4AM9A

Crystal structure of the yersinia enterocolitica type iii secretion chaperone sycd in complex with a peptide of the translocator yopd
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
131
structure length
131
Chain Sequence
b'NEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE SYCD
publication title Crystal Structure of the Yersinia Enterocolitica Type III Secretion Chaperone Sycd in Complex with a Peptide of the Minor Translocator Yopd
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Chaperone
total genus 52
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2012-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07720 TPR_3 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4am9A00
3Q49B 4XI0A 4BWRA 5CCLA 4GCOA 4J0UA 4Y6WA 3MEKA 3RIBA 4KYOB 2VSYA 3RJVA 4WNGA 3TG4A 5FZRA 2FEZA 2Y4UA 3MKRA 1OUVA 3KD7A 1HZ4A 3MA5A 2E2EA 2LSVA 1Y8MA 3TGOA 5FZQA 3AS8A 3MV3B 2PL2A 3S7FA 2WPVA 3CKBA 3AS5A 2OOEA 3Q47B 1NA0A 3O48A 2VGXA 4HOUA 3OXGA 1KT0A 4GZ5A 2QFCA 2UY1A 1FCHA 4YVOA 3ZN3A 2IFUA 4I9CA 4XI9A 3CV0A 4G23A 4GYWA 3CVQA 1ZBPA 4KBQA 3OXFA 5DIZA 2V5FA 3ULQA 2KCKA 2C0LA 5CHEE 3ASFA 2ONDA 3KAEA 3ASDA 3CVNA 4U0UA 2KCLA 4AM9A 5FTPA 2PQRA 3ZHEB 2HYZA 5BNWA 4NRHB 2HO1A 1YA0A 3WXXA 3VTYA 5LCWJ 3N71A 3QDNA 3QWWA 2IF4A 5AYWD 5C1DA 5ARGA 4G26A 4GYOA 3RKVA 4AY5A 2UWJG 3ASHA 5EX3A 3BEEA 1B89A 2VQ2A 3E4BA 5EKQD 4I17A 2XEVA 3FWVA 5G05J 4ABNA 1KT1A 4G25A 3OXLA 2AVPA 2LSUA 4UI9C 4HOSA 4I1AA 4BT8A 4CGVA 2VGYA 1QZ2A 4YVQC 1XNFA 4A1SA 3LKUA 4WUYA 4GPKA 1IHGA 3CVPA 3CKCA 4BTAA 2KATA 5DBKA 4RG6A 3AS4A 4HOQA 3LY9A 4GZ6A 4WNEA 1PC2A 5G04J 1NA3A 4O6FA 4RG9A 5KJNA 5A7DB 4Y6CA 3Q4AB 2FO7A 2KC7A 2HR2A 4JA7A 3LCAA 4JL0A 2FF4A 3U4TA 3ZFWA 3RO2A 2R5SA 3RU0A 3CEQA 2XPIA 2YQ8A 5EX0A 3MV2B 3S7BA 4JA9A 4U04A 3PE3A 3QWVA 2PQNA 4J8FA 4W9RA 5BW8C 2VSNA 3QOUA 2XGOA 2Y4TA 1KLXA 4I2ZA 4HORA 3ZGQA 5JJ7A 4UI9K 2YHCA 2FI7A 5FJYA 4BT9A 4N3BA 4AY6A 4UQZA 3LPZA 4F3VA 2LNIA 4I9EA 3KS2A 4ME2A 1QQEA 4IN3B 2VGXB 5G05C 3IEGA 2UY1B 2J9QA 3GYZA 4GA1A 5ARFA 2GW1A 3VTXA 5D0QD 3S7DA 4N39A 3RO3A 4UI9J 2I6HA 4H7YA 1WAO1 3Q15A 4U0ZA 2JLBA 3CK8A 4I2WA 3JYSA 4N3AA 1WM5A 4N5CA 4N2SA 4GA0A 4UQYA 2MHKA 4XIFA 3ZHEA 3GZ2A 4WNDA 3LYAA 3CVLA 2XGSA 3CK7A 5CCMA 4J8EA 3URZA 3FP3A 3LY8A 3UPVA 4CDRA 3LY7A 1HXIA 2XCBA 3GW4A 3S7JA 3CK9A 4H7XA 5FT9A 3SZ7A 3R9AB 5M72A 4G24A 1E96B 4GYYA 2WQHA 5A6CA 4G1TA 1ELRA 5KJKA 5KJMA 3TAXA 3FFLA 3UQ3A 1ELWA 4N3CA 2Q7FA 1P5QA 3TG5A 1HH8A 4UQXA 2XCCA 2DBAA 1IYGA 5FZSA 3PE4A 5KJLA 5JJTA 4AIFA 3SF4A 4NQ0A 3Q5MA 4BTBA 4WNFA 2BUGA 5BT1A 3U3WA 5LCWC 2VYIA 5JJ6A 1ZU2A 5HQ8A 4JHRA 2XGMA 5D0OD 4APOA 4CGWA 4J8DA 3NF1A 3UUXA 2NC9A 1TJCA 3QWPA 5HI7A 3GZ1A 4U0SA 1W3BA 2C0MA 4LEUA 4EQFA 2P58C 3EDTB 4G2VA 4U07A 4GA2A 3PDNA 3K9IA 2C2LA 4GZ3A 4KXKB 1NZNA 3QKYA 4N2QA 3ASGA 2L6JA 2PZIA 2FBNA 3ESKA 3HYMB 3ZPJA 4HOTA 4GCNA 4B94A 1A17A 2KCVA 5G04C 4YNDA
chains in the Genus database with same CATH superfamily
1K8KG 3DEPA 3Q49B 4GCOA 2DZNA 4KZCA 4L1BA 4XKCA 4HI9A 1Z3XA 3RIBA 5AENA 3ZEFA 2KBXA 1K1AA 4CRWA 2FEZA 1LTXA 2Y4UA 4LSZE 2MRIA 1E7UA 1HZ4A 3UIPC 3AJIA 2AXVA 5FZQA 2IQCA 4U63A 3T5VA 1UN8A 3ZKJA 4GMJA 4AJWA 5KNGA 4HOUA 4F1PA 2UY1A 1FCHA 5ITZF 5ENPD 2ZGGA 3G2WA 1H2VC 1RZ4A 2DCPA 5AIJA 4G23A 4DUIA 4F1SA 2C0LA 4BX8A 2YHEA 2OVFA 4KZ0A 3ASDA 3CVNA 3JUEA 2WXQA 4AM9A 2XZDG 4F7AA 2HO1A 3C3OA 1UJKA 4GTSA 2ZIRA 2E0IA 2A4ZA 3N71A 3QWWA 5AYWD 3AU5A 4G26A 3RSEG 3AG4E 3TWTA 3RKVA 4AY5A 2UWJG 3ASHA 4UWKA 5EX3A 3PUJA 3BEEA 1LD7A 2WMNA 3GZSA 4J6IA 5EDSA 4MKTA 5EKQD 2GRRB 3E33A 5AN8A 5G05J 1N4QA 1TJFA 3PNLB 2PM6A 3OXLA 2LSUA 1TNUA 2JEKA 1HF8A 1JCRA 3SFZA 4BT8A 2OCCE 2VGYA 3L13A 3MYVA 2GROB 1K1BA 1L5JA 2IO2C 3FTXA 4MRUA 2QYUA 3CVPA 4DX1A 2KATA 2Y3AA 4HOQA 4DX5D 3LY9A 2L9BA 4GPMA 4GZ6A 4WNEA 1NA3A 3SBTB 1H6KA 4O6FA 3BUAA 2EIKE 4ZHBA 2EIJE 2CG2A 3HVEA 4EZJA 2FO7A 3CGHA 5ENTD 3SFYA 2HR2A 1TNZA 2RKKA 4JA7A 2VSOE 2J49A 5AARA 3UMVA 5EN5D 1N11A 1E7VA 3RO2A 2R5SA 4HFGA 2JABA 1TNYA 2IJGX 3MV2B 3S7BA 4JA9A 1TN8A 3PE3A 5JHAA 3FH5A 5BW8C 3CSFA 4MBGA 5BPPA 4APFA 3I3NA 3ZRHA 3QAQA 2XGOA 4TV3A 3SFXA 5KCMA 4I2ZA 4HORA 3DSWA 3O4ZA 1AWCB 3SBSA 2KM4A 4M7CA 1EDUA 1WY6A 2YHCA 2FI7A 4C9BB 4N3BA 2F37A 3UKRG 3LEWA 3UX4A 3LPZA 4GTPA 4B93B 4I9EA 4ME2A 2V4HC 4B0ZA 2R05A 3PZ3A 4IN3B 2J4DA 3AU4A 2J08A 2L0IA 4XZ4A 2XZTG 2R59A 2UY1B 3LVRE 2RFAA 1N9AA 4GA1A 1V55E 2GW1A 3LJ3A 4U7EB 2WXFA 3UIOC 2WQ6A 5CRUA 5ANRA 4N39A 3RO3A 4EECA 3ULYA 5E75A 3ZNGA 2DIWA 3W9FA 3CK8A 3C3QA 2X6HA 4N2SA 4GA0A 5AJDA 2ZU6B 4G8LA 2NYJA 3ZHEA 1TYQG 4WNDA 4BY6A 2GRLA 4DX2A 4HVBA 3TJPA 3GW4A 3LXUX 2X38A 3UT4A 3R9AB 4X8QA 5M72A 3Q79A 3KSQA 5A6CA 4TUUA 5KJKA 3EU9A 3FTVA 3FFLA 1HE8A 4GZDA 4HRNA 2X6IA 4EZKA 1D8EA 3SHFA 1JWGA 4FJYA 3FEXA 1P5QA 2IY0C 1HH8A 3APFA 3IBEA 1X5BA 1MX4A 3ZXSA 1N4SA 3P1UA 4C0MA 2XRYA 1IYGA 5JJTA 2LAHA 3FTUA 3SF4A 4NQ0A 3FUMA 3DWLG 2BKGA 3PH0C 4WNFA 1N54A 2R2LA 3L6AA 5JJ6A 2V5QC 4U8YD 3R9MA 4B8AA 3UINC 4YDYA 4EBAG 2P9KG 3UUXA 3HVEB 2ILRA 5BV1A 2NC9A 1DC2A 3ML8A 4E6HA 4V3IA 2C0MA 2H6HA 3B7UX 3D9NA 3PRZA 3FUEA 4XKBA 2AXUA 2GRPB 3PZ1A 4U07A 4LNBA 3HDXA 2DVWA 3NOGD 4GZ3A 4KXKB 1NZNA 2LUHA 5EIDA 3ASGA 2P9NG 4A3TA 2DYSE 3QB2A 3CHQA 4L7TA 2H6GA 5CMYA 1H2TC 3HYMB 1KPSB 5BXOA 4HOTA 3BQOA 4FJZA 4YNDA 5ANLA 3T5XA 4B8CB 4XI0A 1N0RA 4BWRA 5LP0A 4FA6A 5B3SE 1Q2ZA 2M63A 4GU5A 3MEKA 4IULA 3NQPA 2A5EA 2WQ7A 2WXJA 3JXJA 3RJVA 4MLPA 2XENA 3TWVA 4LNUD 3KD7A 1ELKA 3TXMA 3L82A 1BI8B 3AS8A 4FLHA 2HE0A 1HG2A 1S70B 3AS5A 3Q47B 3X2QE 4DX6D 3LVQE 4U8VD 4AV7A 2QFCA 3KEZA 4DI4A 3ZN3A 1O1RA 4XI9A 4JD2G 3EU5A 1ZBPA 3CHMA 3OXFA 3D9PA 1VDYA 2V5FA 2WXPA 5CHEE 4TXRA 3E34A 2DWZA 1JCQA 2LO6A 2LXLA 2KCLA 3L22A 3E32A 2PQRA 2XEHA 2HYZA 3FUHA 3ZHEB 5AQBA 1E8WA 2NXPA 1E8YA 1UJJA 3FEYA 4HLEA 3TWRA 4AXHA 4A3VA 1KZOA 5ARGA 1UW4B 2I9CA 4GYOA 1D9SA 4UWFA 3EIQC 1S0PA 3G2SA 3RAUA 3E4BA 3TXNA 3DXKG 5C2YA 3B7RL 3TWXA 3UXGA 4JHKA 3CLJA 4G25A 4OVVA 1SVXA 2AVPA 1S63A 4BSXA 5D2MC 3SY2A 3UM1A 3HXFA 4FHJA 4TXQA 1XNFA 3IHVA 3LKUA 4WUYA 5T8IA 3DRAA 1JUQA 2EQXA 4L2LA 1INZA 4RG6A 3AS4A 1EYHA 4N5QA 5CMWA 3UI2A 3SO8A 4BESA 4CYMD 3NZSA 3UM3A 3VLDA 2WXLA 2BEDA 2WVIA 3UM2A 5LFAA 1N52A 4FC8A 4HS2A 4K03A 4OAUC 2HM8A 1EPUA 3FY4A 1Z5SC 1MX6A 3ABLE 4JHJA 3RU0A 3ZVVA 2XPIA 2VSXE 2YQ8A 3B7SA 4BFRA 5J08A 4P29A 4GTRA 1H6OA 3FUDA 2XS8A 2IEJA 2L0TB 2PQNA 3DSVA 4I6JA 3ASNE 3QC1A 5IY5E 2ETCA 4I6GA 4O1OA 3MX3A 4RVBA 2FULA 3NB2A 2VSNA 2BF0X 4FULA 1FVHA 1FT2A 3DSUA 3D9LA 3SGHA 4K0RA 4DLOA 2FO1E 2Y1LE 4XEIG 1D8DA 4ILGA 4A1GA 4UQZA 2H6FA 3Q9UC 2Y0BG 2OVBA 4F53A 4HB5A 3AG2E 2R03A 3MKQB 1QQEA 3EIJA 5JHBA 3E30A 4ILHB 1TEZA 3B13A 5FINA 1A5EA 3QNKA 1HG5A 4UI9J 3FUJA 2I6HA 4H7YA 3NZUA 2A5UA 3U66A 4JPSA 3FUKA 2Y69E 3ABME 3JQ1A 2XS1A 2X6JA 4I2WA 3D3MA 1YCSB 4N3AA 4CT4A 4N5CA 4ANXA 4CCAA 1OCOE 3GZ2A 5E76A 5KBAA 1OCRE 3LYAA 3HXDA 1KZPA 2XPZA 4J8EA 5AQ9A 4GTQA 3UPVA 4CDRA 3LY7A 4DLQA 3ENEA 1UOHA 3J5PA 2WB2A 2XCBA 4GAAA 3VLEA 3ZW3A 1OCZE 1G3NB 1HFAA 3CK9A 5FT9A 3FHEA 4NACA 3SZ7A 1NI1A 5T3RA 1H2UA 4G24A 2WQHA 3ZIMA 1ELRA 5KJMA 1TN7A 3TAXA 1Z6TA 3LDZA 2YNQA 1IKND 1ELWA 3DSSA 2YINA 2GRNB 1DCEA 2IO3C 4JVSA 3FU6A 5CEDB 3PE4A 2L6BA 1N4PA 4D10C 3Q5MA 1FPPA 4UWLA 5AAOA 2BUGA 2DYRE 2XEEA 2OEVA 2VYIA 2V0PA 2V8SE 2XGMA 5D0OD 4APOA 5FQ4A 3ONLA 3D9JA 3LJNA 4J8DA 5G2NA 3CR3A 1Y6IA 3HG0D 3UKUG 3BG1B 2X3MA 1BPOA 3ZYKA 1QYMA 4M3OA 3DEOA 4LEUA 4XX5A 3IXEA 3D9IA 3JUIA 5CRVA 5HS0A 4GTMA 3EDTB 5AQ7A 1DCQA 2IOSA 3PDNA 3K9IA 1BD8A 3ULEG 3CHRA 2QYJA 2VGEA 3QKYA 4ZFHA 3HXCA 4FADA 4IRUA 4ACKA 3SI5A 2PM7A 2IOLA 3EHRA 4ACLA 4DRXE 2L6JA 4GMRA 4QQIA 2XPYA 4AVXA 3Q78A 1E90A 5CCLA 3ZYLA 5JMND 4J0UA 4Y6WA 2F8XK 1NP7A 2AWIA 5EILA 2VSYA 3VLFA 4K5CA 3MKRA 3AAAC 3CVWA 5BUZA 3L08A 3MA5A 5ENNA 2E2EA 2LSVA 2OEWA 3T8MA 2CHZA 1Y8MA 2ZISA 4HRLA 3TGOA 3CVYA 3JQ0A 3MV3B 2WPVA 3CKBA 4YDEA 4DJAA 4LG6A 3OXGA 4GZ5A 3NOCD 3CVUA 3V30A 5AJLA 4JEUA 5FIOA 3WG7E 4JW1A 2LAIA 2IFUA 4I9CA 4Q69A 4GYWA 1SA5A 4KBQA 2R02A 5DIZA 3APDA 3PS6A 2KCKA 1V54E 4G8KA 2PNNA 3ESLA 2ONDA 3KAEA 3QK0A 4U0UA 2WM9A 4LERA 2P9SG 3AG3E 5A23A 3W9GA 4NRHB 1U2VG 3BU8A 1YA0A 3WXXA 4FLBA 5LCWJ 3QDNA 5C1DA 3CQGB 1UN9A 3C72A 4I1OB 3HIZA 4UWHA 4JXTA 5ENRD 2WXMA 3APCA 2XEVA 4AOFA 1BLXB 3FWVA 4ABNA 4ANWA 3B7BA 2IONA 4UI9C 4JB8P 3HRAA 4GB9A 1U3CA 4HOSA 4CGVA 4A55A 1QZ2A 3S2AA 4A1SA 1E8XA 1XGWA 2GGFA 4BTAA 5DBKA 4NURA 4PS8A 5CEAA 2P2CP 5HRYA 4U96D 3R7QA 3Q9NC 5G04J 2KZTA 4ANUA 3HHMA 3Q75A 3V2XA 3PREA 3FUIA 3C5RA 3UTMA 5KJNA 2WXNA 4Y6CA 3Q4AB 4JC8A 2WXOA 1SQMA 2KC7A 4OYSA 5B1AE 3LCAA 5D66A 3PZDA 2LXMA 3KSLA 3U4TA 3ZFWA 3JCKC 3CEQA 3PNTB 2VJ8A 3T9KA 5KNHD 1JCSA 4U04A 3QWVA 3DSTA 3SD5A 3E37A 5G55A 3TWSA 2RFMA 4FP7A 2XRZA 4QFVA 4R7LA 5ENQD 4G11A 2R17C 3FH8A 2Y4TA 2QY7A 3ZGQA 3FH7A 2WXKA 4BT9A 3OTNA 4O60A 4WWNA 4BERA 4CDMA 1NL4A 2WMOA 3CSTA 2LNIA 5FQ6A 3U64A 5KWDA 2F0YA 4HI8A 5CECB 1PY1A 3L17A 4GMLA 2J9QA 3GYZA 4HXIA 5ARFA 3VTXA 4I43A 5D0QD 5HKPA 3BG0B 1WAO1 2AW6A 4U8HA 4DPRA 4U0ZA 4BX9A 3MGBA 1EF1C 3AG1E 1H0AA 2J4BA 3Q73A 4UQYA 1IXVA 3I4RB 2MHKA 4I6EA 3CVLA 2XGSA 3RRUA 1SZ9A 3R7RA 4JEHA 4FU3A 5CCMA 4JZYA 3JXIA 2EILE 3FP3A 3LY8A 2QZAA 1HXIA 2GRQB 3S7JA 3PUKA 1SZAA 4C0EA 4DX7D 3PVLA 4DI3A 3ZYMA 1DVPA 1E96B 2AJAA 4G1TA 4BSZB 4URKA 2WXGA 5H7PA 1MX2A 3IV0A 5EYPF 4J8YA 2J8SD 3UQ3A 2I1JA 2NSZA 1O5MA 3TG5A 3D9KA 2ZGDA 2MOWA 4OVUA 2DBAA 5KJLA 3PZ4A 4AIFA 2CFUA 2I1KA 2WXRA 4CEMA 3D9OA 4GZCA 3CQCB 5BT1A 5LCWC 2X6KA 1ZU2A 3L9TA 5HQ8A 4JHRA 3FU0A 2KZTB 4J7WA 4KT6B 2I2OA 3P2BA 2GRMA 5EYLA 1TJCA 4KVMA 2XQ0A 1N0QA 3QWPA 4ATZD 4LCTA 4U0SA 1W3BA 1DNPA 3FU3A 3QJZA 4EQFA 4UUCA 2P58C 3J5QB 1RW2A 4G2VA 3CVVA 1UG3A 4KMOA 2C2LA 1O1SA 3HXEA 4HBDA 3ONKA 2P9PG 1MHQA 2FBNA 3G2UA 4NIKA 4EZLA 4GCNA 1AP7A 2CG3A 2KXPC 4B94A 3FU5A 5G04C 4GTVA 1QBQA 1IHBA 4RQIA 3RRNB 4OAVB 2OV8A 5EIBE 1H19A 4KYOB 4LUNU 4U95D 1Z3YA 3OAWA 4WNGA 3TG4A 5FZRA 1E8ZA 3C98A 1OUVA 1TNBA 4AP2A 4PUCA 2P9IG 3CHPA 3DPDA 2PL2A 3S7FA 3IKOB 4LRZA 2OOEA 1NA0A 3ISMC 3O48A 2VGXA 3SNXA 2VTBA 1KT0A 2EINE 4L2YA 3UT8A 1LD8A 4YVOA 3TWQA 1IQUA 2P9UG 3T8KA 3CV0A 5FWQA 3CVQA 2H6IA 3ULQA 3ZXPA 3ASFA 3V31A 1PAQA 4PH4B 3FTYA 5J90A 1OY3D 5FTPA 5BNWA 1OWOA 2B6CA 3VTYA 1OWMA 1MQSA 2IF4A 1SW6A 3EUVA 4Q94A 1WG0A 1FVFA 2ETBA 3CIAA 3G2TA 3DBSA 2IU1A 1NFIE 5LX8A 2CHXA 5ENSD 1B89A 2VQ2A 4E85A 1BU9A 1OWLA 4I17A 3I4GA 1N94A 1OXJA 3CVXA 3FTSA 4RSYA 1KT1A 1N95A 4FHKA 1LF8A 4CT0A 4I1AA 4K5BA 1MJ0A 1WDYA 3TWWA 4RLYA 1TR4A 3PEVB 3UM0A 3D9MA 4YVQC 1OWPA 2ETAA 3RK6A 4GPKA 1IHGA 4GTOA 1H6PA 3CKCA 3TL5A 1FT1A 5CERB 2CHWA 4PDXA 5CBNA 1PC2A 2CFZA 3EJNA 4PS7A 4RG9A 3UT7A 4BEPA 5A7DB 1O1TA 2RG8A 4XE0A 3V2OA 5FQ7A 2J09A 4Z68A 3ML9A 4JL0A 4WWPA 4HLLA 4YDOA 2FF4A 1HU3A 4EHMA 5BV0A 1TNOA 1BI7B 2B0OE 4EBAA 2QC9A 5EX0A 2RD0A 3FULA 4CDNA 5JA4D 3FTWA 4J8FA 4W9RA 1OCCE 3NBNB 3B95A 4TXPA 4DK5A 4Q96A 3FDHA 2XHEA 1S64A 3QOUA 1ZB1A 2EIME 1KLXA 5T4YA 2X6FA 4L23A 3EHQA 1MZCA 3C3RA 5JJ7A 5BXUA 4UWGA 4UI9K 3B7TA 5FJYA 1MYOA 4AY6A 4F3VA 4BETA 3TWUA 2MYOA 3KS2A 3ABKE 4TUMA 3EHNA 3PZ2A 1HS6A 2DZOA 2VGXB 5G05C 2VTBB 3IEGA 1HX8A 1OWNA 5ENOD 4L9PA 2V4LA 5B1BE 3QARA 3DPYA 3S7DA 5LOZA 1U3DA 4J8SA 3F6QA 3Q15A 2JLBA 5FQ8A 4HNAD 3JYSA 2AXZA 1WM5A 4CZ2D 4HQDA 3HXBA 2WXIA 4XIFA 4PS3A 4TRQA 1QNFA 3CK7A 4WAFA 3URZA 3PEUB 2P9LG 3ZYQA 1TN6A 3G2VA 5AQAA 2BKKB 4H7XA 3CHOA 3EHMA 4GYYA 1JPLA 3NAWA 4O1PA 4ANVA 3DXMG 4KVOA 3MCXA 5CBOA 3FUFA 3MKQA 4F6RD 4N3CA 2Q7FA 2ZXWE 3CHSA 2BTDA 3L54A 4IYPA 4UQXA 2XCCA 1K3ZD 3ASOE 1OT8A 3V79K 3Q7FA 3KEAA 5FZSA 3ZU7B 1N4RA 3MJWA 3I5PA 1GW6A 4BTBA 4C48B 4B89A 4AEZC 3U3WA 2WXHA 3FUNA 3RRMB 4K5AB 3ZUVB 3MZLB 2J07A 1YMPA 4WWOA 4CGWA 3NF1A 1JWFA 1HO8A 1YYHA 3FTZA 4YDWA 5HI7A 3GZ1A 1IQRA 4GTTA 4A63B 3SQVA 1SA4A 3L16A 4GA2A 4EPZA 4ATGA 1X81A 4MS6A 3U9WA 3LS8A 4N2QA 2F8YA 3IHYA 4ILIA 2PZIA 3ESKA 3Q7AA 3DSXA 3D9HA 3ZPJA 4I1MA 4HRMB 1A17A 2KCVA 4LNGA
chains in the Genus database with same CATH topology
5ANLA 3T5XA 3Q49B 4XI0A 4B8CB 4BWRA 5CCLA 3ZYLA 4GCOA 5LP0A 4KZCA 4L1BA 4XKCA 3RRNB 4FA6A 2OV8A 1Z3XA 4J0UA 2M63A 4GU5A 4IULA 3MEKA 4Y6WA 3RIBA 3NQPA 1NP7A 2AWIA 1H19A 3ZEFA 5AENA 2WQ7A 4KYOB 2WXJA 4LUNU 1Z3YA 2VSYA 3OAWA 4WNGA 3RJVA 3TG4A 3VLFA 5FZRA 4MLPA 4CRWA 2FEZA 1E8ZA 3C98A 2Y4UA 3MKRA 2MRIA 1E7UA 1OUVA 4AP2A 3KD7A 3CVWA 5BUZA 1HZ4A 3L08A 1ELKA 3MA5A 2E2EA 2LSVA 5ENNA 3T8MA 2CHZA 4PUCA 3TXMA 1Y8MA 3TGOA 3CVYA 3JQ0A 2AXVA 5FZQA 3AS8A 2IQCA 3MV3B 4U63A 4FLHA 3CHPA 3DPDA 3T5VA 2PL2A 3FU5A 2WPVA 3IKOB 1HG2A 1UN8A 3S7FA 4LRZA 4GMJA 3CKBA 3AS5A 2OOEA 3Q47B 4AJWA 1NA0A 3SNXA 3O48A 2VGXA 4HOUA 4DJAA 3OXGA 2VTBA 3LVQE 1KT0A 4GZ5A 4AV7A 2QFCA 4L2YA 3UT8A 2UY1A 1FCHA 4YVOA 3CVUA 5AJLA 4JEUA 1IQUA 3KEZA 3G2WA 4JW1A 2LAIA 3ZN3A 4DI4A 1H2VC 2IFUA 2DCPA 4I9CA 4XI9A 4Q69A 5AIJA 3CV0A 4G23A 4GYWA 5FWQA 3CVQA 1ZBPA 4KBQA 3CHMA 3OXFA 3D9PA 4F1SA 1VDYA 5DIZA 2V5FA 3APDA 3PS6A 3ULQA 2KCKA 2WXPA 2C0LA 5CHEE 4BX8A 3ASFA 2YHEA 2OVFA 3ESLA 1PAQA 2ONDA 3FTYA 2LO6A 3ASDA 3KAEA 4KZ0A 4PH4B 3CVNA 3QK0A 4U0UA 5J90A 2KCLA 3L22A 2WM9A 4LERA 2WXQA 4AM9A 5FTPA 4F7AA 2PQRA 3ZHEB 2HYZA 3FUHA 5A23A 5BNWA 4NRHB 1OWOA 1E8WA 2HO1A 2NXPA 1UJKA 1YA0A 2E0IA 1E8YA 2A4ZA 3WXXA 1UJJA 4FLBA 3VTYA 5LCWJ 3FEYA 4HLEA 3N71A 1OWMA 1MQSA 3QDNA 3QWWA 4AXHA 2IF4A 5AYWD 5C1DA 3CQGB 5ARGA 1UN9A 4A3VA 3AU5A 4G26A 4I1OB 3HIZA 1UW4B 4JXTA 4Q94A 4UWHA 1FVFA 2I9CA 3CIAA 3G2TA 4GYOA 3RKVA 3DBSA 4AY5A 2UWJG 3ASHA 2IU1A 4UWKA 4UWFA 5EX3A 3PUJA 3EIQC 3BEEA 5LX8A 1S0PA 2CHXA 2WMNA 3G2SA 1B89A 2VQ2A 3E4BA 3GZSA 3TXNA 4J6IA 5EDSA 4MKTA 4E85A 5EKQD 5C2YA 3B7RL 1OWLA 2WXMA 3APCA 4I17A 2XEVA 4AOFA 3I4GA 3FWVA 5G05J 3FTSA 4ABNA 3CVXA 4RSYA 4ANWA 1TJFA 1KT1A 3PNLB 4JHKA 3CLJA 4G25A 4OVVA 2PM6A 2IONA 3OXLA 2AVPA 2LSUA 4BSXA 4UI9C 2JEKA 4FHKA 1HF8A 1LF8A 4GB9A 1U3CA 4CT0A 4HOSA 4I1AA 3SFZA 4BT8A 4CGVA 2VGYA 3L13A 4A55A 3PEVB 1QZ2A 4FHJA 3D9MA 4YVQC 3MYVA 3S2AA 1L5JA 3FTXA 1XNFA 1OWPA 1E8XA 4MRUA 3IHVA 3LKUA 4WUYA 5T8IA 3RK6A 1IHGA 4A1SA 4GPKA 3CVPA 1JUQA 1XGWA 3CKCA 2GGFA 4BTAA 2EQXA 2KATA 3TL5A 5DBKA 4L2LA 1INZA 4RG6A 2Y3AA 4NURA 3AS4A 4HOQA 4PS8A 3LY9A 1EYHA 2L9BA 5CMWA 3R7QA 2CHWA 4PDXA 4GZ6A 4WNEA 1PC2A 5G04J 1NA3A 2CFZA 3EJNA 3SBTB 1H6KA 3NZSA 2KZTA 4O6FA 3VLDA 3HHMA 4ANUA 2WXLA 2WVIA 4PS7A 5LFAA 3PREA 4RG9A 1N52A 3FUIA 3UT7A 2CG2A 3HVEA 5KJNA 5A7DB 2WXNA 4FC8A 4Y6CA 4EZJA 3Q4AB 4JC8A 2RG8A 2WXOA 4HS2A 4K03A 4XE0A 2FO7A 5FQ7A 1SQMA 2KC7A 3CGHA 4OYSA 2J09A 2HM8A 2HR2A 3ML9A 4JA7A 1EPUA 3LCAA 3FY4A 4JL0A 2VSOE 4WWPA 2FF4A 1HU3A 2J49A 3PZDA 3UMVA 5BV0A 3U4TA 3ZFWA 1E7VA 3RO2A 2R5SA 4HFGA 4JHJA 3RU0A 3ZVVA 3JCKC 3CEQA 3PNTB 4EBAA 2XPIA 2VSXE 2VJ8A 2YQ8A 3B7SA 4BFRA 5J08A 4P29A 5EX0A 2IJGX 2RD0A 3MV2B 3S7BA 3FULA 4JA9A 4CDNA 4U04A 3FUDA 3PE3A 3QWVA 2L0TB 2PQNA 3FTWA 4I6JA 4J8FA 3SD5A 3QC1A 4W9RA 5JHAA 3FH5A 5G55A 5BW8C 3CSFA 4I6GA 4FP7A 3MX3A 4RVBA 4DK5A 4QFVA 4R7LA 2XRZA 5BPPA 4APFA 2FULA 3I3NA 4Q96A 3ZRHA 3FDHA 2XHEA 2VSNA 4G11A 3QOUA 2R17C 3QAQA 2XGOA 2BF0X 3FH8A 4TV3A 2Y4TA 4FULA 1KLXA 5T4YA 2X6FA 4L23A 5KCMA 4I2ZA 1FVHA 4HORA 2QY7A 3O4ZA 3SBSA 3ZGQA 5JJ7A 3D9LA 2KM4A 4UWGA 1EDUA 4UI9K 3SGHA 1WY6A 2YHCA 3FH7A 2WXKA 2FI7A 3B7TA 3OTNA 4K0RA 5FJYA 4BT9A 4C9BB 4DLOA 4N3BA 4ILGA 3UX4A 3LEWA 4A1GA 4WWNA 4AY6A 4UQZA 3LPZA 4F3VA 4CDMA 2OVBA 2WMOA 4F53A 3CSTA 2LNIA 4I9EA 3KS2A 4ME2A 5FQ6A 3U64A 4B0ZA 3MKQB 1QQEA 3EIJA 3EHNA 1HS6A 4IN3B 2J4DA 3AU4A 1PY1A 3L17A 2VGXB 5G05C 2VTBB 2J08A 4GMLA 2L0IA 3IEGA 4XZ4A 1HX8A 2R59A 1OWNA 2UY1B 2J9QA 3GYZA 3LVRE 5JHBA 4GA1A 2V4LA 4HXIA 5ARFA 4ILHB 1TEZA 2GW1A 3LJ3A 4I43A 3B13A 3VTXA 2WXFA 5D0QD 3QARA 2WQ6A 3S7DA 5ANRA 5LOZA 3QNKA 4N39A 1HG5A 1U3DA 4UI9J 4J8SA 3FUJA 2I6HA 4H7YA 3RO3A 3NZUA 4EECA 3BG0B 1WAO1 2AW6A 3Q15A 4U8HA 4DPRA 2A5UA 3U66A 4JPSA 4U0ZA 5E75A 3FUKA 4BX9A 2JLBA 2DIWA 3MGBA 3CK8A 5FQ8A 1EF1C 3JQ1A 2X6JA 4I2WA 3D3MA 3JYSA 2AXZA 4N3AA 1H0AA 4CT4A 1WM5A 2X6HA 2J4BA 4N5CA 4N2SA 4ANXA 4GA0A 5AJDA 4UQYA 2ZU6B 4CCAA 3I4RB 2WXIA 2MHKA 4XIFA 3ZHEA 3GZ2A 5E76A 4PS3A 4I6EA 4WNDA 3LYAA 4TRQA 3CVLA 2XGSA 1SZ9A 3R7RA 1QNFA 2GRLA 3CK7A 4JEHA 3RRUA 2XPZA 4FU3A 4BY6A 5CCMA 4J8EA 4JZYA 4WAFA 3URZA 4HVBA 3PEUB 3FP3A 3LY8A 3UPVA 4CDRA 3ZYQA 3LY7A 3TJPA 4DLQA 3ENEA 3G2VA 2WB2A 1HXIA 2XCBA 3GW4A 3LXUX 3S7JA 3PUKA 1SZAA 4GAAA 3VLEA 4C0EA 2X38A 3ZW3A 1HFAA 3CK9A 4H7XA 3CHOA 3FHEA 3PVLA 4NACA 5FT9A 3R9AB 3SZ7A 4DI3A 5M72A 3EHMA 3ZYMA 1DVPA 1H2UA 1E96B 1JPLA 2WQHA 4G24A 4GYYA 5T3RA 3ZIMA 5A6CA 4ANVA 4G1TA 1ELRA 4TUUA 5KJKA 4KVOA 4URKA 2WXGA 5KJMA 3MCXA 3TAXA 3FTVA 1Z6TA 3FFLA 3IV0A 1HE8A 4GZDA 3LDZA 2YNQA 3FUFA 3UQ3A 3MKQA 2X6IA 2I1JA 4EZKA 1ELWA 3SHFA 2YINA 2NSZA 1JWGA 4N3CA 4FJYA 2Q7FA 3FEXA 1P5QA 3TG5A 3CHSA 1HH8A 3APFA 3D9KA 3IBEA 1X5BA 2BTDA 3L54A 4IYPA 3ZXSA 4UQXA 2XCCA 2MOWA 3P1UA 4OVUA 4C0MA 2DBAA 2XRYA 4JVSA 3FU6A 1IYGA 5FZSA 3PE4A 5KJLA 5JJTA 2LAHA 4AIFA 3FTUA 2CFUA 3MJWA 3SF4A 2I1KA 4NQ0A 2WXRA 3FUMA 4CEMA 4D10C 3I5PA 3Q5MA 3D9OA 1GW6A 3PH0C 4GZCA 4BTBA 4UWLA 4B89A 4WNFA 1N54A 2BUGA 3CQCB 5BT1A 4AEZC 3U3WA 5LCWC 3L6AA 2WXHA 2VYIA 2X6KA 3FUNA 5JJ6A 1ZU2A 3RRMB 5HQ8A 2V0PA 4JHRA 3FU0A 2V8SE 2XGMA 5D0OD 3UT4A 4APOA 5FQ4A 2KZTB 3ONLA 3D9JA 4KT6B 4B8AA 3MZLB 2J07A 4WWOA 4CGWA 4J8DA 2I2OA 3NF1A 5G2NA 4EBAG 3CR3A 1JWFA 1HO8A 1Y6IA 3HVEB 3UUXA 3P2BA 2ILRA 3BG1B 2NC9A 2X3MA 5BV1A 1BPOA 2GRMA 3ML8A 1TJCA 4E6HA 4KVMA 2XQ0A 3QWPA 3FTZA 3ZYKA 4V3IA 5HI7A 3GZ1A 4LCTA 4U0SA 1IQRA 4M3OA 1W3BA 2C0MA 1DNPA 3FU3A 3QJZA 4LEUA 4XX5A 4EQFA 3D9IA 3B7UX 3D9NA 3JUIA 3PRZA 3FUEA 2P58C 4XKBA 2AXUA 3EDTB 4G2VA 2IOSA 3L16A 4GA2A 4U07A 4EPZA 3CVVA 4ATGA 3HDXA 3PDNA 1UG3A 3K9IA 2C2LA 4KMOA 4GZ3A 4KXKB 4MS6A 3U9WA 3CHRA 1NZNA 3ONKA 3LS8A 3QKYA 4N2QA 3ASGA 4A3TA 4FADA 3QB2A 4IRUA 3CHQA 4ACKA 3SI5A 2PM7A 2IOLA 4ACLA 2L6JA 3IHYA 4L7TA 4ILIA 1MHQA 2PZIA 2FBNA 2XPYA 3ESKA 5CMYA 4AVXA 1H2TC 3G2UA 3HYMB 4EZLA 1E90A 3ZPJA 4HOTA 4GCNA 4FJZA 2CG3A 4I1MA 4B94A 1A17A 2KCVA 5G04C 4YNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q49 B;  4XI0 A;  4BWR A;  5CCL A;  4GCO A;  4J0U A;  4Y6W A;  3MEK A;  3RIB A;  4KYO B;  2VSY A;  3RJV A;  4WNG A;  3TG4 A;  5FZR A;  2FEZ A;  2Y4U A;  3MKR A;  1OUV A;  3KD7 A;  1HZ4 A;  3MA5 A;  2E2E A;  2LSV A;  1Y8M A;  3TGO A;  5FZQ A;  3AS8 A;  3MV3 B;  2PL2 A;  3S7F A;  2WPV A;  3CKB A;  3AS5 A;  2OOE A;  3Q47 B;  1NA0 A;  3O48 A;  2VGX A;  4HOU A;  3OXG A;  1KT0 A;  4GZ5 A;  2QFC A;  2UY1 A;  1FCH A;  4YVO A;  3ZN3 A;  2IFU A;  4I9C A;  4XI9 A;  3CV0 A;  4G23 A;  4GYW A;  3CVQ A;  1ZBP A;  4KBQ A;  3OXF A;  5DIZ A;  2V5F A;  3ULQ A;  2KCK A;  2C0L A;  5CHE E;  3ASF A;  2OND A;  3KAE A;  3ASD A;  3CVN A;  4U0U A;  2KCL A;  4AM9 A;  5FTP A;  2PQR A;  3ZHE B;  2HYZ A;  5BNW A;  4NRH B;  2HO1 A;  1YA0 A;  3WXX A;  3VTY A;  5LCW J;  3N71 A;  3QDN A;  3QWW A;  2IF4 A;  5AYW D;  5C1D A;  5ARG A;  4G26 A;  4GYO A;  3RKV A;  4AY5 A;  2UWJ G;  3ASH A;  5EX3 A;  3BEE A;  1B89 A;  2VQ2 A;  3E4B A;  5EKQ D;  4I17 A;  2XEV A;  3FWV A;  5G05 J;  4ABN A;  1KT1 A;  4G25 A;  3OXL A;  2AVP A;  2LSU A;  4UI9 C;  4HOS A;  4I1A A;  4BT8 A;  4CGV A;  2VGY A;  1QZ2 A;  4YVQ C;  1XNF A;  4A1S A;  3LKU A;  4WUY A;  4GPK A;  1IHG A;  3CVP A;  3CKC A;  4BTA A;  2KAT A;  5DBK A;  4RG6 A;  3AS4 A;  4HOQ A;  3LY9 A;  4GZ6 A;  4WNE A;  1PC2 A;  5G04 J;  1NA3 A;  4O6F A;  4RG9 A;  5KJN A;  5A7D B;  4Y6C A;  3Q4A B;  2FO7 A;  2KC7 A;  2HR2 A;  4JA7 A;  3LCA A;  4JL0 A;  2FF4 A;  3U4T A;  3ZFW A;  3RO2 A;  2R5S A;  3RU0 A;  3CEQ A;  2XPI A;  2YQ8 A;  5EX0 A;  3MV2 B;  3S7B A;  4JA9 A;  4U04 A;  3PE3 A;  3QWV A;  2PQN A;  4J8F A;  4W9R A;  5BW8 C;  2VSN A;  3QOU A;  2XGO A;  2Y4T A;  1KLX A;  4I2Z A;  4HOR A;  3ZGQ A;  5JJ7 A;  4UI9 K;  2YHC A;  2FI7 A;  5FJY A;  4BT9 A;  4N3B A;  4AY6 A;  4UQZ A;  3LPZ A;  4F3V A;  2LNI A;  4I9E A;  3KS2 A;  4ME2 A;  1QQE A;  4IN3 B;  2VGX B;  5G05 C;  3IEG A;  2UY1 B;  2J9Q A;  3GYZ A;  4GA1 A;  5ARF A;  2GW1 A;  3VTX A;  5D0Q D;  3S7D A;  4N39 A;  3RO3 A;  4UI9 J;  2I6H A;  4H7Y A;  1WAO 1;  3Q15 A;  4U0Z A;  2JLB A;  3CK8 A;  4I2W A;  3JYS A;  4N3A A;  1WM5 A;  4N5C A;  4N2S A;  4GA0 A;  4UQY A;  2MHK A;  4XIF A;  3ZHE A;  3GZ2 A;  4WND A;  3LYA A;  3CVL A;  2XGS A;  3CK7 A;  5CCM A;  4J8E A;  3URZ A;  3FP3 A;  3LY8 A;  3UPV A;  4CDR A;  3LY7 A;  1HXI A;  2XCB A;  3GW4 A;  3S7J A;  3CK9 A;  4H7X A;  5FT9 A;  3SZ7 A;  3R9A B;  5M72 A;  4G24 A;  1E96 B;  4GYY A;  2WQH A;  5A6C A;  4G1T A;  1ELR A;  5KJK A;  5KJM A;  3TAX A;  3FFL A;  3UQ3 A;  1ELW A;  4N3C A;  2Q7F A;  1P5Q A;  3TG5 A;  1HH8 A;  4UQX A;  2XCC A;  2DBA A;  1IYG A;  5FZS A;  3PE4 A;  5KJL A;  5JJT A;  4AIF A;  3SF4 A;  4NQ0 A;  3Q5M A;  4BTB A;  4WNF A;  2BUG A;  5BT1 A;  3U3W A;  5LCW C;  2VYI A;  5JJ6 A;  1ZU2 A;  5HQ8 A;  4JHR A;  2XGM A;  5D0O D;  4APO A;  4CGW A;  4J8D A;  3NF1 A;  3UUX A;  2NC9 A;  1TJC A;  3QWP A;  5HI7 A;  3GZ1 A;  4U0S A;  1W3B A;  2C0M A;  4LEU A;  4EQF A;  2P58 C;  3EDT B;  4G2V A;  4U07 A;  4GA2 A;  3PDN A;  3K9I A;  2C2L A;  4GZ3 A;  4KXK B;  1NZN A;  3QKY A;  4N2Q A;  3ASG A;  2L6J A;  2PZI A;  2FBN A;  3ESK A;  3HYM B;  3ZPJ A;  4HOT A;  4GCN A;  4B94 A;  1A17 A;  2KCV A;  5G04 C;  4YND A; 
#chains in the Genus database with same CATH topology
 1K8K G;  3DEP A;  3Q49 B;  4GCO A;  2DZN A;  4KZC A;  4L1B A;  4XKC A;  4HI9 A;  1Z3X A;  3RIB A;  5AEN A;  3ZEF A;  2KBX A;  1K1A A;  4CRW A;  2FEZ A;  1LTX A;  2Y4U A;  4LSZ E;  2MRI A;  1E7U A;  1HZ4 A;  3UIP C;  3AJI A;  2AXV A;  5FZQ A;  2IQC A;  4U63 A;  3T5V A;  1UN8 A;  3ZKJ A;  4GMJ A;  4AJW A;  5KNG A;  4HOU A;  4F1P A;  2UY1 A;  1FCH A;  5ITZ F;  5ENP D;  2ZGG A;  3G2W A;  1H2V C;  1RZ4 A;  2DCP A;  5AIJ A;  4G23 A;  4DUI A;  4F1S A;  2C0L A;  4BX8 A;  2YHE A;  2OVF A;  4KZ0 A;  3ASD A;  3CVN A;  3JUE A;  2WXQ A;  4AM9 A;  2XZD G;  4F7A A;  2HO1 A;  3C3O A;  1UJK A;  4GTS A;  2ZIR A;  2E0I A;  2A4Z A;  3N71 A;  3QWW A;  5AYW D;  3AU5 A;  4G26 A;  3RSE G;  3AG4 E;  3TWT A;  3RKV A;  4AY5 A;  2UWJ G;  3ASH A;  4UWK A;  5EX3 A;  3PUJ A;  3BEE A;  1LD7 A;  2WMN A;  3GZS A;  4J6I A;  5EDS A;  4MKT A;  5EKQ D;  2GRR B;  3E33 A;  5AN8 A;  5G05 J;  1N4Q A;  1TJF A;  3PNL B;  2PM6 A;  3OXL A;  2LSU A;  1TNU A;  2JEK A;  1HF8 A;  1JCR A;  3SFZ A;  4BT8 A;  2OCC E;  2VGY A;  3L13 A;  3MYV A;  2GRO B;  1K1B A;  1L5J A;  2IO2 C;  3FTX A;  4MRU A;  2QYU A;  3CVP A;  4DX1 A;  2KAT A;  2Y3A A;  4HOQ A;  4DX5 D;  3LY9 A;  2L9B A;  4GPM A;  4GZ6 A;  4WNE A;  1NA3 A;  3SBT B;  1H6K A;  4O6F A;  3BUA A;  2EIK E;  4ZHB A;  2EIJ E;  2CG2 A;  3HVE A;  4EZJ A;  2FO7 A;  3CGH A;  5ENT D;  3SFY A;  2HR2 A;  1TNZ A;  2RKK A;  4JA7 A;  2VSO E;  2J49 A;  5AAR A;  3UMV A;  5EN5 D;  1N11 A;  1E7V A;  3RO2 A;  2R5S A;  4HFG A;  2JAB A;  1TNY A;  2IJG X;  3MV2 B;  3S7B A;  4JA9 A;  1TN8 A;  3PE3 A;  5JHA A;  3FH5 A;  5BW8 C;  3CSF A;  4MBG A;  5BPP A;  4APF A;  3I3N A;  3ZRH A;  3QAQ A;  2XGO A;  4TV3 A;  3SFX A;  5KCM A;  4I2Z A;  4HOR A;  3DSW A;  3O4Z A;  1AWC B;  3SBS A;  2KM4 A;  4M7C A;  1EDU A;  1WY6 A;  2YHC A;  2FI7 A;  4C9B B;  4N3B A;  2F37 A;  3UKR G;  3LEW A;  3UX4 A;  3LPZ A;  4GTP A;  4B93 B;  4I9E A;  4ME2 A;  2V4H C;  4B0Z A;  2R05 A;  3PZ3 A;  4IN3 B;  2J4D A;  3AU4 A;  2J08 A;  2L0I A;  4XZ4 A;  2XZT G;  2R59 A;  2UY1 B;  3LVR E;  2RFA A;  1N9A A;  4GA1 A;  1V55 E;  2GW1 A;  3LJ3 A;  4U7E B;  2WXF A;  3UIO C;  2WQ6 A;  5CRU A;  5ANR A;  4N39 A;  3RO3 A;  4EEC A;  3ULY A;  5E75 A;  3ZNG A;  2DIW A;  3W9F A;  3CK8 A;  3C3Q A;  2X6H A;  4N2S A;  4GA0 A;  5AJD A;  2ZU6 B;  4G8L A;  2NYJ A;  3ZHE A;  1TYQ G;  4WND A;  4BY6 A;  2GRL A;  4DX2 A;  4HVB A;  3TJP A;  3GW4 A;  3LXU X;  2X38 A;  3UT4 A;  3R9A B;  4X8Q A;  5M72 A;  3Q79 A;  3KSQ A;  5A6C A;  4TUU A;  5KJK A;  3EU9 A;  3FTV A;  3FFL A;  1HE8 A;  4GZD A;  4HRN A;  2X6I A;  4EZK A;  1D8E A;  3SHF A;  1JWG A;  4FJY A;  3FEX A;  1P5Q A;  2IY0 C;  1HH8 A;  3APF A;  3IBE A;  1X5B A;  1MX4 A;  3ZXS A;  1N4S A;  3P1U A;  4C0M A;  2XRY A;  1IYG A;  5JJT A;  2LAH A;  3FTU A;  3SF4 A;  4NQ0 A;  3FUM A;  3DWL G;  2BKG A;  3PH0 C;  4WNF A;  1N54 A;  2R2L A;  3L6A A;  5JJ6 A;  2V5Q C;  4U8Y D;  3R9M A;  4B8A A;  3UIN C;  4YDY A;  4EBA G;  2P9K G;  3UUX A;  3HVE B;  2ILR A;  5BV1 A;  2NC9 A;  1DC2 A;  3ML8 A;  4E6H A;  4V3I A;  2C0M A;  2H6H A;  3B7U X;  3D9N A;  3PRZ A;  3FUE A;  4XKB A;  2AXU A;  2GRP B;  3PZ1 A;  4U07 A;  4LNB A;  3HDX A;  2DVW A;  3NOG D;  4GZ3 A;  4KXK B;  1NZN A;  2LUH A;  5EID A;  3ASG A;  2P9N G;  4A3T A;  2DYS E;  3QB2 A;  3CHQ A;  4L7T A;  2H6G A;  5CMY A;  1H2T C;  3HYM B;  1KPS B;  5BXO A;  4HOT A;  3BQO A;  4FJZ A;  4YND A;  5ANL A;  3T5X A;  4B8C B;  4XI0 A;  1N0R A;  4BWR A;  5LP0 A;  4FA6 A;  5B3S E;  1Q2Z A;  2M63 A;  4GU5 A;  3MEK A;  4IUL A;  3NQP A;  2A5E A;  2WQ7 A;  2WXJ A;  3JXJ A;  3RJV A;  4MLP A;  2XEN A;  3TWV A;  4LNU D;  3KD7 A;  1ELK A;  3TXM A;  3L82 A;  1BI8 B;  3AS8 A;  4FLH A;  2HE0 A;  1HG2 A;  1S70 B;  3AS5 A;  3Q47 B;  3X2Q E;  4DX6 D;  3LVQ E;  4U8V D;  4AV7 A;  2QFC A;  3KEZ A;  4DI4 A;  3ZN3 A;  1O1R A;  4XI9 A;  4JD2 G;  3EU5 A;  1ZBP A;  3CHM A;  3OXF A;  3D9P A;  1VDY A;  2V5F A;  2WXP A;  5CHE E;  4TXR A;  3E34 A;  2DWZ A;  1JCQ A;  2LO6 A;  2LXL A;  2KCL A;  3L22 A;  3E32 A;  2PQR A;  2XEH A;  2HYZ A;  3FUH A;  3ZHE B;  5AQB A;  1E8W A;  2NXP A;  1E8Y A;  1UJJ A;  3FEY A;  4HLE A;  3TWR A;  4AXH A;  4A3V A;  1KZO A;  5ARG A;  1UW4 B;  2I9C A;  4GYO A;  1D9S A;  4UWF A;  3EIQ C;  1S0P A;  3G2S A;  3RAU A;  3E4B A;  3TXN A;  3DXK G;  5C2Y A;  3B7R L;  3TWX A;  3UXG A;  4JHK A;  3CLJ A;  4G25 A;  4OVV A;  1SVX A;  2AVP A;  1S63 A;  4BSX A;  5D2M C;  3SY2 A;  3UM1 A;  3HXF A;  4FHJ A;  4TXQ A;  1XNF A;  3IHV A;  3LKU A;  4WUY A;  5T8I A;  3DRA A;  1JUQ A;  2EQX A;  4L2L A;  1INZ A;  4RG6 A;  3AS4 A;  1EYH A;  4N5Q A;  5CMW A;  3UI2 A;  3SO8 A;  4BES A;  4CYM D;  3NZS A;  3UM3 A;  3VLD A;  2WXL A;  2BED A;  2WVI A;  3UM2 A;  5LFA A;  1N52 A;  4FC8 A;  4HS2 A;  4K03 A;  4OAU C;  2HM8 A;  1EPU A;  3FY4 A;  1Z5S C;  1MX6 A;  3ABL E;  4JHJ A;  3RU0 A;  3ZVV A;  2XPI A;  2VSX E;  2YQ8 A;  3B7S A;  4BFR A;  5J08 A;  4P29 A;  4GTR A;  1H6O A;  3FUD A;  2XS8 A;  2IEJ A;  2L0T B;  2PQN A;  3DSV A;  4I6J A;  3ASN E;  3QC1 A;  5IY5 E;  2ETC A;  4I6G A;  4O1O A;  3MX3 A;  4RVB A;  2FUL A;  3NB2 A;  2VSN A;  2BF0 X;  4FUL A;  1FVH A;  1FT2 A;  3DSU A;  3D9L A;  3SGH A;  4K0R A;  4DLO A;  2FO1 E;  2Y1L E;  4XEI G;  1D8D A;  4ILG A;  4A1G A;  4UQZ A;  2H6F A;  3Q9U C;  2Y0B G;  2OVB A;  4F53 A;  4HB5 A;  3AG2 E;  2R03 A;  3MKQ B;  1QQE A;  3EIJ A;  5JHB A;  3E30 A;  4ILH B;  1TEZ A;  3B13 A;  5FIN A;  1A5E A;  3QNK A;  1HG5 A;  4UI9 J;  3FUJ A;  2I6H A;  4H7Y A;  3NZU A;  2A5U A;  3U66 A;  4JPS A;  3FUK A;  2Y69 E;  3ABM E;  3JQ1 A;  2XS1 A;  2X6J A;  4I2W A;  3D3M A;  1YCS B;  4N3A A;  4CT4 A;  4N5C A;  4ANX A;  4CCA A;  1OCO E;  3GZ2 A;  5E76 A;  5KBA A;  1OCR E;  3LYA A;  3HXD A;  1KZP A;  2XPZ A;  4J8E A;  5AQ9 A;  4GTQ A;  3UPV A;  4CDR A;  3LY7 A;  4DLQ A;  3ENE A;  1UOH A;  3J5P A;  2WB2 A;  2XCB A;  4GAA A;  3VLE A;  3ZW3 A;  1OCZ E;  1G3N B;  1HFA A;  3CK9 A;  5FT9 A;  3FHE A;  4NAC A;  3SZ7 A;  1NI1 A;  5T3R A;  1H2U A;  4G24 A;  2WQH A;  3ZIM A;  1ELR A;  5KJM A;  1TN7 A;  3TAX A;  1Z6T A;  3LDZ A;  2YNQ A;  1IKN D;  1ELW A;  3DSS A;  2YIN A;  2GRN B;  1DCE A;  2IO3 C;  4JVS A;  3FU6 A;  5CED B;  3PE4 A;  2L6B A;  1N4P A;  4D10 C;  3Q5M A;  1FPP A;  4UWL A;  5AAO A;  2BUG A;  2DYR E;  2XEE A;  2OEV A;  2VYI A;  2V0P A;  2V8S E;  2XGM A;  5D0O D;  4APO A;  5FQ4 A;  3ONL A;  3D9J A;  3LJN A;  4J8D A;  5G2N A;  3CR3 A;  1Y6I A;  3HG0 D;  3UKU G;  3BG1 B;  2X3M A;  1BPO A;  3ZYK A;  1QYM A;  4M3O A;  3DEO A;  4LEU A;  4XX5 A;  3IXE A;  3D9I A;  3JUI A;  5CRV A;  5HS0 A;  4GTM A;  3EDT B;  5AQ7 A;  1DCQ A;  2IOS A;  3PDN A;  3K9I A;  1BD8 A;  3ULE G;  3CHR A;  2QYJ A;  2VGE A;  3QKY A;  4ZFH A;  3HXC A;  4FAD A;  4IRU A;  4ACK A;  3SI5 A;  2PM7 A;  2IOL A;  3EHR A;  4ACL A;  4DRX E;  2L6J A;  4GMR A;  4QQI A;  2XPY A;  4AVX A;  3Q78 A;  1E90 A;  5CCL A;  3ZYL A;  5JMN D;  4J0U A;  4Y6W A;  2F8X K;  1NP7 A;  2AWI A;  5EIL A;  2VSY A;  3VLF A;  4K5C A;  3MKR A;  3AAA C;  3CVW A;  5BUZ A;  3L08 A;  3MA5 A;  5ENN A;  2E2E A;  2LSV A;  2OEW A;  3T8M A;  2CHZ A;  1Y8M A;  2ZIS A;  4HRL A;  3TGO A;  3CVY A;  3JQ0 A;  3MV3 B;  2WPV A;  3CKB A;  4YDE A;  4DJA A;  4LG6 A;  3OXG A;  4GZ5 A;  3NOC D;  3CVU A;  3V30 A;  5AJL A;  4JEU A;  5FIO A;  3WG7 E;  4JW1 A;  2LAI A;  2IFU A;  4I9C A;  4Q69 A;  4GYW A;  1SA5 A;  4KBQ A;  2R02 A;  5DIZ A;  3APD A;  3PS6 A;  2KCK A;  1V54 E;  4G8K A;  2PNN A;  3ESL A;  2OND A;  3KAE A;  3QK0 A;  4U0U A;  2WM9 A;  4LER A;  2P9S G;  3AG3 E;  5A23 A;  3W9G A;  4NRH B;  1U2V G;  3BU8 A;  1YA0 A;  3WXX A;  4FLB A;  5LCW J;  3QDN A;  5C1D A;  3CQG B;  1UN9 A;  3C72 A;  4I1O B;  3HIZ A;  4UWH A;  4JXT A;  5ENR D;  2WXM A;  3APC A;  2XEV A;  4AOF A;  1BLX B;  3FWV A;  4ABN A;  4ANW A;  3B7B A;  2ION A;  4UI9 C;  4JB8 P;  3HRA A;  4GB9 A;  1U3C A;  4HOS A;  4CGV A;  4A55 A;  1QZ2 A;  3S2A A;  4A1S A;  1E8X A;  1XGW A;  2GGF A;  4BTA A;  5DBK A;  4NUR A;  4PS8 A;  5CEA A;  2P2C P;  5HRY A;  4U96 D;  3R7Q A;  3Q9N C;  5G04 J;  2KZT A;  4ANU A;  3HHM A;  3Q75 A;  3V2X A;  3PRE A;  3FUI A;  3C5R A;  3UTM A;  5KJN A;  2WXN A;  4Y6C A;  3Q4A B;  4JC8 A;  2WXO A;  1SQM A;  2KC7 A;  4OYS A;  5B1A E;  3LCA A;  5D66 A;  3PZD A;  2LXM A;  3KSL A;  3U4T A;  3ZFW A;  3JCK C;  3CEQ A;  3PNT B;  2VJ8 A;  3T9K A;  5KNH D;  1JCS A;  4U04 A;  3QWV A;  3DST A;  3SD5 A;  3E37 A;  5G55 A;  3TWS A;  2RFM A;  4FP7 A;  2XRZ A;  4QFV A;  4R7L A;  5ENQ D;  4G11 A;  2R17 C;  3FH8 A;  2Y4T A;  2QY7 A;  3ZGQ A;  3FH7 A;  2WXK A;  4BT9 A;  3OTN A;  4O60 A;  4WWN A;  4BER A;  4CDM A;  1NL4 A;  2WMO A;  3CST A;  2LNI A;  5FQ6 A;  3U64 A;  5KWD A;  2F0Y A;  4HI8 A;  5CEC B;  1PY1 A;  3L17 A;  4GML A;  2J9Q A;  3GYZ A;  4HXI A;  5ARF A;  3VTX A;  4I43 A;  5D0Q D;  5HKP A;  3BG0 B;  1WAO 1;  2AW6 A;  4U8H A;  4DPR A;  4U0Z A;  4BX9 A;  3MGB A;  1EF1 C;  3AG1 E;  1H0A A;  2J4B A;  3Q73 A;  4UQY A;  1IXV A;  3I4R B;  2MHK A;  4I6E A;  3CVL A;  2XGS A;  3RRU A;  1SZ9 A;  3R7R A;  4JEH A;  4FU3 A;  5CCM A;  4JZY A;  3JXI A;  2EIL E;  3FP3 A;  3LY8 A;  2QZA A;  1HXI A;  2GRQ B;  3S7J A;  3PUK A;  1SZA A;  4C0E A;  4DX7 D;  3PVL A;  4DI3 A;  3ZYM A;  1DVP A;  1E96 B;  2AJA A;  4G1T A;  4BSZ B;  4URK A;  2WXG A;  5H7P A;  1MX2 A;  3IV0 A;  5EYP F;  4J8Y A;  2J8S D;  3UQ3 A;  2I1J A;  2NSZ A;  1O5M A;  3TG5 A;  3D9K A;  2ZGD A;  2MOW A;  4OVU A;  2DBA A;  5KJL A;  3PZ4 A;  4AIF A;  2CFU A;  2I1K A;  2WXR A;  4CEM A;  3D9O A;  4GZC A;  3CQC B;  5BT1 A;  5LCW C;  2X6K A;  1ZU2 A;  3L9T A;  5HQ8 A;  4JHR A;  3FU0 A;  2KZT B;  4J7W A;  4KT6 B;  2I2O A;  3P2B A;  2GRM A;  5EYL A;  1TJC A;  4KVM A;  2XQ0 A;  1N0Q A;  3QWP A;  4ATZ D;  4LCT A;  4U0S A;  1W3B A;  1DNP A;  3FU3 A;  3QJZ A;  4EQF A;  4UUC A;  2P58 C;  3J5Q B;  1RW2 A;  4G2V A;  3CVV A;  1UG3 A;  4KMO A;  2C2L A;  1O1S A;  3HXE A;  4HBD A;  3ONK A;  2P9P G;  1MHQ A;  2FBN A;  3G2U A;  4NIK A;  4EZL A;  4GCN A;  1AP7 A;  2CG3 A;  2KXP C;  4B94 A;  3FU5 A;  5G04 C;  4GTV A;  1QBQ A;  1IHB A;  4RQI A;  3RRN B;  4OAV B;  2OV8 A;  5EIB E;  1H19 A;  4KYO B;  4LUN U;  4U95 D;  1Z3Y A;  3OAW A;  4WNG A;  3TG4 A;  5FZR A;  1E8Z A;  3C98 A;  1OUV A;  1TNB A;  4AP2 A;  4PUC A;  2P9I G;  3CHP A;  3DPD A;  2PL2 A;  3S7F A;  3IKO B;  4LRZ A;  2OOE A;  1NA0 A;  3ISM C;  3O48 A;  2VGX A;  3SNX A;  2VTB A;  1KT0 A;  2EIN E;  4L2Y A;  3UT8 A;  1LD8 A;  4YVO A;  3TWQ A;  1IQU A;  2P9U G;  3T8K A;  3CV0 A;  5FWQ A;  3CVQ A;  2H6I A;  3ULQ A;  3ZXP A;  3ASF A;  3V31 A;  1PAQ A;  4PH4 B;  3FTY A;  5J90 A;  1OY3 D;  5FTP A;  5BNW A;  1OWO A;  2B6C A;  3VTY A;  1OWM A;  1MQS A;  2IF4 A;  1SW6 A;  3EUV A;  4Q94 A;  1WG0 A;  1FVF A;  2ETB A;  3CIA A;  3G2T A;  3DBS A;  2IU1 A;  1NFI E;  5LX8 A;  2CHX A;  5ENS D;  1B89 A;  2VQ2 A;  4E85 A;  1BU9 A;  1OWL A;  4I17 A;  3I4G A;  1N94 A;  1OXJ A;  3CVX A;  3FTS A;  4RSY A;  1KT1 A;  1N95 A;  4FHK A;  1LF8 A;  4CT0 A;  4I1A A;  4K5B A;  1MJ0 A;  1WDY A;  3TWW A;  4RLY A;  1TR4 A;  3PEV B;  3UM0 A;  3D9M A;  4YVQ C;  1OWP A;  2ETA A;  3RK6 A;  4GPK A;  1IHG A;  4GTO A;  1H6P A;  3CKC A;  3TL5 A;  1FT1 A;  5CER B;  2CHW A;  4PDX A;  5CBN A;  1PC2 A;  2CFZ A;  3EJN A;  4PS7 A;  4RG9 A;  3UT7 A;  4BEP A;  5A7D B;  1O1T A;  2RG8 A;  4XE0 A;  3V2O A;  5FQ7 A;  2J09 A;  4Z68 A;  3ML9 A;  4JL0 A;  4WWP A;  4HLL A;  4YDO A;  2FF4 A;  1HU3 A;  4EHM A;  5BV0 A;  1TNO A;  1BI7 B;  2B0O E;  4EBA A;  2QC9 A;  5EX0 A;  2RD0 A;  3FUL A;  4CDN A;  5JA4 D;  3FTW A;  4J8F A;  4W9R A;  1OCC E;  3NBN B;  3B95 A;  4TXP A;  4DK5 A;  4Q96 A;  3FDH A;  2XHE A;  1S64 A;  3QOU A;  1ZB1 A;  2EIM E;  1KLX A;  5T4Y A;  2X6F A;  4L23 A;  3EHQ A;  1MZC A;  3C3R A;  5JJ7 A;  5BXU A;  4UWG A;  4UI9 K;  3B7T A;  5FJY A;  1MYO A;  4AY6 A;  4F3V A;  4BET A;  3TWU A;  2MYO A;  3KS2 A;  3ABK E;  4TUM A;  3EHN A;  3PZ2 A;  1HS6 A;  2DZO A;  2VGX B;  5G05 C;  2VTB B;  3IEG A;  1HX8 A;  1OWN A;  5ENO D;  4L9P A;  2V4L A;  5B1B E;  3QAR A;  3DPY A;  3S7D A;  5LOZ A;  1U3D A;  4J8S A;  3F6Q A;  3Q15 A;  2JLB A;  5FQ8 A;  4HNA D;  3JYS A;  2AXZ A;  1WM5 A;  4CZ2 D;  4HQD A;  3HXB A;  2WXI A;  4XIF A;  4PS3 A;  4TRQ A;  1QNF A;  3CK7 A;  4WAF A;  3URZ A;  3PEU B;  2P9L G;  3ZYQ A;  1TN6 A;  3G2V A;  5AQA A;  2BKK B;  4H7X A;  3CHO A;  3EHM A;  4GYY A;  1JPL A;  3NAW A;  4O1P A;  4ANV A;  3DXM G;  4KVO A;  3MCX A;  5CBO A;  3FUF A;  3MKQ A;  4F6R D;  4N3C A;  2Q7F A;  2ZXW E;  3CHS A;  2BTD A;  3L54 A;  4IYP A;  4UQX A;  2XCC A;  1K3Z D;  3ASO E;  1OT8 A;  3V79 K;  3Q7F A;  3KEA A;  5FZS A;  3ZU7 B;  1N4R A;  3MJW A;  3I5P A;  1GW6 A;  4BTB A;  4C48 B;  4B89 A;  4AEZ C;  3U3W A;  2WXH A;  3FUN A;  3RRM B;  4K5A B;  3ZUV B;  3MZL B;  2J07 A;  1YMP A;  4WWO A;  4CGW A;  3NF1 A;  1JWF A;  1HO8 A;  1YYH A;  3FTZ A;  4YDW A;  5HI7 A;  3GZ1 A;  1IQR A;  4GTT A;  4A63 B;  3SQV A;  1SA4 A;  3L16 A;  4GA2 A;  4EPZ A;  4ATG A;  1X81 A;  4MS6 A;  3U9W A;  3LS8 A;  4N2Q A;  2F8Y A;  3IHY A;  4ILI A;  2PZI A;  3ESK A;  3Q7A A;  3DSX A;  3D9H A;  3ZPJ A;  4I1M A;  4HRM B;  1A17 A;  2KCV A;  4LNG A; 
#chains in the Genus database with same CATH homology
 5ANL A;  3T5X A;  3Q49 B;  4XI0 A;  4B8C B;  4BWR A;  5CCL A;  3ZYL A;  4GCO A;  5LP0 A;  4KZC A;  4L1B A;  4XKC A;  3RRN B;  4FA6 A;  2OV8 A;  1Z3X A;  4J0U A;  2M63 A;  4GU5 A;  4IUL A;  3MEK A;  4Y6W A;  3RIB A;  3NQP A;  1NP7 A;  2AWI A;  1H19 A;  3ZEF A;  5AEN A;  2WQ7 A;  4KYO B;  2WXJ A;  4LUN U;  1Z3Y A;  2VSY A;  3OAW A;  4WNG A;  3RJV A;  3TG4 A;  3VLF A;  5FZR A;  4MLP A;  4CRW A;  2FEZ A;  1E8Z A;  3C98 A;  2Y4U A;  3MKR A;  2MRI A;  1E7U A;  1OUV A;  4AP2 A;  3KD7 A;  3CVW A;  5BUZ A;  1HZ4 A;  3L08 A;  1ELK A;  3MA5 A;  2E2E A;  2LSV A;  5ENN A;  3T8M A;  2CHZ A;  4PUC A;  3TXM A;  1Y8M A;  3TGO A;  3CVY A;  3JQ0 A;  2AXV A;  5FZQ A;  3AS8 A;  2IQC A;  3MV3 B;  4U63 A;  4FLH A;  3CHP A;  3DPD A;  3T5V A;  2PL2 A;  3FU5 A;  2WPV A;  3IKO B;  1HG2 A;  1UN8 A;  3S7F A;  4LRZ A;  4GMJ A;  3CKB A;  3AS5 A;  2OOE A;  3Q47 B;  4AJW A;  1NA0 A;  3SNX A;  3O48 A;  2VGX A;  4HOU A;  4DJA A;  3OXG A;  2VTB A;  3LVQ E;  1KT0 A;  4GZ5 A;  4AV7 A;  2QFC A;  4L2Y A;  3UT8 A;  2UY1 A;  1FCH A;  4YVO A;  3CVU A;  5AJL A;  4JEU A;  1IQU A;  3KEZ A;  3G2W A;  4JW1 A;  2LAI A;  3ZN3 A;  4DI4 A;  1H2V C;  2IFU A;  2DCP A;  4I9C A;  4XI9 A;  4Q69 A;  5AIJ A;  3CV0 A;  4G23 A;  4GYW A;  5FWQ A;  3CVQ A;  1ZBP A;  4KBQ A;  3CHM A;  3OXF A;  3D9P A;  4F1S A;  1VDY A;  5DIZ A;  2V5F A;  3APD A;  3PS6 A;  3ULQ A;  2KCK A;  2WXP A;  2C0L A;  5CHE E;  4BX8 A;  3ASF A;  2YHE A;  2OVF A;  3ESL A;  1PAQ A;  2OND A;  3FTY A;  2LO6 A;  3ASD A;  3KAE A;  4KZ0 A;  4PH4 B;  3CVN A;  3QK0 A;  4U0U A;  5J90 A;  2KCL A;  3L22 A;  2WM9 A;  4LER A;  2WXQ A;  4AM9 A;  5FTP A;  4F7A A;  2PQR A;  3ZHE B;  2HYZ A;  3FUH A;  5A23 A;  5BNW A;  4NRH B;  1OWO A;  1E8W A;  2HO1 A;  2NXP A;  1UJK A;  1YA0 A;  2E0I A;  1E8Y A;  2A4Z A;  3WXX A;  1UJJ A;  4FLB A;  3VTY A;  5LCW J;  3FEY A;  4HLE A;  3N71 A;  1OWM A;  1MQS A;  3QDN A;  3QWW A;  4AXH A;  2IF4 A;  5AYW D;  5C1D A;  3CQG B;  5ARG A;  1UN9 A;  4A3V A;  3AU5 A;  4G26 A;  4I1O B;  3HIZ A;  1UW4 B;  4JXT A;  4Q94 A;  4UWH A;  1FVF A;  2I9C A;  3CIA A;  3G2T A;  4GYO A;  3RKV A;  3DBS A;  4AY5 A;  2UWJ G;  3ASH A;  2IU1 A;  4UWK A;  4UWF A;  5EX3 A;  3PUJ A;  3EIQ C;  3BEE A;  5LX8 A;  1S0P A;  2CHX A;  2WMN A;  3G2S A;  1B89 A;  2VQ2 A;  3E4B A;  3GZS A;  3TXN A;  4J6I A;  5EDS A;  4MKT A;  4E85 A;  5EKQ D;  5C2Y A;  3B7R L;  1OWL A;  2WXM A;  3APC A;  4I17 A;  2XEV A;  4AOF A;  3I4G A;  3FWV A;  5G05 J;  3FTS A;  4ABN A;  3CVX A;  4RSY A;  4ANW A;  1TJF A;  1KT1 A;  3PNL B;  4JHK A;  3CLJ A;  4G25 A;  4OVV A;  2PM6 A;  2ION A;  3OXL A;  2AVP A;  2LSU A;  4BSX A;  4UI9 C;  2JEK A;  4FHK A;  1HF8 A;  1LF8 A;  4GB9 A;  1U3C A;  4CT0 A;  4HOS A;  4I1A A;  3SFZ A;  4BT8 A;  4CGV A;  2VGY A;  3L13 A;  4A55 A;  3PEV B;  1QZ2 A;  4FHJ A;  3D9M A;  4YVQ C;  3MYV A;  3S2A A;  1L5J A;  3FTX A;  1XNF A;  1OWP A;  1E8X A;  4MRU A;  3IHV A;  3LKU A;  4WUY A;  5T8I A;  3RK6 A;  1IHG A;  4A1S A;  4GPK A;  3CVP A;  1JUQ A;  1XGW A;  3CKC A;  2GGF A;  4BTA A;  2EQX A;  2KAT A;  3TL5 A;  5DBK A;  4L2L A;  1INZ A;  4RG6 A;  2Y3A A;  4NUR A;  3AS4 A;  4HOQ A;  4PS8 A;  3LY9 A;  1EYH A;  2L9B A;  5CMW A;  3R7Q A;  2CHW A;  4PDX A;  4GZ6 A;  4WNE A;  1PC2 A;  5G04 J;  1NA3 A;  2CFZ A;  3EJN A;  3SBT B;  1H6K A;  3NZS A;  2KZT A;  4O6F A;  3VLD A;  3HHM A;  4ANU A;  2WXL A;  2WVI A;  4PS7 A;  5LFA A;  3PRE A;  4RG9 A;  1N52 A;  3FUI A;  3UT7 A;  2CG2 A;  3HVE A;  5KJN A;  5A7D B;  2WXN A;  4FC8 A;  4Y6C A;  4EZJ A;  3Q4A B;  4JC8 A;  2RG8 A;  2WXO A;  4HS2 A;  4K03 A;  4XE0 A;  2FO7 A;  5FQ7 A;  1SQM A;  2KC7 A;  3CGH A;  4OYS A;  2J09 A;  2HM8 A;  2HR2 A;  3ML9 A;  4JA7 A;  1EPU A;  3LCA A;  3FY4 A;  4JL0 A;  2VSO E;  4WWP A;  2FF4 A;  1HU3 A;  2J49 A;  3PZD A;  3UMV A;  5BV0 A;  3U4T A;  3ZFW A;  1E7V A;  3RO2 A;  2R5S A;  4HFG A;  4JHJ A;  3RU0 A;  3ZVV A;  3JCK C;  3CEQ A;  3PNT B;  4EBA A;  2XPI A;  2VSX E;  2VJ8 A;  2YQ8 A;  3B7S A;  4BFR A;  5J08 A;  4P29 A;  5EX0 A;  2IJG X;  2RD0 A;  3MV2 B;  3S7B A;  3FUL A;  4JA9 A;  4CDN A;  4U04 A;  3FUD A;  3PE3 A;  3QWV A;  2L0T B;  2PQN A;  3FTW A;  4I6J A;  4J8F A;  3SD5 A;  3QC1 A;  4W9R A;  5JHA A;  3FH5 A;  5G55 A;  5BW8 C;  3CSF A;  4I6G A;  4FP7 A;  3MX3 A;  4RVB A;  4DK5 A;  4QFV A;  4R7L A;  2XRZ A;  5BPP A;  4APF A;  2FUL A;  3I3N A;  4Q96 A;  3ZRH A;  3FDH A;  2XHE A;  2VSN A;  4G11 A;  3QOU A;  2R17 C;  3QAQ A;  2XGO A;  2BF0 X;  3FH8 A;  4TV3 A;  2Y4T A;  4FUL A;  1KLX A;  5T4Y A;  2X6F A;  4L23 A;  5KCM A;  4I2Z A;  1FVH A;  4HOR A;  2QY7 A;  3O4Z A;  3SBS A;  3ZGQ A;  5JJ7 A;  3D9L A;  2KM4 A;  4UWG A;  1EDU A;  4UI9 K;  3SGH A;  1WY6 A;  2YHC A;  3FH7 A;  2WXK A;  2FI7 A;  3B7T A;  3OTN A;  4K0R A;  5FJY A;  4BT9 A;  4C9B B;  4DLO A;  4N3B A;  4ILG A;  3UX4 A;  3LEW A;  4A1G A;  4WWN A;  4AY6 A;  4UQZ A;  3LPZ A;  4F3V A;  4CDM A;  2OVB A;  2WMO A;  4F53 A;  3CST A;  2LNI A;  4I9E A;  3KS2 A;  4ME2 A;  5FQ6 A;  3U64 A;  4B0Z A;  3MKQ B;  1QQE A;  3EIJ A;  3EHN A;  1HS6 A;  4IN3 B;  2J4D A;  3AU4 A;  1PY1 A;  3L17 A;  2VGX B;  5G05 C;  2VTB B;  2J08 A;  4GML A;  2L0I A;  3IEG A;  4XZ4 A;  1HX8 A;  2R59 A;  1OWN A;  2UY1 B;  2J9Q A;  3GYZ A;  3LVR E;  5JHB A;  4GA1 A;  2V4L A;  4HXI A;  5ARF A;  4ILH B;  1TEZ A;  2GW1 A;  3LJ3 A;  4I43 A;  3B13 A;  3VTX A;  2WXF A;  5D0Q D;  3QAR A;  2WQ6 A;  3S7D A;  5ANR A;  5LOZ A;  3QNK A;  4N39 A;  1HG5 A;  1U3D A;  4UI9 J;  4J8S A;  3FUJ A;  2I6H A;  4H7Y A;  3RO3 A;  3NZU A;  4EEC A;  3BG0 B;  1WAO 1;  2AW6 A;  3Q15 A;  4U8H A;  4DPR A;  2A5U A;  3U66 A;  4JPS A;  4U0Z A;  5E75 A;  3FUK A;  4BX9 A;  2JLB A;  2DIW A;  3MGB A;  3CK8 A;  5FQ8 A;  1EF1 C;  3JQ1 A;  2X6J A;  4I2W A;  3D3M A;  3JYS A;  2AXZ A;  4N3A A;  1H0A A;  4CT4 A;  1WM5 A;  2X6H A;  2J4B A;  4N5C A;  4N2S A;  4ANX A;  4GA0 A;  5AJD A;  4UQY A;  2ZU6 B;  4CCA A;  3I4R B;  2WXI A;  2MHK A;  4XIF A;  3ZHE A;  3GZ2 A;  5E76 A;  4PS3 A;  4I6E A;  4WND A;  3LYA A;  4TRQ A;  3CVL A;  2XGS A;  1SZ9 A;  3R7R A;  1QNF A;  2GRL A;  3CK7 A;  4JEH A;  3RRU A;  2XPZ A;  4FU3 A;  4BY6 A;  5CCM A;  4J8E A;  4JZY A;  4WAF A;  3URZ A;  4HVB A;  3PEU B;  3FP3 A;  3LY8 A;  3UPV A;  4CDR A;  3ZYQ A;  3LY7 A;  3TJP A;  4DLQ A;  3ENE A;  3G2V A;  2WB2 A;  1HXI A;  2XCB A;  3GW4 A;  3LXU X;  3S7J A;  3PUK A;  1SZA A;  4GAA A;  3VLE A;  4C0E A;  2X38 A;  3ZW3 A;  1HFA A;  3CK9 A;  4H7X A;  3CHO A;  3FHE A;  3PVL A;  4NAC A;  5FT9 A;  3R9A B;  3SZ7 A;  4DI3 A;  5M72 A;  3EHM A;  3ZYM A;  1DVP A;  1H2U A;  1E96 B;  1JPL A;  2WQH A;  4G24 A;  4GYY A;  5T3R A;  3ZIM A;  5A6C A;  4ANV A;  4G1T A;  1ELR A;  4TUU A;  5KJK A;  4KVO A;  4URK A;  2WXG A;  5KJM A;  3MCX A;  3TAX A;  3FTV A;  1Z6T A;  3FFL A;  3IV0 A;  1HE8 A;  4GZD A;  3LDZ A;  2YNQ A;  3FUF A;  3UQ3 A;  3MKQ A;  2X6I A;  2I1J A;  4EZK A;  1ELW A;  3SHF A;  2YIN A;  2NSZ A;  1JWG A;  4N3C A;  4FJY A;  2Q7F A;  3FEX A;  1P5Q A;  3TG5 A;  3CHS A;  1HH8 A;  3APF A;  3D9K A;  3IBE A;  1X5B A;  2BTD A;  3L54 A;  4IYP A;  3ZXS A;  4UQX A;  2XCC A;  2MOW A;  3P1U A;  4OVU A;  4C0M A;  2DBA A;  2XRY A;  4JVS A;  3FU6 A;  1IYG A;  5FZS A;  3PE4 A;  5KJL A;  5JJT A;  2LAH A;  4AIF A;  3FTU A;  2CFU A;  3MJW A;  3SF4 A;  2I1K A;  4NQ0 A;  2WXR A;  3FUM A;  4CEM A;  4D10 C;  3I5P A;  3Q5M A;  3D9O A;  1GW6 A;  3PH0 C;  4GZC A;  4BTB A;  4UWL A;  4B89 A;  4WNF A;  1N54 A;  2BUG A;  3CQC B;  5BT1 A;  4AEZ C;  3U3W A;  5LCW C;  3L6A A;  2WXH A;  2VYI A;  2X6K A;  3FUN A;  5JJ6 A;  1ZU2 A;  3RRM B;  5HQ8 A;  2V0P A;  4JHR A;  3FU0 A;  2V8S E;  2XGM A;  5D0O D;  3UT4 A;  4APO A;  5FQ4 A;  2KZT B;  3ONL A;  3D9J A;  4KT6 B;  4B8A A;  3MZL B;  2J07 A;  4WWO A;  4CGW A;  4J8D A;  2I2O A;  3NF1 A;  5G2N A;  4EBA G;  3CR3 A;  1JWF A;  1HO8 A;  1Y6I A;  3HVE B;  3UUX A;  3P2B A;  2ILR A;  3BG1 B;  2NC9 A;  2X3M A;  5BV1 A;  1BPO A;  2GRM A;  3ML8 A;  1TJC A;  4E6H A;  4KVM A;  2XQ0 A;  3QWP A;  3FTZ A;  3ZYK A;  4V3I A;  5HI7 A;  3GZ1 A;  4LCT A;  4U0S A;  1IQR A;  4M3O A;  1W3B A;  2C0M A;  1DNP A;  3FU3 A;  3QJZ A;  4LEU A;  4XX5 A;  4EQF A;  3D9I A;  3B7U X;  3D9N A;  3JUI A;  3PRZ A;  3FUE A;  2P58 C;  4XKB A;  2AXU A;  3EDT B;  4G2V A;  2IOS A;  3L16 A;  4GA2 A;  4U07 A;  4EPZ A;  3CVV A;  4ATG A;  3HDX A;  3PDN A;  1UG3 A;  3K9I A;  2C2L A;  4KMO A;  4GZ3 A;  4KXK B;  4MS6 A;  3U9W A;  3CHR A;  1NZN A;  3ONK A;  3LS8 A;  3QKY A;  4N2Q A;  3ASG A;  4A3T A;  4FAD A;  3QB2 A;  4IRU A;  3CHQ A;  4ACK A;  3SI5 A;  2PM7 A;  2IOL A;  4ACL A;  2L6J A;  3IHY A;  4L7T A;  4ILI A;  1MHQ A;  2PZI A;  2FBN A;  2XPY A;  3ESK A;  5CMY A;  4AVX A;  1H2T C;  3G2U A;  3HYM B;  4EZL A;  1E90 A;  3ZPJ A;  4HOT A;  4GCN A;  4FJZ A;  2CG3 A;  4I1M A;  4B94 A;  1A17 A;  2KCV A;  5G04 C;  4YND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...