4AM0A

Structure of dengue virus strain 4 diii in complex with fab 2h12
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
211
Chain Sequence
DVQLVEPGAELVQPGASVKMSCKASGYTFSSYWINWEKQRPGKGLEWIGNIYPGSGTVNYDDKFKSKATLTIDTSSNTAYMQLSSLTSEDSAVYYCTRGGSHAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 2H12, HEAVY CHAIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
molecule tags Viral protein
total genus 37
structure length 211
sequence length 217
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4am0A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4am0A02
1Y18B 3BXNB 1MFEL 5AYQA 4FP8H 3AGVA 3AVEA 2P7TA 1TETL 4L4VB 1NCBL 5CZVL 1WWBX 1E4KC 3V6OE 2R2EB 5T1KB 5IFHH 2CLVA 2UUDK 1U3HA 3DMMB 5DLML 4UOW0 3ARTA 2PNDA 1GGIH 2KQMA 1QA9A 3NIFF 3MO1A 2C3VA 4ZO9A 5FK9B 1LEGA 3L6FB 3MLPA 5A3IC 4KKNA 3NPSC 1YYML 5F1NB 4C56D 3OKDA 5GGTL 5T3XH 2IALA 4LLUB 4MAUH 5KVMC 4IS6B 1BVKB 1L7TH 3GSWB 4KRPD 3WFDH 1AIFB 1IGFL 2IEPA 2V5MA 1G7IA 3DJ9A 3EOAA 2DL9A 5A1AA 3S9DB 2Y07H 3SQOH 3RKDC 1N6UA 3L3OA 1LEIB 2BXYA 4OZ4B 4RMSA 4X4YB 1JWUB 1T6WA 4N0FA 2VLKD 1X4YA 1CDHA 1RJZB 2DQFA 1XCTA 4MQ7A 4I3RL 3S7GA 1YJDL 2VLJA 4O02H 1W0WA 4OLYH 3ARGB 3FQUA 2BHYA 4MMXC 5IHUL 1OAUH 3MLVH 4PJ8D 4YHNB 4NQED 3KWWB 4PJDE 3VWJD 5J1TC 2VERN 4WV1A 5GHWL 4KZEH 1JWSA 4N1HB 4LPWA 3QCTH 4K7FB 5E2UL 1YNTA 5ACMA 4JM2B 2DM7A 1NCUA 2UY6A 2X9YA 1SJHA 2H32B 2RHEA 1OTSC 3IDYB 3ARFA 4XAWL 4WUUB 3QEHA 2XKNA 1U91B 4ZPVA 1QR1A 3QIBD 1DBJH 3UTOA 4AYFA 1FZKB 3LRSA 4LAQH 5KVEL 1NLDL 3ARBD 1M05A 4LCYA 2CQVA 2ED7A 2YC1B 1I9EA 1EPFA 1U8PB 5LGHL 5EUOA 3KPQA 3QJFB 3CLFL 4HXBL 1Z5LA 1FZOA 3PWLA 4NO2B 1DUZA 3G5XB 1IM9A 4LLWB 2R1XB 4CRPA 1I85C 3QUMB 1HYSD 1KPVA 3MRJB 1FBIH 4HLZH 1Q9LA 3FT4A 5MEPA 3DV4A 4Q6IC 1S7RA 2MTPA 2PR4L 3QI9D 4WUUE 3V4UH 4XWOD 3JSSA 4GAFB 5CD5D 1EHAA 4Y5VC 3VRJA 3MRMB 1RK1B 4TSBH 4WU7A 3FFCD 4IHOB 1UWEH 1CFVH 4LL9A 4G43B 4IBLT 6FABH 5BZWB 2XWJA 3MREA 4NKDB 5F3BB 3UMTA 3MFFB 1RUMH 1MAJA 2KH2B 4FHBD 1ZV5A 1LDPL 2V2XA 3BZEB 2F5BH 1GIGH 4JZOA 1IAIH 3IDJB 4R0LC 4ZS6D 2DQIH 2FD6L 3GMNB 3MYJB 4QWWD 1AE6H 1XZ0A 5HYFA 3BGMB 1K8IA 4KV5E 1VFAA 4F7EB 1FPTH 2OL3L 4OD2B 3QNZA 3O3DA 5HTSA 1CYGA 4HJ0D 5GIRB 4HJJL 4JY6B 4DEPC 2AXGA 2E6JA 5IB4B 4WFED 1YPZB 5C07B 1OAXL 1NSNL 1DQJA 4LCCB 5ICXA 3WXWH 5CCKH 5DD3H 4K07A 4E42B 2DI7A 3PHQB 5DJYA 5C09A 3ZE0E 1T1WB 5MERA 1WISA 5I15L 1KCSH 3UX9B 3OAYK 1RMFL 5CS7A 1OWWA 4PJAA 1T1ZB 5LG1A 3OKNB 3DURA 4QRSB 4Y16A 4HEME 4I4WA 5JLZA 5EPMA 3WNLA 2EZ0C 5J11B 3HAEG 4S0SD 5D1ZB 4WEBH 4ZODA 4UTAH 2VABB 5EZLA 2FX9H 3A6CL 3CFKB 5E8DL 1TVHA 1U8KA 2Z8VC 5E94B 3RL2B 3EW3B 4P2OB 5KBNC 4XBPB 5DD5L 2Z35A 4RBPH 4ZOEA 2NW2B 2EIZB 3T8XB 1YPZE 5DUBA 5IROC 4OCYH 2NY2B 3L3GA 3SJVB 1WWCA 1U8JB 5L2KB 4JCMA 4G5ZL 4U1HB 4J23A 4X6EA 5HGBA 1JUFB 5IT2H 3DROB 2VMFA 4KVNH 1T66D 4OJFH 4KGJA 3ULVE 2Y06H 4GLRH 5BO1L 5IKCA 4ODSL 2MPAH 5I8CB 4HH9A 4KK6C 4D9RE 4N5EC 1KIQB 5LQBH 4NQCE 3BHBB 4Y8DC 3ETBF 3DI2B 1EXUB 3VFGH 4EUPH 3SKJH 3TZVA 3HC0A 4NHUB 1VADA 3BRFA 4U2YA 1HYRC 1TZGL 2DQHH 3L7FA 3T09A 3LV3B 3BE1L 5FV1L 3DXAD 4U1JB 1S7UB 3RGHA 5CEZH 4RRPA 1Z3GH 1JZ3A 3SJVE 1B2WL 1I8IB 4YHPB 1IBGL 4AZ8A 3SE3C 1P7QD 5JPMB 4GAYA 3EO0A 4M6NL 4A6YL 1GZPB 1WBZA 2BNUA 2UZXB 2N7AA 3MXWL 3AS2A 4JDVB 3JVGA 3PABA 4Y4KA 1ADQL 3MXVL 3O4LB 3RUGF 1DBAL 4NT6A 2ZCLL 3UAJC 5KN5B 1A6PA 3D3VD 3IGAB 2NNAA 2VXTH 1RUKH 2HG5A 3FB8B 2ZUTA 2EECA 4KQ4H 3DO3A 4FQPA 2CLZB 1YEJH 2SEBB 1QLFA 3BP7B 4PV9B 4YEEA 1GC1H 5T5NF 3CFEA 2FBJH 5EWIH 5F1IB 5C8JB 1FJ1B 1JPFB 1GGTA 3JTSA 3J7HA 2FZ3A 3O45B 4Z9KB 1JN6A 1AXIB 4P2CG 3KHQA 1A6UH 1Q9WA 3DUSA 5D7LD 4ZO8A 3C2SA 5DRWB 2GI7A 1CFSB 4XCFH 2ADGB 4M1DL 5FKAA 2P5EB 4I0PC 5TPWH 1HSAB 2B4CL 3H7LA 1AP2B 1NCCL 2X4QA 2A74B 3PIQB 3E3QE 1NPUA 1XGTB 1S7TA 1MVUA 3UJIL 5E2WH 4FQJL 4DW2H 4XI5D 2FB4H 4F7CA 5FCSH 3VMNA 3LB6D 4RAVA 1AKJD 3DGGB 4TSAL 2PTVA 1KN4H 4FQQB 4DGVL 2A6KB 2VZUA 1H8OA 3RWJA 4BSJA 3GIZH 3MMEA 5DC4B 3AROA 3FOLA 2HJKB 4YBQD 4B5EA 4PJEB 5EO9B 2YK1H 1MAML 1D5MB 1KCUL 1T4KB 1U8QB 1WC7B 1WTLA 4MVBC 3O6FD 3CX5J 1ND0B 4MJIB 3EZ8A 4HPOL 3EDKA 2MKLC 4X80H 3WIHA 3RWCA 4YFEA 4J3UA 4LSTH 3B2VL 4PJDA 2FSEA 1F97A 5BVPL 1IGMH 4YPGB 3WBDA 3SDDD 2X4OB 5IB3A 1MY7A 1RFDH 2R1WA 4IS6A 1BVKA 3GSWA 3HAEB 4G6KL 2HYMA 4OLWH 3OKKA 3VFSA 4JFHD 2P48B 4JJHA 1Q0XH 4RMQA 4OZ4A 4XP9H 5TDOB 4NC1E 4ZFOL 2PYFB 4P99A 4WU5B 3GO1L 4M48H 2CRZA 1T5WA 2A0LD 4OD3L 3PL6C 2HRPL 3ARGA 3X11A 4MJIE 1ZEAH 4JFED 1TJIL 2P45B 3KWWA 1MCFA 3KPOB 2IQAA 3D48R 1RURH 3QR2A 1AH1A 1DVFA 3I6GB 3LS5H 4PJGB 4C58B 5T33L 4JY4B 5DUML 1J0IA 3GZKA 5C0AA 5D1XA 2FIKB 3G6AA 3AMKA 1E4XI 1TJGL 5F9OL 1LO2H 1KJ2H 5CSGA 4LU5H 2H2SC 5F7UA 5I1AB 1T2XA 1XIWA 4UT9L 4NM8H 2NR6C 4G6FD 5DYOB 3MROA 2YC1A 4RFOL 3RU8L 3WNNA 5TDPB 1U8PA 1ZK9A 2XKSA 4ELME 2DQTL 3MJ8A 5E1AB 1AXSB 1BJ1H 4G7VL 3MBEA 1JF1B 1NJ9A 2ORBL 1V7MH 4Q9RL 2VR4A 3UJJL 1HIMH 1RU9H 5F7FA 2WINA 1N6VA 4J3OC 1A47A 1PKOA 1YEFH 3NH7H 2FX8L 4RWHA 1MEXL 3LEXA 3KAAA 4UB0H 1F4XH 3MRMA 5KSAC 2V5SA 2AJZA 4KJYB 3AC0A 4I3SH 4G43A 1W0VA 4YIQB 3FQWB 5HDBE 1IL1A 1JHTA 1MWAL 4NKDA 5F3BA 3BH8B 5TGBB 3RVTC 4PRAB 4EN3A 3BP5A 3DSFL 3M1BA 3ET9F 4C57C 4LPTA 4G6AC 1WZ1L 4UOJA 5SX5H 3VFMA 1OQOA 4LCIH 1FZMA 4IEFB 1HHGB 4PTTB 3SO5A 3IDJA 2Z91A 5D71L 4XXCC 2OYPA 3GMNA 3MYJA 5HYSG 4Z7OF 1JGUH 1X5GA 2PXYD 2GY5A 3HE6C 2AXFA 1ZVHA 4OD2A 1IEBA 5CP3H 3ZO0A 3DX8A 3F12B 4PR5B 3QEGL 5IB4A 1MJ8L 4LSQH 2X4SB 5HHPB 4NO0A 3JWDH 4WFHE 3EDFA 3BDYL 2DM3A 3PWPD 4OF6A 4NQEE 4OAWA 4Y0GA 1DL7H 4JKWA 2IANB 4U1KA 2W1NA 1KTKE 3IRPX 2CH8A 3QUXA 1A7QL 1A5FL 1S9VB 5D1ZA 1KB9J 4NQCA 1LK2A 2OR7A 5C6WH 4LLDB 4NKOA 3RJDA 3WFEH 1NCWH 3DUUA 3HCVB 1CF8H 2YOCA 5E94A 4P2OA 1FL6A 1I7RA 2QSCL 3HI5L 5ITFB 1G7QB 2EIZA 3AS0A 2HJLB 2J1KA 3QHTC 3VFWA 3FN9A 3SJVA 4CJ0A 1YEIH 1U8JA 1NGZA 1CL7H 1GGIL 4X9GA 5EU7C 2E9BA 3X14A 2CUHA 3IFNH 2NY3B 1JUFA 1OSZA 4G42A 5EBLB 3CXHJ 2E27L 4NUJB 5D72H 3DGCR 5FECA 4QXWA 1FIGL 5DQJB 4YXLH 3BVNA 2Y07L 3SQOL 1YY8B 2EO9A 3D39B 4GOSA 4ZUWA 4D0BB 5DZLA 3AY4A 4PJ7F 2YMXH 3OX8A 5E2TL 1CDIA 1N64L 4XBGB 1B6DA 4Z7UE 4RWYH 3OAYH 2OCFD 4JO1H 4WVRA 1ZLWK 3TN0D 1S7UA 4A2LA 4I18B 2R4RH 3MR9B 5IB1A 5C08A 1OAUL 1U9KA 4UOW1 2C3XA 4YHIA 3WIHH 4JHWL 5F1SA 5I8KH 2BP3A 2YXFA 4M8VA 3ESUF 4N9OB 2YBRA 2Q20A 2BSTB 1MRCH 1DLHB 2YA0A 4AL8L 1INQB 5KN5A 4MAYC 3BN9D 4O51B 4PBWD 3DBXA 3X13B 1DBJL 2LTQB 1CDGA 3RL1B 1TZHA 4KTEH 2ARJA 5F97E 1IFHH 4LAQL 3BD5A 2CLZA 5EIIA 3RIFK 1H9VA 4LHUG 3BP7A 4H25A 35C8H 4PV9A 2R0WH 1A7NH 3LRGA 1YDPB 2WUCH 4EDXB 5E00B 3VXSD 1S7WA 1PG7W 1ES0B 2VDLH 1DBKH 3NVQA 1DCLA 4OV5B 2XFXA 1FBIL 1EHXA 3P11H 4HFUH 3NZ8A 5DRWA 1CFSA 2ADGA 2FX7H 4U6YA 4OCMC 3RWFA 5DQDL 5C2UB 2A74A 5ITBH 4OZFG 4UAOB 3DX9B 1UWEL 4LDEB 3S4SB 1TVDA 4GAJL 4MA7H 2EDJA 2ERJB 5FUZH 5HYSB 5DZNA 3HZYB 5IK3A 3TJEH 4KI5E 5KVDL 2HLAB 2X70B 1GIGL 1HHJB 3LKQB 3VFPB 2IC2A 4PJCB 1IAIL 2HJKA 3BT2H 2DQIL 1WAAF 1Q0YH 3LQAH 2XXMB 1AE6L 1BAFH 1MHCA 4UZGA 5GGQH 3S35L 1MFAH 2RFXB 3V9FA 1FH5H 4QGYA 4HGKC 4MJIA 3SBWC 3DXAE 5JO5B 4YPGA 5HHNA 5TQ2H 3T4YA 3IFOB 3TT3H 3QAZB 1IQDB 3LS4L 4Z78B 3QDGB 4GRWB 1KCSL 3D0LA 4QHLB 3SGKC 1NDGB 3GSOA 2CGRH 4YE4H 3F7RA 4HK0A 1CD1A 2J8UE 4E41B 5F70A 3H9SB 4WU5A 2HT2D 5I71B 2NY5C 3F7PC 1RUQL 3WJLA 2IFFL 3VRIA 5IIEB 2F58H 3CUPB 5DUPH 4ELMA 4MWFB 4U1GB 5DRZB 1D9KB 5IW1A 5EN2B 2VQTA 3VD5A 3EDDA 4K8RD 4X7TA 4KXZH 5KAQG 2X89A 3CFBB 4JY4A 4AT6A 2MHAB 4LNVA 4PP1D 2OTPA 3ULUC 4GRWE 4F80A 4MSWA 5F7KC 1QR4A 1J1OH 2QKIA 2FIKA 4YHMH 3WEXB 4GRLC 4BM7A 3ZKMD 1IM3A 1T83C 4U6TA 4E0RB 4UNUA 1NBVL 1KENL 2MPAL 4NO3A 5LQBL 2C3HA 3BSZH 1HILB 3S97C 1BBJA 3B9KA 3NFPB 4BA8A 5DYOA 3ZL4L 4EI5D 3QHFH 1UM5L 1IGIL 4N0UB 1NFDF 3TNNB 3I02A 4WNQB 1CXKA 3D25A 1CDUA 3SDXE 3EFFB 4LNRA 1NMCB 4UT6H 1Z3GL 2PYEB 1UH3A 1RZJC 3HR5A 3VXQB 4BQCA 3GSNB 4ZXBB 4C4KO 4JQXA 3DETC 1CG9B 4GSDL 1V7NL 3ILPB 3JWOC 1EEZB 4KRMB 4UUJA 4R26L 4K7PY 2Y9RT 4BZ1H 2EE9A 4V1DD 4NZUH 1T04B 6CGTA 1WBYB 1EO7A 4AIXA 3V6ZB 4Q2ZA 1A3LL 2BOBB 2YPKB 3PGCB 1ZTXH 2YPLE 4LHUB 2ZUYA 1CU4H 4N0UE 4X7SL 4FMKA 3D69B 3ARPA 4NQEA 4Q74A 3VWJA 1ZT1A 5FYKE 2DYPA 3GKWL 1CGSH 3KPSD 5A2FA 4TVPD 4PTTA 3TVMB 5FYLL 1W72H 1SMOA 2OR9H 4JFHE 1F42A 1T1XB 4EVNB 4NQXB 4P9MH 4XPTL 2DM4A 2DQEH 1ZT7B 4L29B 1RZ8A 1KELL 1UQSB 4OB5H 1F2XK 4M7ZB 2E7BA 3QIBA 2VL5A 1QLEL 3DX6B 4BZ2L 5KZCB 3EUUA 4PR5A 4OZFB 4Z0XB 2X4SA 1FLTX 4G9FD 4R3SB 4NRYA 2HFFB 3RWHA 1CZ8H 4JPKL 4BQ8A 3UYRL 4JFEE 2VXSH 1OAYH 4NP4H 3UTTB 1KFAL 1RZ7L 3HUJB 3ES6A 3QRFM 1RIHH 4DW2L 1ZT4A 4KJPD 3VGAC 1AR2A 2FO1A 2FCBA 4PRHB 1DEEB 3UBXI 3K7UA 2XN9D 1S9VA 1DQLL 1DUYB 1WV7T 3SY0B 2D9CA 3UTQA 5JHDB 1FNHA 3L1OL 1CDCA 5ITFA 4X8XA 5F6IB 1AI1H 5TH2A 3BW9B 4Z7UA 4JZNB 1HDMA 3O4OC 4WHTB 4YNYA 1QSZA 1JNHB 4K2UH 1Q9OA 2UZIH 4FMFA 3BZDA 4XPGL 1QP1A 1ZVSB 4H26B 5AEAA 1NC4B 2ICEB 4LSVH 4LLVB 5E08L 3QUYD 1QBBA 3OKYA 4ONFL 1I8LC 3RFZC 1EBPA 5E5MB 1NC2A 4LMQE 5CWSA 1T1YB 4PRHE 5H2BB 2X4TA 1ERNA 4NUJA 4XH2A 3RVVD 3CPLA 2J6EL 4OLWL 2NXZC 5DQJA 1KJMA 4J1UA 1WT5A 5EH1A 5L2KD 5JHDE 3ZT5A 4DJMA 4L8CA 4D0BA 4LVOB 3C60D 3SOBH 2R56L 3H0TA 2Q8AL 3RDTA 3MCKB 3WNMA 4P2RB 4M48L 5C0IB 3UPAA 5I1JL 4Z5RB 2F8XC 5JDSB 4DAGH 4JDZA 3UBXG 4HF5H 1JI1A 1VKXA 2HH0L 3UDWC 1SVZA 4Y4HD 1ZEAL 1MUJB 1F4AA 3FO9A 4X8JA 2VXUH 5E8OB 4YFLI 4GT7A 5C86A 3FL7A 1P1ZB 4JAMB 2BSTA 4N0CD 2IGFH 2NY5L 3L5WA 3AM8A 3U0TB 1M7IA 4URTB 1BZ9A 1INQA 1UXWB 3MRKA 2HKHL 1S9YA 4X5LA 1LO2L 5J0BA 4GXUM 3VD4A 1KJ2L 3JBG7 1OTUD 5KJRH 3QIWC 1QHOA 3FB5B 1MHHB 2FDBP 3RIFF 2IBZX 5DK2B 1MY5A 5A16B 4YDLC 1JRHL 3SCMB 4XP1L 1MFDH 1LO0H 2DLHA 2ED8A 2DLTA 3QWQB 4MJ6B 3PWPE 1U6AH 4P23C 3BQUC 1UFUA 1ZANL 4XPHL 2HVJA 2EEBA 5E00A 5FM8A 5LGJB 4XNXH 1XGRB 3BFOA 2ED9A 3PDDA 1SQ2N 4FFVD 3ZTJG 2FO4A 4NN5B 1ITBB 1FQ9C 4YHLH 1B6UA 3MNWA 1HIML 4UIKL 3CVHB 1IQWH 3DO7B 2CIIB 4LPYA 3A6BL 3NH7L 5ACLA 2R8SH 4BZYA 4AENB 4ZTPL 1UA6H 3Q6FB 2HFEA 1LHZA 1NAMB 3UCRA 1FNEB 3O3BB 4TUJA 4JO4L 4X6DF 1P4LA 3DXAA 1SHMA 2ZG2A 3MRFB 3GMLB 4POYA 1WZKA 2PTUA 3OWEA 2HLFC 3IXTB 4I3SL 4Y2DD 3S4SA 5J1SC 3QCUL 1ZHBB 3QUZD 2WWMC 2VAJA 4RGOH 4H1LH 3JWOL 4P4KC 2P5ED 2BZDA 4LCIL 1UACH 2J8UA 2Y5EA 1QYGL 1L0QA 2GJ6B 2HLAA 5HI4C 2X70A 5HYJD 3FQXA 3P4NB 5IOPB 2IMNA 1I3UA 1TCMA 3D3VA 5A40E 1ZXQA 2DQCL 1FDLH 4D0DB 5DWUH 4DUWA 4QOKB 4OKDA 5TE6H 5GJSH 1GAFL 4UQ2B 2XT1B 4BELD 1UJ3B 5CD3A 4JGUA 3CDYA 4ZAKC 1BLNA 4JQVA 4OZHB 4LCWD 3VJ6B 3QQNA 1IQDA 3T0EB 1MFNA 2DMKA 4QHLA 2Q7NA 1XCQB 4PLJC 1U41A 4OF0A 2YA1A 4UILL 2HJFB 3CSYB 1UXSB 2DBLL 3U30C 2P47B 1U0QA 3O6LH 1Q38A 2HKFL 3WLBA 1IT9H 2P8LA 1RVFH 3MLWL 5J3HD 2G5BB 4HKXA 2W60A 1IGTB 3T1FA 5DVNA 3WFEL 2WW8A 3QXAB 3VFNB 1G0YR 1G9MH 5FB8B 3R8QA 1FO0L 1J1PL 4QOKE 3KYKL 2WUBL 3PP3K 1J05B 3TF7C 5BW7C 2EE3A 2PETA 3SDXA 5HI3D 2VKXA 2QADB 4LP5A 3DVGA 4OZHE 3CFBA 3GI9H 1YEIL 3VGDA 3T0EE 3T0VA 3QNXB 1G6RA 2EDFA 5CBEB 3WUZA 4PG2C 3IFNL 1AKJA 1F90H 2JJSC 1EO8H 4KAQH 4IRJB 1J5OL 2V5TA 5D72L 1T20B 2EDEA 3RVXC 1YN6B 1I1AB 3FONB 1BD2B 2XZCH 2YPLA 3O6FA 1OT2A 4NWUL 2EO1A 3UBXB 5EG6C 4DOHB 4FN0A 1I1FB 4MQXC 7CGTA 1UM6H 2YMXL 4DTGH 4JFOA 3SDDA 3O2DA 3AB0C 1KLFA 2R4RL 1T22B 1C7TA 2IBZY 1JNJA 3VXQA 3VGGA 4PPTA 1V3KA 2CIKA 3BIKB 4JCLA 1EEZA 2WNGA 5FYJL 1WBYA 2XWBA 4I0PB 2BJML 4K55A 4X99A 5H94B 4EQ2A 5DFVD 3CX5K 3LN5B 4NFCA 1EFXD 1SMAA 3P73B 2YPKA 1W0YT 4JREB 5CSBA 4LIQH 2V17L 4HX1A 2AJXL 1N5AB 3QWOB 4DOHE 2DN7A 2GAZB 4PJ5B 4JFEA 5IBLD 1WVZA 1ZWIA 5DD6B 25C8L 5EBMB 1J7VR 5EC2B 5HSFA 5J13B 3RWGA 3TBWA 1A7NL 5EO1A 1GZQB 4RMVA 4X6CA 4KUCD 2WUCL 4DZBA 2DTSA 4X6FA 2D03H 1T1XA 1G84A 4NQXA 1F58H 2OSLB 2GEEA 2VDLL 1UQSA 4PBXA 2H45A 3G6JF 1YMMD 3RZCD 4XCNA 3LZFH 3DX6A 3BKJL 1PG7X 3FT2B 3KPRD 4Z0XA 4QYOB 1G9NC 3QRGH 3U4BH 1JJUA 1I9RH 2FX7L 3GSXB 1Z9MA 1AGEB 2HFFA 4GKOA 5F89B 3KGRA 1V05A 4HZAA 4HWNA 4ISVA 4K3HA 1JL8A 2P43B 3STLA 1NEZG 1IKFH 4K7PH 5ADPL 1I1RA 5LCVL 4PRHA 4UT7L 2AEPH 1TENA 1U8MB 4Y4FC 4FG6C 1IC1A 4TVSa 1A9BA 3MJ9L 3EO1B 4NQDE 2VAAA 2ZSWB 5IVXB 2E8YA 3X3FH 5MENB 3B43A 1CXHA 1UT9A 1OVZA 4M8QB 3BT2L 3HLAA 3QB7C 3V52L 5DZOA 1JYVA 3SKNB 3U4EB 2Q87A 3T77A 3WIIL 5GGQL 1MFAL 3MUY1 3VDCA 4BFIB 3U7WH 1OWRM 5IB2B 1PZ5B 2ZOLB 1KV3A 3GBLA 2ICEA 32C2B 1KT2B 2IH3A 3O3AB 5L7XH 2ZUWA 4W4OA 1WWWX 3QXUA 4L8DA 5FGBC 1JIBA 3FO1A 1RJCA 5E5MA 4B50A 1YEEH 4P2QB 3VE0A 4HV8B 1CFNB 4U31A 4J7RA 3TFKC 2PXYA 2CGRL 4NO5A 5GRWA 1DE4B 3SO3C 4V1DE 4YE4L 5MENE 2X4UB 1UB6B 3AREA 2VWEC 4FQ1L 1P6FA 4HHAB 3MCKA 3QDJB 4QHUB 3EOTH 2YXMA 1JNNL 2VC2H 2F58L 5DR5H 1CQYA 1FP5A 1XH3B 3R06B 4YDKH 1A1NA 3PWPA 4NN7B 4D94A 1A7RH 3BJLA 4QRUA 5JHLH 5F7EH 5K59E 1AO7B 1QFWM 5A43C 1J0HA 3NGBC 3NIDE 3NZHH 1OW0C 3WS3A 2ESVE 4JAMA 2XV6B 4P2QE 1TVBB 1FNSL 1AY1H 3U0TA 3VGFA 4WFGE 1UXWA 3V7MA 5I1CH 1XGYH 4NOBA 2X4RB 3IJHB 3TA3A 2GTZA 4ZS7L 5I9QC 2BK8A 4UV7L 5DK2A 5FGCE 4HW6A 4IIQC 5FEBA 3OXSB 4WW1B 4MJ6A 2BVYA 3O9WB 3P0GB 1PYWA 3V5KB 4WIQA 4JJ5B 4NM4H 2F74B 3I75A 4H5SB 5LGJA 1KB9K 3G9AB 5K33A 3RRQA 2R1YB 1EUTA 4YBLB 2A6DA 3GSQA 3HE6B 5JQ6H 1LNUB 1XGPB 3QXDB 3DO7A 2FL5A 1VESA 3HMXA 2A6IB 5FO7A 2DI9A 4TUKL 4YUEH 1KSRA 4WFFE 1YC8A 5B3JF 1NAMA 3O3BA 4JFPB 4LRNH 3LKNB 5IMKA 3BYYA 3OR6B 3VFRB 4BH8B 3BPLC 4HBQA 3MRFA 2C1OB 4U7SA 3DOSA 3Q48A 1TPXC 4PREA 4G9DB 5ACZA 2VISB 4L9LA 1MREH 4OGYL 1EO5A 2DJUA 4OIAA 2FATL 1MJ7H 2Z31B 3ARRA 2BVOB 4RMUA 4GUPA 4LHQB 3DLQR 3MV01 5BRZD 1Q72H 2DLIA 1R0AH 3H3BC 2L7UA 4JO3H 1A6WL 4Q7DA 3S96B 1NBYA 2JIXD 1A6VL 5IMOA 4M3JA 4OIBA 3IDGA 2WIMA 4AEIH 2AKRA 2JKXA 2V2WA 3CH8A 1QRND 1UVQB 2B39A 4D0DA 1WEJL 4XVTH 5EOQH 2NXYD 4BQ9A 4OB5L 4QOKA 1WK0A 5CMAB 3VI3F 3MLTB 4P5TC 2CKBL 5DC0A 3TH2T 4MXWH 1TIUA 5FFLA 1NEZB 2QQLL 4ORZC 5IQ9B 3IDXL 1TLKA 2FEEI 4JPVL 1CZ8L 2H3NA 3T0EA 2CJUL 3NTCH 4LPCA 2A6JB 2CDGB 2VXSL 5AZEL 1XCQA 1ROWA 4APQA 4N68A 2JB6A 3CIQA 4NP4L 3RVWC 1UXSA 2PTTB 4L1HA 1G0DA 2AABL 4XMPL 2LU7A 3GRWL 2OZ4A 2G5BA 4YHZL 2KZWA 1C16B 1G9NL 4RNRA 1U3ZA 1MCNA 2WBJD 12E8H 4P2YA 3QDGD 3VXNB 1G9EA 1JZ4A 2P8PB 4DKEL 4RFNC 1HHKB 1IGJA 3MLRL 5FXCH 3WD5H 4E41D 2VTFA 4OKVB 1J1XL 4TUOA 4IRZL 4LSVL 2NCMA 4LSPL 1FORL 3QDMD 2Z8RA 5DEZA 4QF1A 4PJXA 2EKSA 4Q58C 3IJSB 1D9KD 3JWNC 4IRJA 3VXRD 1DQQB 4MAYB 5KSUB 3UPCA 3FONA 5HHMD 4N90D 5D2LB 5JA9A 5D93C 5GZND 4UU9B 1ULVA 3SOBL 1RZGB 4U1MA 5JOFA 5DJXB 2WWKO 3S34L 3OJMB 1F00I 3PWUA 5EO0B 4DAGL 5IWLC 4HF5L 4XNUH 5D6DC 5GS1C 3I6KA 1ZGLB 4FXLA 4KK5C 1VGKA 4ZFGL 5H94A 5IM7B 3U7YH 2IGFL 2XYCA 3W39A 1D5XB 5ECJE 2PYED 1MI5D 5CFHA 5I1HL 5JXEC 1N5AA 1H3WM 3I50H 3SGJA 4NNXA 2OK0L 4AEEA 2YPVL 1DBML 4RIRB 4LCWE 4G6MH 1MFDL 1LO0L 5JOPD 2B1HL 3MRGB 2L4OA 5EOCH 1U6AL 1FGNL 3HFML 5IVNA 3FFDA 4OCWL 4NQDA 4ZUUB 3E6FB 4XNXL 1KB5B 5C0FA 4PJHF 1GVIA 2APXA 3C6LD 1P5UA 3DV6A 1AD0A 4MCYA 1OP5K 1IQWL 4ZUVA 2K7QA 2V7NB 5ICZB 5CKAA 4LCUA 4D8PB 4X83A 5KTEH 3QO1A 1HQRA 1LE5A 1AGEA 2OX5A 1UA6L 3L3IB 4HXAH 4OM0H 4ZDHA 5F89A 4XP4L 1RZKC 4W4NA 2CPCA 1QFOA 1JFQH 1SBSH 5I66B 3IVKA 2B1AL 3PG2A 2HFGH 4LOUC 4GMSH 5A3ID 2ZUQB 2QHLA 3CDGB 3EO1A 2XZQL 1CGVA 4C54A 2DQJL 4V1DA 4DVRL 1D5IL 3GHEL 4PJ9B 1UACL 2XPGB 1SEQH 4OCXL 1K2DB 3F5WA 3RKDD 3U4EA 1MCHA 3JXAA 1INDH 1HXMB 3HMXH 5AWNH 1PVHA 4L8SB 1VA9A 5HDOA 1NBZB 1CTOA 4QTIH 4BFIA 5IB2A 1Y6NR 2B5IC 4J12A 5T1LB 4FQXC 2NY7L 5C0CD 2ADFH 4RAUA 4Z7WF 1JNLL 3GBMH 1HHHA 3O3AA 5D7IF 4HG4J 5AYUL 4GRLB 5DO2C 4HUUB 3KPLB 4YX2L 1QFWH 2ESVA 5FKPB 3VWKB 4WWKB 4Y5XB 5IG7B 2M26A 5E7FA 1RY7B 2A73A 4OUOA 1DE4A 1LEKA 3O6LL 4X7CC 5DURD 2BSRB 1MCWW 5ALBH 3QWRA 4PJXF 1UG9A 1J87A 1RZFH 1OTSD 2ZNXA 4BSVB 4OI7A 5GQBA 4IRSB 2FGWH 3H2WA 3SE9H 3ULSB 2Y7QB 3R06A 5EU6B 2BX5A 1OAKH 4LFHG 3DRTB 3BUYB 1FV1B 2BVPA 2DQGH 3CVIL 1R5VA 3GI9L 3C6SB 2F15A 2XN9A 1MRFH 4LLAA 4M62L 4P2RD 5E70A 1FFOA 3HE7A 5DJAB 1FFPB 2M1KA 5C0NC 5C71A 1Q94A 5ALCH 1EO8L 3GJFB 4FFWC 4LEXH 1HKLL 1RIUL 2F53E 1ACZA 1DANT 3O0RH 3U46B 3KHOA 1I7TB 3QIUC 4MD0B 4OCLC 4PUBH 3DIFB 3LN9A 4KHTL 3F58H 4WW1A 5EU6E 5JIHA 2AV1B 5ISZE 3FMGH 5E9DE 3QUYA 1RJYA 4HUWB 5IJKC 4DTGL 2JJTC 2R1YA 3LY6A 4LDLB 2VDNL 1UM4H 3LN4A 5DK0A 3KXFB 1U95B 3MRRB 3HG1D 2GHWB 1CK0H 3LIZH 4PJBB 1XGPA 4U0RC 3DYOA 3TNMB 5MHSE 1BP3B 2A6IA 5IV2A 3M17B 5GZOC 3G5YA 3PV7A 3PDOB 4NBXB 4CDGC 1J18A 2O5ZH 2AS5M 3F62A 3VFOA 3LKNA 2ITDA 3MBXH 2EDOA 3OR6A 2J8OA 3VFRA 1KCVL 4O2EA 2XTJB 1U3HC 4AEHL 2C1OA 3CX2A 3RX7A 2MCPH 1XF4B 3BKYH 2VDRL 1WICA 4GW4B 2Z31A 4AM0A 1MLCB 3VGAB 1Z0NA 4JM2F 4R7DA 5F9JB 3K8MA 3MQIA 2R23B 3S96A 5F7YC 5D6CB 1B88A 4L4TB 3PWJA 3X12B 1LILA 4U0QB 1TJHL 4PJBE 3VD7A 3OGCA 5JW5B 2D03L 1F58L 5HPOA 4NHCH 1T7ZA 1M71A 2EH7L 2EZ0D 3O41A 4AG4L 1FAIH 3L5JA 1MLBA 1UYWH 2IJ0C 3LZFL 4M1CC 4GW1B 4XC1H 5TQ0H 1NEZA 2NYYC 4LVHC 2XTJE 3QRGL 4I77H 3U4BL 2F19H 1GC1C 1RSFA 4S10A 3H42L 5KSBE 5IJVA 2P24B 3U6RB 2WP3T 1EVTC 3X3GL 4WV1C 3FO0H 1CFTA 2ICWI 4PP2B 4FZ8L 4K8RH 1A3RH 1KTLB 3FTGA 5H37H 2AEPL 4XTRC 3FB6B 4XVJL 3ARFC 3O3EB 4G8GE 3W9EB 3QULB 3EYUH 1RZKL 4CU7A 1ZHNA 4KK6D 4KJQC 2AERT 4N5ED 1D5ZA 5DDHB 4TTDC 1HHKA 3P9LB 3HNTL 1KPRA 3QHZH 4PS4H 4QRRB 4WO4B 1NCAL 1C1EL 1JWMB 2AK4B 2D7TH 2D7NA 3P0YL 4F9LA 3IAQA 5E7BA 4NKIL 2WZPD 1RUPH 3A0OA 1MIEL 4BKLB 3P4MA 4JRXD 4OZGB 4ZYKA 3RZWA 4K94H 5FUCE 5HYJA 4DCQA 4NWTH 1UZ8B 1A1MA 5DJCA 3QZWA 2B20A 1YPZF 2JCCA 4LSRL 4NQVA 4L8BB 4F15C 3LH2L 4PGDA 1F6AA 1RUAL 3GJEB 5I75C 4P23B 5BMFH 3UAJD 2NY4C 2VL4A 1ZSDB 5DJXA 3FT3A 4LCWA 5EUKB 3ZDYF 4YHYC 5F9DC 1VPOH 1UB5A 5EO0A 5I1EH 1TNNA 3THMH 3GHBL 2PW2B 4YDKL 4LSSL 1BD2D 3MRQA 4CVZB 1ZOXA 2GJZA 3PWNB 1A7RL 4RX4D 1CE6A 5LBSH 4OGXH 5SV4A 2MMXA 4FQHA 1QBLH 4M7JH 5J9PA 4TVPH 4I48B 4PB9H 2E7CA 5IM7A 4BUGA 3RIAK 5JDJA 1JPSH 1H5BB 1JGVH 4UIMB 3VG0L 3VI4E 1CI5A 1LO5B 1CGXA 3P4OB 5FAAA 1QKZH 3TM6A 5FO9B 5GRJH 5DJ2A 3QCVL 4X4MA 3KNBB 2X4PB 2DMCA 1BVLA 1S7VB 4O00A 2O61B 2M8XA 3FQRA 3WN5A 2NY0D 3QYCA 1T5XB 4PIRF 3D85B 1J0YA 3JUYA 3IFPA 4MJ5B 3E6FA 3H9HA 1T7WA 3FRPG 2ZNWA 3QQ9C 4G6JH 5SX4I 4M5ZH 1N0XH 2CMRL 4FTVD 4ZAKB 3L3IA 3T3PF 3VMPA 1A14L 5B38A 2Y6SC 5D1QA 1A4JB 1QFHA 2OM5A 1P2CB 4IOIA 5SWQA 1KCKA 4K3JH 4W6XB 1MIML 1M6OA 3UPRA 4F57H 3CH1B 4XBEH 3OKMA 5B8CC 2BXZA 5HPMB 1YUHB 4MXQC 4PJ9A 1KIRA 2XPGA 2XQBH 3OBAA 1VACA 4GW5B 4AEIL 3CFJA 3QP3A 5F7MC 1YY9C 3P77B 3B5TA 3H6JA 5KS9A 5EOQL 5CHNB 3FHQA 4Q0XL 4OM1L 4RZCB 3MV7B 1F4WL 5ID0B 1SJEB 4OZIE 2BOCB 4Z7VB 3PL6D 1UZ6F 5EB9A 1J8HB 2CR3A 5HI5C 1MJJB 3AFLA 4A2MA 1G0XA 4WWKA 4Y5XA 4YGAB 1JTPA 5CUSL 1E6OH 1NH6A 9CGTA 4PGBB 4TQEL 1OP5H 2UWEB 4FZEH 4JGJA 3HPLB 5BV7C 1NL0H 2F53A 3VXMB 3RZCA 4Y4KC 1KN2H 2BNRD 1AFVH 4ZFZA 3KPRA 1MI5E 3JWDC 4IRSA 3C5ZB 4LBEB 1EGJH 3EOBA 5IFAH 1H3PH 3AB0B 3MRCB 5ISZA 5HGDB 2H2SD 2EEDA 5E9DA 2P49B 3MV7E 2NR6D 3BOVA 1D3CA 5C7XH 5ADOH 3MGTA 1YN7B 1H3GA 1WGOA 3BO8B 1J8HE 4KHXH 3C6SA 3QDJD 1S3KH 3C87A 5DJAA 1FFPA 2A1WH 2EDWA 2W9EL 5JUEL 4R90H 2Y72A 4PJEF 1BVZA 3REVA 4MNGA 2IPTH 2FJGA 2J5LC 3VXME 5B39A 3EJYC 5SWSE 3ZE2F 2ICWB 3V6OC 2DIAA 4AH2A 1AO7D 4QEGA 4MD0A 3ZDXE 5IHLB 4YXKL 3S88L 1WJ3A 3DIFA 3ROOB 4GQ9H 4QHKI 1X5YA 3QBTB 4U49A 4MJ4A 4HWZB 2AV1A 2H2PC 3F6LA 4H20H 1D5BB 5KSAD 1YEHL 3EYVB 1R3IL 2MKWA 2XNAB 2V5RA 3AMLA 4ZMAT 4XNUL 3MRRA 4ZG1A 4PJBA 3RVTD 4PLKC 4XZUA 1XGQB 2QBWA 2DB8A 4G6AD 4X7DC 4BSWA 1CBVL 1RV6X 3U83A 1KEGH 1NGWB 5IW6B 3SDCA 1CFBA 1I9IL 2AV7B 5E6IB 4IJ3B 1RJLB 5D9SA 3E6HA 4UDUB 3O81A 2V9QA 3CFCL 5FOBB 3HE6D 4JFQB 4HZLB 1H3VA 1FNGB 4PJGF 5KSBA 2G2RA 2R0ZH 3G6DL 3I50L 4ONGL 3BAEL 3QSKB 2YRPA 2YD3A 1R3JA 2R23A 1CLZL 1KEML 4G6ML 2XKUA 3W9DA 3X12A 3V8OA 3O11A 4R96B 1PEWA 3SKMB 5ERWB 2I9TB 4G8GA 5DTFB 1MJUL 4HIEA 5DJDA 2O5XL 1A6ZA 3TO4B 2ATKB 4PBVC 4L5FH 3S3SA 4M5YL 4XGZA 3IKCA 1OM3L 3H9YA 2EYSB 1H0DA 3U48A 3HAEH 4HGWB 4S1QH 3EGSA 1GOFA 4S1DC 3ARQA 4J6RH 3ARGC 2FECI 2P24A 3U6RA 1I3RA 3H7BA 3G5VB 5HY9B 1DVFC 1RZIB 1H3UA 1D6EA 1X5IA 2HFGL 4YAQB 4JM2C 1KLGB 5HYIA 5D1XC 3IDYC 5IVZB 3HZMB 4U1IA 3VFUB 3CZFB 4KK8C 3QEQB 4KUCF 3IJYB 1UWXK 3W9EA 2FLBT 5GGUA 1QRKA 1C12B 4I5BB 4JPIB 4WW2F 2BDNL 4JKLA 5AZ2L 4G80B 2GK0A 5I8EB 4XNYH 3V5HB 4JEGB 5JW3L 2D7OA 4KKBC 1XIWC 5IESH 2H8PB 3VG9C 3EIFA 4XP5H 2VQ1A 3LKSB 2WQRA 5CILH 3DRQB 1OPGH 1U93A 3UTSB 4LLYB 3OHXA 2Y1VA 3NGBB 5KANI 4C83A 1EFQA 5BRZA 4LLMB 1P5VA 5BXFB 3MBEC 4BKLA 5E8PB 3GBML 5C0BB 2JIXA 5CIPB 5HGGS 4JZJA 1P4IH 3OKEB 4CAGA 4PRDB 1KIPB 3LQAC 8FABB 1QRNA 2YUWA 3L9RA 5I9QB 4JB9H 3GMRA 4JFFB 1RIVH 3SKOB 4P59L 5AAWA 3PWVA 2X9XA 5EDXA 5FYLD 3D1MC 1QSED 1QBMH 2GITA 4MAYD 1N8ZA 2YSSB 1FSKC 1JE6A 1AGFA 3MV9B 3W2DH 2OXGA 3HPJA 3JV5A 4NQTA 5BV7L 4Q9BA 3WFHA 4ZOAA 4WGVB 4WI6A 4Z77A 2HT4C 3S5LA 4CU6A 5HJ3A 3V4VH 1YQ2A 3RIAF 4KJWC 2WBJA 5GGRB 4J8RA 4PD4J 1H5BA 4FQ2H 1I8KB 2C1PB 3OB0K 2BY3A 4UIMA 3KLSA 4HCRA 3MJ6A 3BPLB 4OGZA 5I1DA 3P4OA 5KANG 3BKMH 3DYMA 4ELKA 3UTPD 4FQLH 4GKNB 2AI0L 3RWDA 2ICCA 4QTHB 3GB7A 2W9LA 5CGMA 4LCCC 3NN8A 3KNBA 5INCB 2Y5TB 4UINH 4PUBL 5DHYB 1G7JA 4F7MB 3F58L 3EDJA 3RHWK 2O61A 3FMGL 1YNLH 3MV9E 3NACH 4XRCA 3MUGA 3D85A 5FUOH 4MJ5A 3ULVC 3MACH 1UM4L 3VXRA 3BZ4B 5J11C 1UKQA 1MFBH 5D1ZC 3RY5A 1EVUA 1IKNC 3L3JB 1T21A 2O26U 1DDHB 1MRDL 1FL3B 2R0LL 5ESVB 3C8KB 5T5FH 1T0NA 2Z9TA 4N9GA 4P2OC 1JK8B 5D5ME 3IDNA 1IAOA 1U8LA 2O5ZL 3HA0A 1KG0B 1P2CA 2Z92A 4LKXB 1BJMA 4OLXL 3ZLQC 5FO8A 4OZIA 2NY2C 1B0GB 4M61B 2OL3A 5D7JB 4FQIH 2JB5H 3C5SB 1S5IH 3OL2A 3TCXA 3BIBX 3P40A 3GGWA 4EBQH 4JRXE 5HPMA 1FVEB 1KJVB 1I4FB 5ETUB 4V2CB 4K23L 1S7XB 4PJFE 1JHKH 1BF2A 5TDNA 5DRNB 4GLRI 5ICYB 4N1EA 4RFNB 1RULH 5C3LD 1MI5A 3P77A 1JZ7A 4WHCA 5ESAA 4Y5YA 1EMTH 3UTZA 2H9GA 3AY4C 1FAIL 2WLYA 1FG2A 4XC1L 5DVKA 2I27N 3MV7A 2PO6A 4RCAA 4OF7A 5ID0A 5J12B 4I77L 1SJEA 4X5WA 2BOCA 2F19L 4K9EC 5E2VH 1N3NB 3D18A 3QNYB 4ESKA 1MJJA 1HOCA 3NFNB 3L5IA 3MRBB 3TCLB 4JE4B 3M07A 3BPOB 3HZVB 4PGBA 5C2BH 3Q1SH 4HWUA 3C6LA 1A3RL 5JTWA 4U1NA 1MF2H 3VXMA 5D93B 2XTLA 3WFBH 5SWSA 3PDGA 2J8HA 3D2UB 4B41A 2I07B 4GRLD 1DEDA 2BRQA 4MA8L 2JK5A 1PG7L 2K1MA 3EYUL 1G7MB 3UZVB 1BFVH 3E3QC 1AD9B 3AUVA 3MV8D 4UNVA 3MODH 4XX1E 2ITCB 1MFEH 4MNQB 3IDMB 3O2VL 3HMWH 4RMWA 4PJCF 4YDJB 1TETH 1IC4H 5CZVH 2EXYC 3TJHD 4WDIB 4MMZC 3O6KL 5DC9B 3ZKSD 5H35A 5IUSA 5DLMH 3VCLB 2HTKC 3O6ML 1ED3B 5IEHB 4JFZL 1ETZB 4KFZC 3DETD 3QQ4B 4HQQL 5D70L 2E9WA 4A6YA 1YYMH 5GGTH 1CVRA 1ADQA 4PGCA 4XPBL 4NUGL 3EKCA 1D5BA 2XZZA 5C0CA 1IGFH 3QUML 3FCTB 3IS0X 3OXRA 3UZEA 1MCLA 2OJZL 1SM3L 2XNAA 2HVKB 4MNQE 3PJSA 3BIAX 3Q5YA 5GS0L 4DZ8B 4D9LL 2CLRB 1XGQA 2W0PA 4JFDE 1L0XA 4QRPD 4OGXL 2WM0A 1LP9E 4M7JL 4OT1L 4NC1C 1E4XH 1XR8B 1YJDH 4KY1L 5E6IA 4MNHA 5IHUH 1CCZA 3WE6A 4LVEA 1JGVL 1N2RB 2QSQA 4GO6B 3TBSB 2GT9A 4JFQA 5GHWH 1DQDL 3OKLB 2VE6B 1QKZL 4HG4K 1HH6B 1BZQK 2BY2A 3BH9B 5GSRB 4FABL 3DNKA 4R97C 2QV2A 1TITA 1MCPL 4XAWH 3BPCB 3SDAD 1UGNA 2WSKA 3FRPA 1YECL 3TYGH 3DTXA 2NQCA 3ECBA 3SKMA 4ORGA 1QQDB 3NIFE 2APWA 5DTFA 4JPWL 4NRXB 4F2MA 4IMLB 4F3FA 2D7QA 1RPQA 3ZSTA 2BNRE 4G6JL 5LGHH 2KKQA 4Q6IA 1ZS8B 3CLFH 3WDJA 1H8NA 3K46A 4AQ1B 3WJLC 3P9MA 4NZRL 3ZHLA 3M8OH 3ARDB 5HHOE 1F3DJ 4OBSA 4Y5VA 1N6QL 1N59A 2VB5A 1YNKL 3SE8L 3WFZA 3FJTA 3KYOB 4G3YL 1EUUA 3ULVL 2PR4H 5HY9A 1FFNB 3G04B 1RZIA 3EFDL 1JGDB 1HKFA 2BSED 4O9HL 2AJVH 2NW3B 3PGFH 5JXAL 1A7PL 1U58A 4XBEL 1EJOL 3FN3A 3WO4B 1QFUH 3F7YA 2VKWA 4HKJA 3AAZB 1Q9KB 1BX2B 1VEMA 4LASH 1C12A 4JPIA 1T6VN 2GCYB 3L3HB 2HMIC 5I8EA 1DQTA 3T4AB 2NXZD 3B9KC 4B7IA 1ZHLA 2ZOKB 4L3EB 4G8EA 3LKSA 4JRYB 3WUWA 3WIFA 1LDPH 4JQIL 1FG9C 3KYAA 5FYJD 4ZFOA 3RGVD 2FD6H 4X4XA 3W81A 2OL3H 4CNIA 2P5WB 2IH1B 3MJ7B 2CDFA 1KIPA 1SEBA 4GH7B 4JQXC 4Y1AD 2VLRD 4W6WB 1T3FB 3T2NL 3K2MC 4WTZG 1NDMA 2AK4D 1OAXH 1NSNH 2D2OA 3RI5K 1A9EB 4FZEL 1ODAA 3ESVF 1NL0L 5DJ0B 5F7DB 1BBDL 2ICWJ 5I15H 1PQZB 1RMFH 2IAMD 4K9EL 4GKZA 5J6GB 5JW4R 2FHBA 2QL1A 5DVMA 4JRYE 3HUJF 3GSNH 4BH7B 3BESR 4QT5B 5IFAL 1H3PL 1QZ1A 2YSSA 3LEYH 4YXHL 4PGJA 1CS6A 3QIWD 4F8TA 3V5DB 3MV9A 1MCRA 5JORB 5I6XB 5C7XL 1FN4A 3A6CH 5CEYB 1CIUA 5ADOL 2PKDA 3C08L 5E8DH 4R4FL 4LFHD 3IETA 1EZVY 4KHXL 3BQUD 1SYSB 2DOCA 1S3KL 1UWXH 1KXVC 2P7TB 2P5WE 1ORQA 2A1WL 4NRZA 2C1PA 1NAKL 4KQ3L 2IPTL 5D5MA 1WFTA 4GKNA 1B3JA 5SWZD 3U36A 3MO1B 1QA9B 1XF5A 1LEGB 1NUDA 5L8JB 3HRZB 1UWGL 2VUOA 2GKIA 2Y5TA 3TP4A 3OKDB 2IALB 5BO1H 4GQ9L 3RHWF 4ODSH 4WHYH 4H20L 3SPVA 2P44B 3WLWC 1G7IB 2CKNA 2XA3A 1MNUL 3EOAB 3KS0J 4JRXA 5F3HA 1HYSC 2HLFD 3BZ4A 5J1AA 2WWMD 1MOEA 1MWAA 4PJFA 4N0FB 1OCWL 1B4RA 1TZGH 4P4KD 5FM5M 3RAJH 3BE1H 2DQFB 1KEGL 1XCTB 2EXWC 4LVHB 1JK8A 3UC0L 1B2WH 2VLJB 3EO9H 1W0WB 3CU7A 1IBGH 5C9JB 2HP4A 4I8DA 1O5DT 1G1YA 4M6NH 4M61A 2JJUA 5D7JA 2LVEA 3H3PL 4RRPG 1JWSB 4NBZB 3MXWH 2R0ZL 4QCIB 5HYEA 1YNTB 3B4NA 2NY3C 1ADQH 5BVJA 3MXVH 4RX4A 1CL7I 1KF9B 1SJHB 5EBWB 2ZCLH 1BHGA 3ARFB 1JV5B 2D31A 1I4FA 3KYNA 4HGMA 1KLUB 2XKNB 3MNZA 1S7XA 4H88H 4ZPVB 1QR1B 3GBNL 5DRNA 3LPWA 4PLJD 2ARJQ 4KC3B 1JPGA 5DHVH 1WT5C 2AK1H 4NC0B 4LCYB 2J7LA 2KBGA 1JYWA 3RDTC 3CZJA 3KPQB 5GRXG 1I1CA 3CXDL 4JG1L 1Z5LB 1FZOB 3PWLB 1DUZB 1ZLVH 1T0MA 5BS0D 5I1LA 3CSBA 3KPPB 3QNYA 1KPVB 3FT4B 3DV4B 5ABDE 2XACC 1U92A 1S7RB 3RPKA 4M1DH 2B4CH 2VDML 5AD0B 1NCCH 4P57B 3U2SA 2KPNA 3CGTA 3AM8C 3D2UA 4I3GA 4F15B 7FABL 4RGNB 3UJIH 5I1KH 2E6PA 2E6QA 5CJ5A 1BWWA 3SHSA 1KACB 3B83A 4JN2A 5L9DH 2LTQC 3ARWA 3RVXD 3T3MF 4XNYL 1T7XA 2RJMA 2XWJB 3MREB 1AD9A 1OLZA 3EAKA 1BREA 2YRLA 4YK4B 5EZJA 2ITCA 4QNPF 4EXPX 4TSAH 1AQDA 3RUGE 2VSCA 4MNQA 1OPGL 2V2XB 2VDQL 4L1DA 4JZOB 4MQXD 1U8NA 4YDJA 4JFDA 4RSVA 1XZ0B 4JANB 4KI5C 2CSPA 1MAMH 1LP9A 1KCUH 3TLRA 1K8IB 1VFAB 3QDHA 1ED3A 3O3DB 4MQTB 1T2QL 4HPOH 2AXGB 4RGNE 2ZZUT 5DVLA 1EH9A 3B2VH 4J4PA 4JHAL 5J6HA 5ICXB 4JB9L 1DQJB 2BMKB 4OZHF 5DJYB 5C09B 3P0VL 1BIIA 2HTLC 4FFYH 4Y7MA 1GGBL 5M94B 4H8WC 4PRID 4PJAB 3FCTA 1QBML 1MCIA 3S37X 4Y16B 3PL6A 4U2ZA 5JLZB 1L9NA 3CVHH 5EPMB 3MA9L 4JKMA 4KMTL 1NUGA 1HI6B 3V8CA 3VXOB 1PBYA 1R24A 3MJGX 3RVUC 1FHGA 3HR6A 4PRPE 1U8KB 3VW3H 2BNRA 4X9FA 4OFYD 4WCYL 4LRIA 3NCYS 2Z35B 2Y4SA 1TJIH 4FQ2L 4Y88A 5DUBB 3TBSA 1ACYL 3OKLA 1VB9A 5HHOA 3L3GB 3BH9A 5T33H 2AP2A 1B90A 5DUMH 4F7TA 3OG4B 4KI1A 1SJXA 1W2KT 4JQVC 5HGBB 1JYXA 4KVCL 4KTYA 3UJTL 1TJGH 3QAZC 4UINL 5F9OH 2BNQB 2NX5B 3P9WB 3MRPB 4BUHA 5IKCB 4HH9B 3VFTB 3JUZA 4MGXA 4FRWA 3NACL 3FQNA 2K9UA 4UT9H 5FUOL 5E8NB 4NRXA 3SE4C 3E2HB 4RFOH 3RU8H 3TZVB 3HC0B 2A9NL 4Y4FD 4FG6D 2FLRT 3PNWA 3L7FB 5I71C 1Q1JL 4FFZH 3B8YA 5KVFL 4CJ1A 4G7VH 2GTWB 3ARDA 4X5XB 2X40A 4I9WE 4P49A 1NANH 4BJLA 4YZFF 1VHPA 3MV8E 1KGCE 2F54E 4GAYB 3EO0B 4PY7A 1ZGLP 1WBZB 2FX8H 1VERA 2BNQE 3KPTA 2NX5E 1MEXH 4KXZI 3PABB 4Y4KB 1NGXB 1YZZA 2DLFL 4HC1L 4NT6B 1YYLL 1YEKL 1BX2A 2GCYA 2VDPH 4XXCA 1JHKL 1MWAH 2NNAB 4XNZB 2HG5B 3TFKD 1X5KA 3K80A 1OOAA 3DSFH 2I5YL 1DTUA 2ZOKA 4JRYA 3MOBL 1QLFB 3WYRA 5FYJU 3QA3B 4NNYA 1NMCC 3NCMA 4NN6B 2ATPA 3JTSB 2PF6A 5DA4A 2FZ3B 4XAKD 4N8PA 1JN6B 2J5LB 2IH1A 4ZXBC 1Q9WB 1FVCA 3PV6A 3QEGH 1FLRH 4JFXA 1MJ8H 3UTSD 3RI5F 4LPVA 5FKAB 3ARXA 5C0BD 5BJTA 1YEGH 2VZOA 1CE1L 1S7TB 1MVUB 1BGXH 4XXDB 4BH7A 3HNSL 4M93B 3G08A 3WNKA 4XB8A 4F7CB 2ZPKL 2EYRB 1A7QH 3V5DA 1A5FH 1SY6H 4JFFD 5JORA 4RAVB 5I2IB 3MODL 5IVXF 3ZT7A 5CEYA 3EJZC 1A2YA 4HAFA 4EUPA 1VSCA 4Q9CA 3TVMC 3RWJB 3EHBC 4EI6A 1SYSA 2JJWA 3HMWL 3MMEB 4ODHH 3I84A 2QSCH 3FOLB 3HI5H 1DSFH 3K1KC 4CN4A 1IC4L 4NPYB 3MA7A 1OAQH 1YMHA 4M7ZC 1T89A 2WBWB 1R5WA 4ODBD 2G75A 1WCQA 2ICES 5JMRA 1TQCB 2FR4A 3ZTJH 1JF6A 3RWCB 4PJDB 3RBSA 2FSEB 3HRZA 4PG9A 1ZAGA 1ZGLM 1CR9L 3CAFA 3ME0A 5IB3B 4DQOL 1BFSA 2R1WB 3VFVA 4Z7OE 2E27H 2OJEA 2RCSL 3JZ7A 5CZKA 1FIGH 4P9HL 3OKKB 3DSNA 3VFSB 1HINL 5IB5A 1BWMA 1P84K 3OKOA 4FXKB 2EDLA 2AW2A 4MYWB 1U8HB 3EYOB 4Z7NF 4JY5H 5E2TH 1N64H 4HK3J 1E4XL 1T5WB 4HKBA 2D0HA 3X11B 5C9JA 5F6IC 3RTQB 1HH9B 4JHWH 2IQAB 1HQ4A 1KTDA 1DVFB 3U82B 4OTXL 4P5TD 4QCIA 5MEQB 1Z9LA 3LMJH 5C0AB 5D1XB 5EBWA 4AL8H 4MD5A 3G6AB 1JV5A 4M02A 4PJ7B 1KLUA 3GJFK 3MRDA 3TYGL 3JV4B 4Y1AE 4DN3L 3D5OF 1S8DB 1EA9C 3RVWD 5KW9L 1I8MA 1XIWB 3VG9B 3MROB 3AREC 4LVOC 1MHEB 1OGAB 5HDLA 1MAKA 1DQML 5IMLB 2H41A 4JN1L 3MJ8B 4RA3A 1UEMA 1EEYA 2I60L 3M8OL 2MFNA 3MBEB 4KRLB 3RUGA 1NJ9B 5BCAA 3KPPA 2FWOB 3TBTA 1D6VL 2WINB 1FAKT 5C0AE 1HCFX 4PJ7E 5F71A 4ODVL 5DQDH 2OXHA 2AJVL 4QRTA 5AD0A 3LEXB 3PGFL 4P57A 2DJ4A 1DLFL 4XNMA 1BM3L 5DD0H 4M6MH 1GGCL 5HYQB 4CVUA 1QFUL 2F5AL 1N26A 4M00A 2AJZB 3U0WL 4LASL 1F8TL 1K8DA 1W0VB 1OGAE 3TA3C 1IL1B 1JHTB 1MCOL 1FSKB 2J6EA 4GAJH 2AQ1A 4XMLL 3NA4A 4EN3B 3BP5B 4M03A 3SCMC 3M1BB 5DQ9B 3VFMB 1QO3A 1FZMB 5JR1H 1JGLL 5KVDH 4R2GC 1RAMA 5DT1L 3BWAA 4XT1C 2AGJL 2Z91B 4WI8A 3GM0A 4WTZA 4YBHA 4JANA 2Q3AA 3NAAL 4NN5C 4PRPA 3S35H 2AXFB 1IEBB 3SGKA 3SGEH 2X09A 3E0GA 4PJIF 2J3SA 2AEIT 3DX8B 5TF1H 5INDA 4NSKA 2BMKA 4Y19D 4NO0B 4KK5D 1NLBH 3KYMB 2AJ3A 1R3KA 2BFVL 2G5RA 3LS4H 3WXVL 3O2DL 4OAWB 4Q9QL 3T65A 5JXED 4L9LC 3GSNL 3V0AC 4U1KB 3LEYL 1KJ2A 2AJUL 3QUXB 4OFIA 1HSBA 1HI6A 4D9QE 3VXOA 4NQCB 1LK2B 4HIJA 2VXVL 1RUQH 4NKOB 2IFFH 3QDAA 3WV0A 3DUUB 2MWCA 4CN1A 3QFJB 1FL6B 3CC5A 1I7RB 2VZ1A 3MYZA 5HDQL 1INEL 1T83A 4HIHA 1J12A 1PLGL 3VFWB 2KL6A 2VSDA 2EDTA 1NGZB 2EDNA 4GJTB 3SDYL 1UJ3C 5TJWK 3MV8A 1X5LA 3X14B 2F54A 4P46A 1OSZB 4H0IA 3MRNA 4G42B 3KJ4B 3T0EC 1WAAE 2BNQA 2NX5A 3MRPA 4RISL 1NBVH 1KENH 4APQC 5FECB 3VFTA 1J0ZA 5D2LF 5BZDA 3BVNB 5E8NA 5E2JA 3ZL4H 4LOUD 1UCBL 3CDCA 4ZUWB 1UM5H 1IGIH 5FHAL 3DARA 3QFJE 4XVSH 4MQSB 3OX8B 3RAJL 2W92A 3C5JA 1NEUA 2GTWA 4X5XA 4JM4H 3EO9L 5KVGH 3CFDB 4ETQA 1W72B 2QQNL 5IB1B 5C08B 1RK0A 4YHIB 4HIXL 2QADC 4GSDH 4PFEA 1V7NH 4R26H 3MUZ1 4KUZL 4POZC 3P3YA 5CP3A 2X1WL 2YBRB 3GKZA 4XCEA 1CGWA 4FQXD 5DGQA 1NGXA 1A3LH 1LD9A 3O8XB 4QRPA 5DO2D 3T2OA 4IRJC 4Y89A 15C8L 2EDHA 4KKLC 2BVEA 4H88L 2F8OA 4X7SH 1I1AC 3DBXB 4JVPA 5DHXB 4U6HB 5GSVA 4OLZL 4DGYL 1TZHB 5CJXA 2ARJB 1RHHA 2UYLA 5EIIB 2AK1L 3GKWH 4DK6A 4H25B 2I25N 1OY3B 3QPQC 5FYLH 3DVNA 5C08E 3QA3A 1ZA6B 2ZJSL 1WZMA 3SDAA 4XPTH 1S7WB 1FO0A 1KELH 3RKPA 1U42A 5E0QA 2XFXB 4L3ED 1OL0A 1QLEH 1S9XA 4BZ2H 3NZ8B 1NFDE 1XEDA 2OR8A 5C9KA 2ADJA 4U6YB 2ENSA 3RWFB 4JPKH 2BRRL 4NZTL 2O93L 5L88L 1UENA 3UYRH 4HJGB 5C0ND 4JREC 4DN4L 3W11C 2H6PA 2OTUA 3PQYD 4FFWD 1KFAH 5I1KL 1RZ7H 1KPUA 2EDYA 4XXDA 1AXTL 2X7LA 2G9HA 2D7MA 5L9DL 3MLUL 2A2QT 2EYRA 3QIUD 1DQLH 5J56B 3W0WD 4BQBA 5I2IA 1MCDA 1AGDA 5J13C 5IK3B 3L1OH 2YD6A 2VDKL 3LKOA 1P69B 2YWYA 3FRUA 4JG0L 3ZKMC 4NPYA 1F4YL 3N06B 2H26A 1MHCB 3I6LD 1HWHB 4AJ0A 4XPGH 2R29H 2J12B 1K4DB 4O2CA 4OUUB 1J11A 5E08H 3ULUF 1BJ1J 4ONFH 4R97B 3WHXA 4NBYB 3K8LA 4NNPH 5HHNB 1D7FA 1EDQA 5J4MA 3QH3A 3T4YB 5GZOD 2HFTA 5AG9A 4FFYL 2VLLB 3D0LB 3C09C 3RGVA 3ZZ1A 2J6EH 1U3HD 3GSOB 3I85A 3DUHA 5T1DL 2ZCKL 4F37K 2COQA 3UDWA 1I9JL 1FIEA 4FXKA 3IAPA 4HK0B 3CVHL 1CD1B 2Z0BA 4Y1AA 4ZSOA 2VLRA 2AJSL 2CRIA 1U8HA 2R56H 3EYOA 2Q8AH 1U3YA 3V0VB 1CQKA 5EA0L 5I1JH 3VRIB 1NAML 1QVOA 3VW3L 4NZDA 2HH0H 4ELMB 4IDJL 1NGPL 2IAMA 4ZUSA 3RTQA 5IW1B 1HH9A 1QNZL 2WMPA 1DJSA 2PN5A 1X7QA 4X7TB 1BPVA 3S37H 4M1CD 5JW4N 4AT6B 2ZG3A 4CKVX 1EV2E 4NCC1 2E7MA 2NY5H 5MEQA 4MSWB 2NYYD 2QKIB 4PJ7A 4OLVH 2HKHH 4XAKE 3RQ3A 1IM3B 1P7KA 3BQUA 3T0WA 4X6BA 1LO4H 4PB0L 3JV4A 3FQTA 1S8DA 2UUDH 4NO3B 1FZJA 2AAVA 1BBJB 3B9KB 3HC4H 1JRHH 1F02I 4XP1H 3ZYOA 5LAXA 1MHEA 1B4JL 3WMSA 1OGAA 4XTRD 4HH8A 5IMLA 1BOYA 1FYTE 3V2AR 3I02B 3ARFD 3D25B 1ZANH 3MJ9A 4M7LH 4XPHH 2B8OT 3QJHB 4FFZL 4AMKL 4LNRB 4Z7QF 4KJQD 4HS8H 4NN7C 4KROC 3OB8A 2FWOA 4RDQG 4TTDD 3C9NA 3HR5B 5D4QA 4UIKH 3B5GA 3FZUC 3VXUD 4UUJB 3A6BH 5HVHB 4ZTPH 2VLKB 4P4KA 3D87B 3HE7C 4Q2ZB 4JO4H 1IM9D 4MCZA 4UNTA 5HYQA 4I2XA 1LWRA 4PGEA 1RZJH 4G8FA 5LGKA 1TQBB 2A77H 3QCUH 2VDPL 2VZSA 4WY7H 5EIQA 2EDBA 5ENWB 4NQEB 3JWOH 3VWJB 4HUVA 1ZT1B 2DYPB 5DQ9A 4C56E 1UADC 3O9WC 1QYGH 3S4SG 1E28A 3TV3H 4UTBH 5EZOL 2NY4D 3GJFH 4XNQA 2QQKL 4GBXA 3BKCL 4YBLC 5DJ8B 1RZ8B 2DQCH 2VR9A 5DMJB 2IPKA 2VLKE 3QIBB 2VL5B 1F2QA 1GAFH 1R3HA 1FL5B 1I7UA 2DTML 1FLRL 3ARBB 3K0WA 1RQ5A 4NRYB 3KYMA 2WV3A 3RWHB 3N0PB 1QSFD 4QXTA 5K9OA 3UYOD 4GKSA 3TH3T 1F6FB 1YEGL 5BS0A 2W0FB 4UILH 3AXLB 1BGXL 2DBLH 3ES6B 4WUKH 5HXMA 1WAAA 1ZT4B 2Z31C 5BW7A 2CO7B 2HKFH 3MLZL 3MLWH 1ZKAA 1TFHA 1SY6L 1PY4A 3OSKA 1JPTL 2NTFA 3MZGB 4PTUA 3KPMA 3OAUL 5HHVL 5IVOA 4LLQB 4R4NC 3UTQB 4CDHA 1FO0H 4X6DE 3UO1L 1DBBL 1J1PH 3HC3L 4PG2A 3KYKH 2WUBH 3LHPL 3QFJA 4ODHL 1DSFL 2JJSA 4OCRL 3HI6H 3FFCB 5FIEA 4YPJA 3PP4L 5TH2B 1EEQA 4Z7UB 1HDMB 1OAQL 4U1SA 4YNYB 3QQ9D 1Q9OB 1FNFA 4NJAL 2VIRB 2OI9B 4JDTL 3EOYG 4MA1B 5D8JL 2NPLX 3ELAT 2FYYA 5L0QC 1J0JA 43C9B 4Z8FL 4OZGF 1XF2B 2EIBA 2NLJA 3GSVB 1J5OH 4U6XB 2Y6SD 1NC2B 5CWSB 5DRXA 3LPFA 2X4TB 4XH2B 3CPLB 3WO3B 4FFVC 4NKQB 3FKUS 5EFIA 4PV8A 1KJMB 4J1UB 4NWUH 3ZE1E 3T0DA 2DM2A 4L8CB 2HWZL 1IC7H 4KTDL 1U2CA 3H0TB 3RDTB 4JY5L 3FFCE 3BEVA 1TXKA 1CICD 4MXQD 4OSUH 5C0GA 4JDZB 2XY1A 3OR7B 1CTNA 1S9WA 4P3DA 1VKXB 3CFDA 1W72A 1YY9D 5EBGA 3WFCH 3VGHA 1G7LA 3FO9B 4X8JB 1MHPL 5T1MB 1J8KA 5FYJH 1CD0A 2BJMH 2CKBA 2I26N 1P9MA 3O8XA 3L5WB 3GSUA 1NFDA 1M7IB 3LMJL 2YD4A 5CJQH 1BZ9B 2BVQA 1OP9A 3RX8A 4LIQE 3MRKB 4IMKA 1FCCA 1S9YB 2V17H 4OFYA 5HI5D 3BI9X 3RNKA 2AJXH 2OS7A 3VXPA 4JVWA 3RNQA 1NGQL 5DEGB 4HKZA 4U6HA 4LMQI 4WFEE 2YN5A 4MA3A 1PY9A 25C8H 4MX7B 4Y4KD 4E5XB 4ZD3H 5LWYL 3JV0A 4YWGH 1OF2A 3QFDA 2HVJB 4YDIH 1ZA6A 3AU1A 4HBCH 4BFGA 1XR9A 2WK2A 2FO4B 3QEUA 3MNWB 3TEUA 1CFQB 5C6TL 3BKJH 2RAMA 2RB8A 3O3UN 4CBPA 4Y4FA 1JPST 2HFEB 4ENEC 2Q1EA 4HJGA 4M6ML 5DD0L 3L7EA 4TUJB 1I3GL 1BOGA 1P4LB 3PHOB 3DXAB 1H8SA 2CD0A 3LQZA 5IEKB 5ADPH 1EHLL 3OMZA 3EJYD 5D7SH 5LCVH 1NFIB 4UT7H 3QQ3A 1P7QB 3A6OA 5CKGA 3MPCA 3MJ9H 3G6JB 2NY6C 4ZUTA 4YO0B 3INUH 3GIVA 4JFYA 1UC6A 1VFMA 2J8UB 3ALXA 5D2NE 5JR1L 3FQXB 5HGAA 4LGRB 3V52H 1CDBA 3D3VB 3WIIH 2VITB 3FOMA 1WWAX 1VEOA 4PLKD 4I0KA 2DMBA 1K4DA 5TF1L 4OUUA 1CXFA 1WSST 4FXGB 5CD3B 1BLNB 1C8PA 1Z9SA 1NLBL 4Z7VF 4L4VD 5D1QC 2WP3O 5FA4A 5I1IH 5T1KD 1UEYA 2VLLA 4U3XA 4XPAL 3DMMD 3G6JE 3GI8L 4F37F 1IGYB 2UWEF 3MX0A 3WLBB 2ZUQC 2P8LB 3VH8G 4XWGL 1BFTA 3I2CL 4FQ1H 4HKXB 2W60B 3V0VA 3QG6A 3K4ZA 1PD6A 3PGDA 3T1FB 5J89A 4PJ9C 1JNNH 1OW0A 1OLLA 3D3VE 1YQVH 3QPXL 1M7XA 1FYTA 1S78C 3H9ZA 3IU4H 4OD1L 3SDXB 3BPNB 3MTRA 2GFBB 1DN0A 4L8SC 3DVGB 2P4AB 4M6OL 1FNSH 1G6RB 3EYFA 1AKJB 3EBAA 4IIQA 3MLSL 4N0RA 4S1DD 2X4NA 3EYQC 3ARGD 5EU4A 3VWKC 5E4IA 1L0YA 4WWKC 1JHLL 1RD6A 2AXHA 4Y5XC 4HMDA 3PE9A 5D7LE 1QFWI 4I13B 4W6YB 4ZS7H 4UV7H 1DVFD 3R1GH 4WGWB 2YPLB 3O6FB 5JPNA 4JM2D 4JO2L 5EU3B 5D1XD 4XVSL 4H1LA 1WFNA 4WUUD 4IRSC 4KK8D 3QJHA 5IF0B 3U4AA 4JFOB 3SDDB 4C56A 5I8OH 5DMGC 4LAJH 1PSKL 4JM4L 4QY8A 5KVGL 4KKBD 1XIWD 3GMMA 3W0WE 4B7LA 3GMPA 4OQTL 4R4BA 2CIKB 4TUKH 2XA8L 1WQVT 5KG9A 3TYFB 2VLKA 1PX3A 2XWBB 4X99B 4JLRA 1C5BL 4Q6YA 5F88A 3I6LE 5TE7H 4OGYH 4HX1B 2FATH 1WITA 4JFEB 4PJ8A 1N5YL 4UI2A 5GS0D 5ENWA 1ZWIB 5CBAB 1A6WH 1A6VH 1ZA3A 3RWGB 3TBWB 3HB3C 5EO1B 4N1CA 4KKAC 5C0EA 4DZBB 4X6CB 4XP6L 3E1F1 4X6FB 3LEVL 3FO2B 4LSUL 5HHQA 4S11A 5DJ8A 1WEJH 4X6DA 5TE4L 3NFSH 4XCNB 2CKBH 1QTYT 1FL5A 1IAKA 2W65A 4JKKA 3ARBA 4G6FB 3RJQB 3B6SA 2QQLH 2HT4D 3IDXH 3SDCC 1GPOH 4JPVH 2DQUL 2CJUH 5GPRA 4ISVB 4DKDC 5AZEH 2XTJC 3STLB 5B4MC 2W0FA 1JZ8A 1NCDL 3AXLA 2AABH 4XMPH 3GRWH 4PRBA 1KYOJ 2UVEA 4YHZH 2BVUA 5C07D 4X6CE 3ROLA 1G9NH 4Q97A 1A9BB 3NABL 3QI9A 3U0PA 2VAAB 2IF7A 5B3JE 1OAZH 4YEFA 2PCPB 4LLQA 5BOZG 5L2JB 4HT1L 1OARL 4DKEH 4LPXA 3HLAB 5GGSY 3V79C 1A22B 1CLCA 3FFCA 3ULVD 3K4DA 3MLRH 3JTTA 3T77B 3OZ9L 4D9RD 5D1ZD 1AGCB 1J1XH 4J3SA 5K9KB 2R29L 2VIRA 2YKLH 3IXAA 4IRZH 1VGEH 4LSPH 3RPIA 1FORH 2IH3B 2X1XR 2E7HA 4P2OD 43C9A 1XF2A 4NNPL 5CEXA 5DMIL 5AUMA 4L8DB 3GSVA 3EDEA 3FO1B 4U6XA 3VH8B 1KB5L 3VE0B 2NY2D 3SJVD 5IWLA 2PXYB 3VI3E 5FUCC 4LVNB 4NO5B 4ODUB 2D4FA 1AR1C 1SYVA 5T3ZL 3IKKA 3AREB 1I7ZA 3NCEB 2PW1A 3TO2A 3S34H 4D3CH 4GG6F 3KPNB 3OR7A 1C5DA 1A1NB 3PWPB 3U1SL 4WO4C 3TGXA 4QRUB 2ZCHL 2APBA 1TTGA 5T1MA 3S37L 3WS3B 5JNYA 4WWID 4YH6A 4ZFGH 4YGVB 4P3CL 1Z2KA 2FJHA 1MFCL 2PUQT 4OBRA 3B2UC 5I1HH 2AEQL 2IBBA 3MOQA 4OLVL 1G7HA 1KC5L 3HNVL 1LO4L 5DEGA 2OK0H 3TA3B 5SX4H 2YPVH 2GTZB 1DBMH 4WI2A 2NXYC 3VXTA 3HC4L 4MX7A 2YN3A 4E5XA 3O4LD 3BUTA 4PLNC 2B1HH 3ULUL 2FJFA 1XF1A 1FGNH 3HFMH 4R2GB 1PYWB 4M7LL 1J88A 4OCWH 4E9LA 3I75B 2DF3A 4HS8L 4S2SA 2A6DB 5D2NA 5H37G 3GSQB 1CFQA 2QR0A 3ZDZF 2FL5B 1NGYA 4OLUH 5FO7B 4KH2A 1OQXA 1MCEA 4YFDB 3CSGA 4U3HA 4XP4H 3BZFB 1MCCA 1ZLWH 1H5BC 2EXYD 5IMKB 3PHOA 3N9GL 5E5RB 4K3EL 2HTKD 5IEKA 2B1AH 4PREB 1RZJL 5ACZB 4L9LB 1IVLA 3ZT6A 2A77L 1NFIA 2OMBA 4WY7L 1F3JB 1OB1B 1P7QA 2UV3A 4GUPB 2B7DT 3G6JA 1K4CA 2XZQH 4YO0A 4WI9A 2DQJH 1T7YA 1NBYB 4DVRH 1D5IH 1VENA 3GHEH 5IMOB 1ORSB 5JW4M 3IDGB 3HZKB 2FEEL 4FQXA 4OCXH 3TV3L 1LGVA 5ILTH 4UTBL 2AKRB 4CMMA 1WTGT 1AGBA 2V2WB 3D9AL 4S1SL 2VITA 3TT1L 2O5YL 3WS6A 4FXGA 2NY7H 1JNLH 1A1OA 5F21B 3DHMA 5AYUH 4XC3L 5EIVA 3MFGB 2IQ9L 4YX2H 2H3NB 5GGSA 1QEWB 4G8IA 1AHWA 2R2CA 3VXSB 4APQB 2JB6B 4JKPL 3L3KA 1IGYA 4MJID 4WUKL 1CLYL 1CXEA 5I76A 1NQBA 5D7LA 5FA3A 3GUTA 1F4HA 4RNRB 3DYPA 4N0YL 3L5HA 3D0VA 1CT8B 2ZUSA 3UEZA 5D7IB 1TNMA 4TPRH 3PQYA 1IGJB 3HI6L 5EZIH 2GFBA 2DJSA 2YD2A 2V7HA 2MNUA 3L95A 1A6TA 3CVIH 2VJXA 4TUOB 3QIUA 4M62H 3W0WA 2CK2A 2PO6C 3FHAA 3VXSE 1JGEA 4QF1B 4PJXB 2EKSB 3RY4A 1HKLH 5LXGL 1RIUH 3GDBA 5IJKA 2D3VA 1M4KA 4W68A 2X89D 1KNOA 4NKMB 4RMRA 4QXUH 2APFA 1G7PB 4Z7WE 1LO3H 4KHTH 3F6IA 3QUKA 2VR5A 5D7IE 1IC7L 3KG5A 5EU3A 3N1MC 5C0DA 1WLHA 5B22A 3C5ZC 3T2QA 5IF0A 3KLHC 4HUXA 2CXKA 4U1MB 5JOFB 4OSUL 2VDNH 3PWUB 1AC0A 3U9PL 2HMID 3RP1A 4FOMA 5JIPA 3B9KD 3I6KB 2Q3ZA 2X1QA 3WFCL 1X5FA 1FNLA 3TBVA 1A4KB 5DGRA 2QHRL 4PJXE 2N56A 4RFEA 3TYFA 2KDGA 1VGKB 4GRMA 2Z8WC 3W39B 5MEOA 2Q8BL 1KCVH 5CJQL 4AEHH 3NIGF 2VDRH 3S8WA 2BSSB 3RWIA 4NNXB 4QXGH 5B21A 2MJWA 5CBAA 1AJ7L 2Q7YB 1GJIA 4L4VE 4GS7B 4TNVK 4ZD3L 4YWGL 1TJHH 1WBXB 3QISA 1MSPA 4QHMB 3FFDB 3HS0A 3OPZL 4YDIL 4KK9C 4NQDB 4HBCL 4MDIA 4WFHD 3FO2A 4XPFL 4CVXA 2XZAL 4KGLA 5C0FB 2EH7H 4AG4H 5IFJA 1AC6A 3ALWA 5MP6L 3DV6B 1Y0LB 4EEEA 1AD0B 2DYPD 4MCYB 5I74C 4ZUVB 5IR1B 1K3IA 4LCUB 4EI5B 5SX5K 2YR3A 3QO1B 1HQRB 5FF6A 1S7QB 3SGDH 1LE5B 5E6IC 4ZDHB 1S5HB 4IJ3C 3H42H 2WIIB 3MOAH 4HMEA 3X3GH 2IBGA 2P42B 3C09B 4ZQKA 1QLRA 4FZ8H 5ESQA 3IVKB 1HHIB 3CLEL 5GRYA 2D0GA 5D7SL 1EIBA 4XVJH 2Y25A 3VXUA 4GMTH 5HVFB 5L2JA 2PCPA 2B4CC 2OTWA 3INUL 4HDIA 4V1DB 1K6QL 43CAA 3ISWA 1RZKH 5GISL 4JHBA 3LSOA 4HCRL 3WLWD 3CDFA 3HNTH 3F5WB 5E5UB 5F93C 2IAND 1NCAH 3TO4C 4R7NA 1C1EH 3P0YH 1AGCA 3Q0HA 5K9KA 5FDWA 4MDJB 4NKIH 3LKPB 5F7NC 5FCUL 1MIEH 4RAUB 1HHHB 2EXWD 3KPSB 4NQUA 2R0KL 4OCSL 4ZPTA 3VH8A 2ESVB 5I1IL 2NZ9C 5KSVA 3Q5TA 5EU5B 4Z0BL 2A73B 4ODUA 1LEKB 4LSRH 2H1PH 1AQKH 1GHFL 2NY3D 3R4DA 3LH2H 1RUAH 3QZWG 2ZSVB 5F44A 5E4EB 4G9FB 4PYGA 1NC2D 2VLMD 5FGCB 4R8WH 4RMTA 1YQVL 1QSFA 3KPNA 5F7HA 3W5NA 3GHBH 5HGHA 2R2HA 4LSSH 3OTTA 4KROB 3E8UL 3OF6D 3IU4L 3D39D 3KJ6H 3FN0L 4N8VA 2FGZA 3KPSE 2BVPB 2Q86A 1R5VB 2EC9U 4TVPE 1IAMA 5F9WC 3RDTD 2IG2H 4YGVA 2XN9B 2YRZA 4BFBD 1FFOB 3HE7B 5DJZB 2NTSP 2EDQA 5LVEA 1P7HL 5F96L 1Q94B 3VG0H 5DFWH 3S3JA 3RA7L 3VRLF 4CMHB 3U9UA 1HXYA 3QCVH 3R1GL 4G9FE 2Y36L 3BYTA 3TIEA 4B53A 3N85L 4J3WA 4RA0C 5DI8A 3BP4A 3LDBB 5CJOL 3BX7C 3CMOL 4HWEL 3K2UL 4HWBL 5M7QA 4G7YH 3QUYB 2B0SH 1RJYB 2WLZA 5I8OL 3I3BA 3LN4B 2XWTB 5DK0B 4ZTOL 4X98A 1H15A 2K3TA 5C07E 5IW3A 2XN9E 2X6MA 2CMRH 2D7PA 3ZKND 4HUMB 4UQ3A 2VZTA 2E7LA 5IV2B 1ZMYA 1P4BL 5B8CA 1A14H 3C60B 4YHOL 3G5YB 3BZFA 3ZDYE 4AK1A 3QO0A 3VFOB 1JVKA 4XHJC 2ITDB 1CICA 3BDXA 4KI5D 4O2EB 3TN0A 3FB7A 5HHXL 3LAFA 4KDTA 4KMLB 5CSZA 1MIMH 5TE7L 4Y4HB 3CXHK 5B38G 4AM0B 1F3JA 1OB1A 5I0DA 4PJHA 4R7DB 3QT2A 1HNGA 3MCLL 4Z95L 5IHBA 1ORSA 3PWJB 3HZKA 2HTLD 3OGCB 4QHNA 5L2KE 3IRZA 5CZXC 2Y23A 1M71B 3O41B 5MI0C 1MLBB 2Z4QA 3NFSL 4Q0XH 5EUOF 4OM1H 3ZYZA 4XCYA 2KUTA 5DXWA 1F4WH 3KLAA 3RVUD 5ID1A 2XIDA 1GPOL 5L0QB 1X5JA 2YZ1A 3V4PL 5IJVB 1QEWA 1DFBL 3VXSA 5CUSH 1PZUB 2C7UB 1CFTB 5D7JC 4TQEH 2OQJA 1MPAH 3KR3H 3FTGB 3IU3B 4NYLA 3T3PE 3BMWA 3NCCB 1QFPA 1OAZL 1XGUA 1TCRA 1CT8A 4KMQA 4Z7WA 2P8MA 3F7VA 1ZHNB 5D7IA 1WUNT 4MHHI 1D5ZB 1K5NB 2J2ZA 1KPRB 2E5EA 2W9DL 1FC1A 3O4LE 3OJDA 2LQRA 4Y2DB 3JV6B 3V6OA 3QUZB 5FHBL 3H9SD 5EOCJ 4NFBA 2YKLL 4MXVF 2CDEB 1VGEL 5J12C 3IT8D 2W9EH 3P4MB 5JUEH 2EE6A 2A9ML 5I73B 4ZYKB 1A21A 2Z93A 4K71B 2NY0C 5HYJB 4DCQB 3MGAA 3MRIA 1T80A 1A1MB 4ONHA 5DJCB 2AQ2A 1S7SA 3QZWB 3BPOC 1JCKA 4NKMA 5C0RL 1X44A 5IQ7H 3OGOE 2JCCB 4YXKH 1LE9B 3S88H 1G7PA 4NQVB 5B39G 1Y18A 3BXNA 4PGDB 2DI8A 1F6AB 2CRMA 1YEHH 1UZ6E 4ODXB 1R3IH 4AIOA 4U6VL 4GXUN 4PJAF 2HT3C 3DVFA 1ZHKB 3FT3B 4LCWB 4D3CL 3C8DA 4L4VA 1UB5B 2W07A 4YLQT 1GOHA 2R2EA 5T1KA 5TFSL 3MRQB 2GJZB 4IOSD 3Q6GL 2P5EE 3DMMA 2YPLD 1CE6B 1A4KA 4RQQB 1CBVH 4FQHB 5FK9A 3L6FA 3F8UB 4MHHG 5J9PB 3S6CA 3BP6B 5HYJE 2VYRE 1I9IH 5F1NA 2B2XL 5FYKD 4EOWL 4LLUA 3CFCH 3PP3H 4IOFC 1AIFA 2JCCE 4ZXBD 3G6DH 2BSSA 5DJ2B 5GRVK 4J4PC 4OFDA 1LEIA 4ONGH 4X4YA 3BAEH 1JWUA 3OG6B 2Q7YA 3B9VA 1MCQA 1CLZH 1KEMH 1BVLB 4M4RA 2NY6B 4TNVF 1BF8A 1RJZA 5IP4A 1GL4B 4PJEE 4XB7A 2XG5A 1WBXA 3WN5B 3FQRB 4QHMA 5CLWA 4LHUD 1MJUH 3IFPB 2N7BA 3H9HB 4HAGA 3ZE2E 2RQ8A 1MQKL 2O5XH 3STZB 4YHNA 4K3DL 4KZDL 3L5XH 1Y0LA 4M5YH 1H3XA 1OM3H 3GK8L 2XG4A 5IR1A 4K7FA 3EJZD 4OLUL 4EI5A 4JM2A 3TVMD 1S7QA 3EHBD 3P30L 4LRIC 1FGVL 1S5HA 2H32A 4WUUA 5B38B 2WIIA 5D1QB 4PGZA 4NJ9L 2RGSA 1JYNA 4X4ME 1U91A 4IOIB 5SWQB 1UJTA 1HHIA 1FZKA 5KZCD 3UPRB 1M6OB 4EZMA 1BQLL 5L6YL 4M43L 3OKMB 3ABZA 1X6NA 5D96C 2RBLA 3QJFA 5JZ7C 5AZ2H 1KIRB 4NO2A 3EJJX 2BDNH 3G5XA 3PXJA 1VACB