8B 3ICLA 3I5AA 2UVUA 1BWVA 3J81j 4ELTA 3KJVA 5A8WA 1YWXA 1FRLA 8RUCA 1H72C 2FJEB 1WWHA 3CIMA 1TAUA 2CPEA 1U1OA 1F3FA 5AXLA 4CH7A 5I42B 1WNEA 2K3IA 3HHEA 5IT9U 4ETZA 3ZTPA 3PKMA 3VZIA 4KQZA 3V6HA 3MMBA 5C42B 1RAAB 1RWKB 4LUBA 2JHEA 4I2PB 3EDQB 4JI7F 2VDIA 5MLCV 2YKPA 4NLUA 2ILZA 1JLBA 1FDNA 1PSDA 3W2WB 4UW2A 1FVQA 4L75A 1B4SA 1GX5A 3RR7A 1KEKA 3I5BA 2V8HA 4FNIA 5KFJA 1N33J 4GVBB 4BBYA 2F4VJ 3CDWA 4TXSA 1ZZFA 4J9RA 2AW0A 4DR1J 2DEJA 3M2VA 5CYQB 1XTZA 2GS8A 4F3MA 4ZCKA 2HWHA 1S6QB 4ICLA 2ALYB 2HS4A 2QZ8A 2BOAA 4UQTA 2YWFA 3HT0A 2DGVA 3PV8A 1FVSA 1WJ9A 1RJJA 2QRRA 2EG1A 3KLIB 1V9OA 4C7QA 1CBKA 2AP6A 4EEYA 2HHUA 2G2ZA 3DXSX 5C24B 1HWKA 3FGVA 4ZLLA 2C2RA 1CJVB 3KG4A 5ETVA 2Z56B 5D4OA 2IFXA 3HULA 3AOCA 1T94A 5F8JA 1Q53A 1ZAWA 4NEZA 2UVVA 2NUUG 3D66A 2EKYA 3LAKA 3I4PA 1KTVA 3F41A 1DLOB 2C3YA 5KG6A 1VBZA 3HO1A 1U6ZA 1M1KT 4QIGA 2CNNB 1S6UA 3AJ2A 2IM1A 5L38A 2E5GA 2FHOB 4W98A 2FVQA 3J7AN 3VTIA 5DZ7A 4MYUA 5KG5A 1UJ5A 2IAJB 1U2RA 2RIJA 3R2CJ 1U6FA 2CG8A 3KNAA 3HFKA 3R6LB 3N6MA 2DEIA 1N5YA 2AYEA 4BS2A 1S57A 2DY9A 2FHKA 1S9EA 4A4JA 4F0KA 3UCZP 4WIIA 2HIQA 2KU7A 4CO5A 2X51A 4PQAA 2QA1A 1HNXJ 4NOHA 2K3KA 2UXBJ 1U1QA 4B3MJ 3KMQA 3P5BP 4K0KF 1NPRA 4IDKA 4EZ6A 2J6UA 3LGHA 1KNZA 4IKAA 3CJKA 4LFAF 4YB6A 3AY0A 1C0UB 2AJ4A 1AW0A 1HARA 3RRKA 4EBEA 2XS5A 4C98A 3TZWA 1RAGB 4FBTA 2MGZA 2NSCA 2OO4A 1VGYA 2L3MA 1G3OA 5DQIA 3B4DA 5HP1B 3WQPA 1SKWA 2CNOB 1NK8A 2R2SA 1Y0HA 4MFBB 2OMOA 2C42A 1VRTB 4CLTA 3MEGA 2IYGA 3KTQA 3BH6B 5F8NA 2F40A 2F7VA 4Y65A 4EK2A 1QTMA 4D3GA 3GYNA 1YZ7A 4ZP7A 4PUOA 2HWIA 1R0CB 3UNGC 4B17A 2OPRB 2AZ1A 2CKWA 4Q0BB 1UWBB 5GADU 3ZZRA 1RAFB 2F4FA 5EX0A 5D78A 2W2QP 3PFEA 2HHTA 4IR1A 1PCAA 4CNZA 3CO0P 2EFPA 3JYTA 3SFUA 3PZPA 3DXBA 1DFDA 2CPJA 1R3NA 2OFHX 2AX1A 3DGPA 2DH7A 2ZJRQ 4JI5F 3KHGA 2H5JB 1N32J 2AYBA 4HHHA 2QTWA 3OR1B 2UU9F 4NYPA 1KS2A 1TUGB 2J76E 4LBIA 4CLFA 1N33F 2F4VF 3I55S 4PR6A 3LGMA 2DGOA 4U8VA 2QN6B 4PXCA 1UPMB 1DY3A 4DR1F 2HNDB 2MJNA 4F3QA 4NLQA 3DRYA 3HZEA 4ID5B 3KJQB 3DLJA 2DJWA 4PPZA 2MLXA 3QIPB 2WHOA 4YUDA 4N5SA 1KFSA 1SJRA 4HACB 2KG1A 4JI2J 3JTPA 4QOTA 3N79A 2E9ZA 3MM7B 3LF0A 1J5OB 4RR5A 4F4AA 4DLGA 3QPIA 1C0TB 1RWOB 2J0WA 3PFOA 3SQGB 1RYRA 4CM0A 4NMXA 3L09A 4LSLA 1QSSA 3M1VA 1NHKL 4LRFA 5HVGA 4AT1B 1YJNS 5ITHA 1GMWD 2CPDA 4DX8H 2VKRA 3NXZA 4IQXA 4N76A 2VBYA 1YZ6A 4FYWB 4NLXA 2MZTA 3CSKA 4ERDA 3MOZA 3UE2A 5F9NA 1X4GA 2QLBB 4CWBA 3TJ9A 2ZBRA 1RWPB 3MEDB 2ZM6J 2BEFA 4F2SA 5J1EB 2GC8A 4O0NA 3HVRA 4H4MB 1Z1ZA 3LQVA 2WOMB 1S97A 1C4CA 1FJGJ 4L6V3 1SKUB 5KG1A 4OHYA 3OVSA 4M5JA 2OTJS 4YY3J 5FIIA 2X1FA 1BMQB 1X4BA 2B5JA 1IQZA 4DR7F 1UW4A 1GXTA 2XMJA 2CPZA 1R8HA 1NJYA 2FJWA 4ATNA 4BC7A 1HA1A 1LWFB 4O3OA 1PJ6A 4R5PB 2LECA 4RW7B 2MMYA 4P52A 3D7SB 3RU0A 2L9NA 2R7VA 2YPZA 1FD8A 2BUNA 4Y2IA 2UXBF 2HMIA 1H0HB 3W5YA 1BE4A 2UUWA 1AFJA 2J8SA 2CQIA 2IJRA 2GVDA 3EGWB 4IRKA 5DLGA 3OTOJ 4JV2A 1F2HA 4M5IA 3BV8A 1A0OB 2XB2D 3KLHB 2OSRA 4YB5A 4HVZA 2JEIA 1NM2A 3M2UA 1TKXA 3Q8YA 4DMZA 5CYMA
chains in the Genus database with same CATH topology
5M2RA 1RP5A 4CZCA 1H7XA 1ZH5A 1WG1A 3LH2S 3GMGA 5HP1A 5IS2A 2DHSA 4IFVA 4ECRA 2IBKA 3P6YC 4N8OA 1UFWA 3B8HA 3VAKA 4MFBA 5LL6d 3JSRA 2HAIA 2YKAA 4K4TA 2UUBF 4FNHA 1VRTA 2FHMA 1WG5A 2KM8C 3R1LA 1C1CA 1N0UA 4KHPF 3IBWA 2HHVA 4ZVHA 4WTYA 4EGLA 2MPUA 2XNRA 5J2MB 1N36F 3BO3A 5LJ5Y 4DS4A 3RB6A 5DLFA 3LO3A 1QJHA 1DQ8A 4Q2LA 5J2NA 3SSRA 2IMWP 4RW6B 1FDDA 3ZZPA 3OLBA 3GIKA 3UR3C 4FF4A 3Q2TC 2MHEA 2AD9A 2CYYA 1VQSA 3PIPQ 3KHHA 4NLOA 4MK9A 4RX6A 3SV4A 4LVNP 1TV6B 2VG6B 4M95A 4IH6A 2Q3PA 5CYJA 2RU9A 2WSEC 4TQSA 2OPPB 3FQKA 1GH8A 1Y5NB 2VG7B 2VD3A 1KD1T 4C97A 3MMCB 2XS2A 2CQ3A 2JLEA 2KH9A 2N7YA 2DNHA 2ZVSA 3G71S 3MHYA 1G1XA 2PD1A 3I9ZA 5M2PA 1MROA 2YNFB 2MSSA 2OPRA 4Y2KA 4V19J 4CO1A 4E8UA 1JMTA 4Q0BA 4DQPA 1UWBA 1LW0B 1IKWB 5KT2A 2CPHA 1V6HA 3NP5A 4DWIA 4Q44A 2M4MA 4WXOA 4C8YA 4KT0C 4WE1B 2J7UA 4DPOA 4DFKA 1SUQA 3JTOA 3DDNA 5F9LA 3MXHP 4B9TA 1RTHB 2AX0A 3DOLB 2WBRA 2ZH2A 4OZ5A 2WB1D 3MM5B 2V4QA 1N32F 4QWEA 2HVIA 3FFIB 5D4LA 4RU9A 4XO0A 1SJ3P 1V3ZA 4G1PA 2ZD1B 3FSXA 3NNCA 1IQTA 4A48A 4J9QA 1FO1A 1HWUA 3K8WA 1Q4RA 5E3AA 2KZMA 2CRLA 1CEZA 3IWNC 1WF2A 3OR1A 2ASDA 4B9VA 2RSQA 3I6PA 4I0WA 5IT4A 1HWIA 5FDLA 1PGZA 1FD2A 2KKHA 6FD1A 2R8KA 1T03B 1HNIA 3S01A 5AE1A 1M0SA 1SV5B 4U67Q 2XGQA 3AA9A 3Q8SB 4CH0S 4IOBA 4ZPWR 2HNDA 3FMWA 4A8XA 4QIFA 2JX2A 1X4DA 4EYIB 5KT5A 4IH5A 4KB7A 4DG1B 1NKEA 4ELUA 3D1OA 2I8EA 2XI3A 2R7WA 2R7OA 2MQQA 1TL1A 1QAXA 1FK9B 2W8KA 3T3FA 1QSYA 2ZZMA 2P6TA 5J2QB 4ID5A 3G6YA 1Q79A 1S7HA 2B4PA 3I0SB 4QIEA 2N3OA 2MKIA 2MDAA 5F8HA 1OIAA 3SCLE 4JI2F 3IRXA 1HBUA 3BSNA 3QGIA 3QIPA 4LF6F 5KFXA 4CQ1A 2ZNZA 4N56A 4RBVA 2W9AA 3DRPB 3RAQA 4KC5A 2ILYA 3BREA 3VWSA 3GQCA 3R1HA 3CDBA 3O6QA 3GIJA 1WD6A 2HS0A 3ZZYA 3TOQA 5EDWA 5B0BA 5HROB 2E1CA 4OFZA 4EWTA 4P2SA 1YJUA 3UD3P 1UVMA 5B0FA 2DCLA 1ZM9A 3MM7A 2GX8A 1HNZF 3Q8QB 1NHUA 5KFLA 4GO5X 5BYRA 1BQNA 5KOWA 1J5OA 1Y7PA 1LXJA 5KFMA 1SXLA 3WZ0A 4CH1A 1YI2S 1FNMA 2DRAA 3O5TB 4YMEA 1C0TA 1LFWA 2YNHB 1S9FA 1VQLS 3MM9A 3SQGA 2LKZA 2JOQA 2MQLA 3Q24A 4ZP8A 1FEEA 4AUKA 1IBKF 3CTRA 5E3CA 2VB6A 3TAPA 1Q7LB 1TUVA 4ZA1A 4K4SA 4F4WA 2Y0SD 2M8HA 2NUHA 4JYAF 1U26A 1X4FA 2DNPA 2XG8A 4KV8B 5A6WA 1B7FA 2F9JA 3BF4A 3GV7B 2F8MA 1OSCA 4BDPA 4UY85 3HVAA 2CQ4A 2JL9A 2KTQA 3LP1A 1YRXA 5L8RC 1RKJA 1YRUA 4ILRA 1IN0A 1FNOA 1F0XA 3IR6B 2ZH4A 2JZ5A 4R8UB 2F8HA 1RT3B 2CVIA 1FKPB 4GKKF 1T05B 5DJBA 4CO4A 4HT7A 1BQMA 1J2VA 2FUG9 3GWCA 2JLFA 2HVZA 4DR4F 4EBCA 4DSLA 2XI2A 3V6DB 1X0FA 1NJWA 3HHNB 3MD3A 3U1LA 3E51A 3QYYA 1Q1KA 2RQKA 2PIIA 2Q43A 3A8EA 2DHAA 3BGUA 3S7RA 4Y28C 3DM2B 5CA5A 3IS9A 3QO9B 5FJ4A 4HEA9 5C25A 3MGJA 3MEDA 3BSOA 4IO1A 3I96A 4H4OA 2R7UA 3IXQA 3ITHA 1ZZNA 4I7FB 1HD1A 5J1EA 3L7OA 3VAJA 5LSOA 2X1AA 3N9UC 3CIZA 4PWUA 1CC7A 4H4MA 4OV1A 3HP6A 2EFGA 5KG7A 3G4SS 2WOMA 2ATLA 2RF2B 3FDSA 1PC5A 4YY3F 5GAHI 1S6PB 4NLVA 1M5HA 4RW8A 1H2UX 2IVMA 2FB0A 3DRSA 4TY9A 2NPIA 1VFJA 2YNGA 3GFXA 3M6VA 3CE8A 3KK2B 3K7RA 4ED5A 1YHQS 1S1VB 2X1BA 4R0EA 5D4NA 4YQWA 4ZLPA 3CD7A 2OIHA 3QJJA 1EETA 1R8BA 1JB0C 1RWUA 2GV1A 2KXFA 4AQYF 5MAOA 5IM0B 4ECTA 2HPUA 2LEPA 2FD2A 3M9OB 3KYLA 4LF8F 4B3OB 1DTQB 1FRHA 2EBEA 3C6TB 3DLEA 2ZHBA 2P5VA 1Y5IB 2NQPA 4XPCA 4LF9F 1APSA 3QJLA 4KO0B 1LWFA 4JV1A 4R5PA 1AROP 1QE1A 2UV8A 1U4BA 1RTJB 5T7LA 3IWLA 3OBIA 4B9SA 3KHLA 2D41A 2IRYA 2PA8D 1FRIA 1ULRA 3O44A 1Y00A 4KIAA 2R7XA 3H40A 4DUZF 2JRSA 1IKXA 3CUNA 4Z2XA 2RUGA 4DR2F 2NLWA 2CQ2A 3J7ZT 2AJFE 2DGWA 4HL9A 5EWGA 4KKOB 2GA7A 4B9NA 3CC7S 1QLNA 2BACA 1VBXA 3G96A 5L1KA 5E3RA 1HW9A 2Q79A 1RA7A 4M8LA 4IG3B 1D9AA 3FNNA 3H5SA 1VK8A 3D0HE 2B4UA 1HNVB 1HQEB 2CIMA 3O3LA 2DR8A 2ZBCA 2BANB 4NA1A 5JVHQ 4DL2A 4PKDB 3TNVA 3R5BA 3OTOF 4Y2AA 2LA4A 4URQU 1NZAA 5B0DA 3TARA 4QIWD 5E5NA 1QAJA 4CI0B 4WKRA 1D3WA 4PG6A 4D3HA 4OX8A 2VPYB 2NZ4A 3KWMA 4F4XA 1F2GA 3CCLS 4ELVA 1WEYA 2IHR1 2IRXA 4A8OA 2BW2A 2V5HG 4O3NA 2IVYA 3CCZA 3W7BA 1XN9A 3DDKA 1UMJA 2L48A 2KO1A 3HI9A 2JSXA 4NCGB 2LEBA 5D3GB 3NCRA 2J9DE 3K5LA 4MIWA 1KQKA 2YWKA 1MU2A 2GMLA 1IBMF 2KM8B 5DS7A 1UETA 3PR4A 2ZNYA 4KFBB 3OL9A 2XC9A 4V19X 4J37A 4I2QB 3MUMP 1NKCA 4ED8A 4WKYA 1TK5A 3K5MA 5A0YB 5JVGQ 4LQ9A 4FXWA 2PI5A 2GMJA 2ZH7A 1CPZA 2YKMB 4QWAA 2WK4A 2R8GA 2E5LF 1HFEL 1DURA 1YQHA 5B0CA 4OL8A 2KHDA 2O3DA 1RQ0A 5KFWA 3DLLQ 4FBUA 2CJQA 4EO8A 3MWBA 3CCQS 4IQMA 4KAIA 5K14B 2M8DB 3H5XA 4UUXA 2HW3A 2DGUA 3PJWA 3TR5A 3G6XA 1TP7A 4P7VA 1N54B 4ED7A 1WF1A 5HMZA 3PRBA 1Q8BA 3C46A 2I2YA 4PCQA 3DC2A 2LCWA 3K59A 2XY7A 3TX8A 5E41A 4WU2A 2J6TA 2PI4A 3NL0A 1FJ7A 3OHBA 1P9QC 2BV3A 5GAGU 2DGSA 4BWJA 4URSA 5J2MA 3M2RB 2OLWA 1WHWA 2C3MA 3BM7A 4HDGA 3MAQA 3VQSA 3IFEA 1TKDA 1TL3B 2ZC4A 2D9OA 4WZQA 3VAHA 4RW6A 1BWEA 1TFYA 2F8EX 2XO7A 1D8ZA 3JSYA 2ZBIA 1TV6A 1VI7A 2VG6A 3DRXA 5BJRA 2XS7A 5KFUA 2D74B 2VC0A 3X1LB 1R0AB 1H38A 2DO4A 3C3LA 2OPPA 2ZKTA 5F3ZA 4QYRA 1VQ6S 2JFDA 2VG7A 1Q8IA 1VQ9S 3MMCA 3TQ1A 2RILA 4FF3A 3IN5A 3SDEB 3ISNC 1UEUA 3HHLC 2WBMA 4XDDA 4RNNA 2LDYA 2YY3A 2YNFA 3HKZD 5DM7Q 1LW0A 1IKWA 3PW5A 2E5HA 2AJQA 5G0RA 2RD5C 5KFPA 3M6UA 1OS5A 3CJ2A 2BOPA 2DGXA 4Q5VA 3DOMA 2GMHA 2BM1A 2BZ2A 3NCQA 3OQ2A 4WE1A 4WFNQ 4NWBA 4HH0A 1RTIB 5E0OA 4BC9A 3ISND 1R43A 3HHLD 3IO1A 1RTHA 2F9DA 1ZPWX 1X8DA 4LJMA 2I1RA 2LQ5A 3DOLA 4F26A 3CCES 2PDAA 4QPTA 3MM5A 4JI3F 2G13A 2LA6A 3FFIA 1UVKA 2NYIA 2ZD1A 5JJBA 2LYVA 1K0TA 2FLOA 1RISA 1T8EA 4DQIA 1X5SA 1Y9OA 1X4HA 1U09A 3ZFVA 2QSFA 5KFQA 1S1XB 3D0IE 2VC1A 2PGCA 1N6QB 4NLPA 3U1NA 3WDOA 3M8RA 4AL6A 3HVTB 3F73A 2M9KA 2EK6A 3A1YG 4HTIA 3FEZA 2AJ0A 2MY8A 1D0EA 2U1AA 3LP2B 2R8JA 3EZUA 5EWEA 2AQ4A 1ZM3A 4O0IA 1T03A 2DH8A 3CCUS 2RRNA 1HNWF 1SV5A 2BBEA 1G7CB 3M30B 4TY8B 1GXLA 1HR0F 4DV4F 4DG1A 4F2RA 3DRRB 2CG4A 2YKNB 5AXMA 3UW1A 3EXCX 3CDEA 3CJ4A 1FK9A 4NLDA 2K7KA 2O66A 4ITSA 5J2QA 2HNYB 3DCAA 2ZJPQ 3I0SA 3OSPA 1RYSA 5E2QA 2RDJA 1VQNS 1XR6A 2XGPA 4HYKA 1KLMB 3UPFA 2Z0GA 1RGVA 3DRPA 4EU0A 5LMUF 1X9SA 3AHPA 4KBIA 1FNXH 2GCFA 2SXLA 4FVMA 4FF2A 2P6SA 4DFPA 5HROA 2MB0B 2V94A 1H6KX 2UZAA 3I4HX 2DO0A 2EI5A 2YTCA 2XLJA 4KJIA 3J7A1 3QAEA 2LMIA 4MK8A 1LKZA 1P6TA 3CEDA 3ETOA 4AFFA 3E01B 3PNIA 3LUYA 3BN7A 2A18A 1R27B 2OPQB 2YNHA 4AL7A 2AGOA 1NK5A 3ENWA 3BO4A 3QMQA 2VBZA 1KQFB 1S1TB 1XMQF 2FJXA 1NJIT 4LSNB 1M90T 4MAKA 1VIOA 1X9WA 2PE8A 3OTDA 1NHVA 3IAM9 2ZDPA 2VQEF 3POTB 2MZSA 4DSJA 4R0JA 4KV8A 3LGNA 2YKOA 3DLKB 3KMSA 5HMYA 2N7CA 3M9NB 2J0XA 3M6WA 4OI1A 4I64A 1FTRA 5DQHA 1WHVA 5DDPC 3VF0B 3LP0B 4YR3A 3THTA 3OUYB 1BD6A 3DHWC 2LLZA 3TANA 1U45A 4BWMA 1LW2B 3OLAA 2XEXA 1ZM2A 2VFTA 2Q6BA 2ZC3A 3ENVA 1XEZA 3MAHA 4R8UA 4FXDA 1XERA 1Q81T 1RT3A 5JXSA 1FKPA 5DRKA 2QEXS 1T05A 2N82B 2MQMA 5KFKA 3NGKA 1JLFB 3OXGA 4HDHA 3V6DA 4NCAA 2FHJD 5KG2A 2AU0A 4ZS6A 2F3JA 1FCAA 3DM2A 1T95A 3WBZA 2PFFB 2FDNA 2CJ9A 3QO9A 1N5QA 1YJVA 1FTCA 3I87A 2M7SA 3H98A 2RNEA 1QUVA 2R2TA 3OVBA 3GV5B 2HHSA 5KG0A 3GB0A 4NZ6A 1JX4A 1ZOTA 2FC9A 4I7FA 4A8QA 2DNGA 4U7UK 4ETXA 4ZK7M 4NLGA 2EW9A 4X4SA 1U1PA 3MTKA 1RAJA 1VQOS 2J9DA 4X84A 2ZOMA 4NA3A 3D28A 5KFFA 1JXEA 3CD0A 2OD4A 4IOAQ 2DR5A 1TAQA 5LT5A 3CDUA 2RF2A 3CF5Q 1ZPVA 4A47A 1S6PA 3TA2A 1L3UA 1UAWA 4NPOA 3UD4P 3V81B 1I94F 3AJ1A 5LMNF 1KVJA 1BC6A 4PXBA 2OMLA 3HDSA 4OZLA 3KK3B 2QA2A 4DR6F 3KK2A 2LQJA 4OI0A 1S1VA 5AXNA 2HRUA 2N3LA 1WEXA 4P7TA 1TFWA 4AXJA 1IJEB 3K2YA 3S1TA 1KC8T 1XNQF 4TYBA 3CCRS 3CCWA 2QFJA 2EBGA 4KE5A 1Q78A 2UUAF 5IM0A 4QR1A 4B3OA 2ROGA 3N5FA 3NAIA 1DTQA 3C6TA 3EUNA 2GW8A 4RUHA 3MUVP 3M05A 1U1RA 1N4LA 3PY8A 3CCVS 4KO0A 5CZVA 1NK0A 4Z37A 4OI3A 5U47A 4DFJA 2NPFA 1RTJA 3PW7A 3BQ0A 1AXQA 2HFOA 4IYQA 4RWWA 1KN6A 1F60B 3BEGB 3NG8A 3NLCA 2QYCA 2CFXA 2FGOA 1HI8A 4NCBA 1JIHA 1OSDA 3JSMB 2KT5A 4RW4B 3CCSS 1VC0A 3FZ2A 2GJ2A 1VBYA 1L3TA 3C8YA 1Y3KA 1VQYA 3JSBA 4NMLA 1T02A 4PQUB 4KKOA 1YJWS 4LQ3A 2B7BB 4I6WA 4YDXA 2FVRA 2HGMA 3CWJA 1HYSB 2DH9A 3KG1A 2A1BA 1JK9B 1K1SA 1YVFA 5KFCA 3IR5B 4IG3A 1HMVB 4ZHRB 4C3KA 5L9NA 1HNVA 1HQEA 2FJVA 3OFEA 2BANA 3K8VA 4OI2A 2UP1A 1UJ4A 1S6OA 4XK8C 4DOZA 3HPOA 2B9WA 4JI1F 4N47A 2IA6A 3NWGA 4C8LA 4ECUA 4B08A 3ZZZA 4K4XA 1URNA 1M5VC 3H2UB 2CQHA 2C3OA 3UDCA 3CCJS 4NCGA 1U1MA 4Q45A 4O3PA 5SZTA 5D3GA 2MQOA 2WB4A 2V4RA 2XWYA 3Q8RB 3PXGa 5AE2A 4DSKA 4OLOA 3SCKE 2D3ZA 3KLVA 5THWA 5I3QA 3O2IA 5HL7Q 4ZVEA 1VK3A 3VALA 1S4FA 4YB7A 3E8OA 2YWHA 2RE1A 4DQSA 1NO8A 2RQ4A 2EFQA 4KFBA 3TVZA 2V9WA 2W9CB 4K4WA 4O3SA 3E2EA 3NGDA 5K8PA 4I2QA 4FN5A 3QAUA 3K0JA 4DV0F 1VQPS 3THVA 3I56S 1T7PA 5A0YA 4F4KA 4QYZJ 1SIWB 2OJ3A 2ZH5A 3IR7B 5G0RB 1Q16B 3PW0A 2YKMA 3OFHA 1NK6A 2Z4PA 1NB7A 2FY1A 2VOPA 1YBAA 2G9OA 4I56A 1B0VA 1DHMA 1IXKA 1FRMA 1TZ0A 2PMZD 5LSRA 1TL4A 1SQEA 3NS6A 2YNIB 5A6PA 3FVYA 1FKOB 2AV5A 3M9MB 3MECB 4WFAQ 2CZ4A 3FSIA 3HHLB 5F0WA 3SV3A 5K14A 1G2EA 1TKTB 4DSIA 3FSYA 1JLAB 2LQBA 3CDAA 5KFYA 5A8KB 2R8IA 1N56A 3BR9A 2KG0A 4DV6F 3VAGA 2FLPA 3B82A 1ZBTA 1MSWD 3QIDA 4NL5A