4AM0A

Structure of dengue virus strain 4 diii in complex with fab 2h12
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
211
Chain Sequence
DVQLVEPGAELVQPGASVKMSCKASGYTFSSYWINWEKQRPGKGLEWIGNIYPGSGTVNYDDKFKSKATLTIDTSSNTAYMQLSSLTSEDSAVYYCTRGGSHAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords FAB 2H12, HEAVY CHAIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
total genus 37
structure length 211
sequence length 217
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4am0A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4am0A02
4HS6A 3BZDA 2DQDH 4NRXA 2JCCB 1Q9WA 5D2LB 1BOGA 5BRZD 3SGJA 2V7HB 2HG5B 5EOTA 1A4KA 1ZEAL 4RNRA 2BNQB 2GSIA 2WQRA 4Q97A 1IM3A 1IAOB 3RNQB 3BQUB 1QFWH 4EDXA 5HPOA 4KVCL 5FB8A 1FN4A 4MX7A 5IBLD 1S5HB 1B4JL 1ZHKB 3RZCB 4Y4FA 1U6AL 4RZCB 2E27L 5LKNA 1KJVB 1ZT1B 2LU4A 1Z9MA 3SO3C 5CAYB 1QTYT 2OS7A 4ONFL 4OSUL 5L0QC 5GGUB 1I8MB 5E4EC 1DBMH 2BVEA 2QQNL 3LIZL 3EW3B 4P9HC 3WHXA 1O0VA 2QQLL 5LGJA 3D85B 1A7BA 2AEIT 2FGWL 4I2XE 4MCYA 5FUCC 2J8UA 4CN4A 5FKPB 3CFBA 3WFBH 3RIAK 1BD2A 5MEOA 5T1DL 3ZKMC 4P59H 4WTXA 2NXZB 3GB7A 3BPNC 5CEXA 5JZ7D 2R2EA 1RZKC 3GHBL 3O45A 4JFDD 1MIEH 3BHBA 1S7UA 2H9GA 3ECBA 5BW7A 4QXUH 3CFKB 3LS4H 5L6YL 1NBVL 5J4MA 3S5LA 1CDHA 2CJUL 1NANH 3UTTB 4ZO9A 3RJDA 3O3EB 4I9WD 2GJ6A 4OQ1A 1XGYH 3L95A 4LIQL 2QEJA 5F6IB 5ILTL 3LPGA 4LLAA 1D5ZB 1GGUA 1U58B 4NT6A 2FWOA 1RUAH 3BMWA 4ZPVA 3TESA 1ACZA 2PNDA 4NQCB 2GIYA 1GPOL 4YEEA 2KL6A 4HAGA 4JKKA 3TBSB 4N8CH 3VFPB 2J1KA 2R1XA 2DM4A 3CFCH 3TVMB 2X1PA 4O2CA 3HRZB 1BFVH 4PJBA 1Q0XH 1VADB 2CGRL 5C86A 4JFPB 4YIQB 5JORA 3QPQC 3M17B 3OPZL 4PUBL 3H9SE 4HXBH 1LP9F 4EJ1C 5HPMB 5FYJD 2EXWC 5A2KH 4HIIB 4I0PA 1INEH 1S9WA 1UG9A 4MDJB 1BGXH 3TJEL 2R29H 3QUZC 5TF1L 4JPWL 4S1QH 1UFUA 5E6IB 5FHBL 3P4NA 1ZT7B 5DUBB 3KNBB 3RGVD 1YJDH 5KSAB 1EO8L 1RZFL 3V4UH 2IANA 3SDXE 5HY9B 1HQRB 1OGAB 1AI1H 4X5XA 2A9NH 2FATL 3MZTA 2R1YA 4LVHC 5DJZA 2F58L 4YDJA 4F7EB 1UJ3A 4F7PB 3ULUE 3BP4A 2JB6A 3RHWF 1FGVL 1AH1A 4X6DA 5FUOH 2HFFA 1XR8B 1M05A 1WCQA 4OLEA 2YD6A 3STLA 4PRAA 5JW3H 1EHNA 1CICC 4WTZA 4ONHA 5KVDL 5LGHH 1KEGL 3UEZA 5C0AD 3HE7C 2EEAA 4N9GB 4QF1B 5DFVC 2YMXL 1U8IB 1W72B 1WICA 4MD4B 5C0FA 1X9QA 5JHDB 5ANMB 5DRNA 5HHXL 3OAYH 3EOAB 5AG8A 5D1ZC 5CD5D 1FIEA 2EYRB 2MFNA 1MJ8L 1R0AH 3TH3T 4NNPL 1F6LL 2BJMH 5TDPB 1XF5B 4LSSL 1BD2E 3VXTB 3REVB 1C8PA 1U92B 3V52H 2E6QA 4L3AA 4LRNH 3LS5H 3RZCA 2WZPD 3NFPA 3V6OC 3SE4C 3PDOB 2FHBA 4RAUA 2DN7A 1KJ3L 3DV4B 5H37H 1EFXB 1I3VA 1A0QH 5DJ6A 4L8SC 2F8VA 3DO7A 1S7TB 3P4OB 3MNWA 5JQ6H 4EQ2A 2ARJB 4AL8L 1JNJA 1HHHA 2YUVA 4S10A 3SCMB 3CVIL 2P24A 4X9FA 2FX9L 3L7FA 2FRGP 3PQYA 2PYED 3TN0C 5FDWA 4WWKC 3SQBA 4S1RL 3PNWB 4PRBB 2A2QT 3TC9A 3HZYA 1J87A 4MA1B 1N5AB 1AR1D 4DFIA 3MBEC 5I8OH 5GS2H 1H5BA 1A2YB 3U79A 3QDJD 3DXAA 4OLZL 4ISVB 3RKPA 5I1IH 3BUTA 1KGCD 3TNMA 5KSUB 2I5YL 4NKMA 4U1HB 3PL6B 4BUGA 1QNZL 5IBTL 1CE1L 4PYHA 4NGHH 1QZ1A 1F00I 2OJEB 1B0RB 3RVTC 3E2HB 5CIPA 4JM4L 5HD8D 3C5ZA 43C9A 3IAQA 3N1FC 3PGDB 3T2NH 4Q9RH 3KXFB 1J11A 3NAAL 5C08E 1I9IH 1J7VR 3VXNA 2R2HA 2EE9A 1VFMA 2D7TH 1KCRH 3JWDH 2EEBA 1OCWL 5D93C 4Z7OF 3HNVL 1LO0H 2V5MA 1A6AB 4KRPB 1JIBA 3SPVB 3P77A 2VLRB 3OV6A 3AS2A 1V7ML 1CD8A 3S35L 4X6DE 3V8CA 3GBML 3NTCL 5BS0A 1NAML 5CBEB 4FTVE 3UPAA 3VA6A 4RWYH 1RK1B 5DQDL 4ZOEA 4XPAH 4GAFB 5FOJA 3NN8A 1MLCA 4ZMAT 1F8TH 4IRJC 5D72L 3PP3H 3WXVH 4LSVH 4ZNEA 3HPLB 4LSRL 5FGRA 4U6YB 3W0WB 5GRWA 5E9DD 4OZHF 3VFNA 1AD0A 2XN9B 4Q9BA 1FNLA 2NTFB 1YUHA 2NY4C 3EYFB 2RIKA 5HHOD 1Y6NR 4UT9L 5DURB 4F7TA 3OKNA 4XNMB 5HYQA 5T33L 3GMQB 4X9GA 2PYFA 4EUPG 3IRZA 1IGTB 4AM0B 4O5LL 1MFDL 1BJ1H 2V9QA 3HZKB 1TCMA 3OJDA 4KRNA 1J1XL 1KYOJ 4PPTA 5DUPH 1BIHA 4WHDA 5INCB 4LOUC 1IM9D 4H0IA 5IQ7H 3DX8B 4K8RD 3WIHH 1I9RH 3A0OA 2B1AH 4OF6A 1FO0H 4X5WB 1IVLA 1B2WL 3B9KC 4OZHB 1F58H 1UXWB 1P1ZA 3O11B 4JO3L 4P46C 1MFBL 1YYML 1M71B 1XGRA 5F3HB 3PGCB 3JVGC 4BSJA 4HKZA 2HKHH 4ZFOB 4YEFA 5D7KD 3GSVA 5TDPA 4PGEA 4BH8A 2FR4A 3RI5K 3UTOA 1OW0C 4EN3C 1DQLH 3C60A 1T1YB 5E6YA 5L8KB 2NY0B 5I76A 3T3MF 1WEJL 1J88A 3ALWA 5D8JH 3T2OA 4FQJL 1HZHH 1U42A 4HPYH 5EU3B 3GSRA 3SKNA 3WEXA 3B3IB 2WMPA 3D48R 4JAMA 4XCFH 3DV4A 3OAYK 2EDRA 1MCWW 1MH5B 2ICWJ 4I18A 1ZTXL 3T0BA 4CNIB 4UBDD 3EFFA 4MJIA 3MXWL 1WFNA 4X7SL 2VLKD 2ZCHH 4ODVL 4QY8B 1I1RA 3JV6B 1Q38A 1IEBB 3DUHA 5JDSA 3ULVF 2J5LC 2A73A 4F9PC 4NJAH 3BKCH 2A6KB 3Q0HA 4KI5C 2RQ8A 1U8PA 2HJLB 4H88L 5IW6A 3QEHB 4XVUC 4I3SH 4JDZA 3L1OL 2XY1A 4ZXBB 2BY1A 2BOCA 2VE6A 3TO2A 5DS8B 4PJCE 4DAGL 1OSPL 3GM0A 1KBGL 3CVHL 4LLDA 4PJ5D 4UNTA 1NLDH 3K1KC 3GSNH 2IJ0C 4XP1H 5E95B 5BS0E 1EBPA 4A2LA 3D0VA 1YEEH 3GJFA 5CD3A 1KB5H 3U7AA 3ETBF 3CZJA 1RJYB 1AQDA 5LBSL 3WS6A 1AHWA 1HWHB 3LN4B 4C56A 5CEYB 3VRLE 1WT5C 3V9FA 3WNPA 5JMOC 4M1DL 5ID0B 1NL0H 4XB7A 2KQMA 4OKVB 1RPQA 4Y5YB 3RUGE 5BMFL 3B43A 4J8RB 4O02L 4U1JA 1Q94A 5IFAL 2BHZA 1P84J 2GYSA 4EBQL 1JWSB 3F62A 3CFJA 2CO7B 4Y4HD 1DLHB 3QDMB 2V7NA 3MJ8B 3QJHB 2HP4A 3BAEH 1J0YA 2Z8RA 1G7HA 1T0NA 3P30L 5GS0L 2AJVL 4UU9A 2OZ4L 5IF0B 3G04B 3ULUH 1FIGH 5E8EA 3UBXB 3RA7H 4X8XA 2ESVD 4QXGL 4M93C 2R2BB 4P2RB 4CW1A 1MNUH 4ODUA 1CG9B 4OLUL 2VDRH 1Q9OA 1S78D 2I25N 3ZHLA 1T21B 2B20A 2D7MA 1LK2B 4FFVC 2ZNWA 1LMKA 3PP3K 5I18L 5CZXD 4M8QA 4M7KH 1MF2H 2F74A 1WITA 3E6HB 4BQ6A 4N8VG 2H3NA 3T0DA 4DUXA 3F65A 1YNKH 4NBZB 5D7SL 2EXYC 3TBVB 4N0CC 1A6VL 3DV6B 4PR5A 5IFJA 2C7UB 2OCFD 2DBJA 1U8OB 3LVEA 4E42A 2EDKA 3DGGA 4M61A 1I8KB 1I85C 2VXVL 3BDYL 4HWEL 3V6BR 3KLHC 4FQXB 3FO0L 1QLFA 3U9UB 1MHCB 5DRXB 1NCDL 2YEZB 4TUKH 1ZWIA 4JEGB 4G43B 1VFBB 4K3EL 2D7PA 1AD9B 1KLGA 1LD9B 5ISZB 1FG2B 4FQQA 3WO3B 1P4IL 4QRRA 5MEPA 2BERA 2VL5A 4PJGF 1T2JA 2AJXL 1AO7B 1U8JB 4KGLA 3QYCA 1HHJA 4S1SL 5H8DA 1XF3B 3TBWA 4Z76B 2XRAL 1K8IB 1MELA 2YPKB 2H6PA 1WBZA 1XGTB 1W0YT 2VLME 5LCVL 1B90A 4C56E 2R4RH 4OZ4B 5SWZD 1FL5A 4F80A 2JB5L 3MLRH 4OD2B 2DQJL 1FFQA 3RIFF 3QHZH 3EYOB 4P4KC 2BMKA 3PWVB 4MNHA 4PJGB 4HQQH 4LHUD 1KF9B 2XKUA 5IMKB 5HYSA 4Z95L 5GGSB 2EDNA 4EI5C 3GMMB 4S2SA 2NNAA 5EU6D 5IIEB 3ARDC 2AGJL 3DX6A 1X5HA 3VXPB 1AKJB 4I0KA 2C4XA 3LB6C 4EKXA 1MI5E 4RGNC 4KUCD 5C09B 2BXZA 2E3VA 3Q3GB 4HPOL 1HWGB 3ZKMD 5CUSH 2XZCL 4HS3A 3VXUD 2IEPA 4NQEE 3Q5TA 1CLZL 3ZT6A 3VFUB 3O6FB 4C55A 1CI5A 3QH3B 4HUXA 3TO4A 5D1XB 4KVCH 3RWDA 3C8KB 3SHSA 5L9DL 3MV7B 4EXKA 5KANI 4UDUB 3LQZA 3WE6A 1B4JH 1QSEA 1YJDC 4H8WL 1EIBA 4J8RA 4LCCC 1U6AH 3DX9A 2HJFB 1QEWB 5C0JA 1D5BA 4UIMA 2E27H 3WYRA 1M7IA 1KXQE 5D2NE 1HOCA 4LCWB 4ONFH 3LV3B 4OSUH 4NCDA 1MFNA 2W1NA 4V1DA 4P2OC 3VDAA 4OCMC 2QQNH 3D25A 1EO5A 4LP5A 3LIZH 2QQLH 1JPFA 1VEOA 4Q6IB 2FGWH 3H42L 1MCFA 4G8IB 1EVTC 5ENWB 3CSBA 5T1DH 1F90L 5I6XB 3QPQD 5L2KA 2NX5B 4DVRL 4P2QE 3LQAL 1ZT4B 4TUJA 1U41A 4Q9QL 3GHBH 2BNRA 2EXWD 4JY6B 4X7TA 2F15A 5L6YH 1NBVH 1CGUA 3QUZD 1D3CA 2CJUH 5IMLB 2XZQL 4JZNB 3ZE2F 1CK0L 3T65B 1QRND 5GGTA 4LIQH 3R06B 5IMOA 2IPKA 5ILTH 3VXSA 1HK6A 3ARPA 2C3VA 4X8JA 5A3IC 4BKLA 1SYSA 5TE4L 3SDYL 5HGDB 4OUUB 2VQ1B 4TTGA 2XNAB 3BJ91 5HGAB 1QR1B 1S9XB 2PXYC 2XY2A 1BLNA 1GPOH 2ITDA 1KUMA 1G7LB 2XTJC 3FO9A 1E4WL 2HVJA 4K3GA 5D6DA 4KJPC 2CGRH 1NFIA 3OPZH 4PUBH 1CICD 1A3QA 5DGQA 1NC4B 3G08B 1CDGA 3TJEH 3HE7D 4CJ0A 1BZ7B 5DFVD 2OSLA 5TF1H 4CAGA 4FXKA 4CGTA 3GFUA 4JPWH 5FHBH 4P5TC 4XVSL 3TPKA 2Y5TB 3BGFB 3CSPA 4GMSL 4U6TA 1BMGA 3JV5A 3QEQB 1FZOA 1T80A 1EO8H 1KG0B 1RZFH 2GI7A 2OL3A 2X44D 4PJ7A 4WUUA 3S4SA 1OT2A 3PABB 5D1ZD 2GITA 4NZUL 4Z78A 1I4FB 1YNTA 2F53D 4O9HL 2FATH 5GSVB 4NQSA 1JPSL 2F58H 5HVWA 4POUB 4AEIL 4JZJA 4TSAL 2R0WL 4NO0A 3VG0L 3GDBA 1K3ZA 1AE6L 1BQSA 2CLZB 4OTXH 4QTIL 2D0FA 4HV8A 5GJSH 3BPLC 3Q6FA 3U6RA 2AEPL 5KVDH 1KEGH 4HCRL 3KPMB 4XNQB 1KNOA 4HGWA 4RCAA 4EXPX 4LMQI 4TNVK 3UTSA 4RGMC 1YZZA 2YMXH 4MDIA 4XBGB 2EDHA 2IH1A 5EBGA 3HMXA 4KQ3L 1C12A 4Y89A 4PJDA 4XNZC 1LNUA 4GRWH 4LDLB 3TN0D 4WWKD 5HHXH 4NKQB 2V9TA 3D69B 3QUKA 4DKAA 4L9LA 2RCSL 3EKCA 1MJ8H 2XXCB 4R26L 5MENB 3SKOA 1NMAL 4PTTA 1KT2B 4NNPH 1ZSDB 3MBED 4HWBA 3X13A 1DZBA 3PHOB 1EAPB 4LSSH 2BVYA 3HI1B 1K9TA 2KDGA 1EH9A 2X4UB 4PY7A 1HH6A 3UZEA 1IAII 4ETQA 4KMLB 4LCYB 4U49A 3T0EB 2QR0B 4JVPA 1KJ3H 4P3WA 5FGCB 2I9TB 1G7PB 2A6DA 3QNXB 2ADJB 3RIAF 4CMHB 3RVTD 2NR6C 3OSKA 4AL8H 1DUZA 1JPTL 2GJZB 2NCMA 3CVIH 3IDNA 4FQ2L 2FX9H 2GTZA 4WI8A 5EZJA 1FYHB 4S1RH 3D2UB 1XZ0B 5HDOA 4OLWL 1QBMH 2NXYC 5DK2B 2Z4QB 4XI5C 5T1KA 3LKNA 4L4VB 1H0DA 4YC2C 4L8CA 1QOKA 3HAEB 4OLZH 3FB6B 1A02N 5A43C 2CLVB 2C3GA 4G42A 1FVEA 5IVXF 2I5YH 1QNZH 5IBTH 4DGVL 1CE1H 5I0DA 3MREB 4WI3A 4Z7WF 1EHXA 4OFVA 2B39A 4R7NA 3CLFL 3IFPA 3QQ4A 2VO5A 2P5EE 3ARQA 4W70A 3D18B 2A74A 1U91B 4IRJD 5T3ZD 3LY6A 4JQXA 4JM4H 4XCNB 5DYOB 4LK4A 3KPQB 1WBYA 5CWSB 1NCTA 1MWAB 2NY4D 2BDNL 3GI9L 4HFWB 3NAAH 1I1FB 4HZAA 4WU7A 5C92A 4K94C 4FQ1L 4GRMB 3G6AB 1VERA 4NNYA 3IKCB 1OCWH 5DZLA 2JJSC 3MLTA 5F1NB 5IVXB 3SDDA 3VWJA 3HNVH 4JCMA 3BMVA 3D87B 3SO5A 4NUGL 2WP3O 1NKRA 4P5KA 4G7YL 4Z7WB 4LBEB 3U2SA 3NFSL 2C4FT 1V7MH 5T1LA 4LOUD 3U36B 3GBMH 3EJJX 3CCHB 4PJEF 3OHXB 3NTCH 1NAMH 4HBCH 4WEBL 3NABL 3P9WB 3TT1L 2WUBL 2GAZA 3FB8A 3ALXA 3C6LB 3B9KD 3QULA 5B38G 2Y5TA 3FQWB 5DQDH 5IB1A 1IC7L 3IJHA 4P46D 2ZSVA 3MBXL 5D72H 4M3KB 4IRSA 2WANA 4LSRH 2QTEA 3CPLA 1E0OB 1UWEH 3MNVB 2VISA 1U3YA 4PJDE 3PWJB 1LO5A 3H7BB 2EDDA 3KDMA 3R0MA 1CT8A 1OAXL 5T33H 4UT9H 2GSGA 4EOWL 4ORZC 1OGTA 2V2WB 5EOCJ 4EN3D 2F54E 4O5LH 4PY8J 3VWKC 1MFDH 3JZ7A 3PWLB 1XMWA 1J1XH 2PTUA 5IMMA 5KZCB 4M5YL 4NQDD 2BY3A 1NDMB 4WW2A 5E56A 5T1MA 4HIEB 5KVEL 2HN7A 3TA3A 4MD0B 3L3HA 5FYKL 3EO0A 3UAJC 4IIQB 3J7HA 3KPNB 3W39A 1T0PB 3SDAB 3UTPD 5HHPB 2FSEB 5JLZA 1B2WH 2VB5A 4R7DA 4MVBC 2BC4B 4MQ7B 2D9CA 4XMPL 4PJ8B 5CJQL 4M7ZB 3LSOB 2CUIA 2OR9H 1MFBH 1YYMH 1V3JA 3FB7B 3ABZA 4GKSA 4FMKA 1P5VA 4KI5D 1F6FB 5FA4B 1AXTH 3DRQA 1T1WA 4JFED 3MV8E 3T77B 1QSVA 4XVUD 4JM2C 5F6HJ 4QHNA 4JVUA 2P4AB 1KLUB 4PG9A 4FQJH 1OB1B 1G6RB 5J1TC 2F5BL 4B7LA 3S5LG 4XT1C 4NRZB 4DZBB 4I13B 5TDOA 3SGJC 5EU7E 2JIXB 4ZUSA 4D9LL 4UZGA 1ZTXH 2HMIC 5IW1B 1TCRA 3MXWH 3TBYA 4X7SH 5ACZB 4ODVH 5J7CC 5BRZB 2DWDB 2X4SA 4FXGA 4OJFL 4XCEB 5D5MA 5LGKA 5ETUB 2FYYB 4Y4FC 3TNNB 1ZE3C 2Z4QA 2VOTA 3W9DA 4LCIL 1CXLA 5HGBB 2HH0L 2D31A 5I75C 1FZJB 4YBLB 4LF3A 1X4YA 3MLPA 4DQOL 4KDWA 4BSVB 2VLJD 3L1OH 4UIKL 2GY7B 4XWGL 3LDBC 3TH4T 4JKWA 1DN0B 5D7IA 5DC9B 1JWUA 1OSPH 2V2XA 1JF1A 1KBGH 3CVHH 3OKMA 3PV6B 5ESVB 4L1DA 1RV6X 3OKKA 3EUUA 3QIBA 1Z3GH 5F1IA 2YA0A 3RWEB 3S37X 43CAB 1C7SA 4R0LB 4KJYA 1C5BL 5BW7C 3VMPA 2HT3C 5LBSH 3OR7A 1FL3A 5DWUL 3BGMA 1XGQA 5H35B 2ED7A 4PD4J 2BSRA 4M8VA 1ZOXA 3VG9B 5F7DB 3SGEI 4M1DH 4IOFC 1CD1B 1TPXB 1YQ2A 2DYPD 4JFDB 5DRWA 4FFVD 2CR3A 5BMFH 3IDGB 4NM4L 4O02H 4WTZG 5GGVL 3WDHA 4PV9B 1MLBA 3CCHA 4TULL 4MA8L 3S7GA 3OHXA 4EBQH 4LLVA 2Y1VA 1MAML 4CKVX 4N68A 2Y06L 2EXYD 2EH7L 3TCXA 5AYQA 4NP4L 1L9MA 3PHSA 3BP5A 1FGNL 4GUPA 2NLJA 2BVUA 5GS0H 3AMLA 2AJVH 2OZ4H 4J6RL 3MFFA 5SV4A 2RBLA 3KLAB 1UKQA 4I0PC 4HUWA 1ZHBA 3QIUA 3QNZB 3KLHD 1GJIA 1A6ZA 3VD4A 1RFDL 2VAAB 1KJMA 4OLUH 5EU4A 3N1GC 4QCIB 1L9NA 5IP4A 2DBLL 1P53A 4XP9L 3I6GB 1UVQB 2EYSB 5I18H 3L5WB 2WINB 3IFOB 1UQSB 2DQIL 4GG6F 3DARA 4OGAC 1AFVL 4TQEL 3LKOB 3D39D 4QKXB 1UJ3C 3MA7B 2PW1B 1RZIB 1GGTA 3RGVB 1PKQE 5D7SH 3QZWA 4NN6B 3GM8A 1A6VH 1KCLA 2BRQA 2DKMA 3RI5F 3UP1A 3W82A 1LO3L 3BI9X 3MRBB 5FOBB 5DQJB 1B9ZA 4XMKL 4J3TA 3PWUB 1J10A 1W2KT 2LVCA 3DIFB 4HIXL 1CDUA 2UY6A 4XBEL 1S7RB 2YXFA 2VXVH 5D5ME 5EFIB 1MCHA 3BDYH 3BSZL 4GSDL 4HWEH 1BEYL 5SX5H 3FO0H 4HMEA 1L0XA 4GG6B 3CIQA 4HH9B 3B8SA 1JTTA 1NCDH 1Q8MA 1J05A 2ATPA 3UZQA 4JG1L 2WUCL 4K3EH 4WGWB 1A6UL 1RURL 5C0AB 4NRZA 4EI5D 1M6OB 1TVDA 1I9JL 3IVKB 3ARDD 5JPMB 1P4IH 3HNTL 4L4TD 5I1GL 5D7IE 3LB6D 2AJXH 3JTSA 4FP8L 4RGND 1DVFC 1K6QL 3UJIL 3JWOL 5HHME 2DWDA 4S1SH 2X09A 1NMCC 1NCBL 3OBAA 1QSFE 1J1PL 2XRAH 4ZUUA 3O6KL 2XWTB 25C8L 3MC0A 5C0BD 3MCKA 1EJOL 5LCVH 3L3DB 2JB5H 4HUKB 3SDCA 1DQQA 2DQJH 3MYJA 3BP7B 5DHYB 3MRNB 3KPTA 2IALA 3L5XL 4FFYL 1P9MA 2I07A 1GSMA 4Z95H 4M03A 5K9OB 4LSTL 3JSSA 3DUUA 1BREA 4R90H 1KV3A 4YDLC 3VE0B 4Y8DC 1QBLL 1MCIA 2ZP0T 4OFYD 5IM7B 5ICYA 2ZNXA 3FO1B 4P2OD 2AGJH 2CSPA 5FYKE 3T09A 2AQ1A 4EI6A 5IB4A 3T1FA 1H5BC 4NRYB 3VGHA 2BVOA 1WZMA 1N0XL 2PYEB 4G8GD 1PZ5B 4U1MB 3AU1A 4Q2ZB 4HPOH 2AV7A 3FRPG 4OCXL 5TDNA 3O3AA 2XZCH 1QFWI 1VFAA 2EKJA 2H8PB 1CLZH 3BKYL 4PGCA 2EIZB 5CBAA 3VGBA 2BOBA 3GIZL 3QDJB 2HLFC 3QQNA 5L9DH 2YPLA 4NQTA 4LLUB 3C5ZC 4H8WH 2OK0L 2J8OA 3ZTNL 3WLWC 4CADA 5F9JA 2CIIB 5F1SA 3QNYB 2NY6B 3H2WA 5A3ID 2BVPA 4CRPA 2PUQT 3HZMA 4PJFA 4RX4D 5F93C 5J56B 2PXYD 3U0WL 4H1LA 1H15A 5EBLB 5DI8B 1FBIL 2XTJD 2NZIA 3FTGA 4KROB 3KJ4B 3H42H 4D9QE 5T5NG 3JTTB 1EK3A 3EIFA 1F90H 2HWZL 4DVRH 1LEGA 4MNGE 5CP3H 3LQAH 5JIHA 1W72L 5T3XE 4Q9QH 1S5IL 1NANI 3TFKC 3VFOB 2XZQH 4JFYA 1I3UA 4P5TD 1CK0H 4LLMB 1TNNA 3LKOA 2EKSB 3BIAX 1FFNB 3LN9A 2VZ3A 5TE4H 5ICZA 1EZVY 3IDJA 4Z7NE 5I71B 3SDYH 2X4TB 3SQOL 2VRAA 2CR6A 5DRZB 4EZMA 1YYLL 1F3JB 1T7WA 3O6ML 4PGBA 1MUJA 1EEZB 4TNWK 5E9DB 1URLA 5HJ3B 5CS7A 1E4WH 1AC6A 4A6YB 1HIMH 4XNYL 5HHOB 2AXHA 5B3NA 4UMGA 4ZDHA 5EFIA 4HUVA 2H41A 2JE8A 3CFEA 3QEUB 1IZKA 1KJ2A 4U6HA 1CFBA 1HDMA 2EH8L 2QKIA 2IAMA 1NSNL 2B0SL 2W0KA 3PHQA 4KH2A 1VEMA 2AXGA 2K7PA 3HCVB 1OL0A 2YWZA 1IM9B 4RIRA 4NCC2 1IGIL 1N6QL 2XFXA 4XVSH 4GMSH 3BEWB 1U8QB 5IFHH 3HPJA 5J11B 3QA3B 3KR3L 2Y7QB 5SX5K 5GRXG 3C60C 5C6WH 4NZUH 3CGTA 1S7SB 2VLLB 4QLRA 2NW3B 3T4AA 2YD5A 1JPSH 4AEIH 2DLIA 4TSAH 2R0WH 3VG0H 2P1YA 1S7VB 4MMXC 3MCG1 2WWKT 4QOKD 1AE6H 4I18C 3HS0B 4QTIH 1TTGA 2FB4L 1EEQA 1S7WB 5B39B 3BZ4B 1HHKA 3IDIB 1MFCL 2AEPH 5ICXB 1P4LB 5L7XL 4HCRH 5HDBE 4Z0XA 2DRUA 2ERJC 3FOMB 4FQIL 3OKEA 3WJJA 5I9QC 2NR6D 3VXRA 2Q7YB 1GC1L 2A83B 4IHOB 1MCQA 2JCCE 4KQ3H 4X7CC 5FK9B 3I9GL 3ZDXE 3CAFA 3LKRA 1J9CT 1I75A 2BNQE 2VLKB 1R24B 5EA0L 4XHJC 1CS6A 1EGJL 3TYGL 2NXYD 2RCSH 2VZVA 4X99B 4XI5D 4R26H 4JQIL 1NMAH 3MZGB 3O6LL 1B6UA 3BP6A 5C07A 4QRTA 4HDIB 1X7QB 4F7CA 1QLRA 4JRYD 5JPNB 4PFEA 5FV1L 3HLAA 4AIZA 2P7TB 2B5IB 1UACL 3OGCA 1JI1A 3WS6C 1AHWC 1IGYB 5FV2A 4U0RC 4PJ5B 4JY5L 4OZGA 3FAWA 2D03L 4U1GC 1Y18A 1E6JL 1NEZB 4M4PA 4KDVA 4D8PA 3ROLA 5FECB 1JPTH 1JK8B 3GSWB 3LKQA 3I3BA 4FQ2H 3U7YH 4GW1A 3T8XA 3L3GB 1FLTX 1FZKB 4L3CB 1INQB 3VGGA 2E6JA 5IV2B 4LSPL 3NH7L 4OLWH 3FT3B 2CIKA 4MLIA 4M02A 4Y1AD 4L5FL 1JYWA 3SJVA 3SKJL 3CC5A 3NCFB 5AUMB 1A7PL 1N2RA 3CMGA 4G8EA 4F15B 1VGEL 4HUMB 4R3SB 5J6GA 5J9PB 2Z92B 3UTTE 2IADB 1YEDB 3BUYA 5DR5H 2XQYK 3G5XB 3MRKA 4MA7L 1CLCA 5AAMA 1FC2D 4DGVH 3UTQA 1OP9A 2OTWB 4PV8A 4Y4HB 4AEFA 1PG7W 2LTQC 2ATKA 4ZFZA 2ZUTA 1DN2A 4ZFOL 1ORSA 4HZLA 2FJFA 4FQPA 3S88L 4LLQB 3G5VB 1F3JA 4ZAKA 3MJ7A 4NQXA 1I7TA 3GI9H 2BDNH 1OAUL 4FQ1H 3E0GA 4OLYL 2ESVB 4JVWA 3VGEA 1ZV5A 1Z5LA 2B4CL 4OGYH 3QEUA 3VWKD 3WUWA 2AV1B 4NUGH 4G7YH 1J0ZA 3NFSH 4P4RA 1I1YA 4BELD 3UAJD 3V0AC 3N1QC 4M48L 3VRJB 3S3SA 4WEBH 3NABH 1WFOA 3TT1H 2WUBH 1DBAL 4PJIA 5HYSG 5E1AB 3H9SD 4MVBD 2Q76B 4JFZL 3QA3A 1NC2A 1ZA6A 1IC7H 4K7PY 3MBXH 3RL2A 3VXRE 4O58L 1LP9E 4H5SA 3TM6A 2DMCA 4HKJA 1YECL 1FDLL 1YN6A 2NW3A 4TSBL 2XWJB 1OAXH 3QISA 1T5XB 3FAXA 4EOWH 1ND0B 4P3DA 2VDNL 1RZ8A 4U1NA 1U8LB 4JM2D 1G7IA 4WCYL 3RNKA 3ULVL 2OX5A 5KAQG 1D5MA 4M5YH 3CZFA 2VN7A 5ICXA 5KVEH 1DANT 2OMBA 4NO3B 3QUYB 1A7NL 5FYKH 3B9VA 4GQPH 4NC2B 4DUWA 5JHDE 4X9IA 3ARGA 3O2DL 2HMID 2RFXB 5F88B 1R3JB 4C54A 2MTPA 4XMPH 5CJQH 4U6XB 3O41A 4OZGE 3NIDF 1T1XB 5EH1A 5EIIB 4Y4FD 3AREA 3IETB 1N3NA 2D4DA 3SE3A 4BSWB 5SWZB 1X7QA 3STZB 4KUCF 2EIBA 3GMRA 5I1CL 1TTFA 4JB9L 5DDHA 4K7FB 5FYLL 2XG5A 2F5BH 2GKIA 4LHUB 4NKOA 3LD8C 3C2AL 3SKMB 2OM5A 2MQ3A 3SO3B 2NY7L 1BD2D 1JWMB 5EU6B 5GSRB 4D9LH 5L0QB 5D6CB 5E4EB 2WW8A 4NNXB 4DZ8A 4F37K 3V4VL 5LXGL 3WLBA 2QLVB 1NBYA 2HT3D 3LKSA 2FO4A 4XNUL 3TO4C 4OJFH 4U1LA 4KJWC 4F2MB 1FVCB 2GJ6D 3OX8A 1RUPL 4IOFD 3BPNB 1BAFL 2AP2A 2Y07L 4LCIH 2HH0H 5DJCA 1PG7X 5DJ2A 4JREC 1U8NB 2G5RA 4MSWB 2V5YA 5INDA 4DQOH 3DGCR 2FZ3A 3MRQA 5K9QG 3H3PL 3QIWA 2H32B 1QR4A 1G9EA 1FNFA 1OSZA 4X4XA 1T03L 4KDTA 4UIKH 4Z7VF 1KTLA 4MXWL 3KYNA 4R4FL 4JO4L 4XWGH 5IEKA 2OTWA 3I75B 3QUXA 3FN3A 4X0KA 3PUCA 5DJXA 3KXFE 4PJIE 2MCPL 1NBZB 1RZGB 5E70A 4OZIF 1HXMA 1C5BH 4I0PD 5JUEL 5DWUH 5BXFB 5HI5C 3DVFA 3MGOB 3OF6A 4DTGL 2VLRE 3CNKA 1G9NC 4D0DB 2KBGA 1YDPA 1ZLUH 1NGXA 4JPIA 2IAND 3N1PC 4NM4H 1CXIA 5EZLA 2YHGA 5GGVH 3QUZB 4OGAD 4TULH 4MA8H 2OQJA 1KN2L 4OZIB 2E8YA 1QRNB 2X7LA 4JN1L 1MAMH 4YHIA 2Y06H 4JFXB 2CDEA 2EH7H 5D6DC 4NP4H 4Z7OE 5DHXB 5DJYA 1FGNH 4HK0B 4PRHA 2X1WL 2Z93B 2HT2C 2XN9E 3L3KA 4XC1L 4HKBA 4J6RH 2Q86A 1KULA 4LVHB 2W65B 4JO1L 5I8EA 2CKBA 1W8OA 3T4YB 1RFDH 2LE9A 1B6DA 5ADPL 3Q1SL 3V5DA 1CICB 2YD8A 4IEFB 3S37L 5GS1A 3DROA 2DBLH 2FL5A 4LLWB 4XP9H 5T5FL 2QQQA 4L29A 4OQTL 3MCLL 3MPCA 3HE7B 3MGTB 2DQIH 1ETZB 4GG8B 4OZHE 4Z7UF 4BFEA 2FGZA 1AFVH 4QNPF 1BECA 4TQEH 5D96C 5JO5A 4V2BA 4GLRH 1IQDB 5F7EL 4JZJC 3ULSA 3GMLB 3OG4B 2R69H 1LO3H 1EO7A 4J23A 5CINL 5D1ZB 4XMKH 3C9NB 3RZCD 2G5BA 4WRLA 2F53B 2G9HB 5K9KA 2GK0B 1NGWA 4HIXH 4XBEH 4GRWF 3GSQA 1CXFA 3WNNA 4KRMB 3B9DA 3RAJL 2J4WL 4BSWA 2NW2A 2BRRL 3BSZH 4NZRL 4GSDH 1BEYH 5IG7B 3ARFA 4Z7UB 4P57A 3OKLA 4JG1H 1FYTA 2WUCH 3PQYD 1A6UH 4KGJA 1RURH 1FNSL 4NYLB 4L8SB 1I9JH 4G7VL 4L9LC 4J1UA 3HNTH 5I1GH 5F7MC 2HJKA 3RP1A 2P45B 2LAAA 3DXAD 2FBJL 4BFIA 4FP8H 3LQAC 2X9YA 1K6QH 3TN0B 3JWOH 3T3ME 4WWKB 3RPIA 2MOVA 3FFDB 3UJIH 4AK1A 4PLKC 1FJ1B 1NCBH 5IBUB 4NKDA 1LDSA 2PW2A 1J1PH 3O6KH 25C8H 5EU5A 2DLHA 2Y4SA 1ZLSL 4NWUL 1EJOH 3MBEB 4PRIA 4AENB 2HLFD 3OXSB 4F33B 1J1OL 2VXUL 3ZDYF 3C5ZD 4NUJB 1T7YA 3KPPA 3WLWD 1FE8L 5DEZA 4L1HA 3L5XH 4FFYH 3FQTB 4ZUVA 1DQJA 3V0VB 2FH8A 3U30C 3K4ZA 1JTOA 3DTXB 4LSTH 3BZFB 3ULVE 1QBLH 5HHNB 1V7NL 1WWWX 5ITBL 1AXIB 2W60A 3LRHA 3U4BL 1YN7B 2UWEF 4YX2L 2UY7A 2BCKA 3RTQA 5KSVB 4LEOA 2DJ4A 1VKXA 3TH2T 1N0XH 2GCYB 5I66B 4GKZA 4R4BB 1JGVL 1F97A 1IAMA 4PRHE 1CFQA 5BS0D 4E0RB 4OCXH 3WXWL 5EC1B 4QRUA 5D93B 3BKYH 1CGTA 5A2IH 3NIGF 3GIZH 3VH8A 2G2RB 5AYUL 3RBGA 3K7UA 3TFKD 1G7QA 4JQXC 2OK0H 1LE9A 2UWEB 3K8MA 3ZTNH 1ZHNB 3TPUB 2YSSA 4WI6A 5FYLE 3ZYJA 1L6ZA 7FABL 3QG6A 5J6HB 1R3LA 4IRJB 1XF2B 1BBJA 2C1OB 3SDDC 3VWJC 4GFTB 1CDCA 4MD5A 3D9AL 3U0WH 1I1CA 1FBIH 2SEBA 3U83A 1ZLUK 4P2RE 1ZHLA 1UA6H 1NPUA 2NY4B 5EG6C 5MERB 5ID1B 1BFTA 2HWZH 2ICWB 3BYTA 1BQHG 4D0BB 5C6PB 1W72H 2KH2B 3TBTB 5I1JL 1S5IH 2E5EA 3D0LA 5TE7L 4WHCA 1A1MA 4WO4A 4RISL 4TTDC 4IRSC 1WAAA 3LEYL 3OR6A 4PYGA 5CLWA 4RFEB 1AGEA 2LABA 1FNGA 3VXOB 3B9AA 3AXLB 1MCNA 2ZPKL 3NA4A 4Y19A 3B9KB 1T2QL 2VSCA 1MCJA 2DQFB 4OZFA 5CZVL 3B4NA 3L9RB 4P46B 1BVZA 3SQOH 1BIIA 4M9OA 3C60D 3AB0C 1YYLH 3G9VA 1DR9A 3O6MH 5CJOL 2YA1A 1F11A 4WW2C 4ZFFB 1MAKA 2RB8A 4XNYH 5EZOL 4YHPA 3TA3C 1GCFA 1KIUA 1G1CA 4U1KB 5E5MB 2VL4A 4EN3B 5FA3B 3QWRA 4XGZB 2EH8H 4MJID 4KI5F 1NSNH 2B0SH 1KIRB 1G9ML 4NQDB 1IQWL 4APQA 4HWZA 4QHLA 4FRWA 3HC0A 3ALPA 1PQZB 1WFTA 3V2AR 1H3VA 3RRQA 1IGIH 1OT1A 1F42A 1N6QH 1MVUA 5TPWL 1AO7E 4EUPB 4FOMA 1VACA 1MCWM 5SWQA 4X6BA 5HGHB 3KR3H 1TQCC 5E2TH 1R5WA 4XHJD 1KIQA 1FL6B 2XZAL 3GRWL 1HKFA 4PRPA 2ZZUT 2ZOLA 2J5LB 3QT2A 3ZDZF 1FNEB 1CFSB 1ZGLB 4JFEB 1X5JA 3O2VL 1C08B 4XZUB 4JANB 3G6DL 4RAHA 1FNAA 3EYVB 4PJGE 3MLSL 1NFDF 4HIHB 2FB4H 1Z0MA 1N5YL 1MFCH 2NY5L 1NUNB 1I3RB 5L7XH 3X14B 5I1LB 4NO5A 2VLMD 3EZ8A 1DQDL 1MWAL 2XIDA 4MA3A 4WTWA 4C56D 4C57C 2D2OA 4FQIH 4OV6F 3PWPA 4E41A 4GXVL 4POZC 2Z35A 4XXDA 4ZNCD 1GC1H 3P73A 4Z9KB 1RZJL 3I9GH 1WTLA 3B6SA 3PJSB 5BV7C 2OP4L 2NMSA 3B2VL 1A6TA 4FQHB 5EA0H 3U0PB 2LQRA 2I9LA 3TYGH 3LN5B 1NFDB 5DHVA 4JQIH 5HTSA 5HHQA 3O6LH 4HGMA 4PJHA 4XBPB 4ELMA 1AJ7L 3RWIB 1YMHB 2WIIA 3VI3F 3QIBC 1N4XL 1AGBA 5EO1B 5C8JA 3OZ9L 1DUYA 2VLJB 3W5MA 4WW1A 5LAXA 1UACH 4KPHL 4LCWE 1JYVA 4J12A 2WAHA 1CIDA 5ELIA 1BHGA 1RHHB 3IDMA 1HSBB 1QFOA 3GIVA 4JY5H 1WAAE 2D03H 1MCEA 1E6JH 3V5HB 2DQHH 4YK4C 3OB8A 5BVJB 1GZPB 3MRRB 1IEHA 3MRGB 2DF3A 4QYOA 2DMKA 3RWFA 3BVNA 4W81A 4WIQA 1TVHB 2GT9A 1L6XA 5KS9F 2CKNA 4EVNB 4LSPH 3NH7H 4M93B 1YNLL 4L5FH 3SKJH 2HLAB 2Z91A 1IJ9A 2DYPB 1A7PH 4M5ZL 4D0BA 1YEJL 4Z8FL 1VGEH 1K5NA 2XXMB 1CBVL 4WI9A 3HUJA 1HH9B 3JUZA 3MTRA 2ZUUA 4ZUWB 4MA7H 1HHIB 4N0YL 4KK9C 2Y36L 1CLOL 4JR9L 1GL4B 2X89A 3ILQC 5KS9B 3QIUC 5DD5L 4WHTB 5JXAL 2A6JA 1V3LA 1JZ3A 1E28B 3LMJL 3S88H 1UWXH 4RMUA 2IQAA 1WTGT 1R3KB 4LPVA 3ZZ1A 2BHUA 3QDGB 1G6RL 1OAUH 2PO6A 1JL8A 1ONQB 4OLYH 1S8DB 4LGRB 3ZE2E 3FZUC 2B4CH 3RHWK 1HILB 4U1KA 3RWGA 4QRRD 4ZUTA 2WBJA 3GNML 3NZ8B 5EBMB 1HE7A 3RWCB 3VFSA 5EIVA 2H45A 5C2BL 7CGTA 3UX9B 5MI0C 1CR9L 3K8KA 4ZTPL 5JOFB 5M95B 4E9LA 5FXCH 4WU5B 2YR3A 4M48H 3MRIA 3W5NA 3JBG7 1XCTA 4MNQA 5JIKA 1KPUB 1UJTA 2FEDC 3GGWA 1DBAH 4N90E 8CGTA 2ITCB 2OTUA 4E5XA 3QEQE 1G7JA 3D39B 5FIEA 4JFZH 1E27B 3N1MC 4N5UA 1AXSA 1L0QA 5LWYL 3ILPA 5DGRA 4O58H 1F2QA 3BDXA 1QVOB 4GAGH 5IR1B 2CPCA 4HS8L 1YECH 1FDLH 1N59A 1FAIL 2E7BA 3K3QA 4WHYH 4GBXA 1A9EB 4G9DA 5FGSA 3MRHB 1PX3A 2VDNH 1ZGLP 3HE6A 5DMJB 4KUZL 4JANA 3BZEA 3TIDA 4WCYH 4P4KB 3ULVH 4PJHE 4DVBA 4DW2L 3TIEA 1JNNL 4XWOC 4MHHG 5LQBL 5K93A 1A7NH 1T0MB 2JK5A 4DN4L 4EI5B 4N0UA 5EC2A 4PJXF 1A22B 3ARDB 2ARJQ 3MLYL 4L4TB 2AVGA 3R0NA 2ILLA 4G6KL 4UUJB 1CF8L 3TO4D 3SDCC 3L3OB 32C2B 3CFIC 4HKXA 4RGNB 5DQ9A 1ZLVK 3E8UL 3BJLA 1QSED 1P2CA 4KJWD 5JW5A 4NO2B 4KMQA 3W9EB 3VFRB 2E9BA 3F7YA 4QGYA 1A64A 3GMPA 4LKXA 2A6IB 5GRVL 1P9MC 3DMMA 5C0BB 1XH3A 5F3BB 2VR4A 5ERWA 4LPTA 4BUHA 5I1CH 4V1DD 2G60L 3T0EE 4JB9H 1W0WA 5I2IB 4LCCB 5IB3B 1JV5B 1U0QA 5FYLH 2DWEA 5FGCE 1LEKA 3C2AH 3PXJA 5F72S 5JIIA 4WNQB 2ZUSA 4R97C 2NY7H 4QHUB 4QHMB 3HUJE 5TGBA 1UB5B 1RUKL 3S3PA 3NPSC 4P0DA 4P2OB 5L2KD 4YGVB 3I50L 5DSCB 3V4VH 4PLOB 2E7CA 3MJ9L 5LXGH 1A4JB 3RVWC 2BNRD 4DCQB 1FVDB 1W0VA 4XNUH 3D6GA 5DD6B 4G8GB 3L7EB 5HI5D 5F7HA 1F3DJ 5FYJL 4PTUA 4U1IB 4LSQL 1S7XB 3GK8L 1RUPH 4QRPA 1BAFH 2MSPA 4P2CG 2Y07H 1VENA 4LNRA 3VXSD 5KVGL 4G8FB 4I48B 3FRUB 3MLZL 1PY4A 3QUMB 3H3PH 1CQYA 3VDCA 1B88A 1NGYA 1MCDA 2O5XL 3IF1B 1T03H 3L6FA 2NTSP 2YRPA 3DSFL 3H0TB 4MXWH 5EUOF 4R4FH 4JO4H 4MWFB 3P2TA 1HHGB 2LVEA 4JDTL 4O2EA 3L5JA 3QQ3B 2PCPB 1J18A 3VRIB 3ROOB 3ZT7A 3ESVF 2ADIB 3PIQB 5FKAA 5L88L 2YC1B 4PB0L 2MCPH 1UADC 3IFNL 6FABL 2HT2D 2JJTA 2PXYB 2E9JA 4JFOA 1S9KC 2XTJB 4LKCA 5JUEH 4NIKB 5ITFA 3G9AB 3QDGA 4DTGH 3RQ3A 4Z7WE 3VGFA 4NHUB 4Z5RA 3V8OA 1JGUL 5AD0B 2D3VA 1BVKA 2N1KA 3RWCA 3RVUC 1D6EA 5IJVA 4TUOA 1RVFL 2AXFA 4WUUD 1XR9A 1JGEB 3UPRA 3IGAA 1YEHL 1GZQA 1RIHL 4WJ5B 1UWXK 3JWOC 1KN2H 5EN2A 2LU3A 3ARBA 4P5TB 4DGYL 1CGSL 4JN1H 1KIPA 3AFLA 1B0GB 1PG7L 4PJAA 4NO0D 5E8DL 4ZS6C 3DVGB 4N0UE 2ENSA 3BWAB 5I1AB 1CVSC 2X2YA 4XC1H 2VABA 4MMZC 1VB9A 2IAMC 4OLXL 5F9DC 3MUGB 4NBXB 3LKPA 3CX2A 2Y6SC 4PJEE 3G5YA 3UTSD 3FFCA 4N8VA 1TZIB 3LEVL 4JO1H 5CJ8A 5DJDB 4BJLA 1A9BA 4N1CA 3HG1A 3FQUA 3H3KA 3SOBH 1WQVT 5ADPH 3O3BA 1DL7L 1XIWA 3WS3B 3Q1SH 4IOIB 3BPLB 4P4KA 1WWAX 1MJ7L 3S37H 4K9EC 1YC8A 1D5IL 4OQTH 1FZMA 1MCOL 5K59F 3DURB 3MCLH 5C0IA 2A0LC 4RGMB 4KRLB 5F89B 3AMKA 4LVOC 1ZVSA 5DEGA 3TCLB 2CLRB 5EO0A 3D1MC 4ZO6A 2BSTA 4JPKL 5F7EH 1HNFA 4F8QA 2EDFA 3CXHJ 4XNZB 1OD9A 2X4RA 4G80B 2YXMA 4PLKD 5CINH 2HT4C 5ABDE 4QRSB 5B22A 3MA9H 3VXQA 1ZA3B 5GIRB 1RJZA 3MNZB 4K23L 5CP7A 3K0WA 2AW2A 2KZ1B 3RAJH 2J4WH 2BRRH 4NZRH 4LAQL 1RIVL 3WJJC 1NFKA 4QOKB 2VZOA 4QRPE 4OV5B 3Q48A 2ICEA 1KB9J 3MRJA 1J8HA 4GKOA 1T20A 5F1OB 1FNSH 1QP1A 3C5SA 4G7VH 2UZXB 4OZFH 5T1KD 3JV4A 5TE6L 4U2YA 1A4JA 4KTYA 2FBJH 1FC1A 4D0CA 4F3FB 5CMAA 1MCBA 3J8F7 1ED3A 1TQBC 2NXYB 2BVQA 4AEHL 3C8HA 4KZEL 3VFWA 8FABA 3SN6N 4M3JA 3CFDB 5K9QI 4HUNB 2XOTA 1ZLSH 4NWUH 4OLVL 4YC2B 2XKNB 5I1HL 2NY6C 3ARWA 4P5MB 5B8CA 1O7SA 3BIKA 1YC7A 1J1OH 4JRYB 2VXUH 1OTUC 5BJTA 3WFEL 1FE8H 1XCQB 4C4KT 4RBPH 5DF0A 1U8MA 2AJ3A 1V7NH 4A6YL 5ITBH 5H2BB 1G0YR 1T04B 1BX2B 3U4BH 4YX2H 5H94B 5C0CA 3SDDD 3VWJD 5JQHC 1CFNA 3WIFB 1P7QB 4NQVB 1NCCL 4GMTL 3REWA 5T1LD 1NMBL 4RFOL 2GTWB 2BSSB 4A2MA 4HWUA 3P4MB 1JGVH 1QSZA 4Y1AB 3WXWH 3MX0A 1EHAA 4JFDE 4K8RL 3OAZH 4LSUL 1Z9OA 1T4KB 2YD7A 1CDYA 3L3IA 5JNYA 1D5XA 3FFCE 2O61B 4XCYA 4YAQA 3Q6GL 1H3PL 4U1SA 5AYUH 4I9WE 4TTDD 4IRSD 1RMFL 3VFGH 3VFVA 4XNXL 1JUFB 3CDGA 3DI3B 2N56A 1IL1A 4ZAKC 5F71A 3FHAA 5ECJE 5I1DB 1MHHA 2YBRA 3C09C 4HIJA 1GGBL 4YFLI 7FABH 1NEUA 3DBXB 5BQ7B 3BEVB 5C1MB 3D9AH 2KQNA 3MOBL 5I74C 1U3HA 2OBGA 3MV9A 1F6AB 3TA3D 4YHYC 3QRGL 4UV4H 3P9MB 3R1GL 2R9HC 5CHNA 4OCLC 5FCUL 3RX5A 2P47B 2W92A 1A1OA 4LU5L 3VWKB 1AGDB 1YMMA 3DO3A 4JFQA 5I1JH 5DJ8A 5TE7H 4Z77B 4RMQA 5J89A 3DUSA 4RISH 1N64L 4L8DA 4NZTL 3HFML 3LEYH 1QKZL 3IJYB 2HVKA 4JM2F 3SE9L 2FHFA 2ZPKH 4HSQA 2NPLX 2ORBL 3H9SB 4RAVA 1T2QH 1J8HE 3QWOB 3FMGL 1T22B 3QEGL 4ODWA 5CZVH 1CGXA 4QTHB 1HCVA 2V5RA 1YPZA 3A6OA 2F19L 3TYFB 1SMAA 4TVPD 5LVEA 4I8DA 2EYTA 2YRLA 2W0FB 3BH9A 3CDFA 3CUPA 5EZOH 1EAJA 5KVMC 1Q0YH 4YLQT 1T1ZB 2X4NA 4XPGH 4OIAA 2FJHA 3ARGC 4JM2B 3RIFK 4HS6B 5C0AE 4NRXB 3QO1A 3NIFF 1IQWH 2P49B 1Q9WB 1BOGB 1UZ8A 4JG0L 4JFFA 5EOTB 1A4KB 4RNRB 4UILL 4X98A 2GSIB 4POZD 1IM3B 5TPWH 3AREC 1E4KA 1IAKA 3SE3C 1R6VA 4FZ8L 1UH2A 2J8UF 4AQ1B 4EDXB 5KN5A 4UTBL 5FB8B 1FN4B 4MX7B 3HAEH 2CK2A 5C0CE 2XZAH 3GRWH 4Y4FB 3MROA 2W9LA 1ZANL 5HVHC 3BRDA 5D9SA 5KANG 5I75B 3WIHA 4WHYG 3O2VH 5E5RB 1EDQA 1FO0A 1XT5A 4OFKA 3QIBD 3G6DH 3MLSH 4MQXC 3BIBX 1CFVL 3V79C 1N5YH 2ENYA 2IGFL 3WHXB 3FCTA 2NY5H 5HGGS 5LGJB 3LDBB 5F8QC 4MCYB 1DQDH 1MWAH 2J3SA 2J8UB 3TP4A 4KZDL 1BD2B 5MEOB 2OMNA 4GXVH 3ARSA 3GB7B 1RZJH 4AG4H 5CEXB 5E2VL 2R2EB 4JKMA 1TVBA 1P7QA 2OP4H 3O45B 2J6EL 3BHBB 1S7UB 2H9GB 3B2VH 3ECBB 2LFGA 3S5LB 3QIWC 4PJBF 4CMMA 4KDTC 2GJ6B 4PRNA 4ZO8A 4RBPK 3L95B 3VXMA 4ZO7A 3QUXC 1AJ7H 1KGCE 2QHRL 4I2XA 4NT6B 2FWOB 5L2JA 1N4XH 4ZPVB 1HKLL 3OZ9H 5IB2A 3LPWA 4KK9D 4KPHH 5HDLA 3BH8A 4CDGC 2R1XB 3ILQD 2Z31A 1RK0A 1S3KL 3QIUD 4GKNA 4ERSL 2OLDA 2UZYB 3WD5L 5FCSH 4O2CB 4PJBB 1PEWA 3S96A 3ISWA 5JORB 4YHML 3OAZK 3B9EA 4JJ5A 5A40E 1A47A 4M43H 4YHLH 3KLSA 4YNYA 1FLRH 4JO2L 4I0PB 1S9WB 4X9HA 1YPZE 1A3LL 4X6DF 3O4LA 3FZUD 1YNLH 3GBNL 3T2QA 2DL9A 3CX5J 3GSOA 1WCBA 3P4NB 1IGFH 4M5ZH 3GSNA 1YEJH 4Z8FH 1NKOA 4CU6A 1YQVH 3KPSA 1QD0A 1IEAA 4D9QD 1CBVH 4ZD3L 2IANB 1KB5A 1BOYA 5SWSA 4X5XB 4N0YH 2FEDD 2Y36H 4ZYKA 1CLOH 2R1YB 3Q5YA 4JHAL 5DJZB 5T3XD 4M6ML 4JR9H 4YDJB 1UJ3B 3NMEA 2FDBP 3NFNA 5DD5H 5D2LF 5F7YC 3DVNA 3BP4B 2JB6B 4X6DB 2HFFB 5JXAH 1V8HA 1M05B 5BZWA 3STLB 4PRAB 3P9LA 5HHOE 4ONHB 1CE6A 5GS1C 3VI4F 4WV1A 3CSYA 1BZ9A 4JDVA 1G6RH 1QYGL 1I7RA 1LK3L 4R4NC 3O3DA 5B38A 1V5JA 1NDGA 5DLML 2ZSWA 5D1QA 3SDXA 3GNMH 5C2BH 5C0FB 1CR9H 1ZVHA 2VXQL 4XWOD 4ZTPH 4P9HL 4O51A 3E6FA 3FO2A 4PJ9A 5DRNB 3CH8A 4HT1L 2P42B 3CMOH 5EBWA 2QSQA 1QACA 4CVXA 1MJUL 5LWYH 3SDCD 1RZKL 3ARFC 1DVFB 3ZKQD 4M9PA 1NMCB 4HS8H 2RHEA 5I0ZA 5D7KE 1RY7B 3NFPB 5FDYA 1FAIH 2W59A 2CDFA 5JOPD 1WUNT 4PS4L 4RAUB 2W38A 1DTUA 5EDXA 5DJ6B 3QXUA 3DO7B 3BD5A 3MNWB 4KUZH 3NGBC 1EMTL 2DQUL 2QSTA 1SYVB 2D7QA 1AIFA 1HHHB 3C6SA 3VCLA 2P24B 3QCTL 3VH8G 1JN6B 3VXME 3L7FB 1JNNH 2JELL 3PQYB 5LQBH 5FDWB 4YDLB 4DN4H 3ZLQC 3QPXH 2AKRA 1FFPA 3CU7A 3HZYB 2AK1L 4ESKA 4DJMA 5IKCA 2OI9C 3MLYH 3QHFL 3RVWD 4PGZA 3CH1A 4G6KH 1H5BB 1CF8H 3DXAB 5GRJH 2YPLD 3E8UH 3TNMB 2VXTL 2YUZA 4NKMB 4DGIL 5IVZA 3D3VA 5DJAA 2BY2A 1L7TL 4LFHD 5GRZA 3O4LE 4N5EC 3EYQC 5CIPB 2G60H 3KGRA 3C5ZB 43C9B 3RTQC 2R39A 1HCFX 2YD9A 3VJ6A 1HXYA 3KPSE 1BPVA 2CMRL 3GKWL 1R3HA 4YO0A 3VXNB 3L3JA 5KG9A 2R2HB 5EULV 5DVNA 1RUKH 1T83A 1JE6A 5SWSE 3ME0A 1JI2A 5DVMA 4OZFG 3I50H 1QO3A 4UQ2A 3MJ9H 3P77B 2ZG3A 1A7RL 2ED8A 5FYJH 3BPOC 2QQKL 4LSQH 1JZ8A 4BFGA 5BS0B 3GK8H 4UQ3A 2YZ8A 3A6BL 4MQTB 4XRCA 5IESH 3RVUD 5KVGH 3IS0X 4NKIL 3MLZH 3EO1A 1SY6L 3NN8B 1MLCB 5C08A 3QCVL 2FECL 2O5XH 4WI7A 3RDTA 3NACL 3DSFH 5FEBA 3THML 3BWUC 3DYPA 3VFNB 1AD0B 1L7IL 3I3DA 1YUHB 4JDTH 4F7TB 3OKNB 5HYQB 4ZS6D 1SQ2N 2X4QA 2PYFB 5L88H 4NJ9L 4PB0H 3IFNH 1DBBL 2XACC 4ZOBA 3U4EA 4D2NA 4JGJA 3OJDB 2IAMD 4FTVA 4BM7A 1KCKA 3GMOA 1TZHA 1UGNA 3F58L 2Y6SD 4WO4C 4PRDA 2EC9U 2JKXA 4GAYA 3RWJA 3SGKA 1B4RA 5JXEA 1JGUH 5TQ2L 1P1ZB 1RVFH 5HXMA 2R8SL 1EXUA 1VCAA 4NC1C 2A0LD 1MHEA 4W68A 2QSVA 1XGRB 1YEHH 1RIHH 5E4IA 4Y2DA 1EEUA 4HKZB 4DGYH 1CGSH 4JGMA 1Q9KA 1PG7H 35C8L 1IILE 4PGEB 3GSVB 5E8DH 2ADGA 4BH8B 2FR4B 5D7JB 2MKLC 3GUTA 5CFHA 4Z7VA 1DVFA 3C60B 2HT4D 5I76B 3RZWA 1AP2A 4XH2A 4OLXH 2VITA 3GSRB 4NN7C 3O4OC 3SKNB 5DXWA 3WEXB 4APQC 3KS0H 1NUFA 3QI9A 4JAMB 3LEVH 3CXDL 5IB5A 3VXRD 1AGCA 4QWWC 4I18B 3UJTL 3LAFA 4MHHI 1SYVA 1DL7H 3D3VE 3EFFB 4MJIB 5D7LA 1MJ7H 3I84A 5AEAA 1JN6A 2VDOL 3D5OF 4LLYA 5CEZD 1D5IH 1MCOH 3U46A 1XAUA 4OF3A 2ERJB 1I1AA 2MMXA 5JDSB 3U0TA 5I9QB 2A73B 4GLRI 3W11C 2QSCL 2VDPL 3KPOA 4H25A 4JPKH 5C07D 4NN5C 1U8PB 1J0KA 3EDKA 5IW6B 2DM7A 3O9WA 3GSUA 1EJ6A 3PDGA 4JDZB 3ZSTA 5ESQB 1U9KA 1ROWA 2BOCB 2VE6B 3TO2B 4HF5L 5SWZE 1BFSA 4K23H 2PTTA 4G3YL 1QHPA 3DLQR 1TTUA 5EO9A 1HSAA 2EDJA 2D9QB 2PTVA 4LLDB 2NY6D 4LAQH 1RIVH 1WZLA 4L8BA 1EZVX 1OTUD 3SY0A 3D0VB 4KK6C 5E8PA 3GJFB 3ZKXC 4QT5A 5T3ZL 2MCG1 5CD3B 3DHJA 5EU6E 2E9IA 1X5YA 2AI0L 1AQDB 4KROD 1ZVYA 1AHWB 4C56B 4U0RB 4HJGB 4AT6A 4U1GB 3SJVD 1C5DA 4NM8L 3VD3A 1F45A 3MRLA 4KK5C 5GRVK 3MACL 5FUCE 5TE6H 2IBZY 2QADC 4WFHE 2WWKO 1K2DA 4PJCA 5J1AA 3VFMA 4U1JB 3RJQB 3VXUE 1Q94B 4AEHH 3HAEG 4KZEH 4GOSA 1MY5A 3SE8L 2CK0L 3CFJB 1TFHA 1X3DA 4OLVH 3UROR 1JP5A 2V7NB 1D9KA 4ALAL 3OAUL 3X3FL 5I1HH 1KTDA 1EVUA 4KVNL 3A6CL 4UOW0 1G7HB 1KOAA 1T0NB 3B83A 3WFEH 5GRUL 3BKJL 4P23A 4UU9B 3H8NA 3ZE0E 4ZAKD 5A2JH 2FO1A 3FRPA 1PBYA 5E8EB 2IF7A 2LTQB 4A6YH 1F3RB 4KAQL 4M7JL 3RUGA 4LASL 4CVZA 1T66C 3KPRA 4CW1B 4ODUB 1Q9OB 5CJ5A 5ESAA 3GI8L 1NCCH 4GMTH 4X7EC 1NMBH 2X9XA 4RFOH 4Z7VE 2EDBA 2R9HD 5I1KL 4M8QB 2F74B 1CDIA 2IPUK 1IGJA 3BFOA 4K8RH 4LSUH 4U31A 4O4YL 2H3NB 2NY2C 1U8KA 4X4YA 1A5FL 4H0HB 2APBA 4LPCA 1U93A 1NC2D 4OM0L 3Q6GH 1H3PH 1KN4L 4FQCL 1RMFH 4HC1L 3FN9A 4OZIE 4PR5B 3IB4A 4LIQE 5IFJB 4FMFA 4XNXH 3VGDA 3UTZA 5D7LE 1X5AA 3N50A 4E42B 2NQCA 5ACLA 3DGGB 1GGBH 4M61B 2PO6C 4YDVA 1CYGA 3BPCA 5C6TL 1QLFB 5D7JA 1TJHL 4GW4A 4FA8A 2WBJC 4NFDA 4Y16A 5DA0B 1ZWIB 3MOBH 3ZHDA 1QA9A 2CRZA 1Y0LA 4YZFF 4ENEC 3T0AA 1F5WA 1KLGB 3AAZA 3MRDA 3QRGH 3R1GH 2UUDK 5E03A 3ARGD 5FCUH 4FQQB 5HI3C 5MEPB 4QRRB 3KJ6L 4LU5H 1KEML 4P49A 4X83A 2VL5B 2ZJSL 5F97E 2P44B 1NUGA 1JHTA 3ZMRA 1EUTA 1WC7A 1HHJB 1N64H 4NZTH 3F5WA 3HFMH 4O2FA 3LRSA 1QKZH 3ARVA 3TBWB 3K1DA 2CUMA 3SE9H 3NVQA 3QB7C 3EOYG 3O2WL 1V05A 4LCUA 4RMWA 3ARED 3WFHA 2ORBH 3IXAA 4GBXC 3UC0L 3V95A 2H6PB 1WBZB 5FO7A 4AIXA 3FMGH 1JMXA 3QEGH 1SJEA 1FL5B 3B8YA 5IHLB 3QO0A 3HE6C 2F19H 2OXHA 5AG9A 5B4MC 1MRFL 2BMKB 5M94B 5ESQA 1J86A 4MNHB 5C0NC 2DQGL 4K3DL 1RULH 5HYSB 1KACB 4OKDA 1NAMA 4YUEL 4S2SB 2NNAB 4QNPE 1X5GA 4CVUA 1CGYA 4AIOA 4MQXD 2Z8VC 3DX6B 1CU4L 3DPBA 4Y7MA 4GRLA 5E8OA 4Z18A 5IQ9A 4KTDL 1KCUL 1AR2A 4YBHA 4C83A 3LD8B 1JF6A 3MO1A 3HR5A 3EOBA 1OWWA 4OCWL 3EOTL 4NPYA 4JG0H 4JZOA 4U0QB 2R23A 3MRMA 2NY1C 4HJGA 1VGKB 4GRWE 3RX7A 4HS3B 2QHLA 3O0RL 3DMMC 1K3IA 1PEZA 4FZ8H 5MP6L 4HUXB 3TO4B 4UTBH 3RWDB 3WFZA 1WFUA 3QIWD 3K4AA 4RQQA 3LQZB 3WE6B 4BQ9A 4NQUA 1QSEB 3KPRE 1RAMA 1G7MA 4U7KA 3DX9B 3I6KA 1ZANH 5C0JB 1D5BB 4UIMB 5IEHA 1M7IB 1HOCB 3OMZA 4JREB 3QUXD 1LE5A 1II4E 4V1DB 1MI5A 4K7PX 3MOQA 5FO8A 1CFVH 3D25B 2MHAA 1QFWL 2IGFH 1JPFB 2FX7L 4NQEA 3VW3L 2IQ9L 4KZDH 3OF6D 5C0RL 3K8LA 1KXVC 5L2KB 5E2VH 4TUJB 2J6EH 2BNRB 1LWRA 3ZDYE 4X7TB 4JHWL 5D2NA 2APXA 4NFCA 2OR7A 2Z8SA 2ZOKA 2FEEL 3OXRA 1RUQL 4NOFA 1CTOA 2IPKB 5IMOB 3VXSB 4X8JB 2C3VB 2P8PA 2QHRH 2UWEE 1SYSB 4P59L 4YDKL 4XB8A 4BKLB 3VFTB 2IFGA 4PRHD 1R5IA 1HKLH 2C9AA 1ZS8A 2JJTC 4UI2A 1BLNB 2ITDB 2VKXA 4PGJA 4QXUL 1PAMA 2JF1A 3FO9B 2F8OA 1SVCP 4P2QA 4YPGA 5IK3A 2HVJB 5T3ZE 1S3KH 3BN9C 4OAWA 4PJ7F 4ERSH 4UNUA 4R8WL 1NFIB 2Q8BL 4YHMH 4J3VA 3NIGE 4OF7A 4I77L 4ZPTA 1KTRL 2J12B 4JO2H 1RUAL 3ARXA 3INUL 2AEQL 2X40A 3F7VA 1A3LH 2DJUA 3QUYD 4R4ND 3FOLA 2OSLB 1JGDA 4FXKB 4ORGA 1S9VA 3GBNH 5IOPA 1REIA 3ARBC 1C7TA 3CVHA 1IC1A 5DTFA 4FHBD 5I73C 2R4SL 4MAYA 3CD4A 1AGFA 4GO6B 1FZOB 4PJ7B 1JF5A 2OL3B 2OTPA 4WUUB 4PB9L 3S4SB 4ZD3H 4UOW1 4Y88A 4HLJA 1CCZA 1SM3H 2BHYA 2GITB 1WIOA 1IGCL 5EUKA 4Z78B 1YNTB 4MJ5A 4JRXA 5D96B 2HFTA 4XPHL 4NQSB 5FO9B 2HFGL 4JHAH 3B2UC 4M6MH 4JZJB 2DLFL 4NO0B 1KENL 4M6NL 1NJ9A 3ARFD 3WNLA 4X6CA 2DIBA 3EYUL 1RSFA 4HV8B 4NSKA 1XIWC 5ADOL 3Q6FB 3U6RB 3BW9A 1FYTD 2EIDA 1KNOB 4HGWB 1QYGH 2XICA 4XTRC 1LK3H 3UTSB 4YGAB 4X6EA 4KV5E 3P4LA 2A9NL 3IU3A 4MDIB 5DLMH 4IRZH 4NQDE 2IH1B 5I17B 1C12B 4PJDB 2VXQH 4WY7L 3WNOA 1LNUB 4P9HH 1MRDL 5CGYC 4HT1H 2OZ4A 4HHAA 3QUKB 4L9LB 2E9WA 1ZEAH 5I8CA 5E7FA 1F4WL 1NCWL 1VGKA 2A38A 3IYLW 4PTTB 3SKOB 5HYJA 4PRID 1MJUH 3X13B 2GFBA 4HUUA 1RZKH 4PY7B 1HH6B 5IHZA 3FQNA 3I02A 4J3WA 2H26A 4ETQB 3QUML 2P8LA 4KI5E 3AC0A 3RVVC 2H32H 2DQEL 4MB4A 2AK4A 1BZQK 3JXAA 1OP5H 5KSBA 4PS4H 2A6DB 2CXKA 4NFBA 4N5ED 5H37G 3GSXA 3EYQD 4OF8A 2YKLL 1EMTH 2DQUH 2IPTL 2V2TA 4UTAL 1DUZB 3RTQD 1D6VL 3IDNB 1IZJA 2GK2A 3K80A 2GTZB 3QCTH 4WGVB 3DHMA 3C08L 2JELH 1FV1A 3U30B 4GS7C 3ZHKA 1YEIL 4JHBA 5EZJB 3ZDZE 3OTTA 4LRNL 4PLJC 4Q9CA 2AK1H 3DX7A 2IH3A 5T1KB 3WL9A 1T89A 3LKNB 3QHFH 1H0DB 4LL9A 4L8CB 3EBAA 5B8CC 1NFDE 3P11L 1A6PA 4G42B 1FVEB 1PYWA 2G75A 1HEZA 2VXTH 4DGIH 1FORL 3QFJA 1NGZA 1VSCA 3KYOA 1OF2A 1MCRA 3E3QC 1YEFL 4R7NB 3IFPB 3QQ4B 3ZKSD 4OUOA 1I8IA 1K8DA 2A74B 2P48B 4XX1E 5C0DA 3VFTA 1WBYB 2HFEA 4QEGA 5GQBA 3UBXI 2CMRH 2VDKL 3GKWH 4WU7B 3DSNA 3C87A 2YD1A 5F9WC 1JVKA 4NNYB 1BP3B 3MLTB 1MIML 4JRXE 4RDQF 3SDDB 3VWJB 1QLEL 1U95A 3TZVA 1MJJA 4S0SD 3VI3E 4P5KB 1SJVA 3U2SB 5CJXA 3OKOA 4AMKL 5T1LB 1A7RH 4PJXA 4WO4D 4Z7QF 1DEEA 4X6CE 4KHTL 2QQKH 4Y5XA 5CZKA 2P5EA 4R96A 1T7ZA 3EDDA 3LOWA 4GW5A 4XPFL 4HMDA 2VYRE 2GAZB 3FB8B 3A6BH 4Y19D 3QULB 3QXDA 5E8NA 1RJLA 4UDTA 4WW2F 4NKIH 2X4OA 5IB1B 1SY6H 3IJHB 2R2CA 2ZSVB 5EIQA 4IRSB 3ES6A 1B3JA 3NACH 2FJGA 3CPLB 4G9FA 5KS9E 2VISB 3THMH 1U3HC 4RWHA 1L7IH 1LO5B 1R5VA 1LEIA 3KDMB 5FO9A 1CT8B 2GSGB 2AAVA 1OGTB 4NJ9H 1FGVH 2CDGA 3V6ZA 3AB0B 3QWRD 1DBBH 4RRPG 5HYJE 5IMMB 1ADQL 1KPRA 2YD3A 3S34L 4WW2B 5T1MB 3F58H 4APQD 2HN7B 3BYYA 3TA3B 3L3HB 3EO0B 1BVLA 3R8BB 1PGRB 3PWNA 3W39B 4HAFA 5HSFA 1UM4L 4QWWD 5JLZB 2AK4E 3RGHA 4R7DB 1NLBL 5KSBE 5I17A 3JWDC 1HQ4A 5TQ2H 2R8SH 2XWBA 4BZ2L 3DOSA 4PRPD 3D39E 4GKSB 2PN5A 4XCCL 3W11D 5DUPL 2F54A 1X5FA 3M8OL 2RGSA 4K55A 3DRQB 2ZKHL 1T1WB 1JZ6A 35C8H 4C58B 2RAMA 4PREA 1TQCB 1CGWA 5CP3A 2R56L 3GJEA 5EUOA 2AJZA 2X70A 1P7KA 4QHNB 4PG9B 5B39G 4OGXL 5TDOB 1VFUA 1A8JH 3PWPD 4ZUSB 4E41D 3CXDH 3QFJE 1P6AB 4KK6D 1E4KC 4W4NA 5EOCL 1TCRB 3TBYB 5D7IF 2VDOH 4ETYA 4N0FA 1INDL 4FXGB 2X4SB 3TT3L 5D5MB 1G0DA 1VESA 1E4XL 1KCVL 3MV8A 4L4TE 4K94L 5D4QA 2QSCH 4KK5D 2VDPH 3W9DB 2X9WA 2D31B 2OJZL 4XCFL 1UXSA 4RGNE 2QADD 1OP5K 3RWHA 5BV7B 4LF3B 3HTLX 3U48A 2MJWA 1J0JA 4JY4A 1WIPA 3ZYIA 1SEQL 2VXSL 3QXAA 2Y23A 4HF5H 2K1MA 4FFZL 1C16A 4G3YH 5D7IB 1WSST 1FHGA 4PJXE 1JWUB 2V2XB 3EGSA 3MMEB 1JF1B 5A16A 1T5WA 3OKMB 1E6OL 3OKKB 3QIBB 5F1IB 3MV11 4QRQA 2YOCA 5T3ZH 5AZEL 2D0HA 1NEZG 4YE4L 4DK6A 1T3FA 2C26A 3HB3C 4KJYB 4Z6AT 2AI0H 3OR7B 1WBXA 5C9JA 1FL3B 3BGMB 1XGQB 4GAJL 2BSRB 2UYLA 2VZSA 1HN1A 4UAOC 2FX8L 2HTKC 1T66D 4NM8H 4G9FE 4YK4B 5C0GA 5BZDA 3MACH 1O7VA 2AXJA 3KYMA 4G8GE 5CSGA 4HJJL 1XGPA 5DRWB 1MCLA 1BJ1J 3WUZA 5DMKB 3QFDA 3S35H 4RMSA 3Q5OA 5FF6A 4FABL 3BO8A 4ODHL 4HCRA 1MLBB 2X41A 3RL1A 4IBLT 4BK5A 5I1EL 4U2ZA 3G5ZA 1ES0A 3SE8H 2CK0H 4LLVB 5DFTA 1H3UA 1AY1L 2NY2D 3DRTA 4GT7A 2X89D 3MR9A 2Z31C 5IGXL 4ALAH 5CGMA 3OAUH 3X3FH 3OKDA 4KVNH 4YR6A 1RU9L 1AQKL 1GAFL 3BP5B 3A6CH 5C71A 4DKEL 4GUPB 4TPRL 2NLJB 4D9RE 5GRUH 3BKJH 3T1WA 3MFFB 3V5KA 2K9UA 4U7MA 1H8OA 2PO6D 4HUWB 4J4PA 4S11A 1ZHBB 3QIUB 1HNGA 4KAQH 4M7JH 4LASH 3S98A 4WWID 1A6ZB 1DP0A 2WBJD 1UENA 1KJMB 2AQ2A 5EU4B 5JTWA 3MRFA 4ENED 3GI8H 3HR6A 1DE4A 5I1KH 1BBDL 4NDMA 5EUOE 4MNQD 4HEME 3FKUS 4JLRA 4MJ6A 5HI3D 5IT2L 1IT9L 5E00A 1DDHA 1A5FH 1CFTA 5MI0B 4EUPH 5M7QA 5DEFA 3QZWB 4OM0H 1KN4H 2J2ZA 4JO3H 4FQCH 4HC1H 1SEBA 4C59B 5DD0L 5A2FA 4TOYL 3KWWA 5TQ0L 3PXHA 1YY8A 4IMLA 4WV1C 5TFSL 4GBXD 2O26U 4Y4KA 4BH7A 2N4IA 5DMIL 3F6LA 1BQHA 2XG4A 3HE6D 4XP5L 5BCAA 5C6TH 1TJHH 5D1QC 5EPMA 3G6JA 5B4MD 3VDBA 1JHKL 2ATPB 1J05B 2P5WA 5C0ND 3K46A 1FSKC 1WEJH 3IT8D 1ORQA 4PJ9C 2W91A 1UYWL 1X5ZA 4UT6L 1PKQA 3EDJA 3ULUC 1KPVA 3U9PL 3KJ6H 1KEMH 3LEXA 2ZJSH 2V9RA 4ZSOA 2VKWA 3U82B 2ICCA 3JTSB 4L3EA 2O5YL 1GHFL 3MRCB 4JFHD 2NY1D 3O2WH 4ZUUB 5FGBA 3DMMD 5C0EA 3UC0H 4WDIA 3MCKB 3FB5A 5F8RC 5JHLL 2X05A 4H88H 3BXNB 3SDCB 1SJHA 5FYJU 1DQQB 4UT7L 3MYJB 1PJ9A 3RPKA 1MRFH 3TLRA 2IALB 1DFBL 2DQGH 4K3DH 2I07B 1DCLA 3F12A 2Q87A 2P8MA 3FQXA 3DUUB 2WWMC 4RA3A 1KYOK 4LHUG 4YUEH 3MMEA 4DAGH 5ICYB 1CD9B 5A2LH 2ED9A 1CU4H 1ZMYA 4EI6B 3HNSL 4F7MA 4H26A 1QSFA 4ODSL 5IB4B 3T1FB 1KCUH 4ELKA 2BVOB 5MEQA 3Q2CA 2FIKA 3AU1B 4R97B 4OCWH 3EOTH 5JIPA 5DO2C 3VD7A 2AV7B 4OD1L 3BT2L 1JNHA 4ZFGL 4PJFF 5TDNB 1H8SA 3O3AB 3NPSB 4QRPD 1VFAB 3O0RH 3CSGA 4PGCB 5CBAB 2BOBB 5MP6H 1XF4A 1JYNA 3NCMA 3M1BA 4ODXA 5DMKA 2YPLB 5DD3L 1FAKT 5IFAH 4CADB 5F9JB 5F44A 5TH2A 4JRYE 4ZQKA 2BVPB 3N06B 5CUSL 1T83C 3ZYOA 1JYXA 4N0CD 1KTKE 3HZMB 4PJFB 5HVFB 1PKOA 1K4CA 2X4PA 4K3JL 4QXTA 3P30H 4H1LB 1H15B 2FX7H 3FTGB 2APWA 3VW3H 2IQ9H 3BN9D 3QDGD 1NCUA 5C0RH 2EICA 1FRGL 4JKLA 4QXGH 1S7QA 4M4RA 1LEGB 4HG4J 3KPLA 5GJTL 4RSVA 4GQ9L 1ZGLM 3AUVA 5C2UB 1K4DA 4DOHE 4OBSA 4NOBA 3FONA 1H9VA 4Y1AE 4JHWH 2WK2A 3RDTC 3G6JE 2I27N 3IAPA 2P5WE 4JFYB 3ARBD 4I5BA 5J13C 3GMNA 1RUQH 3WO4C 1MHPL 1IKNA 2Q6WA 4IS6A 3GZKA 3WKNA 1VPOL 4YDKH 5ICZB 3X12A 3IDJB 4HW6A 4FXLA 1BJMA 3MLWL 4PGBB 1MUJB 2I24N 2EDLA 4ZSOE 3WJLA 4MNGA 4MCZA 3B2UD 1IE5A 3FFCD 4L3EE 2APTA 4ZDHB 1CWVA 4HUVB 3CFEB 3HG1D 1KJ2B 4R8WH 1MCKA 2Q8BH 3SGKC 4JN2A 4K7PL 4U6HB 5JXEC 1HDMB 1XIWD 2PR4L 3FT2A 2QKIB 3AS1A 4P4KD 4I77H 3P0YL 3UYPA 2IAMB 4AY0A 3PHQB 1I3GL 1OPGL 3BGAA 2AXGB 2AEQH 3INUH 4F57L 4XTRD 3DI2B 1EEYA 4P3CL 4RIRB 1A1NA 5CILL 3WN5A 4Y2DC 4PBXA 2XFXB 1P84K 4U4BA 2X42A 3HPJB 2R4SH 3M07A 4MGXA 2E7LA 3MRPA 3SEPA 2XPGA 5CGYD 1CGVA 1U3JA 4PB9H 1EX0A 4Y5VA 5DJ0A 1IGCH 4LVOB 3MRCA 2Q8AL 4XPHH 3T4AB 3N85L 5B3JF 2HFGH 3QI9C 3NCBB 4HX1A 2DLFH 2O93L 1KENH 1BFOA 4M6NH 5AWNL 3BXNA 4G6FD 3T3PF 3EYUH 1VA9A 2GUOA 3RVVD 1HHKB 1S9YA 5ADOH 1M7DA 4YHKL 1HI6B 4Z0XB 1J8HD 1M4KA 4UINL 4PP2A 4MB5A 1I7UA 5KW9L 2VIRA 1I1AC 4PJHF 3OKEB 3VGAC 3ZSSA 3VXRB 1MCPL 5DK0A 1LP9B 4B7IA 1A14L 4HJ0C 1F13A 5LJYH 3LKRB 4WY7H 6CGTA 5HYEA 3O9WC 1MRDH 1QFWM 4OTXL 3O8XA 4OZGF 2ZUQC 5CSZA 4PLJD 5GJSL 1WZKA 1F4WH 1NCWH 3V6FA 2ZG1A 5IBUG 1BQLL 4HXAL 4X6FA 3BP6B 5C07B 4QRTB 2AQ3A 1UC6A 4OIIL 3EDFA 4F7CB 1QLRB 3C5JA 4IMKA 3FQRA 2R0KL 3QUMH 1X4ZA 1TQBB 2Q20A 3HLAB 3NIFE 5E5UB 4AIZB 2DQEH 4NZDA 3OGCB 2JCCA 5D2LA 2CUHA 4YBQC 3RY5A 2VR5A 2V7HA 1LO2L 2HG5A 2BNQA 4OZGB 5E2UL 1Y18B 2YKLH 1IAOA 4D8PB 5C0CD 3ROLB 2IPTH 1WIUA 4UTAH 3RNQA 1D6VH 1Q1JL 3LKQB 2J8UE 4GW1B 3BQUA 3T8XB 3C08H 5JW4N 2N7BA 1YEIH 2XA8L 1S5HA 5FFLA 3P3YA 1ZHKA 2L4OA 2CIKB 4KJPD 4RZCA 3SJVB 2JJVA 1TDQA 1KJVA 1ZT1A 3CC5B 5IJKA 1N2RB 4G8EB 1D9KC 2DQCL 4BYHA 3EFDL 3ZKNC 5J6GB 1X5LA 1H3TA 5GGUA 4WFEE 3ZL4L 1I8MA 2GJ6E 3P11H 3BUYB 1IBGL 3MRKB 1FORH 4P23C 3D85A 1ITCA 3U4AA 3UTQB 4PV8B 4ZFZB 2ATKB 1YEFH 5FKPA 4YHOL 1QBML 1ORSB 5IWLA 3FT4B 4HZLB 2FJFB 3X11B 5GS2D 4PJIF 1U3HD 4ZAKB 3MJ7B 4X4ZA 1Q9LB 5F7FA 3C09B 4NQXB 4PJBE 1I7TB 3CFKA 3DNKA 3MV9D 2VDKH 3CLEL 5ALBL 1Z5LB 1TITA 3UTTA 3O3EA 1EHLL 4KU1A 1MIMH 3AY4A 1YMMD 1QLEH 3WUWB 1OLLA 5I74B 1D5ZA 1U58A 1CD0A 4P4RB 4AMKH 1I1YB 5FAAA 4TVSa 4YHYB 4KHTH 4C4KO 4JJHA 4NQCA 5IW3A 4XPFH 4PJIB 4DWHA 3TBSA 3VFPA 2CO6B 4OF5A 2IANE 5HHVL 3TVMA 2B2XL 4OCNC 1NC2B 1ZA6B 3HRZA 4NBYB 1T7XA 1VADA 3RL2B 1FCCA 2C4FU 4JFPA 4YIQA 5D7JC 3M17A 4Y16C 2FLRT 4H5SB 1FH5L 1N0LA 4HKJB 5HPMA 2VMFA 1J5OL 1OTSC 1YN6B 4HIIA 4O9HH 1JPGB 4MDJA 4CU7A 4HBCL 2AABL 4P3DB 2JJUA 1RZ8B 4LPYA 4U1NB 2HTLC 5E6IA 2DLEA 1ZT7A 4IJ3C 5DUBA 1G7IB 4OB5L 1OAYL 3KNBA 3RNKB 1D5MB 1ADQH 1U3ZA 3CZFB 3S34H 1HI6A 5KSAA 3NOIA 1PX4A 1PSKL 4MZ3A 4JFFD 5HY9A 1UWEL 1HQRA 1OGAA 3EJZC 4X9BA 1MVFA 1UM4H 5FUZL 3ARGB 1LP9A 1FNHA 3EAKA 3MQIA 1NLBH 5D2LE 4F7EA 2O5ZL 4F7PA 2M2DA 1XR8A 3O41B 4BZ2H 4R9HA 3WV0A 3VI4E 2VNCA 2XKSA 4XCCH 1LGVA 3LQMA 5GISL 3AREB 3M8OH 1N3NB 5C3LD 3ET9F 2ZKHH 4JKPL 5J12C 1CLYL 4N9GA 4QF1A 3GMRB 2R56H 1U8IA 1UM6L 1W72A 4MD4A 5DDHB 4DUVA 3P40A 4GRLC 5JHDA 5HVHB 4P2YA 4NKOB 2M26A 5ANMA 2ZUWA 4K3HA 4OGXH 2OR9L 3EOAA 4KKNA 2EYRA 1N7ML 3PQYE 3S6CA 4DZ8B 1AXTL 3MXVL 3F6IA 2ZCLL 5EOCH 1P7QD 1BQUA 3GHEL 3WLBB 1XF5A 1NBYB 3HB3D 3LKSB 2FO4B 3VXTA 1INDH 3REVA 3TT3H 1U92A 4U1LB 3BOVA 1E4XH 1KCVH 5JA8B 4K94H 2HTKD 3OKYA 1H8NA 3OX8B 3DXAE 3PDOA 5DJCB 2OJZH 3VXMD 5DJ2B 1EFXA 5INDB 3MSPA 1S7TA 2FZ3B 3MRQB 3P4OA 5E7BA 2ARJA 3S8WA 3I6LE 3QIWB 4X80L 5KVFL 4X4XB 1OSZB 4Y8AA 3SCMA 1SEQH 2VXSH 1R3IL 1KTLB 1FFRA 4PGDB 3KYNB 4FFZH 4QHKI 2EE6A 5BO1L 5IEKB 1KC5L 2Z31D 2XZZA 4XX1G 3PNWA 3QUXB 4PRBA 3ARRA 4KKBC 1E6OH 4X0KB 3CLFH 4KK8C 3FT4A 4NQCE 1CL7L 1N5AA 5DJXB 4MZ2A 4XPBL 3X11A 5AZEH 1HXMB 4YE4H 1A2YA 4MXVF 4ISVA 1Q9LA 3HMWL 1GH7A 5D2NC 4GAJH 4P99A 3O4LD 1CXEA 5KSUA 2J88L 4HEPG 4U1HA 2FX8H 4AH2B 3PL6A 3KVQA 5CLTA 4HK3J 4HJJH 1YDPB 4JHZA 4N8PA 3KPSD 1NGXB 3HC3L 1MOEA 4M7LT 2OJEA 4JPIB 1B0RA 1Z3GL 2FD6L 5EZLB 3MJ6A 4FABH 4ODHH 5SWSD 3PGDA 2OQJB 5I1EH 5DVLA 2WV3A 1OHQA 3KXFA 1AY1H 2NZ9C 2X7LB 5F21B 4YHIB 5J8OA 5IGXH 4ZNEE