4ALPA

The lin28b cold shock domain in complex with hexauridine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
b'DPQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIN28 ISOFORM B
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Xenopus tropicalis
molecule tags Chaperone/rna
total genus 18
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4alpA00
1B8AA 1KC8C 1NTGA 2JA6H 4DV6Q 1GKHA 4X66Q 2N3SA 4KI0A 1WCMH 1OXVA 3HKZE 3S2DH 1X3GA 3PV0A 2OWOA 2Z6KA 1IBLQ 2R93H 4AYBE 3F2DA 1QZGA 3HOVG 4X64L 1VCIA 2KENA 3BJUA 3A5UA 1MIUA 2E2HH 1V1QA 1MKHA 2ZTCA 2BH8A 3PIOA 1U5KA 3SGIA 3HKSA 1VQCA 4IJHA 5C3EG 4LF7L 4DR3Q 3ULJA 1G6PA 2Q2TA 1TWCH 1HZ9A 3HFZB 4JI2Q 1K9MC 4DAMA 2KHJA 4B3SQ 3RLOA 1E1TA 1HNZL 4NXNQ 1N32L 4B3ML 2MNAA 4GKKL 3F2CA 1SE8A 2RF4A 2JK8A 5IT9c 2YU9H 4A3DG 2IY5B 1GD7A 1O7IA 1JT8A 1EIFA 1Z47A 4AQYQ 3TS0A 5HGQA 2NVQH 1VQFA 4HJAA 2N78A 1L0WA 3W1GA 2NN6I 1H95A 2R92H 4GN5A 2CWPA 4OX9L 1JE5A 5FJ8H 1IBMQ 4DV7L 3K80C 1FJGQ 4EX5A 2C35B 4IO9A 2JA8G 4BA2I 4LF5L 2RCNA 1YHAA 1NE3A 1YBYA 4PZ8A 2CWAA 1XMQL 3RZDH 1SR3A 5LMUL 3AYHB 3M4PA 3CMEA 1WI5A 1XPOA 4JI3Q 3JC66 2PQAA 2GN5A 4YCWA 3H0GG 1X9NA 4YWLA 2UUBL 4PZ7A 4TVAB 1FVIA 3WWVA 1XNQL 1IZ6A 4NXML 1VQEA 2WAQG 3ULLA 4A3JG 4DR4L 1VQAA 3UDXA 1Y1WH 4B3RL 1V43A 2F3IA 4JBJA 4JCVE 1L1OC 4DV1Q 4DV3Q 1PHJA 4L5RC 3HOUG 3NELA 4LFCL 4BA1I 4DR5Q 3I56A 4RG1A 4A3EG 1XPUA 4IFDI 2PQAB 5IP9G 4A3LH 3HOVH 4A76A 3GTMH 3W1BA 1GO3E 4YWMA 4A3KG 5DLQE 2ASBA 4OO1I 2R7FA 4JBKA 5GAHC 5C3EH 2HIXA 1QZHA 4R1JA 2VZAA 3H3VI 3RZOH 5C44H 4FDBA 5LMNW 2F4VL 3PO2H 1K3RA 3UDGA 3KF6A 1B70B 1QVFA 4YY3Q 3KF8B 3AQQA 2F52A 5GQOA 3T1YL 1L1OA 2Y0SG 4POGA 5JEAJ 1PH7A 1PH5A 1Q8KA 4IOAA 4DAYB 2MO1A 1VQ8A 2JEBI 2BA1A 1YJNA 4BY7H 5FLXc 1OXTA 4QL5A 3U58A 1AE3A 1RIPA 1PYBA 1QUQA 3KF6B 1TWAH 4DPGA 1AE2A 4UP8A 5GROA 3J81i 2ZM6L 3CF5A 4JOIC 1N36L 2HT1A 4GN4B 3AEVA 4YCUA 1L1OB 4LNQA 3TS2A 1KIXA 4GOPB 2K52A 1JMCA 2PI2E 2JA8H 3EBEA 3CCJA 4JV5Q 3S17H 4DR2Q 1Q7YC 3K7UC 1K0RA 4O0AA 1UEBA 1TWHH 1UE7A 5BR8L 3KJPA 2VQFQ 4A3FG 4A3MH 4JI8Q 1Q81C 4B3TL 4GKJL 4X62Q 1BBWA 1CKNB 3OTOQ 3RN5A 4YWKA 1N8RC 1W3SA 2AKWB 1CUKA 3GD7A 4X65Q 2ZJQA 4YHHQ 3T1HQ 1X56A 3KJOA 3RN2A 1KL9A 4X6AH 3NEMA 4JOIA 1J5EL 1BKBA 4KHPQ 2WB1G 1N33L 4A93H 3F8TA 2BH2A 4QGUA 1E3PA 2K5VA 2UUCQ 4BY1G 4YCVA 2JA9A 2NZOA 2UU9Q 4DV5L 1L2FA 3GTJH 2JEAI 3W5OA 3S2HH 4BBRH 4A3IH 3GTKH 2UXCL 1YEZA 2OQ0A 1NMFA 1VQNA 2HIVA 2E5LL 1HJPA 4J15A 3U4ZA 1VQ6A 2K5HA 4LF6Q 1PH8A 2EIFA 1VQKA 4LF4L 4LF9Q 2I0QA 3U4VA 2R7ZH 1N34L 3PF4A 3DLLA 4DUYL 2ES2A 5C4XH 4OONA 2JQOA 2K14A 4LWCA 5AJ3L 2K5NA 4H02A 1SN8A 4DV6L 4K0KL 1FGUA 4X66L 3HKZG 5HY6A 2JJQA 5JEAG 5IYBG 4BXXG 2VY3A 1S72A 1YJWA 3VDYA 1X3FA 3J80i 4AH6A 4GNXB 1EQQA 4AYBG 4JI1Q 2UUAQ 3I4NG 1IBLL 4JI0Q 3H3VH 3G4SA 4PMWA 2YTYA 4TQUS 1VQ4A 3J7ZC 3RNUA 1VQ5A 5IP7G 5GAEC 3OW2A 2IX0A 2LSSA 4JYAQ 1C7YA 4LF8Q 5M3MH 3PO3H 3PUVA 2DUDA 5IWAQ 4LFBL 5IYCH 1WYDA 4JI2L 1NY4A 4B3SL 4NXNL 1VS0A 1D8LA 5M3FH 3HOWG 4A3BH 1RL2A 1VQOA 4A3CG 1KXLA 1CSQA 2A8VA 2IHFA 3DM3A 2I5MX 4NB3A 5FLMH 1P8LA 2JA5G 3K81C 1I50H 2L15A 2Z0SA 4GS3A 4JI4Q 4ALPA 1VQMA 3K8AA 3KFUA 1HNXQ 2PI2A 4AQYL 1PH6A 3AFPA 1VQ7A 3A5ZB 3ZJYC 3PSIA 1YNXA 3S1MH 3S15H 1C0AA 3Q8DA 4DKAC 2VUMG 4PG3A 1XNRL 1C9OA 1T9HA 3RLFA 2XTIA 4QY7A 2ALYB 3HOXG 2VS1A 1IBML 2JE6I 1FJGL 3I4MG 1G51A 3G48A 2N8NA 2YTVA 1N32Q 1HNZQ 5LMNQ 1X6OA 5H1SE 3I4OA 3PUZA 4B3MQ 3M7NA 4GKKQ 3J7A5 4JI3L 1YZ6A 1PVOA 2NZHA 1Q46A 4IJLA 4R4QA 3FP9A 1X55A 2QA4A 1HR0L 2HQLA 3CPWA 1EIYB 1FL0A 3D0FA 3G71A 4DV3L 5GADC 1CKMA 4KHZA 2VNUD 4LF6L 3CCMA 3GTGH 1SROA 2OTLA 4AIMA 4LUOA 3CCSA 4MZ9A 1N9WA 4XIGS 1JB7A 3PF5A 1VQDA 2E8GA 2YTXA 1IL2A 4DR7Q 1NMGA 1XMOQ 4DUZQ 3KDFA 3L7ZC 1XPRA 1TWFH 1I3QH 1QVCA 3F2BA 4DR1L 1K8AC 3I2ZA 4JBMA 4C3HH 1KAWA 3M3YH 3CQZH 1DGSA 4R4CA 5M5WH 1YJ9A 1PA6A 4LUZA 4JI5Q 3CXCA 1E1OA 1B7YB 2GVAA 2NN6G 2JA5H 4A3DH 4B3RQ 3CPFA 2K4KA 1CKOA 5M5XH 4LFCQ 3KDFB 2PNHA 2K50A 2ZJRA 4QJFA 1PFSA 3F1ZA 3AFQA 1S3OA 3TREA 3ULPA 1HZAA 5C4JH 2A1AA 4P71A 3IRBA 1GVPA 1KHIA 1LTLA 2H5XA 2B63G 3I4MH 2UXBQ 3RLNA 2F4VQ 2JA7G 1YITA 4IPDA 1SFOH 1PH3A 4JV5L 4A4IA 4LFAQ 2VQFL 2Q2UA 3TRZA 3T1YQ 4BBSG 1QUQB 1AH9A 3I55A 2EXDA 4JC0A 3S16H 1Y1VG 4P75A 3H0GH 4X62L 4DK6C 1EQRA 3OTOL 2KCMA 1HR0W 3BU2A 4X65L 3UDIA 3T1HL 4IFDG 1W2BA 1K83H 3E0EA 3PUXA 1HNWQ 3M85A 4A3JH 2ZM6Q 1N36Q 1WCMG 1M1KC 2ZTDA 1PH9A 4KHPL 4L5QA 5C0XJ 4R4TA 5ELOA 4IPHA 2YV5A 5M5YH 3HOUH 4A3EH 2UUCL 2UXDQ 5JJKA 4OWTB 2E2JH 3ERSX 5IP9H 4NPSA 4PZ6A 1IBKQ 1VQ9A 2UU9L 4JI6L 3GTOH 4DR6Q 1UE5A 1Q1EA 4A3KH 2HHHQ 4JI7L 2WP8J 4UP9A 2OTJA 4B3TQ 3A0JA 3NBHB 3B6YA 4UP7A 4GLXA 5ELNA 4DV4L 3GTLH 2NVXH 4GKJQ 1UE1A 4GOPC 3CCEA 3PCOB 2LXKA 1YVCA 1X65A 3H15A 2KBNA 4HIKA 3CAMA 1XJVA 4LF9L 1XTDA 3G6EA 1PH2A 1J5EQ 3L2PA 3TEHB 4DV0Q 1Y14B 1I6HH 4HJ5A 4GLVB 3CC2A 1JJCB 1OXUA 1VQGA 1UWVA 2R92G 1YHBA 4ME3A 3D31A 4DV2Q 1WFQA 3S24A 2VQEQ 3HOYG 3BZCA 5FJ8G 1G291 4QIWE 1MJEA 4LW1A 2B63H 2CFMA 4JI1L 5IYDG 2BA0A 4GOPA 4JI0L 2UXCQ 2E5LQ 3CCUA 1VQIA 1I94Q 3CCRA 1HZBA 4A3BG 4LF4Q 2VW9A 1Q1BA 3FKIG 4A3FH 4DR3L 4JYAL 3CP0A 3OYYA 1MJCA 4HIMA 1N34Q 3E9IA 4R4IA 4POFA 1A8VA 2AWNA 1VQHA 4DUYQ 1SLJA 1VQLA 3MEFA 4WJ3M 4OXPA 4KLKA 1EYGA 5AJ3Q 3CD6A 2V1CC 1TXYA 1S40A 3E9HA 1TWGH 2CQOA 4K0KQ 1KRTA 1ASZA 3RR5A 1HNWL 1Y1WG 1BBUA 1QVGA 2CCZA 3J81j 4JI4L 2K75A 1D7QA 5EAYA 1HNXL 2R7DA 4HJ8A 1Z9FA 1GM5A 4BY1H 4GLAC 4A3LG 4X64Q 1SMXA 2RHSB 4L5SA 1WOCA 2FXQA 4QQBX 5GAGC 4C3JH 2A19A 4DK3C 5JJLA 4LF7Q 1LM0A 3CCLA 5C0XG 1P16A 1E22A 1A0IA 4HIOA 2IHEA 5C44G 4LFBQ 3PUYA 3KLWA 3PO2G 2NVYH 3CW2C 3GDEA 3M9BA 5IY0A 3NENA 3KOJA 4P73A 5LMNL 4HIDA 2EQSA 2ATWA 4P72A 3M4QA 4IFDJ 1PH4A 2MFIA 4JG2A 1NBWA 4HJ9A 1OTCA 2D62A 1YHQA 4Y7NH 2Q2IA 4UY8C 3S1RH 4BY7G 4BXXH 5IYBH 2B3GA 4OX9Q 1XNRQ 4IPGA 3PGZA 3GTPH 4DV1L 2CKZB 4HJ7A 3HOYH 3UE0A 2KHIA 4GN3B 3K7AH 4XTCS 4DV7Q 4DR5L 3I4NH 5IYDH 2B29A 1J6QA 2ID0A 4LF5Q 2AWOA 5IE8A 5IP7H 1JJ2A 4Y52H 1UE6A 4LUVA 5LMUQ 1XMQQ 4A3MG 1XMOL 4DR7L 2RHQB 3JAMc 4DUZL 5JJIA 3FKIH 4UPAA 1JJGA 4APVA 2OQKA 2UUBQ 1KD1C 1EUJA 3FHWA 1KRSA 3GTQH 1XNQQ 3HOWH 3S1QH 4NXMQ 4A3GG 3U50C 4A3CH 4YY3L 1HR0Q 3KYHC 1CSPA 4DNIA 3STBC 3UE1A 2KCTA 4JI5L 3EIVA 2WAQE 4DR4Q 1KQSA 1E24A 4A93G 3ER0A 5J3BA 4MNOA 1OXSC 3HOZG 2Q2HA 3I7FA 2ZTEA 1I5FA 2XGTA 2R6GA 1HZCA 1LUZA 2YYZA 4OWWB 4BBRG 3JAMi 4A3IG 2VUMH 2ZJPA 1EOVA 3J81c 1U0LA 1E7ZA 3HOXH 1SRUA 2OCEA 4IPCA 2QEXA 4DR1Q 2UXBL 3A74A 3K0XA 2D0PA 4DR2L 2N49A 1EWIA 1K8GA 4LFAL 2R7ZG 2VL6A 4JI8L 3PIPA 1VQJA 1NJIC 2Y0SE 1LYLA 3BZKA 1EFWA 2AHOB 4RMFA 5C4XG 4YHHL 2QGQA 2JA6G 3L0OA 1OXXK 3TQYA 1WJJA 1CKNA 4OO1G 2MQHA 1ASYA 1V9PA 2UXDL 1X3EA 1Q86C 3S1NH 2R93G 2I5HA 3GO5A 2D0OA 4WJ4A 3EN2A 3CC7A 1IBKL 5K36G 4DR6L 1A63A 3PUWA 2HHHL 1VQBA 2WFWA 4R4OA 5E7NA 5BR8Q 4OWXB 1K73C 4A75A 5M3MG 3PO3G 1HH2P 3LGJA 3S14H 1M90C 3MXNB 5IYCG 1VQPA 1YI2A 3ICEA 5M3FG 3CC4A 1Q82C 3CCVA 4A3GH 3M4OH 2DGYA 1X54A 5FLMG 4L5TA 1BVSA 4EQ5A 4DV0L 4GNXC 2GVBA 1N33Q 2WB1E 2IT1A 1IYJB 4DV5Q 4O2DA 3HOZH 4JI6Q 3UDFA 4DV2L 4JI7Q 2VQEL 1PV4A 2IX1A 4C2MH 2UUAL 3CCQA 4DV4Q 3J80c 2PMZE 4P74A 2Z6KC 3CMAA 1I94L 2JA7H 4C3IH 1A62A 2LXJA 2I5LX 3STBD 5C0XI 4JBWA 4GNXA 2AMCB 2E2IH 1R9TH 4IOCA 4LF8L 4BBSH 5IWAL 1PH1A 1IXRA 1Y1VH 4MTNA 1Q12A 2NVTH 2MO0A 1PYSB 1YIJA
chains in the Genus database with same CATH superfamily
2H4OA 1F9RA 3OWEB 4RCOA 1A15A 1B50A 4AYBE 2KENA 1MIUA 4H7BA 2ZTCA 2F0QA 1KNAA 3VR3A 4BBRB 4A3IB 3SHLA 2Q2TA 3RLOA 1MHWC 4X3KA 2G9DA 2Z4IA 2MNAA 2EZVA 1U9RA 5IT9c 4A3DG 2R7ZB 1EIFA 5HGQA 2M00A 4HJAA 3W1GA 1BXTA 1A2UA 4HN7A 3K80C 2R93B 2K28A 4IALA 2RCNA 1YHAA 4IN3A 4PZ8A 4CDEC 1AZQA 4ME5A 4DAPA 2MGSA 3AYHB 3M4PA 4EQPA 1RJTA 3JC66 2J0TD 3H0GG 1X9NA 4PNYA 4PZ7A 2HCIA 2EJGC 4NXML 1VQEA 1RF2D 4N8FA 2ZXRA 5HURA 4DR4L 3UDXA 5CYUA 4B3RL 4L5RC 4DV1Q 1I50B 1S5CD 3HOUG 1XPUA 4BA1I 4A3EG 4RG1A 3AB9A 5IP9G 3HOVH 1D1IA 2SNSA 1BO0A 3ZYYX 4CKEA 4A3KG 5DLQE 1JC7A 1S5ED 2R7FA 3A54A 4XT1B 2BDOA 4JBKA 1SE3A 2OT2A 1Z6HA 5ELCA 3HGBA 4KY7A 4YY3Q 2F52A 3T1YL 4UAIA 4CDFC 1SMYC 2CVRA 1GUOA 1Q8KA 2TSSA 4DAYB 1I4HA 1JWMD 2A6HD 2MO1A 4QL5A 1VF5C 1AE3A 3KF6B 5FO8B 3U58A 1TWAH 1D6EC 3IFTA 4EQOA 3CF5A 2K7VA 3D6WA 4H13C 2HT1A 5ELBA 3GTGB 3CCJA 4JV5Q 3S17H 3T16A 3NBIA 4H44C 4ZUJA 3A8JE 3GTMB 4A3MH 1UE7A 5G3LD 1ET9A 3KJPA 4JI8Q 2X69A 3RN5A 1CKNB 1N8RC 3JAME 3GD7A 2ZJQA 4YHHQ 3KJOA 5CV8A 2CW0D 4OHJA 4IUVA 2UUCQ 2JA9A 5D65A 4C3JG 4DF7A 1L2FA 3SK6A 2RSNA 3S2HH 4BBRH 4A3IH 5FKAC 1EOTA 3BYTB 5C4JB 1F2MA 2KUMA 2E5LL 4FP5D 1VQ6A 1I4RA 4LF6Q 3K5LA 4LF9Q 1SFOB 2IL8A 2R7ZH 1N34L 2WKDA 4DUYL 4IQZA 4KN7C 1XX8A 5IYBG 2VY3A 2WAQB 4A3JB 3PMFA 4GNXB 4XQQA 1SNDA 4JI0Q 2BOSA 4IUNA 5K36H 4PMWA 3T53B 2PW5A 2YTYA 1BF4A 3TP6A 3J7ZC 1VQ5A 4JYAQ 3GV3A 4F88A 1C7YA 4LFBL 2DUDA 2QILA 1WYDA 3GTLB 1VS0A 1RODA 1TY0A 1RL2A 1VQOA 1WTPA 1CSQA 4NB3A 5FLMH 1I50H 2L15A 1BCPD 1VQMA 3K8AA 2PI2A 4QF4A 3AFPA 1CHQD 1VQ7A 1NSNS 3I90A 3A56A 1CZWA 1XNRL 5E3FA 1B4OA 2OEOA 2ALYB 1HFNA 5EBDA 1WTHA 2YTVA 1N32Q 2LKVA 3I4OA 3PUZA 4B3MQ 4GKKQ 4K5WA 3H6MA 1K8MA 4K6DA 1EQVA 3C3LA 1Q46A 3SK4A 5BN5A 1Q90A 2Z4HA 2EDGA 3TBIB 4WJWA 4J6HA 3CCMA 3GTGH 4LK1C 1E2VA 3FMCA 4MZ9A 2X6GA 4BY1B 3FDTA 1MGSA 3L7ZC 1QVCA 3BVZA 5DAUA 4JBMA 1S5BD 3IFDA 1LTAD 4R4CA 1HRJA 1GUNA 1PA6A 3OIPA 4LUZA 1ICWA 1B7YB 1SYDA 1AFPA 2Q8TA 3CPFA 2ZJRA 2K50A 2KECA 2Q8RE 3K5NA 4X3TA 5C4JH 2A1AA 3QIAA 1RTOA 2UXBQ 2F4VQ 4AYBB 2J4XA 3K7AB 3I4NB 4R9WA 2JA7G 4IPDA 1SFOH 5D14A 1PH3A 4JV5L 2EE1A 1AH9A 2EXDA 4JC0A 1EY9A 1EQRA 1TWFB 3R8BA 3BU2A 1WTXA 3GTQB 3UDIA 2DJFC 1HNWQ 4A3JH 1N36Q 3URYA 4QUCA 4L5QA 4RH6A 4QB4A 4R4TA 5C0XJ 4IPHA 2UUCL 1G6ZA 3ERSX 2HHHQ 4UP9A 4DV4L 1QILA 3GTLH 4FXGC 1K0SA 1UE1A 3J81E 1VMPA 5I2XA 4QUFA 3KLRA 3CCEA 1EQQA 4LF6L 1X65A 4HIKA 4C1NI 3CAMA 4LF9L 5EQ0A 1XTDA 2O4XA 1PH2A 3L2PA 3S16B 4HJ5A 4GLVB 4RKLA 1YHBA 4DV2Q 2B8FA 3S24A 2VQEQ 2KCNA 1G291 4FYDA 1NNXA 1O80A 4QIWE 2UXCQ 5IYDG 1JOQA 2BA0A 2WKCA 4JI0L 4ZAIA 4G7HC 3CCRA 3CHBD 2AQ1B 2PYKA 3GTOB 1SYGA 2K33A 4BS9A 4JYAL 1QNKA 4QCLA 3MEFA 1STEA 4KLKA 5AJ3Q 3CD6A 4K0KQ 1KRTA 3RR5A 2L4NA 1VMCA 1GUTA 4RCNA 3I4LA 1D7QA 1Z9FA 4BY1H 4QQBX 2A19A 1LM0A 2RSOA 1EU4A 1PTOD 3PUYA 3A55A 4C2MB 1F2ZA 1KDBA 3KOJA 4KK7A 2L12A 5LL6X 5T1IA 1IW7C 1ENAA 2MFIA 4J8QA 4HSPA 1I6VC 1NBWA 4DN4M 4HJ9A 1Y1VB 2F0TA 4V190 2NVTB 1QB5D 3NQTA 1CQFA 3PGZA 1AW7A 4RGOS 4HJ7A 3NQIA 4GN3B 1BDOA 3K7AH 4L8JA 3I4NH 1A2TA 4WORA 3VYUA 2ID0A 2AWOA 5IE8A 5IGCA 5IP7H 2E2HB 4WFN3 4A3MG 5JJIA 2RHQB 3JAMc 2GA4B 2A6EC 3GTQH 3QO2A 4OIKA 1TQOA 2K1BA 4DNIA 4DNTB 3STBC 2CH4A 3UE1A 3W3AA 1B3QA 1KQSA 5J3BA 2NTTA 4MNOA 1TY2A 2BDNA 1ILPA 2NVQB 2ZTEA 3H09A 4OWWB 1LUZA 4BBRG 3JAMi 4A3IG 4DAYA 3HOYB 4IPCA 2RA4A 1AEXA 2UXBL 3IKJA 1Q3LA 2F0GA 2R7ZG 1FR3A 1PRTB 3KLSX 5J1ZA 4NW2A 3RMHA 3BG3A 5IGDA 1OXXK 3I8ZA 3R2IA 3D8GA 1CKNA 2MQHA 3BZDB 1X3EA 1PLFA 2R93G 3GO5A 1SNMA 3G7LA 5K36G 1SYFA 3CC7A 4RHRA 3AMUA 4C1NK 3V05A 3PUWA 2HHHL 1K73C 5C3EB 3LWEA 3MHBA 1YI2A 2CHBD 3CC4A 3KLSA 1X54A 5FLMG 3EQLC 5EGTA 1TU2B 2NZ1D 5JOBA 1IYJB 1DYQA 4O2DA 5IIFA 2CH4W 4JI6Q 3UDFA 2KJXA 4BY7B 4DV2L 2VQEL 1PV4A 4C2MH 3MVVA 3NXWA 2PQEA 3CCQA 1KLUD 4CJ1B 1ESFA 1A62A 2I5LX 5C0XI 3BVMA 4JBWA 4GNXA 1MBYA 4IOCA 4LF8L 2K5QA 5IWAL 1Y1VH 4MTNA 5E4XA 5EBCA 1E2WA 1Q12A 2NVTH 2EYFA 1EY8A 1KC8C 4KI0A 1OXVA 3HKZE 1D2BA 3NK9A 3PIP3 2E2HH 1HUMA 1V1QA 2R3ZA 4XDXA 3PIOA 1YNJC 4ZKCB 1U5KA 3EROA 1O7ZA 3DWAA 2DY7A 4DR3Q 3DHQA 4FF2A 1HZ9A 1LTRD 1BOSA 2KHJA 4NXNQ 1RHPA 2F0PA 1CK1A 3MC0B 2JK8A 5T1GA 1KTKA 1GD7A 1DD2A 5KIXA 2NVQH 1VQFA 1L0WA 2NN6I 2NWGA 5C4XB 1H95A 1JE5A 1EY6A 5FJ8H 1M4VA 1IBMQ 5CC4A 4DK1A 4EX5A 2JA8G 1T5XD 1EU3A 1HTPA 1NE3A 1YBYA 2HCCA 3TSSA 1SR3A 2PNRC 3CMEA 1WI5A 2JYOA 2PQAA 4YCWA 1ICFB 5M3MB 3S9WA 2HUGA 2PW7A 1FGBD 1MD2D 2WAQG 4A3JG 1VQAA 5IGEA 4JCVE 3NELA 4LFCL 5C5LA 4A3LH 2HDMA 5KRUA 4A76A 3T13A 2XRQD 4O42A 4YWMA 2ASBA 4ULLA 5EPLA 3C46A 2EOTA 5C3EH 2HIXA 1LT3D 3H3VI 1GHKA 4FDBA 4K6LA 4CJ2C 3UDGA 1A3VA 1DOLA 1B70B 4KKUA 5GQOA 5ELFA 1WD0A 4G7OC 4FXDA 1PH5A 2JEBI 2BA1A 4BY7H 1OXTA 1CZGA 4DPGA 1AE2A 3LNNA 3J81i 4JOIC 2F0JA 1L1OB 4LNQA 3TS2A 1JMCA 1LT5D 1ZXTA 3EBEA 3HOVB 4DR2Q 4O0AA 3EFXD 4GKJL 5L37A 3OTOQ 4JPBW 2AKWB 1CUKA 1K28A 4X65Q 1JWSD 2ZT9C 3M3YB 2XWJB 3NEMA 5DM73 4CKCA 3CQZB 1J5EL 1BKBA 1S5FD 3H94A 4ZLTF 4KHPQ 1ML0D 1G2TA 4BY1G 4YCVA 4K5VA 1Y8PB 5A2QL 1EWCA 1BCPB 3D4RA 1NMFA 1HFGA 1VQNA 3U9SA 4J15A 3U4ZA 4DFAA 3I4MB 2XRSD 2WINB 4KKTA 1VQKA 5I9PA 3NP8A 2I0QA 4LF4L 3TDQA 2BE5C 1JOKA 3DLLA 5C4XH 2JQOA 4KY6A 1IKLA 3HG9A 2JJQA 1IL8A 2K03A 3VDYA 3NPPA 4OO1H 2ZXPA 4AYBG 3I4NG 3VA5A 4TQUS 1VQ4A 5IP7G 5GAEC 2IX0A 3S2HB 5M3MH 2V4DA 3EJIA 1G2SA 1NY4A 5J39A 4NXNL 1D8LA 4CGYB 2IHFA 3FRPB 1IYUA 4K14A 2E75C 4B08A 2JA5G 2WACA 1B9MA 4GS3A 3KFUA 3Q6SA 1R4QB 3A5ZB 3PSIA 1C0AA 1R4PB 4PG3A 1C9OA 2KA7A 2XTIA 1RKNA 3P20A 2VS1A 3D4DA 1IBML 3G48A 3TP5A 2B63B 1YNNC 1HNZQ 3J80E 1X6OA 3CRKC 3J7A5 1EYAA 1TKWB 2WV6D 1YZ6A 4ILWA 2NZHA 2KCCA 1DM0B 1H9SB 4HMIA 4A3FB 5LL6S 3FP9A 1HR0L 3OPOA 1ET6A 2NTSA 2HDLA 3E3XA 3ND8A 3O13A 3G71A 4KHZA 1SYCA 3ONAB 4LUOA 2RBMA 2ZXOA 1IL2A 3I3CA 1NMGA 3KDFA 4Q0FA 1RCVD 4DR1L 4MHEA 3F2BA 1JB3A 2B2YC 3I2ZA 1KAWA 3M3YH 3EVQA 2L5TA 3CQZH 1DGSA 1YJ9A 3DEOA 4S3SA 2K4KA 5JVH3 4IUTA 4WRDA 4Y7NB 1T5EA 1BQQT 3S1RB 1S3OA 3HZXA 1HZAA 3IRBA 1GVPA 1MSHA 1KHIA 1LTLA 3HKZB 3QOLA 5CBAE 3GTPB 5FO7B 3I4MH 1PDQA 1WTOA 2G9HD 1H9JA 3I72A 1SBBB 2Q2UA 3TRZA 2A69C 1QUQB 1Y1VG 1PRTF 3OTOL 2E2DC 3T56B 4X65L 3MXPA 1SJHD 3E0EA 3PUXA 3M85A 2FJ2A 2DN8A 2ZM6Q 2ZTDA 1PH9A 4KHPL 5ISRA 1B2TA 5JJKA 2B2VC 4EGVA 4FXKC 1UE5A 2RVLA 4UDUC 2ICIA 2WP8J 4XYQA 4B3TQ 3A0JA 3NBHB 2VUMB 1HPCA 1A3TA 3HOXB 1CFMA 2EY5A 5FK9C 5K5PA 4RWSC 1F2LA 2LXKA 2VXWA 3P1HA 3H15A 1XJVA 3G6EA 1B44D 1F77A 4NP5A 1Y14B 3UI2A 4DU9A 4I7AA 1JJCB 1OXUA 1VQGA 1GXDC 3HOYG 2A73B 5FJ8G 1MJEA 1WTRA 2B63H 4PMBA 1ILQA 1HQRD 1ZYRC 1QWYA 4KY5A 2SDFA 3FEWX 1HA5A 5KEEA 1DXMA 3FKIG 4ZYSA 4A3FH 4HIMA 5CV9A 3S14B 1SLJA 3J7AF 4OXPA 4WJ3M 1TXYA 1ASZA 1E0BA 3M4OB 1BBUA 1QVGA 5J22A 2KOLA 1K8OA 2R7DA 4A3LG 4X64Q 2RHSB 4L5SA 1WOCA 5GAGC 4IUQA 3HOZB 3K0YA 5COYA 3NWSA 4LF7Q 1U4RA 1QE6A 1SEBD 1STGA 4HIOA 4BWGB 3K6OA 4HIDA 4L63B 2EQSA 3HS0C 3T4AC 4IFDJ 3L3OC 4Z9CB 1S4ZA 4BBSB 2D62A 4Y7NH 4K8JA 4UY8C 3S1RH 4BY7G 3FPPA 3R93A 4BXXH 2XIWA 5JEAH 4OX9Q 2G5DA 3GTPH 4DV1L 3UE0A 1LT4D 3D6CA 4IZ8A 4XTCS 4DV7Q 4P2CB 3S2DB 2B29A 1J6QA 3IL8A 4LF5Q 4Y52H 4LUVA 5LMUQ 1JJGA 1PRTC 4UPAA 2OQKA 1GHJA 1WD1A 2UUBQ 1KD1C 1EUJA 3T51B 3S1QH 1TWCB 4A3GG 3NE5B 3U50C 4YY3L 3KYHC 4E6IA 2LMCB 1EIGA 2MJ8A 5G3LF 4XYOA 1G91A 3H91A 1OXSC 2K01A 2Q2HA 3I7FA 1I5FA 5CV6A 2VUMH 2R6GA 2YYZA 3VR2A 5FLXL 1UUPA 2R92B 3HOXH 1E7ZA 1GUWA 3KBXA 1SRUA 2QDBA 3QG1A 2QEXA 2EVBA 3A74A 1AZPA 2LS01 1Y8OB 2N49A 2VL6A 4JI8L 3OWFA 1PTOH 1VQJA 2Y0SE 3DWPA 3NTIA 1NJIC 1ENCA 4HCEA 3BZKA 5C4XG 4YHHL 2DNEA 3L0OA 3TQYA 1WJJA 3MXNA 3QWNA 4OO1G 1ASYA 1Q86C 4K8IA 2D0OA 4WJ4A 3EN2A 4F87A 3CRLC 1TS3A 1A63A 1VQBA 5E7NA 5BR8Q 4OWXB 1SE2A 1UAPA 3N52A 5M3MG 3S14H 3LGJA 1VQPA 3RZOB 1H9MA 3J80L 3ICEA 3M4OH 1JE4A 1B3AA 1LTID 2NN6H 1BVSA 4EQ5A 2SNMA 1V1PA 2WB1E 2ICEC 2K04A 1WTQA 4DV5Q 3HOZH 4JI7Q 2IX1A 2AQ3B 1FNUA 3HP3A 3J80c 1STAA 1BCPF 2PMZE 5A35A 2Z6KC 1SXTA 1L0YB 1BUVT 2IX3A 2LXJA 5BN4A 1JR0D 1LABA 2AMCB 4N9TA 4BBSH 1IXRA 5AFWA 4MN3A 1KRSA 1PYSB 1B8AA 1AN8A 1EY7A 1ZEQX 1X3PA 2JA6H 1GKHA 1F9SA 2FINB 4X66Q 4X3SA 3S2DH 5C4ZA 2SOBA 3OOCA 1LTSD 3HOVG 2A6HC 1VCIA 4X64L 4TSSA 2F3WA 1PZKD 2RDHA 1BNZA 4RGTA 2VB3X 4LF7L 1VQCA 4IJHA 3GTJB 1XWEA 2FFKB 2IJ0A 1TWCH 1JQYD 3HFZB 3I91A 4JI2Q 4DAMA 1K9MC 4B3SQ 1N32L 1LV9A 1RDPD 4B3ML 4GKKL 3WOFA 3F2CA 1U4LA 2XNAC 4G7ZC 4KTAA 3P7JA 3A7AB 4AQYQ 1E2ZA 3OSOA 3TS0A 3BDCA 2N78A 4ZQ3A 1ONLA 2R92H 5KGUA 4GN5A 2CWPA 1GUSA 2F0NA 4OX9L 2K5WA 2CW0C 5A2QE 1H9SA 2J7ZA 2PZWA 4DV7L 2C35B 4IO9A 4BA2I 1EY5A 4LF5L 5CGKA 2CWAA 5LMUL 4JI3Q 1CT1D 2GN5A 2UUBL 4K2KA 1CQVA 1FVIA 4M1UB 3WWVA 1IZ6A 1K3BC 1KABA 3U9OA 2E74C 3ULLA 2B2TC 2F3IA 1L1OC 4DR5Q 4IFDI 2A68D 2F03A 1GO3E 3S1MB 3BDLA 4R1JA 3RZOH 1PZJD 2F4VL 1K3RA 5F2DA 3KF6A 4FVMA 3TN2A 3AQQA 4R8IA 4POGA 1PH7A 4IUUA 3MWYW 4IOAA 1IHZA 3M7GA 1VQ8A 2IWHA 1HNWL 1LTTD 3VR6A 1QUQA 1N36L 5GROA 4UP8A 4RGMA 1BCPC 4GN4B 2SEBD 1KIXA 2K52A 2F0VA 1BBXC 1UEAB 1L0XB 2ENBA 5BR8L 4A3FG 1Q81C 4RHSA 4ZCKA 5EKIA 4YWKA 1W3SA 2N88A 1I3QB 2F0FA 2LFNA 1EY0A 1X56A 4C3HB 1KL9A 4X6AH 3NBHA 4JOIA 1FD7D 5M5WB 4MIUA 3M4YA 3F8TA 1E3PA 2NZOA 5M5XB 4KJNA 4DV5L 1YNND 3GTJH 2JEAI 2Z6BA 1SNPA 2UXCL 2OQ0A 2MPMA 1HJPA 2F0EA 1KAAA 5EJWA 1SNQA 1PH8A 3BDOA 4RA8A 2F0DA 4CBVA 3U4VA 2EYMA 2ES2A 1PTOF 1DJRD 4OONA 5I2YA 5AJ3L 2K14A 1H9KA 3TP7A 3MTSA 1SN8A 4K0KL 4X66L 2F3VA 2B39A 3CKIB 3HKZG 5CMDA 5JEAG 4BXXG 1S72A 4ZUIA 3K5MA 1YJWA 2UUAQ 2NYZD 5ELDA 3G4SA 3I73A 3GV6A 3RNUA 4Q5VA 3OW2A 1I4GA 1SMYD 3PUVA 5I6WA 5IYCH 1PFBA 3E6ZX 4JI2L 4B3SL 2A74C 2M9VA 1QG7A 3NHHA 1FYCA 2I5MX 3HRZC 3K81C 2H1EA 2Z0SA 4JI4Q 2Y0SB 4ALPA 2K6AA 1HNXQ 4AQYL 1PH6A 1I6HB 3GQBA 1YNXA 3S1MH 4OEMB 2VUMG 1QJOA 3RLFA 4QY7A 1SYEA 4C56C 3HOXG 2A69D 2NUCA 2JP1A 2JE6I 5CR3A 1XYIA 1HCZA 2N8NA 4CKBA 1WVLA 2OXPA 3TZDA 3M7NA 4JI3L 2O5IC 3X3MA 2F0IA 5TSSA 1X55A 1DOMA 3MXUA 2QA4A 1PFMA 1NR4A 1FL0A 2K05A 5GADC 1H9RA 3DUZA 4OELB 2VNUD 2NB0A 3WOEA 2WB1B 1SROA 3GP7A 4AIMA 2OTLA 3OMGA 1N9WA 4XIGS 1C48A 5EKLA 4DK0A 4KV6A 1VQDA 3PF5A 2QEJC 4N9PA 4KN4C 4LJZC 3Q0AA 1HA6A 3VYRA 4QIWB 1I3QH 1K8AC 1FNWA 4C3HH 3F2UA 5M5WH 1TR5A 5JAVA 1LTGD 5D3DA 2F4IA 1HTLD 2JSOA 2GVAA 2NN6G 2RKSA 4B3RQ 2QKIC 5C6AA 4PV1C 1CKOA 5M5XH 4QJFA 1PFSA 1LTBD 3AFQA 2EJMA 3FVQA 3DXJC 5KYIA 2B2YA 2I07B 2L55A 3RLNA 4XQNA 4GZYC 1YITA 5FOBB 4A4IA 3T1YQ 4BBSG 2Z1CA 5FO9B 3I55A 1PTOC 2KCMA 2X6LA 1VDZA 2KEDA 4DXGA 2MUYA 1W2BA 3HOWB 1SNCA 5JJZA 2UXDQ 5IOCA 5ELOA 2YV5A 3SR1A 4OWTB 1B53A 4NPSA 4V0BA 2RCFA 4FF3A 4JI6L 4DR6Q 4F8MA 3MA2B 1EEFD 2OTJA 4UP7A 1KNEA 5ELNA 2NBFA 4QMGA 3Q24A 4GOPC 2A5HA 3WDNA 1YVCA 2KBNA 3R2TA 3P75A 3D4WA 3OW7A 2E76C 2B2VA 3TEHB 1I6HH 1ESRA 3CC2A 5EPKA 5IODA 1WTVA 3C1FA 4HEDA 5EPJA 1UWVA 2L1BA 2R92G 1BR9A 3N6RA 1WFQA 5FLXE 3BZCA 2E5LQ 2AUJD 3CCUA 3S1NB 2RQXA 1I94Q 2PZTA 1HZBA 4RKBA 3TMEA 2VW9A 1ENFA 4DR3L 3CP0A 1N34Q 3E9IA 4R4IA 4POFA 1A8VA 2AWNA 1VQHA 2EY2A 4DUYQ 1VQLA 2V1CC 4G57A 3K59A 4MTKA 1S40A 2CQOA 1KLGD 2FMMA 5E1FA 1SJED 2PZUA 3J81j 4JI4L 5IT9L 5EAYA 1HNXL 4GLAC 1NAPA 1SMXA 3H3VC 1JOOA 1EL0A 5JJLA 1EEID 5KNBA 1E22A 1A0IA 4LFBQ 4JK1C 3VR5A 3GDEA 3NENA 4P73A 1SDFA 2ATWA 3W2DA 3TP8A 1PH4A 4C3IB 2E2IB 1LO5D 2XVSA 1R9TB 1YHQA 3SXHA 2Q2IA 3MEHA 2EY6A 2B3GA 1XNRQ 4IPGA 1S5DD 2PO4A 1WCMB 5IYDH 5C3XA 1GOZA 1JJ2A 3SEBA 1XMQQ 3K58A 2Q8IB 3VR4A 3OMCA 3FHWA 1XNQQ 3HOWH 4A3CH 4K2LA 3SVMA 1JWUD 1HHVA 2KCTA 4EQNA 3E0JA 2YU9B 4DGZA 5M9OA 2XGTA 1XTCD 2ZJPA 1U0LA 2OCEA 1LLRD 1A6XA 1KDCA 3K0XA 4DR2L 1EWIA 3MFGA 3PIPA 4A3BB 3RZDB 3HEJA 2K5DA 2AHOB 4RMFA 4CDCC 2B2WC 2EYJA 1Q8IA 4O1NA 1XXGA 1SNOA 3S1QB 1X32A 1V9PA 2UXDL 1Y1WB 3S1NH 5KNDA 3LWUA 4DAVA 3OHXC 1M8AA 2B2UC 2RDFA 4DR6L 2M2LA 1IW7D 4R4OA 4K5XA 4A75A 4R8NA 1HH2P 4ABNA 3CU7A 1M90C 5IYCG 1Y8NB 5C44B 5IGGA 3PO2B 1Q82C 2EPBA 2DGYA 5DNFA 1TVXA 4HCSA 5EKKA 3SDZA 4L5TA 5DEHA 1U4MA 1N33Q 1PTOB 3SK5A 3K57A 4KJOA 1JCKB 3TZUA 4F7XA 3IAYA 4DV4Q 1B1ZA 2A6ED 1EZ6A 2WIIB 2F0KA 1I94L 3DWQA 4NDXA 4C3IH 2JA8B 3STBD 3SE0A 1Z7TA 2E2IH 1AP0A 1R9TH 1SYBA 1TWHB 1QNUA 1J8IA 3V96A 2MO0A 4GOPB 4IFDH 1NTGA 4DV6Q 2N3SA 2KEEA 1WCMH 3KK7A 5CV7A 2EYOA 1X3GA 3KBGA 3PV0A 4TKOB 2OWOA 2Z6KA 5D3IB 1IBLQ 2R93H 3F2DA 1QZGA 4JW0A 4A93B 1EFID 3BJUA 3A5UA 1MKHA 2BH8A 2L11A 3SGIA 3HKSA 4HAEA 5C3EG 4U68A 2XWBB 3OIQA 4M8AA 3ULJA 3DMUA 1FNVA 3C1EA 1G6PA 2XN9C 3GTKB 2RDGA 2EYHA 4C3HG 1E1TA 1HNZL 3RUZA 3ERQA 3C2PA 1SE8A 1TT2A 2RF4A 2YU9H 2IY5B 1O7IA 5CV5A 1JT8A 1Z47A 5IGBA 4U673 3PQIA 2JA6B 1EYDA 2MP1A 3QJYA 2PPBC 1FJGQ 5JVG3 1SAPA 1O7YA 4A3BH 1XMQL 3RZDH 1XPOA 1DONA 4YWLA 1EQTA 4NKLA 4TVAB 3PO3B 1XNQL 1PXUA 2F0WA 1IYVA 3BVGA 4CHTB 4HSVA 5M3FB 5E4WC 3A8KE 1DOKA 1Y1WH 2PCFB 1V43A 4JBJA 3A7LA 2C9OA 4DV3Q 1PHJA 3I56A 2PQAB 1MSGA 5HGTA 3GTMH 4H0LC 3W1BA 1D1KA 4OO1I 1II3A 2D5DA 3S15B 5GAHC 5C0XH 1W6KA 1QZHA 2VZAA 3R3OA 5C44H 5LMNW 1D5MC 3PO2H 3BYYB 2B2TA 4OIJA 1QVFA 3KF8B 1EWHA 1RTNA 3X3NA 1L1OA 2Y0SG 3NSWA 5JEAJ 3PIO3 3Q22A 1TS2A 3A8IE 1YJNA 1STNA 5FLXc 1RIPA 1PYBA 1YNJD 4I65A 2ZM6L 1CA5A 1D5ZC 3AEVA 4YCUA 2JXMB 1V8QA 2PI2E 2JA8H 4HR7B 1EZ8A 2EY1A 1Q7YC 3K7UC 1K0RA 2VQFQ 1UEBA 1TWHH 4ZK9B 4B3TL 4DNRB 4X62Q 1BBWA 2R61A 2DY8A 3T1HQ 1EIHA 2HQEA 3RN2A 3I70A 4UHVA 3V2TA 2WB1G 1N33L 4A93H 2BH2A 4QGUA 4A3DB 2JA5B 2K5VA 3VA7A 2F1MA 4RGNA 2UU9Q 1TS4A 3W5OA 4CDDC 2B8GA 3GTKH 4OL7A 1YEZA 4RFBA 2HIVA 4G4KA 1O78A 2K5HA 2QDLA 2EXZA 2EIFA 2FMCA 1IKMA 3PF4A 5CV4A 3H0GB 4LWCA 2K5NA 4H02A 1NCVA 4DV6L 1FGUA 5HY6A 2FHTA 1K83B 1X3FA 5C4HA 1C4QA 3J80i 4AH6A 4JI1Q 1NR2A 1IBLL 4PQXA 3H3VH 3HOUB 5M5YB 4A3EB 1NUCA 1TIID 5BN3A 2E2JB 4JVZA 1OO9B 1I4QA 2EJFC 2LSSA 3NTHA 4A3KB 4LF8Q 3VYSA 3PO3H 1HQMC 3DEPA 5IWAQ 5JPNC 1B9NA 2NVXB 5I9OA 3HOWG 5M3FH 1KXLA 2EYLA 1DCZA 4A3CG 2AQ2B 2A8VA 3DM3A 3NTKA 1P8LA 2Z8LA 4J1MA 1JICA 4YIJA 3ZJYC 3S15H 2I46A 3Q8DA 4DKAC 1MI2A 1T9HA 1G8ZD 3DM1A 5C5MA 1FJGL 3I4MG 1G51A 4L6TB 3J7AV 4FNFA 5LMNQ 2IW3A 5H1SE 4CJ0B 1PVOA 5DM63 3JAML 4IJLA 4R4QA 3ND9A 2HQLA 4N8X1 1F9PA 3CPWA 1EIYB 1QOHA 1TWGB 3D0FA 2KQ3A 3QOJA 3QR8A 1QCBD 4DV3L 1CKMA 1I4PA 4DXFA 3CCSA 4XXEA 2QW7A 1JB7A 3MAQA 2YTXA 2E8GA 4DR7Q 4C3JB 1XMOQ 1PMRA 4DA2A 4DUZQ 1CHPD 1XPRA 1TWFH 2BE5D 2LY7A 2NVYB 4JI5Q 3CXCA 1E1OA 2JA5H 4A3DH 3NWTA 4B9WA 5IT9E 4LFCQ 3KDFB 2PNHA 3F1ZA 3TREA 3ULPA 1EY4A 4P71A 1D5XC 2BCOA 2H5XA 2B63G 1STHA 2F0UA 1HUNA 4C3IG 2D2CC 4LFAQ 2VQFL 3S16H 4P75A 4X62L 3H0GH 4DK6C 3FKIB 4KD3A 2O2LD 1HR0W 2Z9HA 3T1HL 4IFDG 4XQJA 1K83H 3MFYA 1V1OA 1M1KC 1WCMG 3HOUH 5M5YH 4A3EH 2E2JH 1IBKQ 1STYA 5IP9H 4PZ6A 1VQ9A 2UU9L 3GTOH 3K5OA 1Q1EA 4A3KH 4JI7L 2JN4A 1I4XA 3KUPA 3B6YA 4GLXA 3MZ5A 1HXYD 2NVXH 4GKJQ 5NUCA 4LMQD 3PCOB 2OF1A 2EYPA 5CBEE 1J5EQ 4DV0Q 1CTMA 2AUKA 1SSOA 3RD4A 3Q23A 2DJGC 1WTWA 2L9HA 4ME3A 3D31A 4FO2A 4FF4A 1X3QA 3L9AX 4LW1A 2CFMA 4JI1L 1LACA 4GOPA 2D9UA 1W6JA 1VQIA 3LX0A 2DNCA 4KMUC 1JORA 4A3BG 4LF4Q 2F0MA 1Q1BA 3OYYA 1C8CA 1MJCA 3QB3A 1RD9D 1EYGA 3E9HA 1TWGH 4A3GB 5IGFA 1Y1WG 2CCZA 1CA6A 2K75A 4HJ8A 1GM5A 2FXQA 4C3JH 4DK3C 2HD3A 4B9XA 3SK8A 3CCLA 5C0XG 1P16A 2IHEA 5C44G 3KLWA 4PMCA 1Y69U 4LAAA 2NVYH 3CW2C 2XSCA 3M9BA 5IY0A 3PO2G 5LMNL 4P72A 3M4QA 2JA7B 1CM9A 1TS5A 3G6JB 4I7ZC 1OTCA 4ODGA 5IYBH 5I4DA 3HOYH 2CKZB 3BS1A 4HMJA 2KVMA 4KKSA 2KHIA 2L0CA 4IURA 4TRDA 4DR5L 1PZID 2N55A 2VB2X 1UE6A 4DR7L 1XMOL 2F0OA 3E5SA 4DUZL 3FKIH 1EYCA 3NUCA 4APVA 3J81L 1DZ1A 4EVOA 2PMZB 1ZKOA 5I6YA 2F0LA 1F9QA 4NXMQ 1HR0Q 1CSPA 1F2YA 1O7LA 4JI5L 3EIVA 2WAQE 4DR4Q 1E24A 4A93G 3ER0A 2MHVA 3EA6A 1ZYRD 3HOZG 3KF8A 2KHSA 4KHVA 1HZCA 1LT6D 1EOVA 3J81c 5CORA 3VYTA 4DR1Q 1U4PA 4OGQC 4ZKBB 5LHY1 2D0PA 1K8GA 4LFAL 5C3WA 1LYLA 1KDAA 1VF7A 1EFWA 1PFNA 4FF1A 5KYLA 2QGQA 2JA6G 4ID6A 4RAUC 4HTHA 1GJXA 4NMZA 3FPUB 2I5HA 3MXGA 1IBKL 2F0SA 5ELEA 2TMPA 2WFWA 1CI3M 3D3RA 3PO3G 3MXNB 2B2WA 4X3UA 2O5JC 2C5CA 5M3FG 3CCVA 4A3GH 2QCPX 2QF7A 4DV0L 1SE4A 4GNXC 2GVBA 3AU7A 1A3UA 2IT1A 2B2UA 2F0HA 1STBA 5JPMC 4ZRZA 1GUGA 1PRTD 1TWAB 2UUAL 1J9OA 1PYWD 2K32A 4KD4A 5KNCA 1V1PB 4P74A 3CMAA 2CQAA 2JA7H 2P5ZX 2A68C 3ITPA 4IUPA 1UNSA 4XT3B 3S17B 3J7YW 4A3MB 1PH1A 2IPKD 4JG2A 1YIJA
chains in the Genus database with same CATH topology
1B8AA 1KC8C 1NTGA 2JA6H 4DV6Q 1GKHA 4X66Q 2N3SA 4KI0A 1WCMH 1OXVA 3HKZE 3S2DH 1X3GA 3PV0A 2OWOA 2Z6KA 1IBLQ 2R93H 4AYBE 3F2DA 1QZGA 3HOVG 4X64L 1VCIA 2KENA 3BJUA 3A5UA 1MIUA 2E2HH 1V1QA 1MKHA 2ZTCA 2BH8A 3PIOA 1U5KA 3SGIA 3HKSA 1VQCA 4IJHA 5C3EG 4LF7L 4DR3Q 3ULJA 1G6PA 2Q2TA 1TWCH 1HZ9A 3HFZB 4JI2Q 1K9MC 4DAMA 2KHJA 4B3SQ 3RLOA 1E1TA 1HNZL 4NXNQ 1N32L 4B3ML 2MNAA 4GKKL 3F2CA 1SE8A 2RF4A 2JK8A 5IT9c 2YU9H 4A3DG 2IY5B 1GD7A 1O7IA 1JT8A 1EIFA 1Z47A 4AQYQ 3TS0A 5HGQA 2NVQH 1VQFA 4HJAA 2N78A 1L0WA 3W1GA 2NN6I 1H95A 2R92H 4GN5A 2CWPA 4OX9L 1JE5A 5FJ8H 1IBMQ 4DV7L 3K80C 1FJGQ 4EX5A 2C35B 4IO9A 2JA8G 4BA2I 4LF5L 2RCNA 1YHAA 1NE3A 1YBYA 4PZ8A 2CWAA 1XMQL 3RZDH 1SR3A 5LMUL 3AYHB 3M4PA 3CMEA 1WI5A 1XPOA 4JI3Q 3JC66 2PQAA 2GN5A 4YCWA 3H0GG 1X9NA 4YWLA 2UUBL 4PZ7A 4TVAB 1FVIA 3WWVA 1XNQL 1IZ6A 4NXML 1VQEA 2WAQG 3ULLA 4A3JG 4DR4L 1VQAA 3UDXA 1Y1WH 4B3RL 1V43A 2F3IA 4JBJA 4JCVE 1L1OC 4DV1Q 4DV3Q 1PHJA 4L5RC 3HOUG 3NELA 4LFCL 4BA1I 4DR5Q 3I56A 4RG1A 4A3EG 1XPUA 4IFDI 2PQAB 5IP9G 4A3LH 3HOVH 4A76A 3GTMH 3W1BA 1GO3E 4YWMA 4A3KG 5DLQE 2ASBA 4OO1I 2R7FA 4JBKA 5GAHC 5C3EH 2HIXA 1QZHA 4R1JA 2VZAA 3H3VI 3RZOH 5C44H 4FDBA 5LMNW 2F4VL 3PO2H 1K3RA 3UDGA 3KF6A 1B70B 1QVFA 4YY3Q 3KF8B 3AQQA 2F52A 5GQOA 3T1YL 1L1OA 2Y0SG 4POGA 5JEAJ 1PH7A 1PH5A 1Q8KA 4IOAA 4DAYB 2MO1A 1VQ8A 2JEBI 2BA1A 1YJNA 4BY7H 5FLXc 1OXTA 4QL5A 3U58A 1AE3A 1RIPA 1PYBA 1QUQA 3KF6B 1TWAH 4DPGA 1AE2A 4UP8A 5GROA 3J81i 2ZM6L 3CF5A 4JOIC 1N36L 2HT1A 4GN4B 3AEVA 4YCUA 1L1OB 4LNQA 3TS2A 1KIXA 4GOPB 2K52A 1JMCA 2PI2E 2JA8H 3EBEA 3CCJA 4JV5Q 3S17H 4DR2Q 1Q7YC 3K7UC 1K0RA 4O0AA 1UEBA 1TWHH 1UE7A 5BR8L 3KJPA 2VQFQ 4A3FG 4A3MH 4JI8Q 1Q81C 4B3TL 4GKJL 4X62Q 1BBWA 1CKNB 3OTOQ 3RN5A 4YWKA 1N8RC 1W3SA 2AKWB 1CUKA 3GD7A 4X65Q 2ZJQA 4YHHQ 3T1HQ 1X56A 3KJOA 3RN2A 1KL9A 4X6AH 3NEMA 4JOIA 1J5EL 1BKBA 4KHPQ 2WB1G 1N33L 4A93H 3F8TA 2BH2A 4QGUA 1E3PA 2K5VA 2UUCQ 4BY1G 4YCVA 2JA9A 2NZOA 2UU9Q 4DV5L 1L2FA 3GTJH 2JEAI 3W5OA 3S2HH 4BBRH 4A3IH 3GTKH 2UXCL 1YEZA 2OQ0A 1NMFA 1VQNA 2HIVA 2E5LL 1HJPA 4J15A 3U4ZA 1VQ6A 2K5HA 4LF6Q 1PH8A 2EIFA 1VQKA 4LF4L 4LF9Q 2I0QA 3U4VA 2R7ZH 1N34L 3PF4A 3DLLA 4DUYL 2ES2A 5C4XH 4OONA 2JQOA 2K14A 4LWCA 5AJ3L 2K5NA 4H02A 1SN8A 4DV6L 4K0KL 1FGUA 4X66L 3HKZG 5HY6A 2JJQA 5JEAG 5IYBG 4BXXG 2VY3A 1S72A 1YJWA 3VDYA 1X3FA 3J80i 4AH6A 4GNXB 1EQQA 4AYBG 4JI1Q 2UUAQ 3I4NG 1IBLL 4JI0Q 3H3VH 3G4SA 4PMWA 2YTYA 4TQUS 1VQ4A 3J7ZC 3RNUA 1VQ5A 5IP7G 5GAEC 3OW2A 2IX0A 2LSSA 4JYAQ 1C7YA 4LF8Q 5M3MH 3PO3H 3PUVA 2DUDA 5IWAQ 4LFBL 5IYCH 1WYDA 4JI2L 1NY4A 4B3SL 4NXNL 1VS0A 1D8LA 5M3FH 3HOWG 4A3BH 1RL2A 1VQOA 4A3CG 1KXLA 1CSQA 2A8VA 2IHFA 3DM3A 2I5MX 4NB3A 5FLMH 1P8LA 2JA5G 3K81C 1I50H 2L15A 2Z0SA 4GS3A 4JI4Q 4ALPA 1VQMA 3K8AA 3KFUA 1HNXQ 2PI2A 4AQYL 1PH6A 3AFPA 1VQ7A 3A5ZB 3ZJYC 3PSIA 1YNXA 3S1MH 3S15H 1C0AA 3Q8DA 4DKAC 2VUMG 4PG3A 1XNRL 1C9OA 1T9HA 3RLFA 2XTIA 4QY7A 2ALYB 3HOXG 2VS1A 1IBML 2JE6I 1FJGL 3I4MG 1G51A 3G48A 2N8NA 2YTVA 1N32Q 1HNZQ 5LMNQ 1X6OA 5H1SE 3I4OA 3PUZA 4B3MQ 3M7NA 4GKKQ 3J7A5 4JI3L 1YZ6A 1PVOA 2NZHA 1Q46A 4IJLA 4R4QA 3FP9A 1X55A 2QA4A 1HR0L 2HQLA 3CPWA 1EIYB 1FL0A 3D0FA 3G71A 4DV3L 5GADC 1CKMA 4KHZA 2VNUD 4LF6L 3CCMA 3GTGH 1SROA 2OTLA 4AIMA 4LUOA 3CCSA 4MZ9A 1N9WA 4XIGS 1JB7A 3PF5A 1VQDA 2E8GA 2YTXA 1IL2A 4DR7Q 1NMGA 1XMOQ 4DUZQ 3KDFA 3L7ZC 1XPRA 1TWFH 1I3QH 1QVCA 3F2BA 4DR1L 1K8AC 3I2ZA 4JBMA 4C3HH 1KAWA 3M3YH 3CQZH 1DGSA 4R4CA 5M5WH 1YJ9A 1PA6A 4LUZA 4JI5Q 3CXCA 1E1OA 1B7YB 2GVAA 2NN6G 2JA5H 4A3DH 4B3RQ 3CPFA 2K4KA 1CKOA 5M5XH 4LFCQ 3KDFB 2PNHA 2K50A 2ZJRA 4QJFA 1PFSA 3F1ZA 3AFQA 1S3OA 3TREA 3ULPA 1HZAA 5C4JH 2A1AA 4P71A 3IRBA 1GVPA 1KHIA 1LTLA 2H5XA 2B63G 3I4MH 2UXBQ 3RLNA 2F4VQ 2JA7G 1YITA 4IPDA 1SFOH 1PH3A 4JV5L 4A4IA 4LFAQ 2VQFL 2Q2UA 3TRZA 3T1YQ 4BBSG 1QUQB 1AH9A 3I55A 2EXDA 4JC0A 3S16H 1Y1VG 4P75A 3H0GH 4X62L 4DK6C 1EQRA 3OTOL 2KCMA 1HR0W 3BU2A 4X65L 3UDIA 3T1HL 4IFDG 1W2BA 1K83H 3E0EA 3PUXA 1HNWQ 3M85A 4A3JH 2ZM6Q 1N36Q 1WCMG 1M1KC 2ZTDA 1PH9A 4KHPL 4L5QA 5C0XJ 4R4TA 5ELOA 4IPHA 2YV5A 5M5YH 3HOUH 4A3EH 2UUCL 2UXDQ 5JJKA 4OWTB 2E2JH 3ERSX 5IP9H 4NPSA 4PZ6A 1IBKQ 1VQ9A 2UU9L 4JI6L 3GTOH 4DR6Q 1UE5A 1Q1EA 4A3KH 2HHHQ 4JI7L 2WP8J 4UP9A 2OTJA 4B3TQ 3A0JA 3NBHB 3B6YA 4UP7A 4GLXA 5ELNA 4DV4L 3GTLH 2NVXH 4GKJQ 1UE1A 4GOPC 3CCEA 3PCOB 2LXKA 1YVCA 1X65A 3H15A 2KBNA 4HIKA 3CAMA 1XJVA 4LF9L 1XTDA 3G6EA 1PH2A 1J5EQ 3L2PA 3TEHB 4DV0Q 1Y14B 1I6HH 4HJ5A 4GLVB 3CC2A 1JJCB 1OXUA 1VQGA 1UWVA 2R92G 1YHBA 4ME3A 3D31A 4DV2Q 1WFQA 3S24A 2VQEQ 3HOYG 3BZCA 5FJ8G 1G291 4QIWE 1MJEA 4LW1A 2B63H 2CFMA 4JI1L 5IYDG 2BA0A 4GOPA 4JI0L 2UXCQ 2E5LQ 3CCUA 1VQIA 1I94Q 3CCRA 1HZBA 4A3BG 4LF4Q 2VW9A 1Q1BA 3FKIG 4A3FH 4DR3L 4JYAL 3CP0A 3OYYA 1MJCA 4HIMA 1N34Q 3E9IA 4R4IA 4POFA 1A8VA 2AWNA 1VQHA 4DUYQ 1SLJA 1VQLA 3MEFA 4WJ3M 4OXPA 4KLKA 1EYGA 5AJ3Q 3CD6A 2V1CC 1TXYA 1S40A 3E9HA 1TWGH 2CQOA 4K0KQ 1KRTA 1ASZA 3RR5A 1HNWL 1Y1WG 1BBUA 1QVGA 2CCZA 3J81j 4JI4L 2K75A 1D7QA 5EAYA 1HNXL 2R7DA 4HJ8A 1Z9FA 1GM5A 4BY1H 4GLAC 4A3LG 4X64Q 1SMXA 2RHSB 4L5SA 1WOCA 2FXQA 4QQBX 5GAGC 4C3JH 2A19A 4DK3C 5JJLA 4LF7Q 1LM0A 3CCLA 5C0XG 1P16A 1E22A 1A0IA 4HIOA 2IHEA 5C44G 4LFBQ 3PUYA 3KLWA 3PO2G 2NVYH 3CW2C 3GDEA 3M9BA 5IY0A 3NENA 3KOJA 4P73A 5LMNL 4HIDA 2EQSA 2ATWA 4P72A 3M4QA 4IFDJ 1PH4A 2MFIA 4JG2A 1NBWA 4HJ9A 1OTCA 2D62A 1YHQA 4Y7NH 2Q2IA 4UY8C 3S1RH 4BY7G 4BXXH 5IYBH 2B3GA 4OX9Q 1XNRQ 4IPGA 3PGZA 3GTPH 4DV1L 2CKZB 4HJ7A 3HOYH 3UE0A 2KHIA 4GN3B 3K7AH 4XTCS 4DV7Q 4DR5L 3I4NH 5IYDH 2B29A 1J6QA 2ID0A 4LF5Q 2AWOA 5IE8A 5IP7H 1JJ2A 4Y52H 1UE6A 4LUVA 5LMUQ 1XMQQ 4A3MG 1XMOL 4DR7L 2RHQB 3JAMc 4DUZL 5JJIA 3FKIH 4UPAA 1JJGA 4APVA 2OQKA 2UUBQ 1KD1C 1EUJA 3FHWA 1KRSA 3GTQH 1XNQQ 3HOWH 3S1QH 4NXMQ 4A3GG 3U50C 4A3CH 4YY3L 1HR0Q 3KYHC 1CSPA 4DNIA 3STBC 3UE1A 2KCTA 4JI5L 3EIVA 2WAQE 4DR4Q 1KQSA 1E24A 4A93G 3ER0A 5J3BA 4MNOA 1OXSC 3HOZG 2Q2HA 3I7FA 2ZTEA 1I5FA 2XGTA 2R6GA 1HZCA 1LUZA 2YYZA 4OWWB 4BBRG 3JAMi 4A3IG 2VUMH 2ZJPA 1EOVA 3J81c 1U0LA 1E7ZA 3HOXH 1SRUA 2OCEA 4IPCA 2QEXA 4DR1Q 2UXBL 3A74A 3K0XA 2D0PA 4DR2L 2N49A 1EWIA 1K8GA 4LFAL 2R7ZG 2VL6A 4JI8L 3PIPA 1VQJA 1NJIC 2Y0SE 1LYLA 3BZKA 1EFWA 2AHOB 4RMFA 5C4XG 4YHHL 2QGQA 2JA6G 3L0OA 1OXXK 3TQYA 1WJJA 1CKNA 4OO1G 2MQHA 1ASYA 1V9PA 2UXDL 1X3EA 1Q86C 3S1NH 2R93G 2I5HA 3GO5A 2D0OA 4WJ4A 3EN2A 3CC7A 1IBKL 5K36G 4DR6L 1A63A 3PUWA 2HHHL 1VQBA 2WFWA 4R4OA 5E7NA 5BR8Q 4OWXB 1K73C 4A75A 5M3MG 3PO3G 1HH2P 3LGJA 3S14H 1M90C 3MXNB 5IYCG 1VQPA 1YI2A 3ICEA 5M3FG 3CC4A 1Q82C 3CCVA 4A3GH 3M4OH 2DGYA 1X54A 5FLMG 4L5TA 1BVSA 4EQ5A 4DV0L 4GNXC 2GVBA 1N33Q 2WB1E 2IT1A 1IYJB 4DV5Q 4O2DA 3HOZH 4JI6Q 3UDFA 4DV2L 4JI7Q 2VQEL 1PV4A 2IX1A 4C2MH 2UUAL 3CCQA 4DV4Q 3J80c 2PMZE 4P74A 2Z6KC 3CMAA 1I94L 2JA7H 4C3IH 1A62A 2LXJA 2I5LX 3STBD 5C0XI 4JBWA 4GNXA 2AMCB 2E2IH 1R9TH 4IOCA 4LF8L 4BBSH 5IWAL 1PH1A 1IXRA 1Y1VH 4MTNA 1Q12A 2NVTH 2MO0A 1PYSB 1YIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8A A;  1KC8 C;  1NTG A;  2JA6 H;  4DV6 Q;  1GKH A;  4X66 Q;  2N3S A;  4KI0 A;  1WCM H;  1OXV A;  3HKZ E;  3S2D H;  1X3G A;  3PV0 A;  2OWO A;  2Z6K A;  1IBL Q;  2R93 H;  4AYB E;  3F2D A;  1QZG A;  3HOV G;  4X64 L;  1VCI A;  2KEN A;  3BJU A;  3A5U A;  1MIU A;  2E2H H;  1V1Q A;  1MKH A;  2ZTC A;  2BH8 A;  3PIO A;  1U5K A;  3SGI A;  3HKS A;  1VQC A;  4IJH A;  5C3E G;  4LF7 L;  4DR3 Q;  3ULJ A;  1G6P A;  2Q2T A;  1TWC H;  1HZ9 A;  3HFZ B;  4JI2 Q;  1K9M C;  4DAM A;  2KHJ A;  4B3S Q;  3RLO A;  1E1T A;  1HNZ L;  4NXN Q;  1N32 L;  4B3M L;  2MNA A;  4GKK L;  3F2C A;  1SE8 A;  2RF4 A;  2JK8 A;  5IT9 c;  2YU9 H;  4A3D G;  2IY5 B;  1GD7 A;  1O7I A;  1JT8 A;  1EIF A;  1Z47 A;  4AQY Q;  3TS0 A;  5HGQ A;  2NVQ H;  1VQF A;  4HJA A;  2N78 A;  1L0W A;  3W1G A;  2NN6 I;  1H95 A;  2R92 H;  4GN5 A;  2CWP A;  4OX9 L;  1JE5 A;  5FJ8 H;  1IBM Q;  4DV7 L;  3K80 C;  1FJG Q;  4EX5 A;  2C35 B;  4IO9 A;  2JA8 G;  4BA2 I;  4LF5 L;  2RCN A;  1YHA A;  1NE3 A;  1YBY A;  4PZ8 A;  2CWA A;  1XMQ L;  3RZD H;  1SR3 A;  5LMU L;  3AYH B;  3M4P A;  3CME A;  1WI5 A;  1XPO A;  4JI3 Q;  3JC6 6;  2PQA A;  2GN5 A;  4YCW A;  3H0G G;  1X9N A;  4YWL A;  2UUB L;  4PZ7 A;  4TVA B;  1FVI A;  3WWV A;  1XNQ L;  1IZ6 A;  4NXM L;  1VQE A;  2WAQ G;  3ULL A;  4A3J G;  4DR4 L;  1VQA A;  3UDX A;  1Y1W H;  4B3R L;  1V43 A;  2F3I A;  4JBJ A;  4JCV E;  1L1O C;  4DV1 Q;  4DV3 Q;  1PHJ A;  4L5R C;  3HOU G;  3NEL A;  4LFC L;  4BA1 I;  4DR5 Q;  3I56 A;  4RG1 A;  4A3E G;  1XPU A;  4IFD I;  2PQA B;  5IP9 G;  4A3L H;  3HOV H;  4A76 A;  3GTM H;  3W1B A;  1GO3 E;  4YWM A;  4A3K G;  5DLQ E;  2ASB A;  4OO1 I;  2R7F A;  4JBK A;  5GAH C;  5C3E H;  2HIX A;  1QZH A;  4R1J A;  2VZA A;  3H3V I;  3RZO H;  5C44 H;  4FDB A;  5LMN W;  2F4V L;  3PO2 H;  1K3R A;  3UDG A;  3KF6 A;  1B70 B;  1QVF A;  4YY3 Q;  3KF8 B;  3AQQ A;  2F52 A;  5GQO A;  3T1Y L;  1L1O A;  2Y0S G;  4POG A;  5JEA J;  1PH7 A;  1PH5 A;  1Q8K A;  4IOA A;  4DAY B;  2MO1 A;  1VQ8 A;  2JEB I;  2BA1 A;  1YJN A;  4BY7 H;  5FLX c;  1OXT A;  4QL5 A;  3U58 A;  1AE3 A;  1RIP A;  1PYB A;  1QUQ A;  3KF6 B;  1TWA H;  4DPG A;  1AE2 A;  4UP8 A;  5GRO A;  3J81 i;  2ZM6 L;  3CF5 A;  4JOI C;  1N36 L;  2HT1 A;  4GN4 B;  3AEV A;  4YCU A;  1L1O B;  4LNQ A;  3TS2 A;  1KIX A;  4GOP B;  2K52 A;  1JMC A;  2PI2 E;  2JA8 H;  3EBE A;  3CCJ A;  4JV5 Q;  3S17 H;  4DR2 Q;  1Q7Y C;  3K7U C;  1K0R A;  4O0A A;  1UEB A;  1TWH H;  1UE7 A;  5BR8 L;  3KJP A;  2VQF Q;  4A3F G;  4A3M H;  4JI8 Q;  1Q81 C;  4B3T L;  4GKJ L;  4X62 Q;  1BBW A;  1CKN B;  3OTO Q;  3RN5 A;  4YWK A;  1N8R C;  1W3S A;  2AKW B;  1CUK A;  3GD7 A;  4X65 Q;  2ZJQ A;  4YHH Q;  3T1H Q;  1X56 A;  3KJO A;  3RN2 A;  1KL9 A;  4X6A H;  3NEM A;  4JOI A;  1J5E L;  1BKB A;  4KHP Q;  2WB1 G;  1N33 L;  4A93 H;  3F8T A;  2BH2 A;  4QGU A;  1E3P A;  2K5V A;  2UUC Q;  4BY1 G;  4YCV A;  2JA9 A;  2NZO A;  2UU9 Q;  4DV5 L;  1L2F A;  3GTJ H;  2JEA I;  3W5O A;  3S2H H;  4BBR H;  4A3I H;  3GTK H;  2UXC L;  1YEZ A;  2OQ0 A;  1NMF A;  1VQN A;  2HIV A;  2E5L L;  1HJP A;  4J15 A;  3U4Z A;  1VQ6 A;  2K5H A;  4LF6 Q;  1PH8 A;  2EIF A;  1VQK A;  4LF4 L;  4LF9 Q;  2I0Q A;  3U4V A;  2R7Z H;  1N34 L;  3PF4 A;  3DLL A;  4DUY L;  2ES2 A;  5C4X H;  4OON A;  2JQO A;  2K14 A;  4LWC A;  5AJ3 L;  2K5N A;  4H02 A;  1SN8 A;  4DV6 L;  4K0K L;  1FGU A;  4X66 L;  3HKZ G;  5HY6 A;  2JJQ A;  5JEA G;  5IYB G;  4BXX G;  2VY3 A;  1S72 A;  1YJW A;  3VDY A;  1X3F A;  3J80 i;  4AH6 A;  4GNX B;  1EQQ A;  4AYB G;  4JI1 Q;  2UUA Q;  3I4N G;  1IBL L;  4JI0 Q;  3H3V H;  3G4S A;  4PMW A;  2YTY A;  4TQU S;  1VQ4 A;  3J7Z C;  3RNU A;  1VQ5 A;  5IP7 G;  5GAE C;  3OW2 A;  2IX0 A;  2LSS A;  4JYA Q;  1C7Y A;  4LF8 Q;  5M3M H;  3PO3 H;  3PUV A;  2DUD A;  5IWA Q;  4LFB L;  5IYC H;  1WYD A;  4JI2 L;  1NY4 A;  4B3S L;  4NXN L;  1VS0 A;  1D8L A;  5M3F H;  3HOW G;  4A3B H;  1RL2 A;  1VQO A;  4A3C G;  1KXL A;  1CSQ A;  2A8V A;  2IHF A;  3DM3 A;  2I5M X;  4NB3 A;  5FLM H;  1P8L A;  2JA5 G;  3K81 C;  1I50 H;  2L15 A;  2Z0S A;  4GS3 A;  4JI4 Q;  4ALP A;  1VQM A;  3K8A A;  3KFU A;  1HNX Q;  2PI2 A;  4AQY L;  1PH6 A;  3AFP A;  1VQ7 A;  3A5Z B;  3ZJY C;  3PSI A;  1YNX A;  3S1M H;  3S15 H;  1C0A A;  3Q8D A;  4DKA C;  2VUM G;  4PG3 A;  1XNR L;  1C9O A;  1T9H A;  3RLF A;  2XTI A;  4QY7 A;  2ALY B;  3HOX G;  2VS1 A;  1IBM L;  2JE6 I;  1FJG L;  3I4M G;  1G51 A;  3G48 A;  2N8N A;  2YTV A;  1N32 Q;  1HNZ Q;  5LMN Q;  1X6O A;  5H1S E;  3I4O A;  3PUZ A;  4B3M Q;  3M7N A;  4GKK Q;  3J7A 5;  4JI3 L;  1YZ6 A;  1PVO A;  2NZH A;  1Q46 A;  4IJL A;  4R4Q A;  3FP9 A;  1X55 A;  2QA4 A;  1HR0 L;  2HQL A;  3CPW A;  1EIY B;  1FL0 A;  3D0F A;  3G71 A;  4DV3 L;  5GAD C;  1CKM A;  4KHZ A;  2VNU D;  4LF6 L;  3CCM A;  3GTG H;  1SRO A;  2OTL A;  4AIM A;  4LUO A;  3CCS A;  4MZ9 A;  1N9W A;  4XIG S;  1JB7 A;  3PF5 A;  1VQD A;  2E8G A;  2YTX A;  1IL2 A;  4DR7 Q;  1NMG A;  1XMO Q;  4DUZ Q;  3KDF A;  3L7Z C;  1XPR A;  1TWF H;  1I3Q H;  1QVC A;  3F2B A;  4DR1 L;  1K8A C;  3I2Z A;  4JBM A;  4C3H H;  1KAW A;  3M3Y H;  3CQZ H;  1DGS A;  4R4C A;  5M5W H;  1YJ9 A;  1PA6 A;  4LUZ A;  4JI5 Q;  3CXC A;  1E1O A;  1B7Y B;  2GVA A;  2NN6 G;  2JA5 H;  4A3D H;  4B3R Q;  3CPF A;  2K4K A;  1CKO A;  5M5X H;  4LFC Q;  3KDF B;  2PNH A;  2K50 A;  2ZJR A;  4QJF A;  1PFS A;  3F1Z A;  3AFQ A;  1S3O A;  3TRE A;  3ULP A;  1HZA A;  5C4J H;  2A1A A;  4P71 A;  3IRB A;  1GVP A;  1KHI A;  1LTL A;  2H5X A;  2B63 G;  3I4M H;  2UXB Q;  3RLN A;  2F4V Q;  2JA7 G;  1YIT A;  4IPD A;  1SFO H;  1PH3 A;  4JV5 L;  4A4I A;  4LFA Q;  2VQF L;  2Q2U A;  3TRZ A;  3T1Y Q;  4BBS G;  1QUQ B;  1AH9 A;  3I55 A;  2EXD A;  4JC0 A;  3S16 H;  1Y1V G;  4P75 A;  3H0G H;  4X62 L;  4DK6 C;  1EQR A;  3OTO L;  2KCM A;  1HR0 W;  3BU2 A;  4X65 L;  3UDI A;  3T1H L;  4IFD G;  1W2B A;  1K83 H;  3E0E A;  3PUX A;  1HNW Q;  3M85 A;  4A3J H;  2ZM6 Q;  1N36 Q;  1WCM G;  1M1K C;  2ZTD A;  1PH9 A;  4KHP L;  4L5Q A;  5C0X J;  4R4T A;  5ELO A;  4IPH A;  2YV5 A;  5M5Y H;  3HOU H;  4A3E H;  2UUC L;  2UXD Q;  5JJK A;  4OWT B;  2E2J H;  3ERS X;  5IP9 H;  4NPS A;  4PZ6 A;  1IBK Q;  1VQ9 A;  2UU9 L;  4JI6 L;  3GTO H;  4DR6 Q;  1UE5 A;  1Q1E A;  4A3K H;  2HHH Q;  4JI7 L;  2WP8 J;  4UP9 A;  2OTJ A;  4B3T Q;  3A0J A;  3NBH B;  3B6Y A;  4UP7 A;  4GLX A;  5ELN A;  4DV4 L;  3GTL H;  2NVX H;  4GKJ Q;  1UE1 A;  4GOP C;  3CCE A;  3PCO B;  2LXK A;  1YVC A;  1X65 A;  3H15 A;  2KBN A;  4HIK A;  3CAM A;  1XJV A;  4LF9 L;  1XTD A;  3G6E A;  1PH2 A;  1J5E Q;  3L2P A;  3TEH B;  4DV0 Q;  1Y14 B;  1I6H H;  4HJ5 A;  4GLV B;  3CC2 A;  1JJC B;  1OXU A;  1VQG A;  1UWV A;  2R92 G;  1YHB A;  4ME3 A;  3D31 A;  4DV2 Q;  1WFQ A;  3S24 A;  2VQE Q;  3HOY G;  3BZC A;  5FJ8 G;  1G29 1;  4QIW E;  1MJE A;  4LW1 A;  2B63 H;  2CFM A;  4JI1 L;  5IYD G;  2BA0 A;  4GOP A;  4JI0 L;  2UXC Q;  2E5L Q;  3CCU A;  1VQI A;  1I94 Q;  3CCR A;  1HZB A;  4A3B G;  4LF4 Q;  2VW9 A;  1Q1B A;  3FKI G;  4A3F H;  4DR3 L;  4JYA L;  3CP0 A;  3OYY A;  1MJC A;  4HIM A;  1N34 Q;  3E9I A;  4R4I A;  4POF A;  1A8V A;  2AWN A;  1VQH A;  4DUY Q;  1SLJ A;  1VQL A;  3MEF A;  4WJ3 M;  4OXP A;  4KLK A;  1EYG A;  5AJ3 Q;  3CD6 A;  2V1C C;  1TXY A;  1S40 A;  3E9H A;  1TWG H;  2CQO A;  4K0K Q;  1KRT A;  1ASZ A;  3RR5 A;  1HNW L;  1Y1W G;  1BBU A;  1QVG A;  2CCZ A;  3J81 j;  4JI4 L;  2K75 A;  1D7Q A;  5EAY A;  1HNX L;  2R7D A;  4HJ8 A;  1Z9F A;  1GM5 A;  4BY1 H;  4GLA C;  4A3L G;  4X64 Q;  1SMX A;  2RHS B;  4L5S A;  1WOC A;  2FXQ A;  4QQB X;  5GAG C;  4C3J H;  2A19 A;  4DK3 C;  5JJL A;  4LF7 Q;  1LM0 A;  3CCL A;  5C0X G;  1P16 A;  1E22 A;  1A0I A;  4HIO A;  2IHE A;  5C44 G;  4LFB Q;  3PUY A;  3KLW A;  3PO2 G;  2NVY H;  3CW2 C;  3GDE A;  3M9B A;  5IY0 A;  3NEN A;  3KOJ A;  4P73 A;  5LMN L;  4HID A;  2EQS A;  2ATW A;  4P72 A;  3M4Q A;  4IFD J;  1PH4 A;  2MFI A;  4JG2 A;  1NBW A;  4HJ9 A;  1OTC A;  2D62 A;  1YHQ A;  4Y7N H;  2Q2I A;  4UY8 C;  3S1R H;  4BY7 G;  4BXX H;  5IYB H;  2B3G A;  4OX9 Q;  1XNR Q;  4IPG A;  3PGZ A;  3GTP H;  4DV1 L;  2CKZ B;  4HJ7 A;  3HOY H;  3UE0 A;  2KHI A;  4GN3 B;  3K7A H;  4XTC S;  4DV7 Q;  4DR5 L;  3I4N H;  5IYD H;  2B29 A;  1J6Q A;  2ID0 A;  4LF5 Q;  2AWO A;  5IE8 A;  5IP7 H;  1JJ2 A;  4Y52 H;  1UE6 A;  4LUV A;  5LMU Q;  1XMQ Q;  4A3M G;  1XMO L;  4DR7 L;  2RHQ B;  3JAM c;  4DUZ L;  5JJI A;  3FKI H;  4UPA A;  1JJG A;  4APV A;  2OQK A;  2UUB Q;  1KD1 C;  1EUJ A;  3FHW A;  1KRS A;  3GTQ H;  1XNQ Q;  3HOW H;  3S1Q H;  4NXM Q;  4A3G G;  3U50 C;  4A3C H;  4YY3 L;  1HR0 Q;  3KYH C;  1CSP A;  4DNI A;  3STB C;  3UE1 A;  2KCT A;  4JI5 L;  3EIV A;  2WAQ E;  4DR4 Q;  1KQS A;  1E24 A;  4A93 G;  3ER0 A;  5J3B A;  4MNO A;  1OXS C;  3HOZ G;  2Q2H A;  3I7F A;  2ZTE A;  1I5F A;  2XGT A;  2R6G A;  1HZC A;  1LUZ A;  2YYZ A;  4OWW B;  4BBR G;  3JAM i;  4A3I G;  2VUM H;  2ZJP A;  1EOV A;  3J81 c;  1U0L A;  1E7Z A;  3HOX H;  1SRU A;  2OCE A;  4IPC A;  2QEX A;  4DR1 Q;  2UXB L;  3A74 A;  3K0X A;  2D0P A;  4DR2 L;  2N49 A;  1EWI A;  1K8G A;  4LFA L;  2R7Z G;  2VL6 A;  4JI8 L;  3PIP A;  1VQJ A;  1NJI C;  2Y0S E;  1LYL A;  3BZK A;  1EFW A;  2AHO B;  4RMF A;  5C4X G;  4YHH L;  2QGQ A;  2JA6 G;  3L0O A;  1OXX K;  3TQY A;  1WJJ A;  1CKN A;  4OO1 G;  2MQH A;  1ASY A;  1V9P A;  2UXD L;  1X3E A;  1Q86 C;  3S1N H;  2R93 G;  2I5H A;  3GO5 A;  2D0O A;  4WJ4 A;  3EN2 A;  3CC7 A;  1IBK L;  5K36 G;  4DR6 L;  1A63 A;  3PUW A;  2HHH L;  1VQB A;  2WFW A;  4R4O A;  5E7N A;  5BR8 Q;  4OWX B;  1K73 C;  4A75 A;  5M3M G;  3PO3 G;  1HH2 P;  3LGJ A;  3S14 H;  1M90 C;  3MXN B;  5IYC G;  1VQP A;  1YI2 A;  3ICE A;  5M3F G;  3CC4 A;  1Q82 C;  3CCV A;  4A3G H;  3M4O H;  2DGY A;  1X54 A;  5FLM G;  4L5T A;  1BVS A;  4EQ5 A;  4DV0 L;  4GNX C;  2GVB A;  1N33 Q;  2WB1 E;  2IT1 A;  1IYJ B;  4DV5 Q;  4O2D A;  3HOZ H;  4JI6 Q;  3UDF A;  4DV2 L;  4JI7 Q;  2VQE L;  1PV4 A;  2IX1 A;  4C2M H;  2UUA L;  3CCQ A;  4DV4 Q;  3J80 c;  2PMZ E;  4P74 A;  2Z6K C;  3CMA A;  1I94 L;  2JA7 H;  4C3I H;  1A62 A;  2LXJ A;  2I5L X;  3STB D;  5C0X I;  4JBW A;  4GNX A;  2AMC B;  2E2I H;  1R9T H;  4IOC A;  4LF8 L;  4BBS H;  5IWA L;  1PH1 A;  1IXR A;  1Y1V H;  4MTN A;  1Q12 A;  2NVT H;  2MO0 A;  1PYS B;  1YIJ A; 
#chains in the Genus database with same CATH topology
 2H4O A;  1F9R A;  3OWE B;  4RCO A;  1A15 A;  1B50 A;  4AYB E;  2KEN A;  1MIU A;  4H7B A;  2ZTC A;  2F0Q A;  1KNA A;  3VR3 A;  4BBR B;  4A3I B;  3SHL A;  2Q2T A;  3RLO A;  1MHW C;  4X3K A;  2G9D A;  2Z4I A;  2MNA A;  2EZV A;  1U9R A;  5IT9 c;  4A3D G;  2R7Z B;  1EIF A;  5HGQ A;  2M00 A;  4HJA A;  3W1G A;  1BXT A;  1A2U A;  4HN7 A;  3K80 C;  2R93 B;  2K28 A;  4IAL A;  2RCN A;  1YHA A;  4IN3 A;  4PZ8 A;  4CDE C;  1AZQ A;  4ME5 A;  4DAP A;  2MGS A;  3AYH B;  3M4P A;  4EQP A;  1RJT A;  3JC6 6;  2J0T D;  3H0G G;  1X9N A;  4PNY A;  4PZ7 A;  2HCI A;  2EJG C;  4NXM L;  1VQE A;  1RF2 D;  4N8F A;  2ZXR A;  5HUR A;  4DR4 L;  3UDX A;  5CYU A;  4B3R L;  4L5R C;  4DV1 Q;  1I50 B;  1S5C D;  3HOU G;  1XPU A;  4BA1 I;  4A3E G;  4RG1 A;  3AB9 A;  5IP9 G;  3HOV H;  1D1I A;  2SNS A;  1BO0 A;  3ZYY X;  4CKE A;  4A3K G;  5DLQ E;  1JC7 A;  1S5E D;  2R7F A;  3A54 A;  4XT1 B;  2BDO A;  4JBK A;  1SE3 A;  2OT2 A;  1Z6H A;  5ELC A;  3HGB A;  4KY7 A;  4YY3 Q;  2F52 A;  3T1Y L;  4UAI A;  4CDF C;  1SMY C;  2CVR A;  1GUO A;  1Q8K A;  2TSS A;  4DAY B;  1I4H A;  1JWM D;  2A6H D;  2MO1 A;  4QL5 A;  1VF5 C;  1AE3 A;  3KF6 B;  5FO8 B;  3U58 A;  1TWA H;  1D6E C;  3IFT A;  4EQO A;  3CF5 A;  2K7V A;  3D6W A;  4H13 C;  2HT1 A;  5ELB A;  3GTG B;  3CCJ A;  4JV5 Q;  3S17 H;  3T16 A;  3NBI A;  4H44 C;  4ZUJ A;  3A8J E;  3GTM B;  4A3M H;  1UE7 A;  5G3L D;  1ET9 A;  3KJP A;  4JI8 Q;  2X69 A;  3RN5 A;  1CKN B;  1N8R C;  3JAM E;  3GD7 A;  2ZJQ A;  4YHH Q;  3KJO A;  5CV8 A;  2CW0 D;  4OHJ A;  4IUV A;  2UUC Q;  2JA9 A;  5D65 A;  4C3J G;  4DF7 A;  1L2F A;  3SK6 A;  2RSN A;  3S2H H;  4BBR H;  4A3I H;  5FKA C;  1EOT A;  3BYT B;  5C4J B;  1F2M A;  2KUM A;  2E5L L;  4FP5 D;  1VQ6 A;  1I4R A;  4LF6 Q;  3K5L A;  4LF9 Q;  1SFO B;  2IL8 A;  2R7Z H;  1N34 L;  2WKD A;  4DUY L;  4IQZ A;  4KN7 C;  1XX8 A;  5IYB G;  2VY3 A;  2WAQ B;  4A3J B;  3PMF A;  4GNX B;  4XQQ A;  1SND A;  4JI0 Q;  2BOS A;  4IUN A;  5K36 H;  4PMW A;  3T53 B;  2PW5 A;  2YTY A;  1BF4 A;  3TP6 A;  3J7Z C;  1VQ5 A;  4JYA Q;  3GV3 A;  4F88 A;  1C7Y A;  4LFB L;  2DUD A;  2QIL A;  1WYD A;  3GTL B;  1VS0 A;  1ROD A;  1TY0 A;  1RL2 A;  1VQO A;  1WTP A;  1CSQ A;  4NB3 A;  5FLM H;  1I50 H;  2L15 A;  1BCP D;  1VQM A;  3K8A A;  2PI2 A;  4QF4 A;  3AFP A;  1CHQ D;  1VQ7 A;  1NSN S;  3I90 A;  3A56 A;  1CZW A;  1XNR L;  5E3F A;  1B4O A;  2OEO A;  2ALY B;  1HFN A;  5EBD A;  1WTH A;  2YTV A;  1N32 Q;  2LKV A;  3I4O A;  3PUZ A;  4B3M Q;  4GKK Q;  4K5W A;  3H6M A;  1K8M A;  4K6D A;  1EQV A;  3C3L A;  1Q46 A;  3SK4 A;  5BN5 A;  1Q90 A;  2Z4H A;  2EDG A;  3TBI B;  4WJW A;  4J6H A;  3CCM A;  3GTG H;  4LK1 C;  1E2V A;  3FMC A;  4MZ9 A;  2X6G A;  4BY1 B;  3FDT A;  1MGS A;  3L7Z C;  1QVC A;  3BVZ A;  5DAU A;  4JBM A;  1S5B D;  3IFD A;  1LTA D;  4R4C A;  1HRJ A;  1GUN A;  1PA6 A;  3OIP A;  4LUZ A;  1ICW A;  1B7Y B;  1SYD A;  1AFP A;  2Q8T A;  3CPF A;  2ZJR A;  2K50 A;  2KEC A;  2Q8R E;  3K5N A;  4X3T A;  5C4J H;  2A1A A;  3QIA A;  1RTO A;  2UXB Q;  2F4V Q;  4AYB B;  2J4X A;  3K7A B;  3I4N B;  4R9W A;  2JA7 G;  4IPD A;  1SFO H;  5D14 A;  1PH3 A;  4JV5 L;  2EE1 A;  1AH9 A;  2EXD A;  4JC0 A;  1EY9 A;  1EQR A;  1TWF B;  3R8B A;  3BU2 A;  1WTX A;  3GTQ B;  3UDI A;  2DJF C;  1HNW Q;  4A3J H;  1N36 Q;  3URY A;  4QUC A;  4L5Q A;  4RH6 A;  4QB4 A;  4R4T A;  5C0X J;  4IPH A;  2UUC L;  1G6Z A;  3ERS X;  2HHH Q;  4UP9 A;  4DV4 L;  1QIL A;  3GTL H;  4FXG C;  1K0S A;  1UE1 A;  3J81 E;  1VMP A;  5I2X A;  4QUF A;  3KLR A;  3CCE A;  1EQQ A;  4LF6 L;  1X65 A;  4HIK A;  4C1N I;  3CAM A;  4LF9 L;  5EQ0 A;  1XTD A;  2O4X A;  1PH2 A;  3L2P A;  3S16 B;  4HJ5 A;  4GLV B;  4RKL A;  1YHB A;  4DV2 Q;  2B8F A;  3S24 A;  2VQE Q;  2KCN A;  1G29 1;  4FYD A;  1NNX A;  1O80 A;  4QIW E;  2UXC Q;  5IYD G;  1JOQ A;  2BA0 A;  2WKC A;  4JI0 L;  4ZAI A;  4G7H C;  3CCR A;  3CHB D;  2AQ1 B;  2PYK A;  3GTO B;  1SYG A;  2K33 A;  4BS9 A;  4JYA L;  1QNK A;  4QCL A;  3MEF A;  1STE A;  4KLK A;  5AJ3 Q;  3CD6 A;  4K0K Q;  1KRT A;  3RR5 A;  2L4N A;  1VMC A;  1GUT A;  4RCN A;  3I4L A;  1D7Q A;  1Z9F A;  4BY1 H;  4QQB X;  2A19 A;  1LM0 A;  2RSO A;  1EU4 A;  1PTO D;  3PUY A;  3A55 A;  4C2M B;  1F2Z A;  1KDB A;  3KOJ A;  4KK7 A;  2L12 A;  5LL6 X;  5T1I A;  1IW7 C;  1ENA A;  2MFI A;  4J8Q A;  4HSP A;  1I6V C;  1NBW A;  4DN4 M;  4HJ9 A;  1Y1V B;  2F0T A;  4V19 0;  2NVT B;  1QB5 D;  3NQT A;  1CQF A;  3PGZ A;  1AW7 A;  4RGO S;  4HJ7 A;  3NQI A;  4GN3 B;  1BDO A;  3K7A H;  4L8J A;  3I4N H;  1A2T A;  4WOR A;  3VYU A;  2ID0 A;  2AWO A;  5IE8 A;  5IGC A;  5IP7 H;  2E2H B;  4WFN 3;  4A3M G;  5JJI A;  2RHQ B;  3JAM c;  2GA4 B;  2A6E C;  3GTQ H;  3QO2 A;  4OIK A;  1TQO A;  2K1B A;  4DNI A;  4DNT B;  3STB C;  2CH4 A;  3UE1 A;  3W3A A;  1B3Q A;  1KQS A;  5J3B A;  2NTT A;  4MNO A;  1TY2 A;  2BDN A;  1ILP A;  2NVQ B;  2ZTE A;  3H09 A;  4OWW B;  1LUZ A;  4BBR G;  3JAM i;  4A3I G;  4DAY A;  3HOY B;  4IPC A;  2RA4 A;  1AEX A;  2UXB L;  3IKJ A;  1Q3L A;  2F0G A;  2R7Z G;  1FR3 A;  1PRT B;  3KLS X;  5J1Z A;  4NW2 A;  3RMH A;  3BG3 A;  5IGD A;  1OXX K;  3I8Z A;  3R2I A;  3D8G A;  1CKN A;  2MQH A;  3BZD B;  1X3E A;  1PLF A;  2R93 G;  3GO5 A;  1SNM A;  3G7L A;  5K36 G;  1SYF A;  3CC7 A;  4RHR A;  3AMU A;  4C1N K;  3V05 A;  3PUW A;  2HHH L;  1K73 C;  5C3E B;  3LWE A;  3MHB A;  1YI2 A;  2CHB D;  3CC4 A;  3KLS A;  1X54 A;  5FLM G;  3EQL C;  5EGT A;  1TU2 B;  2NZ1 D;  5JOB A;  1IYJ B;  1DYQ A;  4O2D A;  5IIF A;  2CH4 W;  4JI6 Q;  3UDF A;  2KJX A;  4BY7 B;  4DV2 L;  2VQE L;  1PV4 A;  4C2M H;  3MVV A;  3NXW A;  2PQE A;  3CCQ A;  1KLU D;  4CJ1 B;  1ESF A;  1A62 A;  2I5L X;  5C0X I;  3BVM A;  4JBW A;  4GNX A;  1MBY A;  4IOC A;  4LF8 L;  2K5Q A;  5IWA L;  1Y1V H;  4MTN A;  5E4X A;  5EBC A;  1E2W A;  1Q12 A;  2NVT H;  2EYF A;  1EY8 A;  1KC8 C;  4KI0 A;  1OXV A;  3HKZ E;  1D2B A;  3NK9 A;  3PIP 3;  2E2H H;  1HUM A;  1V1Q A;  2R3Z A;  4XDX A;  3PIO A;  1YNJ C;  4ZKC B;  1U5K A;  3ERO A;  1O7Z A;  3DWA A;  2DY7 A;  4DR3 Q;  3DHQ A;  4FF2 A;  1HZ9 A;  1LTR D;  1BOS A;  2KHJ A;  4NXN Q;  1RHP A;  2F0P A;  1CK1 A;  3MC0 B;  2JK8 A;  5T1G A;  1KTK A;  1GD7 A;  1DD2 A;  5KIX A;  2NVQ H;  1VQF A;  1L0W A;  2NN6 I;  2NWG A;  5C4X B;  1H95 A;  1JE5 A;  1EY6 A;  5FJ8 H;  1M4V A;  1IBM Q;  5CC4 A;  4DK1 A;  4EX5 A;  2JA8 G;  1T5X D;  1EU3 A;  1HTP A;  1NE3 A;  1YBY A;  2HCC A;  3TSS A;  1SR3 A;  2PNR C;  3CME A;  1WI5 A;  2JYO A;  2PQA A;  4YCW A;  1ICF B;  5M3M B;  3S9W A;  2HUG A;  2PW7 A;  1FGB D;  1MD2 D;  2WAQ G;  4A3J G;  1VQA A;  5IGE A;  4JCV E;  3NEL A;  4LFC L;  5C5L A;  4A3L H;  2HDM A;  5KRU A;  4A76 A;  3T13 A;  2XRQ D;  4O42 A;  4YWM A;  2ASB A;  4ULL A;  5EPL A;  3C46 A;  2EOT A;  5C3E H;  2HIX A;  1LT3 D;  3H3V I;  1GHK A;  4FDB A;  4K6L A;  4CJ2 C;  3UDG A;  1A3V A;  1DOL A;  1B70 B;  4KKU A;  5GQO A;  5ELF A;  1WD0 A;  4G7O C;  4FXD A;  1PH5 A;  2JEB I;  2BA1 A;  4BY7 H;  1OXT A;  1CZG A;  4DPG A;  1AE2 A;  3LNN A;  3J81 i;  4JOI C;  2F0J A;  1L1O B;  4LNQ A;  3TS2 A;  1JMC A;  1LT5 D;  1ZXT A;  3EBE A;  3HOV B;  4DR2 Q;  4O0A A;  3EFX D;  4GKJ L;  5L37 A;  3OTO Q;  4JPB W;  2AKW B;  1CUK A;  1K28 A;  4X65 Q;  1JWS D;  2ZT9 C;  3M3Y B;  2XWJ B;  3NEM A;  5DM7 3;  4CKC A;  3CQZ B;  1J5E L;  1BKB A;  1S5F D;  3H94 A;  4ZLT F;  4KHP Q;  1ML0 D;  1G2T A;  4BY1 G;  4YCV A;  4K5V A;  1Y8P B;  5A2Q L;  1EWC A;  1BCP B;  3D4R A;  1NMF A;  1HFG A;  1VQN A;  3U9S A;  4J15 A;  3U4Z A;  4DFA A;  3I4M B;  2XRS D;  2WIN B;  4KKT A;  1VQK A;  5I9P A;  3NP8 A;  2I0Q A;  4LF4 L;  3TDQ A;  2BE5 C;  1JOK A;  3DLL A;  5C4X H;  2JQO A;  4KY6 A;  1IKL A;  3HG9 A;  2JJQ A;  1IL8 A;  2K03 A;  3VDY A;  3NPP A;  4OO1 H;  2ZXP A;  4AYB G;  3I4N G;  3VA5 A;  4TQU S;  1VQ4 A;  5IP7 G;  5GAE C;  2IX0 A;  3S2H B;  5M3M H;  2V4D A;  3EJI A;  1G2S A;  1NY4 A;  5J39 A;  4NXN L;  1D8L A;  4CGY B;  2IHF A;  3FRP B;  1IYU A;  4K14 A;  2E75 C;  4B08 A;  2JA5 G;  2WAC A;  1B9M A;  4GS3 A;  3KFU A;  3Q6S A;  1R4Q B;  3A5Z B;  3PSI A;  1C0A A;  1R4P B;  4PG3 A;  1C9O A;  2KA7 A;  2XTI A;  1RKN A;  3P20 A;  2VS1 A;  3D4D A;  1IBM L;  3G48 A;  3TP5 A;  2B63 B;  1YNN C;  1HNZ Q;  3J80 E;  1X6O A;  3CRK C;  3J7A 5;  1EYA A;  1TKW B;  2WV6 D;  1YZ6 A;  4ILW A;  2NZH A;  2KCC A;  1DM0 B;  1H9S B;  4HMI A;  4A3F B;  5LL6 S;  3FP9 A;  1HR0 L;  3OPO A;  1ET6 A;  2NTS A;  2HDL A;  3E3X A;  3ND8 A;  3O13 A;  3G71 A;  4KHZ A;  1SYC A;  3ONA B;  4LUO A;  2RBM A;  2ZXO A;  1IL2 A;  3I3C A;  1NMG A;  3KDF A;  4Q0F A;  1RCV D;  4DR1 L;  4MHE A;  3F2B A;  1JB3 A;  2B2Y C;  3I2Z A;  1KAW A;  3M3Y H;  3EVQ A;  2L5T A;  3CQZ H;  1DGS A;  1YJ9 A;  3DEO A;  4S3S A;  2K4K A;  5JVH 3;  4IUT A;  4WRD A;  4Y7N B;  1T5E A;  1BQQ T;  3S1R B;  1S3O A;  3HZX A;  1HZA A;  3IRB A;  1GVP A;  1MSH A;  1KHI A;  1LTL A;  3HKZ B;  3QOL A;  5CBA E;  3GTP B;  5FO7 B;  3I4M H;  1PDQ A;  1WTO A;  2G9H D;  1H9J A;  3I72 A;  1SBB B;  2Q2U A;  3TRZ A;  2A69 C;  1QUQ B;  1Y1V G;  1PRT F;  3OTO L;  2E2D C;  3T56 B;  4X65 L;  3MXP A;  1SJH D;  3E0E A;  3PUX A;  3M85 A;  2FJ2 A;  2DN8 A;  2ZM6 Q;  2ZTD A;  1PH9 A;  4KHP L;  5ISR A;  1B2T A;  5JJK A;  2B2V C;  4EGV A;  4FXK C;  1UE5 A;  2RVL A;  4UDU C;  2ICI A;  2WP8 J;  4XYQ A;  4B3T Q;  3A0J A;  3NBH B;  2VUM B;  1HPC A;  1A3T A;  3HOX B;  1CFM A;  2EY5 A;  5FK9 C;  5K5P A;  4RWS C;  1F2L A;  2LXK A;  2VXW A;  3P1H A;  3H15 A;  1XJV A;  3G6E A;  1B44 D;  1F77 A;  4NP5 A;  1Y14 B;  3UI2 A;  4DU9 A;  4I7A A;  1JJC B;  1OXU A;  1VQG A;  1GXD C;  3HOY G;  2A73 B;  5FJ8 G;  1MJE A;  1WTR A;  2B63 H;  4PMB A;  1ILQ A;  1HQR D;  1ZYR C;  1QWY A;  4KY5 A;  2SDF A;  3FEW X;  1HA5 A;  5KEE A;  1DXM A;  3FKI G;  4ZYS A;  4A3F H;  4HIM A;  5CV9 A;  3S14 B;  1SLJ A;  3J7A F;  4OXP A;  4WJ3 M;  1TXY A;  1ASZ A;  1E0B A;  3M4O B;  1BBU A;  1QVG A;  5J22 A;  2KOL A;  1K8O A;  2R7D A;  4A3L G;  4X64 Q;  2RHS B;  4L5S A;  1WOC A;  5GAG C;  4IUQ A;  3HOZ B;  3K0Y A;  5COY A;  3NWS A;  4LF7 Q;  1U4R A;  1QE6 A;  1SEB D;  1STG A;  4HIO A;  4BWG B;  3K6O A;  4HID A;  4L63 B;  2EQS A;  3HS0 C;  3T4A C;  4IFD J;  3L3O C;  4Z9C B;  1S4Z A;  4BBS B;  2D62 A;  4Y7N H;  4K8J A;  4UY8 C;  3S1R H;  4BY7 G;  3FPP A;  3R93 A;  4BXX H;  2XIW A;  5JEA H;  4OX9 Q;  2G5D A;  3GTP H;  4DV1 L;  3UE0 A;  1LT4 D;  3D6C A;  4IZ8 A;  4XTC S;  4DV7 Q;  4P2C B;  3S2D B;  2B29 A;  1J6Q A;  3IL8 A;  4LF5 Q;  4Y52 H;  4LUV A;  5LMU Q;  1JJG A;  1PRT C;  4UPA A;  2OQK A;  1GHJ A;  1WD1 A;  2UUB Q;  1KD1 C;  1EUJ A;  3T51 B;  3S1Q H;  1TWC B;  4A3G G;  3NE5 B;  3U50 C;  4YY3 L;  3KYH C;  4E6I A;  2LMC B;  1EIG A;  2MJ8 A;  5G3L F;  4XYO A;  1G91 A;  3H91 A;  1OXS C;  2K01 A;  2Q2H A;  3I7F A;  1I5F A;  5CV6 A;  2VUM H;  2R6G A;  2YYZ A;  3VR2 A;  5FLX L;  1UUP A;  2R92 B;  3HOX H;  1E7Z A;  1GUW A;  3KBX A;  1SRU A;  2QDB A;  3QG1 A;  2QEX A;  2EVB A;  3A74 A;  1AZP A;  2LS0 1;  1Y8O B;  2N49 A;  2VL6 A;  4JI8 L;  3OWF A;  1PTO H;  1VQJ A;  2Y0S E;  3DWP A;  3NTI A;  1NJI C;  1ENC A;  4HCE A;  3BZK A;  5C4X G;  4YHH L;  2DNE A;  3L0O A;  3TQY A;  1WJJ A;  3MXN A;  3QWN A;  4OO1 G;  1ASY A;  1Q86 C;  4K8I A;  2D0O A;  4WJ4 A;  3EN2 A;  4F87 A;  3CRL C;  1TS3 A;  1A63 A;  1VQB A;  5E7N A;  5BR8 Q;  4OWX B;  1SE2 A;  1UAP A;  3N52 A;  5M3M G;  3S14 H;  3LGJ A;  1VQP A;  3RZO B;  1H9M A;  3J80 L;  3ICE A;  3M4O H;  1JE4 A;  1B3A A;  1LTI D;  2NN6 H;  1BVS A;  4EQ5 A;  2SNM A;  1V1P A;  2WB1 E;  2ICE C;  2K04 A;  1WTQ A;  4DV5 Q;  3HOZ H;  4JI7 Q;  2IX1 A;  2AQ3 B;  1FNU A;  3HP3 A;  3J80 c;  1STA A;  1BCP F;  2PMZ E;  5A35 A;  2Z6K C;  1SXT A;  1L0Y B;  1BUV T;  2IX3 A;  2LXJ A;  5BN4 A;  1JR0 D;  1LAB A;  2AMC B;  4N9T A;  4BBS H;  1IXR A;  5AFW A;  4MN3 A;  1KRS A;  1PYS B;  1B8A A;  1AN8 A;  1EY7 A;  1ZEQ X;  1X3P A;  2JA6 H;  1GKH A;  1F9S A;  2FIN B;  4X66 Q;  4X3S A;  3S2D H;  5C4Z A;  2SOB A;  3OOC A;  1LTS D;  3HOV G;  2A6H C;  1VCI A;  4X64 L;  4TSS A;  2F3W A;  1PZK D;  2RDH A;  1BNZ A;  4RGT A;  2VB3 X;  4LF7 L;  1VQC A;  4IJH A;  3GTJ B;  1XWE A;  2FFK B;  2IJ0 A;  1TWC H;  1JQY D;  3HFZ B;  3I91 A;  4JI2 Q;  4DAM A;  1K9M C;  4B3S Q;  1N32 L;  1LV9 A;  1RDP D;  4B3M L;  4GKK L;  3WOF A;  3F2C A;  1U4L A;  2XNA C;  4G7Z C;  4KTA A;  3P7J A;  3A7A B;  4AQY Q;  1E2Z A;  3OSO A;  3TS0 A;  3BDC A;  2N78 A;  4ZQ3 A;  1ONL A;  2R92 H;  5KGU A;  4GN5 A;  2CWP A;  1GUS A;  2F0N A;  4OX9 L;  2K5W A;  2CW0 C;  5A2Q E;  1H9S A;  2J7Z A;  2PZW A;  4DV7 L;  2C35 B;  4IO9 A;  4BA2 I;  1EY5 A;  4LF5 L;  5CGK A;  2CWA A;  5LMU L;  4JI3 Q;  1CT1 D;  2GN5 A;  2UUB L;  4K2K A;  1CQV A;  1FVI A;  4M1U B;  3WWV A;  1IZ6 A;  1K3B C;  1KAB A;  3U9O A;  2E74 C;  3ULL A;  2B2T C;  2F3I A;  1L1O C;  4DR5 Q;  4IFD I;  2A68 D;  2F03 A;  1GO3 E;  3S1M B;  3BDL A;  4R1J A;  3RZO H;  1PZJ D;  2F4V L;  1K3R A;  5F2D A;  3KF6 A;  4FVM A;  3TN2 A;  3AQQ A;  4R8I A;  4POG A;  1PH7 A;  4IUU A;  3MWY W;  4IOA A;  1IHZ A;  3M7G A;  1VQ8 A;  2IWH A;  1HNW L;  1LTT D;  3VR6 A;  1QUQ A;  1N36 L;  5GRO A;  4UP8 A;  4RGM A;  1BCP C;  4GN4 B;  2SEB D;  1KIX A;  2K52 A;  2F0V A;  1BBX C;  1UEA B;  1L0X B;  2ENB A;  5BR8 L;  4A3F G;  1Q81 C;  4RHS A;  4ZCK A;  5EKI A;  4YWK A;  1W3S A;  2N88 A;  1I3Q B;  2F0F A;  2LFN A;  1EY0 A;  1X56 A;  4C3H B;  1KL9 A;  4X6A H;  3NBH A;  4JOI A;  1FD7 D;  5M5W B;  4MIU A;  3M4Y A;  3F8T A;  1E3P A;  2NZO A;  5M5X B;  4KJN A;  4DV5 L;  1YNN D;  3GTJ H;  2JEA I;  2Z6B A;  1SNP A;  2UXC L;  2OQ0 A;  2MPM A;  1HJP A;  2F0E A;  1KAA A;  5EJW A;  1SNQ A;  1PH8 A;  3BDO A;  4RA8 A;  2F0D A;  4CBV A;  3U4V A;  2EYM A;  2ES2 A;  1PTO F;  1DJR D;  4OON A;  5I2Y A;  5AJ3 L;  2K14 A;  1H9K A;  3TP7 A;  3MTS A;  1SN8 A;  4K0K L;  4X66 L;  2F3V A;  2B39 A;  3CKI B;  3HKZ G;  5CMD A;  5JEA G;  4BXX G;  1S72 A;  4ZUI A;  3K5M A;  1YJW A;  2UUA Q;  2NYZ D;  5ELD A;  3G4S A;  3I73 A;  3GV6 A;  3RNU A;  4Q5V A;  3OW2 A;  1I4G A;  1SMY D;  3PUV A;  5I6W A;  5IYC H;  1PFB A;  3E6Z X;  4JI2 L;  4B3S L;  2A74 C;  2M9V A;  1QG7 A;  3NHH A;  1FYC A;  2I5M X;  3HRZ C;  3K81 C;  2H1E A;  2Z0S A;  4JI4 Q;  2Y0S B;  4ALP A;  2K6A A;  1HNX Q;  4AQY L;  1PH6 A;  1I6H B;  3GQB A;  1YNX A;  3S1M H;  4OEM B;  2VUM G;  1QJO A;  3RLF A;  4QY7 A;  1SYE A;  4C56 C;  3HOX G;  2A69 D;  2NUC A;  2JP1 A;  2JE6 I;  5CR3 A;  1XYI A;  1HCZ A;  2N8N A;  4CKB A;  1WVL A;  2OXP A;  3TZD A;  3M7N A;  4JI3 L;  2O5I C;  3X3M A;  2F0I A;  5TSS A;  1X55 A;  1DOM A;  3MXU A;  2QA4 A;  1PFM A;  1NR4 A;  1FL0 A;  2K05 A;  5GAD C;  1H9R A;  3DUZ A;  4OEL B;  2VNU D;  2NB0 A;  3WOE A;  2WB1 B;  1SRO A;  3GP7 A;  4AIM A;  2OTL A;  3OMG A;  1N9W A;  4XIG S;  1C48 A;  5EKL A;  4DK0 A;  4KV6 A;  1VQD A;  3PF5 A;  2QEJ C;  4N9P A;  4KN4 C;  4LJZ C;  3Q0A A;  1HA6 A;  3VYR A;  4QIW B;  1I3Q H;  1K8A C;  1FNW A;  4C3H H;  3F2U A;  5M5W H;  1TR5 A;  5JAV A;  1LTG D;  5D3D A;  2F4I A;  1HTL D;  2JSO A;  2GVA A;  2NN6 G;  2RKS A;  4B3R Q;  2QKI C;  5C6A A;  4PV1 C;  1CKO A;  5M5X H;  4QJF A;  1PFS A;  1LTB D;  3AFQ A;  2EJM A;  3FVQ A;  3DXJ C;  5KYI A;  2B2Y A;  2I07 B;  2L55 A;  3RLN A;  4XQN A;  4GZY C;  1YIT A;  5FOB B;  4A4I A;  3T1Y Q;  4BBS G;  2Z1C A;  5FO9 B;  3I55 A;  1PTO C;  2KCM A;  2X6L A;  1VDZ A;  2KED A;  4DXG A;  2MUY A;  1W2B A;  3HOW B;  1SNC A;  5JJZ A;  2UXD Q;  5IOC A;  5ELO A;  2YV5 A;  3SR1 A;  4OWT B;  1B53 A;  4NPS A;  4V0B A;  2RCF A;  4FF3 A;  4JI6 L;  4DR6 Q;  4F8M A;  3MA2 B;  1EEF D;  2OTJ A;  4UP7 A;  1KNE A;  5ELN A;  2NBF A;  4QMG A;  3Q24 A;  4GOP C;  2A5H A;  3WDN A;  1YVC A;  2KBN A;  3R2T A;  3P75 A;  3D4W A;  3OW7 A;  2E76 C;  2B2V A;  3TEH B;  1I6H H;  1ESR A;  3CC2 A;  5EPK A;  5IOD A;  1WTV A;  3C1F A;  4HED A;  5EPJ A;  1UWV A;  2L1B A;  2R92 G;  1BR9 A;  3N6R A;  1WFQ A;  5FLX E;  3BZC A;  2E5L Q;  2AUJ D;  3CCU A;  3S1N B;  2RQX A;  1I94 Q;  2PZT A;  1HZB A;  4RKB A;  3TME A;  2VW9 A;  1ENF A;  4DR3 L;  3CP0 A;  1N34 Q;  3E9I A;  4R4I A;  4POF A;  1A8V A;  2AWN A;  1VQH A;  2EY2 A;  4DUY Q;  1VQL A;  2V1C C;  4G57 A;  3K59 A;  4MTK A;  1S40 A;  2CQO A;  1KLG D;  2FMM A;  5E1F A;  1SJE D;  2PZU A;  3J81 j;  4JI4 L;  5IT9 L;  5EAY A;  1HNX L;  4GLA C;  1NAP A;  1SMX A;  3H3V C;  1JOO A;  1EL0 A;  5JJL A;  1EEI D;  5KNB A;  1E22 A;  1A0I A;  4LFB Q;  4JK1 C;  3VR5 A;  3GDE A;  3NEN A;  4P73 A;  1SDF A;  2ATW A;  3W2D A;  3TP8 A;  1PH4 A;  4C3I B;  2E2I B;  1LO5 D;  2XVS A;  1R9T B;  1YHQ A;  3SXH A;  2Q2I A;  3MEH A;  2EY6 A;  2B3G A;  1XNR Q;  4IPG A;  1S5D D;  2PO4 A;  1WCM B;  5IYD H;  5C3X A;  1GOZ A;  1JJ2 A;  3SEB A;  1XMQ Q;  3K58 A;  2Q8I B;  3VR4 A;  3OMC A;  3FHW A;  1XNQ Q;  3HOW H;  4A3C H;  4K2L A;  3SVM A;  1JWU D;  1HHV A;  2KCT A;  4EQN A;  3E0J A;  2YU9 B;  4DGZ A;  5M9O A;  2XGT A;  1XTC D;  2ZJP A;  1U0L A;  2OCE A;  1LLR D;  1A6X A;  1KDC A;  3K0X A;  4DR2 L;  1EWI A;  3MFG A;  3PIP A;  4A3B B;  3RZD B;  3HEJ A;  2K5D A;  2AHO B;  4RMF A;  4CDC C;  2B2W C;  2EYJ A;  1Q8I A;  4O1N A;  1XXG A;  1SNO A;  3S1Q B;  1X32 A;  1V9P A;  2UXD L;  1Y1W B;  3S1N H;  5KND A;  3LWU A;  4DAV A;  3OHX C;  1M8A A;  2B2U C;  2RDF A;  4DR6 L;  2M2L A;  1IW7 D;  4R4O A;  4K5X A;  4A75 A;  4R8N A;  1HH2 P;  4ABN A;  3CU7 A;  1M90 C;  5IYC G;  1Y8N B;  5C44 B;  5IGG A;  3PO2 B;  1Q82 C;  2EPB A;  2DGY A;  5DNF A;  1TVX A;  4HCS A;  5EKK A;  3SDZ A;  4L5T A;  5DEH A;  1U4M A;  1N33 Q;  1PTO B;  3SK5 A;  3K57 A;  4KJO A;  1JCK B;  3TZU A;  4F7X A;  3IAY A;  4DV4 Q;  1B1Z A;  2A6E D;  1EZ6 A;  2WII B;  2F0K A;  1I94 L;  3DWQ A;  4NDX A;  4C3I H;  2JA8 B;  3STB D;  3SE0 A;  1Z7T A;  2E2I H;  1AP0 A;  1R9T H;  1SYB A;  1TWH B;  1QNU A;  1J8I A;  3V96 A;  2MO0 A;  4GOP B;  4IFD H;  1NTG A;  4DV6 Q;  2N3S A;  2KEE A;  1WCM H;  3KK7 A;  5CV7 A;  2EYO A;  1X3G A;  3KBG A;  3PV0 A;  4TKO B;  2OWO A;  2Z6K A;  5D3I B;  1IBL Q;  2R93 H;  3F2D A;  1QZG A;  4JW0 A;  4A93 B;  1EFI D;  3BJU A;  3A5U A;  1MKH A;  2BH8 A;  2L11 A;  3SGI A;  3HKS A;  4HAE A;  5C3E G;  4U68 A;  2XWB B;  3OIQ A;  4M8A A;  3ULJ A;  3DMU A;  1FNV A;  3C1E A;  1G6P A;  2XN9 C;  3GTK B;  2RDG A;  2EYH A;  4C3H G;  1E1T A;  1HNZ L;  3RUZ A;  3ERQ A;  3C2P A;  1SE8 A;  1TT2 A;  2RF4 A;  2YU9 H;  2IY5 B;  1O7I A;  5CV5 A;  1JT8 A;  1Z47 A;  5IGB A;  4U67 3;  3PQI A;  2JA6 B;  1EYD A;  2MP1 A;  3QJY A;  2PPB C;  1FJG Q;  5JVG 3;  1SAP A;  1O7Y A;  4A3B H;  1XMQ L;  3RZD H;  1XPO A;  1DON A;  4YWL A;  1EQT A;  4NKL A;  4TVA B;  3PO3 B;  1XNQ L;  1PXU A;  2F0W A;  1IYV A;  3BVG A;  4CHT B;  4HSV A;  5M3F B;  5E4W C;  3A8K E;  1DOK A;  1Y1W H;  2PCF B;  1V43 A;  4JBJ A;  3A7L A;  2C9O A;  4DV3 Q;  1PHJ A;  3I56 A;  2PQA B;  1MSG A;  5HGT A;  3GTM H;  4H0L C;  3W1B A;  1D1K A;  4OO1 I;  1II3 A;  2D5D A;  3S15 B;  5GAH C;  5C0X H;  1W6K A;  1QZH A;  2VZA A;  3R3O A;  5C44 H;  5LMN W;  1D5M C;  3PO2 H;  3BYY B;  2B2T A;  4OIJ A;  1QVF A;  3KF8 B;  1EWH A;  1RTN A;  3X3N A;  1L1O A;  2Y0S G;  3NSW A;  5JEA J;  3PIO 3;  3Q22 A;  1TS2 A;  3A8I E;  1YJN A;  1STN A;  5FLX c;  1RIP A;  1PYB A;  1YNJ D;  4I65 A;  2ZM6 L;  1CA5 A;  1D5Z C;  3AEV A;  4YCU A;  2JXM B;  1V8Q A;  2PI2 E;  2JA8 H;  4HR7 B;  1EZ8 A;  2EY1 A;  1Q7Y C;  3K7U C;  1K0R A;  2VQF Q;  1UEB A;  1TWH H;  4ZK9 B;  4B3T L;  4DNR B;  4X62 Q;  1BBW A;  2R61 A;  2DY8 A;  3T1H Q;  1EIH A;  2HQE A;  3RN2 A;  3I70 A;  4UHV A;  3V2T A;  2WB1 G;  1N33 L;  4A93 H;  2BH2 A;  4QGU A;  4A3D B;  2JA5 B;  2K5V A;  3VA7 A;  2F1M A;  4RGN A;  2UU9 Q;  1TS4 A;  3W5O A;  4CDD C;  2B8G A;  3GTK H;  4OL7 A;  1YEZ A;  4RFB A;  2HIV A;  4G4K A;  1O78 A;  2K5H A;  2QDL A;  2EXZ A;  2EIF A;  2FMC A;  1IKM A;  3PF4 A;  5CV4 A;  3H0G B;  4LWC A;  2K5N A;  4H02 A;  1NCV A;  4DV6 L;  1FGU A;  5HY6 A;  2FHT A;  1K83 B;  1X3F A;  5C4H A;  1C4Q A;  3J80 i;  4AH6 A;  4JI1 Q;  1NR2 A;  1IBL L;  4PQX A;  3H3V H;  3HOU B;  5M5Y B;  4A3E B;  1NUC A;  1TII D;  5BN3 A;  2E2J B;  4JVZ A;  1OO9 B;  1I4Q A;  2EJF C;  2LSS A;  3NTH A;  4A3K B;  4LF8 Q;  3VYS A;  3PO3 H;  1HQM C;  3DEP A;  5IWA Q;  5JPN C;  1B9N A;  2NVX B;  5I9O A;  3HOW G;  5M3F H;  1KXL A;  2EYL A;  1DCZ A;  4A3C G;  2AQ2 B;  2A8V A;  3DM3 A;  3NTK A;  1P8L A;  2Z8L A;  4J1M A;  1JIC A;  4YIJ A;  3ZJY C;  3S15 H;  2I46 A;  3Q8D A;  4DKA C;  1MI2 A;  1T9H A;  1G8Z D;  3DM1 A;  5C5M A;  1FJG L;  3I4M G;  1G51 A;  4L6T B;  3J7A V;  4FNF A;  5LMN Q;  2IW3 A;  5H1S E;  4CJ0 B;  1PVO A;  5DM6 3;  3JAM L;  4IJL A;  4R4Q A;  3ND9 A;  2HQL A;  4N8X 1;  1F9P A;  3CPW A;  1EIY B;  1QOH A;  1TWG B;  3D0F A;  2KQ3 A;  3QOJ A;  3QR8 A;  1QCB D;  4DV3 L;  1CKM A;  1I4P A;  4DXF A;  3CCS A;  4XXE A;  2QW7 A;  1JB7 A;  3MAQ A;  2YTX A;  2E8G A;  4DR7 Q;  4C3J B;  1XMO Q;  1PMR A;  4DA2 A;  4DUZ Q;  1CHP D;  1XPR A;  1TWF H;  2BE5 D;  2LY7 A;  2NVY B;  4JI5 Q;  3CXC A;  1E1O A;  2JA5 H;  4A3D H;  3NWT A;  4B9W A;  5IT9 E;  4LFC Q;  3KDF B;  2PNH A;  3F1Z A;  3TRE A;  3ULP A;  1EY4 A;  4P71 A;  1D5X C;  2BCO A;  2H5X A;  2B63 G;  1STH A;  2F0U A;  1HUN A;  4C3I G;  2D2C C;  4LFA Q;  2VQF L;  3S16 H;  4P75 A;  4X62 L;  3H0G H;  4DK6 C;  3FKI B;  4KD3 A;  2O2L D;  1HR0 W;  2Z9H A;  3T1H L;  4IFD G;  4XQJ A;  1K83 H;  3MFY A;  1V1O A;  1M1K C;  1WCM G;  3HOU H;  5M5Y H;  4A3E H;  2E2J H;  1IBK Q;  1STY A;  5IP9 H;  4PZ6 A;  1VQ9 A;  2UU9 L;  3GTO H;  3K5O A;  1Q1E A;  4A3K H;  4JI7 L;  2JN4 A;  1I4X A;  3KUP A;  3B6Y A;  4GLX A;  3MZ5 A;  1HXY D;  2NVX H;  4GKJ Q;  5NUC A;  4LMQ D;  3PCO B;  2OF1 A;  2EYP A;  5CBE E;  1J5E Q;  4DV0 Q;  1CTM A;  2AUK A;  1SSO A;  3RD4 A;  3Q23 A;  2DJG C;  1WTW A;  2L9H A;  4ME3 A;  3D31 A;  4FO2 A;  4FF4 A;  1X3Q A;  3L9A X;  4LW1 A;  2CFM A;  4JI1 L;  1LAC A;  4GOP A;  2D9U A;  1W6J A;  1VQI A;  3LX0 A;  2DNC A;  4KMU C;  1JOR A;  4A3B G;  4LF4 Q;  2F0M A;  1Q1B A;  3OYY A;  1C8C A;  1MJC A;  3QB3 A;  1RD9 D;  1EYG A;  3E9H A;  1TWG H;  4A3G B;  5IGF A;  1Y1W G;  2CCZ A;  1CA6 A;  2K75 A;  4HJ8 A;  1GM5 A;  2FXQ A;  4C3J H;  4DK3 C;  2HD3 A;  4B9X A;  3SK8 A;  3CCL A;  5C0X G;  1P16 A;  2IHE A;  5C44 G;  3KLW A;  4PMC A;  1Y69 U;  4LAA A;  2NVY H;  3CW2 C;  2XSC A;  3M9B A;  5IY0 A;  3PO2 G;  5LMN L;  4P72 A;  3M4Q A;  2JA7 B;  1CM9 A;  1TS5 A;  3G6J B;  4I7Z C;  1OTC A;  4ODG A;  5IYB H;  5I4D A;  3HOY H;  2CKZ B;  3BS1 A;  4HMJ A;  2KVM A;  4KKS A;  2KHI A;  2L0C A;  4IUR A;  4TRD A;  4DR5 L;  1PZI D;  2N55 A;  2VB2 X;  1UE6 A;  4DR7 L;  1XMO L;  2F0O A;  3E5S A;  4DUZ L;  3FKI H;  1EYC A;  3NUC A;  4APV A;  3J81 L;  1DZ1 A;  4EVO A;  2PMZ B;  1ZKO A;  5I6Y A;  2F0L A;  1F9Q A;  4NXM Q;  1HR0 Q;  1CSP A;  1F2Y A;  1O7L A;  4JI5 L;  3EIV A;  2WAQ E;  4DR4 Q;  1E24 A;  4A93 G;  3ER0 A;  2MHV A;  3EA6 A;  1ZYR D;  3HOZ G;  3KF8 A;  2KHS A;  4KHV A;  1HZC A;  1LT6 D;  1EOV A;  3J81 c;  5COR A;  3VYT A;  4DR1 Q;  1U4P A;  4OGQ C;  4ZKB B;  5LHY 1;  2D0P A;  1K8G A;  4LFA L;  5C3W A;  1LYL A;  1KDA A;  1VF7 A;  1EFW A;  1PFN A;  4FF1 A;  5KYL A;  2QGQ A;  2JA6 G;  4ID6 A;  4RAU C;  4HTH A;  1GJX A;  4NMZ A;  3FPU B;  2I5H A;  3MXG A;  1IBK L;  2F0S A;  5ELE A;  2TMP A;  2WFW A;  1CI3 M;  3D3R A;  3PO3 G;  3MXN B;  2B2W A;  4X3U A;  2O5J C;  2C5C A;  5M3F G;  3CCV A;  4A3G H;  2QCP X;  2QF7 A;  4DV0 L;  1SE4 A;  4GNX C;  2GVB A;  3AU7 A;  1A3U A;  2IT1 A;  2B2U A;  2F0H A;  1STB A;  5JPM C;  4ZRZ A;  1GUG A;  1PRT D;  1TWA B;  2UUA L;  1J9O A;  1PYW D;  2K32 A;  4KD4 A;  5KNC A;  1V1P B;  4P74 A;  3CMA A;  2CQA A;  2JA7 H;  2P5Z X;  2A68 C;  3ITP A;  4IUP A;  1UNS A;  4XT3 B;  3S17 B;  3J7Y W;  4A3M B;  1PH1 A;  2IPK D;  4JG2 A;  1YIJ A; 
#chains in the Genus database with same CATH homology
 1B8A A;  1KC8 C;  1NTG A;  2JA6 H;  4DV6 Q;  1GKH A;  4X66 Q;  2N3S A;  4KI0 A;  1WCM H;  1OXV A;  3HKZ E;  3S2D H;  1X3G A;  3PV0 A;  2OWO A;  2Z6K A;  1IBL Q;  2R93 H;  4AYB E;  3F2D A;  1QZG A;  3HOV G;  4X64 L;  1VCI A;  2KEN A;  3BJU A;  3A5U A;  1MIU A;  2E2H H;  1V1Q A;  1MKH A;  2ZTC A;  2BH8 A;  3PIO A;  1U5K A;  3SGI A;  3HKS A;  1VQC A;  4IJH A;  5C3E G;  4LF7 L;  4DR3 Q;  3ULJ A;  1G6P A;  2Q2T A;  1TWC H;  1HZ9 A;  3HFZ B;  4JI2 Q;  1K9M C;  4DAM A;  2KHJ A;  4B3S Q;  3RLO A;  1E1T A;  1HNZ L;  4NXN Q;  1N32 L;  4B3M L;  2MNA A;  4GKK L;  3F2C A;  1SE8 A;  2RF4 A;  2JK8 A;  5IT9 c;  2YU9 H;  4A3D G;  2IY5 B;  1GD7 A;  1O7I A;  1JT8 A;  1EIF A;  1Z47 A;  4AQY Q;  3TS0 A;  5HGQ A;  2NVQ H;  1VQF A;  4HJA A;  2N78 A;  1L0W A;  3W1G A;  2NN6 I;  1H95 A;  2R92 H;  4GN5 A;  2CWP A;  4OX9 L;  1JE5 A;  5FJ8 H;  1IBM Q;  4DV7 L;  3K80 C;  1FJG Q;  4EX5 A;  2C35 B;  4IO9 A;  2JA8 G;  4BA2 I;  4LF5 L;  2RCN A;  1YHA A;  1NE3 A;  1YBY A;  4PZ8 A;  2CWA A;  1XMQ L;  3RZD H;  1SR3 A;  5LMU L;  3AYH B;  3M4P A;  3CME A;  1WI5 A;  1XPO A;  4JI3 Q;  3JC6 6;  2PQA A;  2GN5 A;  4YCW A;  3H0G G;  1X9N A;  4YWL A;  2UUB L;  4PZ7 A;  4TVA B;  1FVI A;  3WWV A;  1XNQ L;  1IZ6 A;  4NXM L;  1VQE A;  2WAQ G;  3ULL A;  4A3J G;  4DR4 L;  1VQA A;  3UDX A;  1Y1W H;  4B3R L;  1V43 A;  2F3I A;  4JBJ A;  4JCV E;  1L1O C;  4DV1 Q;  4DV3 Q;  1PHJ A;  4L5R C;  3HOU G;  3NEL A;  4LFC L;  4BA1 I;  4DR5 Q;  3I56 A;  4RG1 A;  4A3E G;  1XPU A;  4IFD I;  2PQA B;  5IP9 G;  4A3L H;  3HOV H;  4A76 A;  3GTM H;  3W1B A;  1GO3 E;  4YWM A;  4A3K G;  5DLQ E;  2ASB A;  4OO1 I;  2R7F A;  4JBK A;  5GAH C;  5C3E H;  2HIX A;  1QZH A;  4R1J A;  2VZA A;  3H3V I;  3RZO H;  5C44 H;  4FDB A;  5LMN W;  2F4V L;  3PO2 H;  1K3R A;  3UDG A;  3KF6 A;  1B70 B;  1QVF A;  4YY3 Q;  3KF8 B;  3AQQ A;  2F52 A;  5GQO A;  3T1Y L;  1L1O A;  2Y0S G;  4POG A;  5JEA J;  1PH7 A;  1PH5 A;  1Q8K A;  4IOA A;  4DAY B;  2MO1 A;  1VQ8 A;  2JEB I;  2BA1 A;  1YJN A;  4BY7 H;  5FLX c;  1OXT A;  4QL5 A;  3U58 A;  1AE3 A;  1RIP A;  1PYB A;  1QUQ A;  3KF6 B;  1TWA H;  4DPG A;  1AE2 A;  4UP8 A;  5GRO A;  3J81 i;  2ZM6 L;  3CF5 A;  4JOI C;  1N36 L;  2HT1 A;  4GN4 B;  3AEV A;  4YCU A;  1L1O B;  4LNQ A;  3TS2 A;  1KIX A;  4GOP B;  2K52 A;  1JMC A;  2PI2 E;  2JA8 H;  3EBE A;  3CCJ A;  4JV5 Q;  3S17 H;  4DR2 Q;  1Q7Y C;  3K7U C;  1K0R A;  4O0A A;  1UEB A;  1TWH H;  1UE7 A;  5BR8 L;  3KJP A;  2VQF Q;  4A3F G;  4A3M H;  4JI8 Q;  1Q81 C;  4B3T L;  4GKJ L;  4X62 Q;  1BBW A;  1CKN B;  3OTO Q;  3RN5 A;  4YWK A;  1N8R C;  1W3S A;  2AKW B;  1CUK A;  3GD7 A;  4X65 Q;  2ZJQ A;  4YHH Q;  3T1H Q;  1X56 A;  3KJO A;  3RN2 A;  1KL9 A;  4X6A H;  3NEM A;  4JOI A;  1J5E L;  1BKB A;  4KHP Q;  2WB1 G;  1N33 L;  4A93 H;  3F8T A;  2BH2 A;  4QGU A;  1E3P A;  2K5V A;  2UUC Q;  4BY1 G;  4YCV A;  2JA9 A;  2NZO A;  2UU9 Q;  4DV5 L;  1L2F A;  3GTJ H;  2JEA I;  3W5O A;  3S2H H;  4BBR H;  4A3I H;  3GTK H;  2UXC L;  1YEZ A;  2OQ0 A;  1NMF A;  1VQN A;  2HIV A;  2E5L L;  1HJP A;  4J15 A;  3U4Z A;  1VQ6 A;  2K5H A;  4LF6 Q;  1PH8 A;  2EIF A;  1VQK A;  4LF4 L;  4LF9 Q;  2I0Q A;  3U4V A;  2R7Z H;  1N34 L;  3PF4 A;  3DLL A;  4DUY L;  2ES2 A;  5C4X H;  4OON A;  2JQO A;  2K14 A;  4LWC A;  5AJ3 L;  2K5N A;  4H02 A;  1SN8 A;  4DV6 L;  4K0K L;  1FGU A;  4X66 L;  3HKZ G;  5HY6 A;  2JJQ A;  5JEA G;  5IYB G;  4BXX G;  2VY3 A;  1S72 A;  1YJW A;  3VDY A;  1X3F A;  3J80 i;  4AH6 A;  4GNX B;  1EQQ A;  4AYB G;  4JI1 Q;  2UUA Q;  3I4N G;  1IBL L;  4JI0 Q;  3H3V H;  3G4S A;  4PMW A;  2YTY A;  4TQU S;  1VQ4 A;  3J7Z C;  3RNU A;  1VQ5 A;  5IP7 G;  5GAE C;  3OW2 A;  2IX0 A;  2LSS A;  4JYA Q;  1C7Y A;  4LF8 Q;  5M3M H;  3PO3 H;  3PUV A;  2DUD A;  5IWA Q;  4LFB L;  5IYC H;  1WYD A;  4JI2 L;  1NY4 A;  4B3S L;  4NXN L;  1VS0 A;  1D8L A;  5M3F H;  3HOW G;  4A3B H;  1RL2 A;  1VQO A;  4A3C G;  1KXL A;  1CSQ A;  2A8V A;  2IHF A;  3DM3 A;  2I5M X;  4NB3 A;  5FLM H;  1P8L A;  2JA5 G;  3K81 C;  1I50 H;  2L15 A;  2Z0S A;  4GS3 A;  4JI4 Q;  4ALP A;  1VQM A;  3K8A A;  3KFU A;  1HNX Q;  2PI2 A;  4AQY L;  1PH6 A;  3AFP A;  1VQ7 A;  3A5Z B;  3ZJY C;  3PSI A;  1YNX A;  3S1M H;  3S15 H;  1C0A A;  3Q8D A;  4DKA C;  2VUM G;  4PG3 A;  1XNR L;  1C9O A;  1T9H A;  3RLF A;  2XTI A;  4QY7 A;  2ALY B;  3HOX G;  2VS1 A;  1IBM L;  2JE6 I;  1FJG L;  3I4M G;  1G51 A;  3G48 A;  2N8N A;  2YTV A;  1N32 Q;  1HNZ Q;  5LMN Q;  1X6O A;  5H1S E;  3I4O A;  3PUZ A;  4B3M Q;  3M7N A;  4GKK Q;  3J7A 5;  4JI3 L;  1YZ6 A;  1PVO A;  2NZH A;  1Q46 A;  4IJL A;  4R4Q A;  3FP9 A;  1X55 A;  2QA4 A;  1HR0 L;  2HQL A;  3CPW A;  1EIY B;  1FL0 A;  3D0F A;  3G71 A;  4DV3 L;  5GAD C;  1CKM A;  4KHZ A;  2VNU D;  4LF6 L;  3CCM A;  3GTG H;  1SRO A;  2OTL A;  4AIM A;  4LUO A;  3CCS A;  4MZ9 A;  1N9W A;  4XIG S;  1JB7 A;  3PF5 A;  1VQD A;  2E8G A;  2YTX A;  1IL2 A;  4DR7 Q;  1NMG A;  1XMO Q;  4DUZ Q;  3KDF A;  3L7Z C;  1XPR A;  1TWF H;  1I3Q H;  1QVC A;  3F2B A;  4DR1 L;  1K8A C;  3I2Z A;  4JBM A;  4C3H H;  1KAW A;  3M3Y H;  3CQZ H;  1DGS A;  4R4C A;  5M5W H;  1YJ9 A;  1PA6 A;  4LUZ A;  4JI5 Q;  3CXC A;  1E1O A;  1B7Y B;  2GVA A;  2NN6 G;  2JA5 H;  4A3D H;  4B3R Q;  3CPF A;  2K4K A;  1CKO A;  5M5X H;  4LFC Q;  3KDF B;  2PNH A;  2K50 A;  2ZJR A;  4QJF A;  1PFS A;  3F1Z A;  3AFQ A;  1S3O A;  3TRE A;  3ULP A;  1HZA A;  5C4J H;  2A1A A;  4P71 A;  3IRB A;  1GVP A;  1KHI A;  1LTL A;  2H5X A;  2B63 G;  3I4M H;  2UXB Q;  3RLN A;  2F4V Q;  2JA7 G;  1YIT A;  4IPD A;  1SFO H;  1PH3 A;  4JV5 L;  4A4I A;  4LFA Q;  2VQF L;  2Q2U A;  3TRZ A;  3T1Y Q;  4BBS G;  1QUQ B;  1AH9 A;  3I55 A;  2EXD A;  4JC0 A;  3S16 H;  1Y1V G;  4P75 A;  3H0G H;  4X62 L;  4DK6 C;  1EQR A;  3OTO L;  2KCM A;  1HR0 W;  3BU2 A;  4X65 L;  3UDI A;  3T1H L;  4IFD G;  1W2B A;  1K83 H;  3E0E A;  3PUX A;  1HNW Q;  3M85 A;  4A3J H;  2ZM6 Q;  1N36 Q;  1WCM G;  1M1K C;  2ZTD A;  1PH9 A;  4KHP L;  4L5Q A;  5C0X J;  4R4T A;  5ELO A;  4IPH A;  2YV5 A;  5M5Y H;  3HOU H;  4A3E H;  2UUC L;  2UXD Q;  5JJK A;  4OWT B;  2E2J H;  3ERS X;  5IP9 H;  4NPS A;  4PZ6 A;  1IBK Q;  1VQ9 A;  2UU9 L;  4JI6 L;  3GTO H;  4DR6 Q;  1UE5 A;  1Q1E A;  4A3K H;  2HHH Q;  4JI7 L;  2WP8 J;  4UP9 A;  2OTJ A;  4B3T Q;  3A0J A;  3NBH B;  3B6Y A;  4UP7 A;  4GLX A;  5ELN A;  4DV4 L;  3GTL H;  2NVX H;  4GKJ Q;  1UE1 A;  4GOP C;  3CCE A;  3PCO B;  2LXK A;  1YVC A;  1X65 A;  3H15 A;  2KBN A;  4HIK A;  3CAM A;  1XJV A;  4LF9 L;  1XTD A;  3G6E A;  1PH2 A;  1J5E Q;  3L2P A;  3TEH B;  4DV0 Q;  1Y14 B;  1I6H H;  4HJ5 A;  4GLV B;  3CC2 A;  1JJC B;  1OXU A;  1VQG A;  1UWV A;  2R92 G;  1YHB A;  4ME3 A;  3D31 A;  4DV2 Q;  1WFQ A;  3S24 A;  2VQE Q;  3HOY G;  3BZC A;  5FJ8 G;  1G29 1;  4QIW E;  1MJE A;  4LW1 A;  2B63 H;  2CFM A;  4JI1 L;  5IYD G;  2BA0 A;  4GOP A;  4JI0 L;  2UXC Q;  2E5L Q;  3CCU A;  1VQI A;  1I94 Q;  3CCR A;  1HZB A;  4A3B G;  4LF4 Q;  2VW9 A;  1Q1B A;  3FKI G;  4A3F H;  4DR3 L;  4JYA L;  3CP0 A;  3OYY A;  1MJC A;  4HIM A;  1N34 Q;  3E9I A;  4R4I A;  4POF A;  1A8V A;  2AWN A;  1VQH A;  4DUY Q;  1SLJ A;  1VQL A;  3MEF A;  4WJ3 M;  4OXP A;  4KLK A;  1EYG A;  5AJ3 Q;  3CD6 A;  2V1C C;  1TXY A;  1S40 A;  3E9H A;  1TWG H;  2CQO A;  4K0K Q;  1KRT A;  1ASZ A;  3RR5 A;  1HNW L;  1Y1W G;  1BBU A;  1QVG A;  2CCZ A;  3J81 j;  4JI4 L;  2K75 A;  1D7Q A;  5EAY A;  1HNX L;  2R7D A;  4HJ8 A;  1Z9F A;  1GM5 A;  4BY1 H;  4GLA C;  4A3L G;  4X64 Q;  1SMX A;  2RHS B;  4L5S A;  1WOC A;  2FXQ A;  4QQB X;  5GAG C;  4C3J H;  2A19 A;  4DK3 C;  5JJL A;  4LF7 Q;  1LM0 A;  3CCL A;  5C0X G;  1P16 A;  1E22 A;  1A0I A;  4HIO A;  2IHE A;  5C44 G;  4LFB Q;  3PUY A;  3KLW A;  3PO2 G;  2NVY H;  3CW2 C;  3GDE A;  3M9B A;  5IY0 A;  3NEN A;  3KOJ A;  4P73 A;  5LMN L;  4HID A;  2EQS A;  2ATW A;  4P72 A;  3M4Q A;  4IFD J;  1PH4 A;  2MFI A;  4JG2 A;  1NBW A;  4HJ9 A;  1OTC A;  2D62 A;  1YHQ A;  4Y7N H;  2Q2I A;  4UY8 C;  3S1R H;  4BY7 G;  4BXX H;  5IYB H;  2B3G A;  4OX9 Q;  1XNR Q;  4IPG A;  3PGZ A;  3GTP H;  4DV1 L;  2CKZ B;  4HJ7 A;  3HOY H;  3UE0 A;  2KHI A;  4GN3 B;  3K7A H;  4XTC S;  4DV7 Q;  4DR5 L;  3I4N H;  5IYD H;  2B29 A;  1J6Q A;  2ID0 A;  4LF5 Q;  2AWO A;  5IE8 A;  5IP7 H;  1JJ2 A;  4Y52 H;  1UE6 A;  4LUV A;  5LMU Q;  1XMQ Q;  4A3M G;  1XMO L;  4DR7 L;  2RHQ B;  3JAM c;  4DUZ L;  5JJI A;  3FKI H;  4UPA A;  1JJG A;  4APV A;  2OQK A;  2UUB Q;  1KD1 C;  1EUJ A;  3FHW A;  1KRS A;  3GTQ H;  1XNQ Q;  3HOW H;  3S1Q H;  4NXM Q;  4A3G G;  3U50 C;  4A3C H;  4YY3 L;  1HR0 Q;  3KYH C;  1CSP A;  4DNI A;  3STB C;  3UE1 A;  2KCT A;  4JI5 L;  3EIV A;  2WAQ E;  4DR4 Q;  1KQS A;  1E24 A;  4A93 G;  3ER0 A;  5J3B A;  4MNO A;  1OXS C;  3HOZ G;  2Q2H A;  3I7F A;  2ZTE A;  1I5F A;  2XGT A;  2R6G A;  1HZC A;  1LUZ A;  2YYZ A;  4OWW B;  4BBR G;  3JAM i;  4A3I G;  2VUM H;  2ZJP A;  1EOV A;  3J81 c;  1U0L A;  1E7Z A;  3HOX H;  1SRU A;  2OCE A;  4IPC A;  2QEX A;  4DR1 Q;  2UXB L;  3A74 A;  3K0X A;  2D0P A;  4DR2 L;  2N49 A;  1EWI A;  1K8G A;  4LFA L;  2R7Z G;  2VL6 A;  4JI8 L;  3PIP A;  1VQJ A;  1NJI C;  2Y0S E;  1LYL A;  3BZK A;  1EFW A;  2AHO B;  4RMF A;  5C4X G;  4YHH L;  2QGQ A;  2JA6 G;  3L0O A;  1OXX K;  3TQY A;  1WJJ A;  1CKN A;  4OO1 G;  2MQH A;  1ASY A;  1V9P A;  2UXD L;  1X3E A;  1Q86 C;  3S1N H;  2R93 G;  2I5H A;  3GO5 A;  2D0O A;  4WJ4 A;  3EN2 A;  3CC7 A;  1IBK L;  5K36 G;  4DR6 L;  1A63 A;  3PUW A;  2HHH L;  1VQB A;  2WFW A;  4R4O A;  5E7N A;  5BR8 Q;  4OWX B;  1K73 C;  4A75 A;  5M3M G;  3PO3 G;  1HH2 P;  3LGJ A;  3S14 H;  1M90 C;  3MXN B;  5IYC G;  1VQP A;  1YI2 A;  3ICE A;  5M3F G;  3CC4 A;  1Q82 C;  3CCV A;  4A3G H;  3M4O H;  2DGY A;  1X54 A;  5FLM G;  4L5T A;  1BVS A;  4EQ5 A;  4DV0 L;  4GNX C;  2GVB A;  1N33 Q;  2WB1 E;  2IT1 A;  1IYJ B;  4DV5 Q;  4O2D A;  3HOZ H;  4JI6 Q;  3UDF A;  4DV2 L;  4JI7 Q;  2VQE L;  1PV4 A;  2IX1 A;  4C2M H;  2UUA L;  3CCQ A;  4DV4 Q;  3J80 c;  2PMZ E;  4P74 A;  2Z6K C;  3CMA A;  1I94 L;  2JA7 H;  4C3I H;  1A62 A;  2LXJ A;  2I5L X;  3STB D;  5C0X I;  4JBW A;  4GNX A;  2AMC B;  2E2I H;  1R9T H;  4IOC A;  4LF8 L;  4BBS H;  5IWA L;  1PH1 A;  1IXR A;  1Y1V H;  4MTN A;  1Q12 A;  2NVT H;  2MO0 A;  1PYS B;  1YIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...