4AM9A

Crystal structure of the yersinia enterocolitica type iii secretion chaperone sycd in complex with a peptide of the translocator yopd
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
131
structure length
131
Chain Sequence
NEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Yersinia Enterocolitica Type III Secretion Chaperone Sycd in Complex with a Peptide of the Minor Translocator Yopd
pubmed doi rcsb
molecule keywords CHAPERONE SYCD
molecule tags Chaperone
source organism Yersinia enterocolitica
total genus 52
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2012-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07720 TPR_3 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4am9A00
4A1SA 1FCHA 4APOA 3Q5MA 3LCAA 5AYWD 1ZBPA 4GZ3A 2PQRA 2XGMA 3GW4A 3LPZA 4IN3B 4I1AA 2VSYA 1KLXA 5D0QD 3WXXA 3TAXA 3CK7A 4J0UA 5G04J 3VTXA 2ONDA 1NA0A 4RG6A 2HR2A 4G2VA 4KBQA 5EX0A 4KXKB 3S7BA 3EDTB 3MV2B 4G23A 3BEEA 2KATA 3GYZA 3LY9A 4XI0A 2FO7A 1E96B 3FP3A 3IEGA 2VGXA 2Y4TA 4JL0A 3ZPJA 1ELWA 3E4BA 3MEKA 4UI9K 4J8DA 1KT0A 3RKVA 4GA1A 2IFUA 3RU0A 1Y8MA 5KJKA 2HO1A 2PQNA 5FZSA 3KAEA 4N5CA 4WNGA 4GCOA 2KC7A 5M72A 3KS2A 4GZ5A 1YA0A 2XPIA 3QOUA 3SF4A 5JJ6A 4GZ6A 3UPVA 4ABNA 3ASGA 2VGYA 2LNIA 3TG4A 4Y6CA 2IF4A 3NF1A 2XCBA 3ZN3A 3S7JA 1XNFA 1NA3A 1WAO1 2WQHA 4HOQA 4BT8A 4BTAA 3HYMB 4J8EA 3Q49B 5FT9A 1IYGA 2P58C 2R5SA 4JHRA 4RG9A 4GCNA 4G24A 5G04C 5D0OD 3GZ1A 4YVOA 4BWRA 2FBNA 4WNFA 2VGXB 2VQ2A 5CCLA 3Q4AB 5EX3A 4JA9A 4G1TA 5CCMA 3OXGA 2PL2A 3ASFA 4GYOA 5KJLA 2Y4UA 2JLBA 3Q47B 4XIFA 4YNDA 3SZ7A 3URZA 3JYSA 2FI7A 4BT9A 4EQFA 5BT1A 3RIBA 4WNEA 3Q15A 3QKYA 2L6JA 4F3VA 3ZHEA 2HYZA 3AS5A 5FTPA 3FFLA 2VSNA 3LKUA 2FEZA 3OXFA 5JJ7A 1TJCA 3MV3B 2QFCA 4U0SA 4G25A 2GW1A 5KJNA 2XGOA 4N3BA 5DIZA 4N3CA 3CKBA 1B89A 4HORA 2XGSA 3TG5A 3PE4A 5BW8C 3CEQA 4N3AA 5FZQA 3CVNA 3CK8A 4GPKA 5FJYA 3GZ2A 2AVPA 2OOEA 2XEVA 3CV0A 4HOUA 4UI9J 1HH8A 4XI9A 4U04A 2LSUA 2Q7FA 4AIFA 5BNWA 4UQZA 1IHGA 2YQ8A 3QWVA 1PC2A 4I17A 2I6HA 4WNDA 3CK9A 2V5FA 2KCLA 4H7XA 3ULQA 4AY6A 4I2WA 1NZNA 3RJVA 4U07A 3N71A 2BUGA 4H7YA 2C0MA 4Y6WA 4CGWA 3ZGQA 4ME2A 2C2LA 3MA5A 2LSVA 2DBAA 2YHCA 3ZHEB 5ARGA 1W3BA 4NRHB 2MHKA 1P5QA 5EKQD 5ARFA 3S7DA 3LY7A 3RO3A 3RO2A 4GYYA 3ASDA 2XCCA 3ASHA 5LCWJ 4UQXA 3OXLA 3S7FA 1ZU2A 2E2EA 4U0ZA 3O48A 3CVQA 1QQEA 4AY5A 4CDRA 5HQ8A 4AM9A 2UWJG 4GA0A 5DBKA 5FZRA 2PZIA 3ESKA 4UI9C 5C1DA 1HXIA 4G26A 5A6CA 3R9AB 3UQ3A 3K9IA 5G05C 3QDNA 4UQYA 3LYAA 3CKCA 4LEUA 3KD7A 3U3WA 2UY1A 3TGOA 2VYIA 2J9QA 3VTYA 5KJMA 1QZ2A 5CHEE 4GA2A 4N39A 4I9EA 3U4TA 4CGVA 4U0UA 4N2SA 3CVLA 3FWVA 4HOTA 2NC9A 3ZFWA 3UUXA 3QWWA 4I9CA 2KCVA 4GYWA 4WUYA 5G05J 3CVPA 3MKRA 5JJTA 1ELRA 1KT1A 4I2ZA 2WPVA 3PE3A 4NQ0A 4YVQC 4BTBA 4HOSA 5A7DB 5LCWC 4B94A 3LY8A 4JA7A 4O6FA 1WM5A 2C0LA 3AS8A 4KYOB 3AS4A 1A17A 4J8FA 5HI7A 3QWPA 4W9RA 1OUVA 3PDNA 2KCKA 2FF4A 4N2QA 2UY1B 1HZ4A
chains in the Genus database with same CATH superfamily
4BSZB 3FTXA 1FCHA 4Q69A 4APOA 3IBEA 4C0EA 4LG6A 2H6IA 5AYWD 4PDXA 4GZ3A 4QFVA 3DRAA 3LPZA 3P1UA 2DIWA 3KSLA 1N52A 1DCQA 2CHXA 4JVSA 4IYPA 1SZ9A 3C5RA 5FQ8A 3VTXA 3QJZA 3G2SA 2HR2A 3EDTB 4B8AA 2IY0C 4L9PA 2CG3A 1FT1A 3MCXA 3UIPC 2FO7A 1H6OA 3G2TA 3C72A 3UXGA 3ZPJA 3B13A 4DX2A 5B1BE 3E4BA 1E90A 2B0OE 3ISMC 3LXUX 4UI9K 3RKVA 4GA1A 2IFUA 4B89A 4KT6B 2VJ8A 1HS6A 4CCAA 1Y6IA 5AARA 2I1KA 3PZ1A 5FZSA 2RD0A 3TWQA 4U63A 3UINC 4GCOA 4I6EA 3UKUG 1K3ZD 3SBTB 3VLFA 3G2WA 4HI9A 3V30A 2GRMA 3QOUA 4URKA 5JMND 4GZ6A 4JD2G 4XZ4A 2P9PG 3RSEG 3JQ0A 3UPVA 3KEAA 4ABNA 1OWNA 4WAFA 2CHZA 5EILA 1TR4A 2IF4A 1NI1A 4JB8P 1EYHA 1PY1A 2WXHA 3R9MA 3DXKG 3ULYA 4BT8A 3W9GA 4A3VA 5A23A 5CRUA 4GTMA 5FT9A 1Z6TA 2AXUA 3DBSA 4KVMA 5AENA 1E8YA 1EPUA 5B3SE 4OVUA 4UWHA 2FBNA 4WNFA 2VGXB 3NAWA 3B7BA 3FU5A 4K0RA 4L1BA 2IONA 2VQ2A 1OXJA 5EX3A 2P2CP 2Y1LE 1TNBA 2ILRA 1MJ0A 1Z3YA 2X6IA 3PUJA 1JWFA 3URZA 2AXVA 4GTPA 3JYSA 5T8IA 3RIBA 2L6JA 4GMRA 3QAQA 1RW2A 5LOZA 1E8ZA 4YDWA 1WY6A 2E0IA 2AW6A 5JJ7A 3SHFA 1RZ4A 1SQMA 2ZU6B 2VTBA 5CBNA 4U8YD 4G25A 2VSOE 2OV8A 5KJNA 2IEJA 3PE4A 2QY7A 4O1PA 4FADA 2X38A 4N3AA 3FH5A 1OT8A 5BXOA 3E34A 3C3RA 1OY3D 2WM9A 4GAAA 5AQAA 1IQRA 3E33A 4TXRA 2V0PA 5ENNA 4AXHA 1Q2ZA 1HH8A 1K8KG 5CBOA 4I6GA 3B7TA 2LSUA 3ZVVA 4FHKA 4XE0A 5BNWA 3L08A 4UQZA 4WNDA 5FQ4A 3EU9A 1DC2A 4AY6A 3APFA 3RJVA 3N71A 2BUGA 2DZOA 4H7YA 3CHSA 2KXPC 3MZLB 1N4PA 3ZHEB 4NIKA 5ARGA 4DI3A 5CERB 4XKCA 2ETBA 4ATGA 2WMNA 5E76A 3V31A 4TUUA 3AG3E 5KWDA 4F1PA 1PAQA 3RO2A 3W9FA 4L7TA 3ASHA 1TN8A 4UQXA 3UX4A 3CVVA 4GTVA 3AAAC 5D66A 3B7UX 2WXLA 1ZU2A 3MKQB 2FULA 5DBKA 3UM3A 4U7EB 3HXCA 3L6AA 1HE8A 4UI9C 5C1DA 2J8SD 3FHEA 4PS7A 1N0RA 5G05C 3QDNA 4G11A 5EYPF 3IXEA 2P9IG 2VYIA 4IULA 2J9QA 4R7LA 3D9IA 1YCSB 4I9EA 5LFAA 5AQBA 2XEHA 4N2SA 2P9NG 2CHWA 5AIJA 2ZIRA 2NC9A 3ZFWA 1O1SA 4AOFA 2Y3AA 3D9LA 2XPYA 5JHAA 2V4HC 2X6FA 3FUMA 2EIJE 1TNOA 1KT1A 3DEPA 4I2ZA 4UWFA 3Q9UC 1NL4A 2NYJA 3ZXSA 2P9SG 1SVXA 4HOSA 3D3MA 4GZDA 3ZRHA 4JA7A 3T9KA 3F6QA 1N9AA 1BI8B 4B0ZA 4LNBA 2QC9A 3UM1A 3UT7A 1JUQA 4MS6A 4DRXE 3D9HA 1WM5A 1FPPA 1K1BA 3AS4A 3FTWA 1A17A 1UN9A 2WXQA 4W9RA 4J7WA 4AVXA 3G2UA 2IU1A 3UI2A 2J4BA 2FF4A 2EINE 1UW4B 3PNTB 3Q5MA 4LRZA 3LCAA 5HS0A 3CHQA 3RRUA 4KMOA 3SBSA 1AWCB 1BU9A 2XGMA 3RK6A 3T8KA 4I1AA 3L16A 2VSYA 3C98A 3SGHA 2XRZA 3FUNA 1Z3XA 1KLXA 4NACA 1BLXB 4YDYA 4ANUA 4HLEA 2F8XK 4HVBA 2ONDA 4RG6A 4G2VA 4KXKB 4GMLA 3BEEA 3LY9A 4XI0A 1E96B 3ZYMA 2L0IA 1HG2A 2AJAA 2VGXA 2AXZA 4B93B 1ELWA 3MEKA 3EHRA 3EIJA 2V8SE 4MLPA 1LF8A 4GZCA 2KM4A 3RU0A 3EHNA 5AJLA 4C48B 3DSWA 4DLOA 1HX8A 4N5CA 1E8WA 3OTNA 3UKRG 2X6HA 2YINA 3Q9NC 2EQXA 3SF4A 4WWNA 5JJ6A 4DUIA 4GU5A 3ASGA 2VGYA 1N94A 2LNIA 2CG2A 4I6JA 2XCBA 3ZN3A 3MJWA 4BESA 3APCA 3SNXA 1TEZA 4EZJA 4M7CA 5CEDB 1KZPA 3CHPA 4CT4A 4F7AA 1IYGA 3DSSA 3O4ZA 4RG9A 4JHRA 4GCNA 5G04C 5D0OD 5CRVA 3GZ1A 1X81A 4G8KA 5ENTD 3J5QB 4F1SA 1D8DA 4EPZA 1A5EA 4L2YA 4JA9A 3ML8A 3E30A 4G1TA 5CCMA 3I4GA 3OXGA 2GROB 3DEOA 1MQSA 3Q7FA 4FLBA 2DWZA 3Q73A 1N4SA 3CHMA 3SZ7A 3Q15A 3QKYA 1U3DA 3CLJA 4JHJA 3ZHEA 3HVEB 3FFLA 1HFAA 5G2NA 5FQ6A 3OXFA 2MRIA 3TJPA 4BY6A 3MV3B 2QFCA 4YDOA 3NB2A 3FEXA 2A4ZA 4U0SA 1YMPA 2GW1A 3UIOC 4N3BA 5DIZA 4N3CA 3CKBA 5EN5D 3KEZA 3TG5A 3ABKE 3KSQA 3CEQA 4E85A 3PEVB 3BG1B 3CVNA 3CK8A 4GPKA 4XX5A 5FJYA 3MKQA 2XEVA 4K5CA 3CV0A 3RRMB 1H2VC 4UI9J 1OWOA 5CECB 4PUCA 2F37A 4K03A 4D10C 4I1OB 2BF0X 3PH0C 2BEDA 5FINA 2GRRB 4LERA 2IOSA 2I6HA 2V5FA 2KCLA 1N4RA 1L5JA 4WWOA 1NZNA 5EIBE 1FVHA 1IHBA 4K5BA 2LSVA 2DBAA 2YHCA 3D9KA 4GTSA 5KNGA 3AG2E 1HF8A 3Q7AA 2RG8A 4ANWA 5BUZA 5IY5E 5FQ7A 3FY4A 2LAIA 1SA4A 3TWVA 5ARFA 4UWLA 4X8QA 1FVFA 2WVIA 1HG5A 4GYYA 4CRWA 3BQOA 1EF1C 3PREA 3ASDA 4E6HA 3CR3A 4HNAD 3PZ3A 2WXIA 1JCSA 3CVXA 3EHMA 3NBNB 2LUHA 2EIME 1QQEA 3TXNA 1UOHA 3HDXA 4AY5A 4CDRA 1INZA 2XZTG 3PVLA 5KBAA 3T8MA 3OAWA 4A55A 1MX2A 3ESKA 5ANRA 4LNUD 3FUIA 2FO1E 3VLEA 1HXIA 1TN7A 5ENSD 5A6CA 4C0MA 4Q94A 3R9AB 2WXMA 3SI5A 2XHEA 4LCTA 2MYOA 2DVWA 3VLDA 3KD7A 4FJYA 3SD5A 3V2XA 3FTUA 4GA2A 4U8HA 4BFRA 3MX3A 3U4TA 4CGVA 3IHVA 1DVPA 3CVLA 3BU8A 1IQUA 2A5EA 3FWVA 4OAVB 2P9KG 4GYWA 2H6GA 3CVPA 3ZKJA 5JJTA 1FT2A 3ZIMA 1S64A 2L0TB 3PE3A 4NQ0A 3HXEA 3Q78A 5AN8A 4DI4A 4B94A 1LD8A 2X6JA 3UM0A 1O1TA 4FJZA 3D9OA 3LVRE 4FHJA 3AS8A 4KYOB 2RFMA 4HQDA 4J8FA 5HI7A 4OAUC 3QWPA 5AQ9A 3TXMA 1OUVA 1MX4A 3C3OA 3V79K 4BX8A 3U9WA 4N2QA 2OVFA 4HI8A 3DSVA 3SFXA 3JXJA 2R2LA 3FULA 3I5PA 1TNYA 1ZB1A 3SFYA 1WDYA 1ZBPA 3DWLG 4UWKA 2PQRA 1N11A 1N54A 4BERA 3X2QE 4GTOA 5AQ7A 5D0QD 3WXXA 3TAXA 3D9PA 3U64A 2WXRA 5G04J 1H6PA 3R7RA 5EX0A 2WXOA 3S7BA 4G23A 3MV2B 2BKKB 4JPSA 3GYZA 1JCQA 3ZXPA 3FP3A 2V5QC 5ITZF 3FUFA 4HRMB 2Y4TA 4JL0A 2XEEA 3AG4E 4IRUA 4J8DA 2XPZA 2ETAA 4EECA 2AWIA 1H2TC 3HXDA 1Y8MA 4NURA 4CDNA 3JCKC 2PQNA 4XEIG 3NOCD 4WNGA 2A5UA 4JC8A 1D9SA 4P29A 3KS2A 4GZ5A 3PEUB 2JEKA 5BXUA 1NP7A 3ZU7B 4HRNA 1KPSB 4RLYA 2WXJA 4AJWA 3HVEA 3NF1A 4LUNU 1QYMA 2QZAA 2R05A 3LEWA 1TJFA 2OCCE 3S7JA 4RQIA 1XNFA 1HU3A 3CGHA 2WQHA 4HOQA 4EHMA 4ZFHA 4J8EA 3LVQE 3FUKA 2P58C 3TWTA 2DYSE 4G24A 1Z5SC 3FUHA 4KVOA 5KCMA 4UWGA 3FTVA 4RVBA 1S63A 4YVOA 3ABLE 4C9BB 1QBQA 3LS8A 2F8YA 5CCLA 3Q4AB 2OVBA 4EZKA 2B6CA 4APFA 1X5BA 2WXKA 3T5XA 4OYSA 2LAHA 3DPDA 1H2UA 4GYOA 3L17A 5KJLA 2Y4UA 2JLBA 3Q47B 3D9NA 1IXVA 3JXIA 3JUEA 4HB5A 4ANVA 4BT9A 4EQFA 5BT1A 3LDZA 3FU3A 4DX6D 3CHOA 2R17C 3L13A 4GB9A 4F3VA 3U66A 2ZXWE 2OEVA 5HRYA 3ZUVB 3PS6A 4HLLA 5JA4D 1JPLA 2VSNA 3FUDA 2FEZA 3CHRA 3TWRA 2YHEA 1TJCA 3HIZA 4OVVA 2IO2C 4BX9A 2J09A 4DX5D 2XGOA 4JHKA 3DSXA 1B89A 1DNPA 4HORA 2XGSA 4FLHA 5BW8C 3ENEA 1SZAA 1EDUA 2F0YA 3FUEA 3DSTA 3GZ2A 2OOEA 5J08A 1E8XA 1TNZA 1H19A 2EIKE 4F6RD 1XGWA 4XI9A 3QK0A 1OCRE 2M63A 4AIFA 3AJIA 2YQ8A 4ILHB 1PC2A 1DCEA 3TWWA 3B95A 3Q75A 4H7XA 1YYHA 4GPMA 5LX8A 3PRZA 2WB2A 5ANLA 1MYOA 1JCRA 2C0MA 4Y6WA 3NZUA 4CGWA 3ZGQA 4ME2A 2C2LA 3IHYA 5E75A 4O60A 3MA5A 2GRNB 3SFZA 1E7VA 5AAOA 4NRHB 2MHKA 4CT0A 1P5QA 5EKQD 1SW6A 4RSYA 4HFGA 2PM7A 3LY7A 3CQGB 3RO3A 4G8LA 3UT4A 2GGFA 4ZHBA 4V3IA 2HM8A 4M3OA 1N0QA 5T3RA 3QARA 2KZTB 1LD7A 2P9UG 4Z68A 3OXLA 3S7FA 3SQVA 3NZSA 4U0ZA 3TL5A 3HXFA 1O5MA 2JABA 4BEPA 4TRQA 4HRLA 3DSUA 2WXNA 4GA0A 4J6IA 2PZIA 3IV0A 4B8CB 1QNFA 3K9IA 4PS3A 4KZ0A 4UQYA 3TWSA 3CKCA 4DK5A 3TWXA 4PS8A 4LEUA 3U3WA 3PZ4A 4N5QA 1OCCE 3VTYA 5KJMA 1QZ2A 2WXPA 4JXTA 2WQ7A 4WWPA 3UT8A 4N39A 2WXGA 4TUMA 3JQ1A 3E32A 3D9JA 4U0UA 2IO3C 3ESLA 4ILGA 1JWGA 3FH7A 3WG7E 1LTXA 4FP7A 4DX1A 5FWQA 2KCVA 4WUYA 4Q96A 3I4RB 3FEYA 5FIOA 5G05J 2CFZA 4MRUA 3MKRA 4FC8A 1N4QA 1UJJA 1K1AA 4I43A 2P9LG 2WPVA 3L54A 4DLQA 4LSZE 3P2BA 4YVQC 4LNGA 4BTBA 4ACLA 2RKKA 3ZEFA 5BPPA 4EZLA 5LCWC 1OWMA 2L9BA 3L22A 1V55E 1TNUA 1V54E 4UUCA 2I9CA 2J4DA 2C0LA 1GW6A 5CEAA 2J08A 4A3TA 2BTDA 1S70B 2XENA 2R02A 2VSXE 3V2OA 3MGBA 3EIQC 2H6FA 1N95A 3HG0D 2QYJA 2XS1A 2UY1B 1HZ4A 5G55A 4A1SA 2XRYA 3CSFA 4GTTA 4O1OA 1G3NB 2NXPA 3Q79A 3R7QA 1AP7A 2GRLA 4GTRA 2H6HA 5D2MC 4XKBA 3GW4A 4L2LA 3FH8A 2I1JA 4IN3B 3PZ2A 4CEMA 3EHQA 2Y0BG 4TXQA 2XZDG 3EU5A 3ZYLA 2R59A 3L9TA 3CK7A 4J0UA 5BV0A 1MZCA 3HXBA 1NA0A 4KBQA 3SY2A 1NFIE 3CVWA 3CVYA 2KATA 4JW1A 2ZGGA 3D9MA 4U96D 3IEGA 2X6KA 2NSZA 3NQPA 3ULEG 3AU4A 3FDHA 4L23A 4EBAA 1KT0A 5LP0A 2X3MA 5KJKA 2HO1A 2BKGA 3KAEA 2WMOA 3LJ3A 5AJDA 1TN6A 2KC7A 1E7UA 5M72A 1S0PA 1YA0A 2XPIA 3CQCB 3DPYA 4F53A 3QC1A 3TG4A 4Y6CA 3T5VA 1H6KA 1NA3A 4DX7D 1WAO1 4U8VD 2IQCA 2RFAA 4TV3A 3CIAA 4BTAA 1MX6A 3HYMB 3MYVA 3RRNB 1IKND 3Q49B 3JUIA 2OEWA 2R5SA 3FTZA 3PZDA 4GTQA 3I3NA 3RAUA 4BETA 1UN8A 1WG0A 2MOWA 4BWRA 5EYLA 5EDSA 3SO8A 4PH4B 4FULA 4TXPA 3TWUA 1O1RA 4YDEA 3B7SA 2WQ6A 2R03A 2PNNA 5KNHD 2CFUA 2PL2A 3ASFA 2LO6A 3HRAA 3L82A 3BG0B 3ONKA 3UTMA 4A63B 4FA6A 4XIFA 4YNDA 2FI7A 4ATZD 1VDYA 4WNEA 2WXFA 2VGEA 3EUVA 1U3CA 1UJKA 4AP2A 1KZOA 2HYZA 4HS2A 3AS5A 5FTPA 4ANXA 5CMWA 3LKUA 1BI7B 3ZYQA 5ENPD 3CVUA 3BUAA 4QQIA 4MKTA 3QNKA 1OCZE 2KZTA 4DJAA 3FU0A 5T4YA 5FZQA 2IOLA 2V4LA 4HXIA 2AVPA 2PM6A 1OWLA 4HOUA 4I1MA 1BD8A 5JHBA 4AEZC 3J5PA 2IJGX 2QYUA 3FU6A 4GMJA 2DYRE 2ZGDA 1BPOA 2GRQB 4U04A 1OCOE 2XS8A 2Q7FA 3DXMG 1IHGA 3QWVA 4I17A 4K5AB 2DCPA 3CK9A 3ASNE 3ULQA 4I2WA 3ML9A 1SA5A 2DZNA 4U07A 3PNLB 4JEUA 5ENQD 1UG3A 1TYQG 1W3BA 3ONLA 4JZYA 3CSTA 1ELKA 1OWPA 4BSXA 4J8YA 3S7DA 4FU3A 2VTBB 2XCCA 5ENOD 5LCWJ 1MHQA 5J90A 2J07A 3HHMA 5HKPA 5H7PA 2J49A 2E2EA 4J8SA 5B1AE 3O48A 3CVQA 3UMVA 1D8EA 2Y69E 5HQ8A 4AM9A 5FZRA 3UM2A 4CDMA 4G26A 4EBAG 3UQ3A 3LYAA 4JEHA 3EJNA 5CMYA 2UY1A 3TGOA 2YNQA 3ZYKA 3FTSA 5CHEE 5BV1A 4ACKA 3ASOE 4DPRA 4HOTA 3FTYA 4ILIA 3GZSA 2LXLA 3UUXA 3QWWA 4I9CA 4KZCA 1HO8A 3NOGD 4U95D 4AV7A 1ELRA 2EILE 3IKOB 2ZISA 2LXMA 3LJNA 3FUJA 1U2VG 4MBGA 5A7DB 5C2YA 3LY8A 4CZ2D 4O6FA 3APDA 4HBDA 3ZNGA 5ENRD 3C3QA 3B7RL 3AG1E 3E37A 3QB2A 3AU5A 2KBXA 3S2AA 5EIDA 2HE0A 3PUKA 2ETCA 3ZW3A 4CYMD 2XQ0A 3G2VA 2L6BA 3ABME 2GRPB 3PDNA 4A1GA 2KCKA 1H0AA 2I2OA 2UWJG
chains in the Genus database with same CATH topology
3FTXA 3PNTB 4A1SA 2XRYA 1FCHA 4Q69A 4APOA 3FULA 3IBEA 3I5PA 3CSFA 4C0EA 3Q5MA 4LRZA 3LCAA 3CHQA 5AYWD 3RRUA 2NXPA 3R7QA 4KMOA 1ZBPA 4PDXA 3SBSA 4UWKA 4GZ3A 2PQRA 2GRLA 2XGMA 3RK6A 4QFVA 4XKBA 3GW4A 3LPZA 4L2LA 3P1UA 3FH8A 2I1JA 1N54A 4I1AA 4IN3B 4CEMA 3L16A 2VSYA 3C98A 3SGHA 2XRZA 3FUNA 2DIWA 1N52A 1Z3XA 1KLXA 4NACA 5D0QD 3WXXA 2CHXA 2R59A 3TAXA 3ZYLA 4JVSA 4ANUA 4IYPA 1SZ9A 3D9PA 3U64A 2WXRA 3CK7A 4J0UA 5G04J 5FQ8A 4HLEA 5BV0A 3VTXA 4HVBA 2ONDA 3QJZA 1NA0A 4RG6A 3R7RA 3G2SA 2HR2A 4G2VA 4KBQA 5EX0A 4KXKB 2WXOA 3S7BA 3EDTB 3MV2B 4G23A 4B8AA 4JPSA 3CVWA 4GMLA 3BEEA 2KATA 3CVYA 4JW1A 3GYZA 3LY9A 2CG3A 3MCXA 4XI0A 2FO7A 1E96B 3D9MA 3ZYMA 2L0IA 3FP3A 1HG2A 3IEGA 2VGXA 2X6KA 3FUFA 2NSZA 2AXZA 3NQPA 3G2TA 2Y4TA 4JL0A 3ZPJA 3AU4A 3B13A 1ELWA 3E4BA 1E90A 3MEKA 3LXUX 4UI9K 3EIJA 2V8SE 4IRUA 3FDHA 1LF8A 2XPZA 4J8DA 4MLPA 4L23A 4EBAA 4EECA 1KT0A 3RKVA 5LP0A 2X3MA 2AWIA 4GA1A 2IFUA 4GZCA 4B89A 2KM4A 1H2TC 3RU0A 4KT6B 1Y8MA 2VJ8A 1HS6A 4NURA 4CCAA 1Y6IA 3EHNA 5AJLA 4CDNA 5KJKA 3JCKC 2I1KA 2HO1A 2PQNA 2RD0A 5FZSA 3KAEA 4DLOA 2WMOA 1HX8A 4N5CA 4U63A 4WNGA 2A5UA 3LJ3A 4JC8A 4GCOA 5AJDA 1E8WA 2KC7A 4P29A 1E7UA 4I6EA 5M72A 3KS2A 3SBTB 3OTNA 1S0PA 4GZ5A 1YA0A 2XPIA 3G2WA 3VLFA 2X6HA 3PEUB 2JEKA 2YINA 1NP7A 2GRMA 2EQXA 3QOUA 3SF4A 4WWNA 5JJ6A 4URKA 3CQCB 4GZ6A 4XZ4A 2WXJA 3JQ0A 4F53A 3QC1A 3UPVA 4GU5A 1OWNA 4ABNA 3ASGA 2VGYA 4AJWA 2LNIA 4WAFA 3TG4A 3HVEA 2CHZA 4Y6CA 2IF4A 3NF1A 4LUNU 2CG2A 4I6JA 2XCBA 3ZN3A 3T5VA 1EYHA 3LEWA 1PY1A 1TJFA 1H6KA 2WXHA 3S7JA 3MJWA 1XNFA 1HU3A 1NA3A 3CGHA 1WAO1 2WQHA 4HOQA 3APCA 3SNXA 2IQCA 1TEZA 4EZJA 4BT8A 4TV3A 3CIAA 4BTAA 4A3VA 5A23A 3HYMB 3MYVA 3RRNB 3CHPA 4J8EA 3LVQE 4CT4A 3Q49B 4F7AA 5FT9A 1Z6TA 1IYGA 3FUKA 3O4ZA 3JUIA 2P58C 2R5SA 3FTZA 4JHRA 4RG9A 4GCNA 2AXUA 3PZDA 4G24A 3DBSA 3FUHA 4KVOA 5KCMA 4UWGA 3FTVA 5D0OD 5G04C 3I3NA 4RVBA 4KVMA 1UN8A 5AENA 3GZ1A 1E8YA 1EPUA 2MOWA 4YVOA 4C9BB 4OVUA 4UWHA 4BWRA 2FBNA 4WNFA 5EDSA 2VGXB 3LS8A 4PH4B 4FULA 3FU5A 4F1SA 4EPZA 4K0RA 4L1BA 2IONA 2VQ2A 5CCLA 3Q4AB 5EX3A 3B7SA 2WQ6A 2OVBA 4EZKA 4L2YA 4JA9A 4APFA 3ML8A 1X5BA 4G1TA 5CCMA 2CFUA 3I4GA 2WXKA 3OXGA 2ILRA 3T5XA 2PL2A 3ASFA 2LO6A 1MQSA 4OYSA 2LAHA 3DPDA 1H2UA 4GYOA 3L17A 3BG0B 3ONKA 4FLBA 4FA6A 2Y4UA 5KJLA 1Z3YA 2JLBA 2X6IA 3Q47B 3PUJA 3CHMA 3D9NA 4XIFA 1JWFA 4YNDA 3SZ7A 2AXVA 3URZA 3JYSA 2FI7A 4ANVA 4BT9A 4EQFA 1VDYA 5BT1A 5T8IA 3RIBA 3LDZA 4WNEA 3Q15A 3FU3A 3CHOA 3QKYA 2L6JA 2WXFA 1U3DA 2R17C 3QAQA 3CLJA 3L13A 4GB9A 5LOZA 4F3VA 1E8ZA 4JHJA 1U3CA 1UJKA 3ZHEA 4AP2A 3U66A 1WY6A 2HYZA 4HS2A 3AS5A 5FTPA 2E0IA 4ANXA 3HVEB 3FFLA 3PS6A 5CMWA 1HFAA 1JPLA 2VSNA 3FUDA 3LKUA 5G2NA 2FEZA 5FQ6A 2AW6A 3CHRA 3OXFA 2MRIA 1HZ4A 2YHEA 3TJPA 5JJ7A 1TJCA 4BY6A 3ZYQA 3MV3B 3SHFA 3HIZA 2QFCA 1SQMA 2ZU6B 3CVUA 4OVVA 2VTBA 3FEXA 2A4ZA 4U0SA 4G25A 4BX9A 2J09A 2VSOE 4MKTA 2GW1A 2OV8A 2XGOA 5KJNA 3QNKA 4N3BA 5DIZA 4JHKA 4N3CA 3CKBA 1B89A 1DNPA 3KEZA 4HORA 2XGSA 3TG5A 3PE4A 2KZTA 2QY7A 4DJAA 4FLHA 3FU0A 5BW8C 3CEQA 3ENEA 4E85A 4FADA 2X38A 1SZAA 3PEVB 5T4YA 3BG1B 1EDUA 4N3AA 3FH5A 5FZQA 2IOLA 3CVNA 3FUEA 3CK8A 4GPKA 4XX5A 5FJYA 2V4LA 3GZ2A 4HXIA 2AVPA 3MKQA 2OOEA 2XEVA 2PM6A 2WM9A 3CV0A 3RRMB 1OWLA 4GAAA 1H2VC 4HOUA 4UI9J 1IQRA 4I1MA 1OWOA 5JHBA 4AEZC 4PUCA 5J08A 2IJGX 2V0PA 1E8XA 3FU6A 4K03A 5ENNA 4AXHA 4GMJA 1HH8A 4D10C 1H19A 1XGWA 4I1OB 4XI9A 1BPOA 3QK0A 4I6GA 3B7TA 4U04A 2LSUA 2BF0X 2M63A 3ZVVA 3PH0C 2Q7FA 4AIFA 4FHKA 4XE0A 5BNWA 3L08A 4UQZA 1IHGA 2YQ8A 4ILHB 3QWVA 4LERA 1PC2A 4I17A 2IOSA 2I6HA 2DCPA 4WNDA 3CK9A 2V5FA 2KCLA 4H7XA 5FQ4A 3ULQA 4AY6A 1L5JA 4WWOA 5LX8A 3APFA 3ML9A 4I2WA 3PRZA 1NZNA 3RJVA 4U07A 2WB2A 3N71A 2BUGA 3PNLB 4H7YA 5ANLA 1FVHA 3CHSA 3MZLB 2C0MA 4Y6WA 4JEUA 3NZUA 4CGWA 3ZGQA 1UG3A 4ME2A 2C2LA 3IHYA 5E75A 3MA5A 2LSVA 2DBAA 2YHCA 3D9KA 3ZHEB 5ARGA 3SFZA 1W3BA 4DI3A 1HF8A 1E7VA 2RG8A 4ANWA 3ONLA 5BUZA 4NRHB 2MHKA 4JZYA 3CSTA 4CT0A 4XKCA 1P5QA 5EKQD 5FQ7A 3FY4A 1ELKA 1OWPA 2LAIA 4ATGA 2WMNA 4RSYA 4HFGA 5ARFA 4BSXA 5E76A 2PM7A 3LY7A 4UWLA 3S7DA 4TUUA 3CQGB 3RO3A 1FVFA 2WVIA 4FU3A 1HG5A 1PAQA 3RO2A 4GYYA 4CRWA 3UT4A 2VTBB 2GGFA 1EF1C 3PREA 3ASDA 4E6HA 2XCCA 3CR3A 4L7TA 4V3IA 3ASHA 2HM8A 4M3OA 5LCWJ 1MHQA 5T3RA 3UX4A 4UQXA 2J07A 5J90A 3CVVA 3HHMA 2WXIA 3QARA 2KZTB 3CVXA 2J49A 3OXLA 3S7FA 3EHMA 3B7UX 3NZSA 2WXLA 1ZU2A 2E2EA 4J8SA 4U0ZA 3O48A 3TL5A 3CVQA 1QQEA 3TXNA 3UMVA 3HDXA 4AY5A 3MKQB 4CDRA 5HQ8A 4AM9A 1INZA 2FULA 4TRQA 3PVLA 2WXNA 4GA0A 3T8MA 3OAWA 5DBKA 4J6IA 4A55A 5FZRA 2PZIA 3ESKA 5ANRA 3FUIA 3IV0A 3L6AA 1HE8A 4UI9C 3VLEA 4CDMA 5C1DA 3FHEA 1HXIA 4G26A 4B8CB 4PS7A 5A6CA 4C0MA 4Q94A 3R9AB 1QNFA 2WXMA 4EBAG 3UQ3A 3SI5A 2XHEA 3K9IA 4PS3A 4LCTA 5G05C 3QDNA 4G11A 3LYAA 4KZ0A 4UQYA 4JEHA 3EJNA 3CKCA 4DK5A 3VLDA 4PS8A 5CMYA 4LEUA 3KD7A 3U3WA 2UY1A 3TGOA 2VYIA 4IULA 4FJYA 2J9QA 4R7LA 3SD5A 3VTYA 2YNQA 3ZYKA 5KJMA 1QZ2A 2WXPA 3FTSA 5CHEE 3FTUA 4JXTA 2WQ7A 4GA2A 4U8HA 4WWPA 3UT8A 3D9IA 4BFRA 4N39A 3MX3A 2WXGA 4I9EA 5BV1A 3U4TA 5LFAA 3JQ1A 4CGVA 3IHVA 3D9JA 4U0UA 4ACKA 4N2SA 1DVPA 3CVLA 2CHWA 3ESLA 5AIJA 4ILGA 1IQUA 1JWGA 3FWVA 4DPRA 3FH7A 4HOTA 2NC9A 3FTYA 3ZFWA 4ILIA 4AOFA 4FP7A 3GZSA 3UUXA 2Y3AA 3QWWA 5FWQA 4I9CA 2KCVA 4GYWA 4WUYA 3D9LA 2XPYA 4Q96A 3I4RB 5JHAA 3FEYA 4KZCA 1HO8A 5G05J 2CFZA 2X6FA 3CVPA 3FUMA 4MRUA 3MKRA 4FC8A 4AV7A 5JJTA 3ZIMA 1ELRA 1KT1A 1UJJA 2L0TB 4I2ZA 4I43A 4UWFA 2WPVA 3L54A 4DLQA 3PE3A 3IKOB 4NQ0A 3P2BA 4YVQC 3ZXSA 4BTBA 3FUJA 4ACLA 4HOSA 3ZEFA 5A7DB 4DI4A 5BPPA 3D3MA 4EZLA 5C2YA 4GZDA 5LCWC 3ZRHA 4B94A 1OWMA 2L9BA 3L22A 2X6JA 3LY8A 4JA7A 4O6FA 3APDA 4FJZA 4B0ZA 3D9OA 3B7RL 3UT7A 3LVRE 1JUQA 4MS6A 2I9CA 1WM5A 2J4DA 3QB2A 3AU5A 4FHJA 3S2AA 2C0LA 1GW6A 3AS8A 4KYOB 3PUKA 3ZW3A 3AS4A 3FTWA 1A17A 2J08A 4J8FA 5HI7A 4A3TA 2BTDA 2XQ0A 1UN9A 2VSXE 2WXQA 3G2VA 3MGBA 3QWPA 3TXMA 4W9RA 3EIQC 4AVXA 3G2UA 2IU1A 1OUVA 3PDNA 4A1GA 2KCKA 2FF4A 1H0AA 2J4BA 4BX8A 1UW4B 3U9WA 4N2QA 2I2OA 2OVFA 2UY1B 2UWJG 5G55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A1S A;  1FCH A;  4APO A;  3Q5M A;  3LCA A;  5AYW D;  1ZBP A;  4GZ3 A;  2PQR A;  2XGM A;  3GW4 A;  3LPZ A;  4IN3 B;  4I1A A;  2VSY A;  1KLX A;  5D0Q D;  3WXX A;  3TAX A;  3CK7 A;  4J0U A;  5G04 J;  3VTX A;  2OND A;  1NA0 A;  4RG6 A;  2HR2 A;  4G2V A;  4KBQ A;  5EX0 A;  4KXK B;  3S7B A;  3EDT B;  3MV2 B;  4G23 A;  3BEE A;  2KAT A;  3GYZ A;  3LY9 A;  4XI0 A;  2FO7 A;  1E96 B;  3FP3 A;  3IEG A;  2VGX A;  2Y4T A;  4JL0 A;  3ZPJ A;  1ELW A;  3E4B A;  3MEK A;  4UI9 K;  4J8D A;  1KT0 A;  3RKV A;  4GA1 A;  2IFU A;  3RU0 A;  1Y8M A;  5KJK A;  2HO1 A;  2PQN A;  5FZS A;  3KAE A;  4N5C A;  4WNG A;  4GCO A;  2KC7 A;  5M72 A;  3KS2 A;  4GZ5 A;  1YA0 A;  2XPI A;  3QOU A;  3SF4 A;  5JJ6 A;  4GZ6 A;  3UPV A;  4ABN A;  3ASG A;  2VGY A;  2LNI A;  3TG4 A;  4Y6C A;  2IF4 A;  3NF1 A;  2XCB A;  3ZN3 A;  3S7J A;  1XNF A;  1NA3 A;  1WAO 1;  2WQH A;  4HOQ A;  4BT8 A;  4BTA A;  3HYM B;  4J8E A;  3Q49 B;  5FT9 A;  1IYG A;  2P58 C;  2R5S A;  4JHR A;  4RG9 A;  4GCN A;  4G24 A;  5G04 C;  5D0O D;  3GZ1 A;  4YVO A;  4BWR A;  2FBN A;  4WNF A;  2VGX B;  2VQ2 A;  5CCL A;  3Q4A B;  5EX3 A;  4JA9 A;  4G1T A;  5CCM A;  3OXG A;  2PL2 A;  3ASF A;  4GYO A;  5KJL A;  2Y4U A;  2JLB A;  3Q47 B;  4XIF A;  4YND A;  3SZ7 A;  3URZ A;  3JYS A;  2FI7 A;  4BT9 A;  4EQF A;  5BT1 A;  3RIB A;  4WNE A;  3Q15 A;  3QKY A;  2L6J A;  4F3V A;  3ZHE A;  2HYZ A;  3AS5 A;  5FTP A;  3FFL A;  2VSN A;  3LKU A;  2FEZ A;  3OXF A;  5JJ7 A;  1TJC A;  3MV3 B;  2QFC A;  4U0S A;  4G25 A;  2GW1 A;  5KJN A;  2XGO A;  4N3B A;  5DIZ A;  4N3C A;  3CKB A;  1B89 A;  4HOR A;  2XGS A;  3TG5 A;  3PE4 A;  5BW8 C;  3CEQ A;  4N3A A;  5FZQ A;  3CVN A;  3CK8 A;  4GPK A;  5FJY A;  3GZ2 A;  2AVP A;  2OOE A;  2XEV A;  3CV0 A;  4HOU A;  4UI9 J;  1HH8 A;  4XI9 A;  4U04 A;  2LSU A;  2Q7F A;  4AIF A;  5BNW A;  4UQZ A;  1IHG A;  2YQ8 A;  3QWV A;  1PC2 A;  4I17 A;  2I6H A;  4WND A;  3CK9 A;  2V5F A;  2KCL A;  4H7X A;  3ULQ A;  4AY6 A;  4I2W A;  1NZN A;  3RJV A;  4U07 A;  3N71 A;  2BUG A;  4H7Y A;  2C0M A;  4Y6W A;  4CGW A;  3ZGQ A;  4ME2 A;  2C2L A;  3MA5 A;  2LSV A;  2DBA A;  2YHC A;  3ZHE B;  5ARG A;  1W3B A;  4NRH B;  2MHK A;  1P5Q A;  5EKQ D;  5ARF A;  3S7D A;  3LY7 A;  3RO3 A;  3RO2 A;  4GYY A;  3ASD A;  2XCC A;  3ASH A;  5LCW J;  4UQX A;  3OXL A;  3S7F A;  1ZU2 A;  2E2E A;  4U0Z A;  3O48 A;  3CVQ A;  1QQE A;  4AY5 A;  4CDR A;  5HQ8 A;  4AM9 A;  2UWJ G;  4GA0 A;  5DBK A;  5FZR A;  2PZI A;  3ESK A;  4UI9 C;  5C1D A;  1HXI A;  4G26 A;  5A6C A;  3R9A B;  3UQ3 A;  3K9I A;  5G05 C;  3QDN A;  4UQY A;  3LYA A;  3CKC A;  4LEU A;  3KD7 A;  3U3W A;  2UY1 A;  3TGO A;  2VYI A;  2J9Q A;  3VTY A;  5KJM A;  1QZ2 A;  5CHE E;  4GA2 A;  4N39 A;  4I9E A;  3U4T A;  4CGV A;  4U0U A;  4N2S A;  3CVL A;  3FWV A;  4HOT A;  2NC9 A;  3ZFW A;  3UUX A;  3QWW A;  4I9C A;  2KCV A;  4GYW A;  4WUY A;  5G05 J;  3CVP A;  3MKR A;  5JJT A;  1ELR A;  1KT1 A;  4I2Z A;  2WPV A;  3PE3 A;  4NQ0 A;  4YVQ C;  4BTB A;  4HOS A;  5A7D B;  5LCW C;  4B94 A;  3LY8 A;  4JA7 A;  4O6F A;  1WM5 A;  2C0L A;  3AS8 A;  4KYO B;  3AS4 A;  1A17 A;  4J8F A;  5HI7 A;  3QWP A;  4W9R A;  1OUV A;  3PDN A;  2KCK A;  2FF4 A;  4N2Q A;  2UY1 B;  1HZ4 A; 
#chains in the Genus database with same CATH topology
 4BSZ B;  3FTX A;  1FCH A;  4Q69 A;  4APO A;  3IBE A;  4C0E A;  4LG6 A;  2H6I A;  5AYW D;  4PDX A;  4GZ3 A;  4QFV A;  3DRA A;  3LPZ A;  3P1U A;  2DIW A;  3KSL A;  1N52 A;  1DCQ A;  2CHX A;  4JVS A;  4IYP A;  1SZ9 A;  3C5R A;  5FQ8 A;  3VTX A;  3QJZ A;  3G2S A;  2HR2 A;  3EDT B;  4B8A A;  2IY0 C;  4L9P A;  2CG3 A;  1FT1 A;  3MCX A;  3UIP C;  2FO7 A;  1H6O A;  3G2T A;  3C72 A;  3UXG A;  3ZPJ A;  3B13 A;  4DX2 A;  5B1B E;  3E4B A;  1E90 A;  2B0O E;  3ISM C;  3LXU X;  4UI9 K;  3RKV A;  4GA1 A;  2IFU A;  4B89 A;  4KT6 B;  2VJ8 A;  1HS6 A;  4CCA A;  1Y6I A;  5AAR A;  2I1K A;  3PZ1 A;  5FZS A;  2RD0 A;  3TWQ A;  4U63 A;  3UIN C;  4GCO A;  4I6E A;  3UKU G;  1K3Z D;  3SBT B;  3VLF A;  3G2W A;  4HI9 A;  3V30 A;  2GRM A;  3QOU A;  4URK A;  5JMN D;  4GZ6 A;  4JD2 G;  4XZ4 A;  2P9P G;  3RSE G;  3JQ0 A;  3UPV A;  3KEA A;  4ABN A;  1OWN A;  4WAF A;  2CHZ A;  5EIL A;  1TR4 A;  2IF4 A;  1NI1 A;  4JB8 P;  1EYH A;  1PY1 A;  2WXH A;  3R9M A;  3DXK G;  3ULY A;  4BT8 A;  3W9G A;  4A3V A;  5A23 A;  5CRU A;  4GTM A;  5FT9 A;  1Z6T A;  2AXU A;  3DBS A;  4KVM A;  5AEN A;  1E8Y A;  1EPU A;  5B3S E;  4OVU A;  4UWH A;  2FBN A;  4WNF A;  2VGX B;  3NAW A;  3B7B A;  3FU5 A;  4K0R A;  4L1B A;  2ION A;  2VQ2 A;  1OXJ A;  5EX3 A;  2P2C P;  2Y1L E;  1TNB A;  2ILR A;  1MJ0 A;  1Z3Y A;  2X6I A;  3PUJ A;  1JWF A;  3URZ A;  2AXV A;  4GTP A;  3JYS A;  5T8I A;  3RIB A;  2L6J A;  4GMR A;  3QAQ A;  1RW2 A;  5LOZ A;  1E8Z A;  4YDW A;  1WY6 A;  2E0I A;  2AW6 A;  5JJ7 A;  3SHF A;  1RZ4 A;  1SQM A;  2ZU6 B;  2VTB A;  5CBN A;  4U8Y D;  4G25 A;  2VSO E;  2OV8 A;  5KJN A;  2IEJ A;  3PE4 A;  2QY7 A;  4O1P A;  4FAD A;  2X38 A;  4N3A A;  3FH5 A;  1OT8 A;  5BXO A;  3E34 A;  3C3R A;  1OY3 D;  2WM9 A;  4GAA A;  5AQA A;  1IQR A;  3E33 A;  4TXR A;  2V0P A;  5ENN A;  4AXH A;  1Q2Z A;  1HH8 A;  1K8K G;  5CBO A;  4I6G A;  3B7T A;  2LSU A;  3ZVV A;  4FHK A;  4XE0 A;  5BNW A;  3L08 A;  4UQZ A;  4WND A;  5FQ4 A;  3EU9 A;  1DC2 A;  4AY6 A;  3APF A;  3RJV A;  3N71 A;  2BUG A;  2DZO A;  4H7Y A;  3CHS A;  2KXP C;  3MZL B;  1N4P A;  3ZHE B;  4NIK A;  5ARG A;  4DI3 A;  5CER B;  4XKC A;  2ETB A;  4ATG A;  2WMN A;  5E76 A;  3V31 A;  4TUU A;  3AG3 E;  5KWD A;  4F1P A;  1PAQ A;  3RO2 A;  3W9F A;  4L7T A;  3ASH A;  1TN8 A;  4UQX A;  3UX4 A;  3CVV A;  4GTV A;  3AAA C;  5D66 A;  3B7U X;  2WXL A;  1ZU2 A;  3MKQ B;  2FUL A;  5DBK A;  3UM3 A;  4U7E B;  3HXC A;  3L6A A;  1HE8 A;  4UI9 C;  5C1D A;  2J8S D;  3FHE A;  4PS7 A;  1N0R A;  5G05 C;  3QDN A;  4G11 A;  5EYP F;  3IXE A;  2P9I G;  2VYI A;  4IUL A;  2J9Q A;  4R7L A;  3D9I A;  1YCS B;  4I9E A;  5LFA A;  5AQB A;  2XEH A;  4N2S A;  2P9N G;  2CHW A;  5AIJ A;  2ZIR A;  2NC9 A;  3ZFW A;  1O1S A;  4AOF A;  2Y3A A;  3D9L A;  2XPY A;  5JHA A;  2V4H C;  2X6F A;  3FUM A;  2EIJ E;  1TNO A;  1KT1 A;  3DEP A;  4I2Z A;  4UWF A;  3Q9U C;  1NL4 A;  2NYJ A;  3ZXS A;  2P9S G;  1SVX A;  4HOS A;  3D3M A;  4GZD A;  3ZRH A;  4JA7 A;  3T9K A;  3F6Q A;  1N9A A;  1BI8 B;  4B0Z A;  4LNB A;  2QC9 A;  3UM1 A;  3UT7 A;  1JUQ A;  4MS6 A;  4DRX E;  3D9H A;  1WM5 A;  1FPP A;  1K1B A;  3AS4 A;  3FTW A;  1A17 A;  1UN9 A;  2WXQ A;  4W9R A;  4J7W A;  4AVX A;  3G2U A;  2IU1 A;  3UI2 A;  2J4B A;  2FF4 A;  2EIN E;  1UW4 B;  3PNT B;  3Q5M A;  4LRZ A;  3LCA A;  5HS0 A;  3CHQ A;  3RRU A;  4KMO A;  3SBS A;  1AWC B;  1BU9 A;  2XGM A;  3RK6 A;  3T8K A;  4I1A A;  3L16 A;  2VSY A;  3C98 A;  3SGH A;  2XRZ A;  3FUN A;  1Z3X A;  1KLX A;  4NAC A;  1BLX B;  4YDY A;  4ANU A;  4HLE A;  2F8X K;  4HVB A;  2OND A;  4RG6 A;  4G2V A;  4KXK B;  4GML A;  3BEE A;  3LY9 A;  4XI0 A;  1E96 B;  3ZYM A;  2L0I A;  1HG2 A;  2AJA A;  2VGX A;  2AXZ A;  4B93 B;  1ELW A;  3MEK A;  3EHR A;  3EIJ A;  2V8S E;  4MLP A;  1LF8 A;  4GZC A;  2KM4 A;  3RU0 A;  3EHN A;  5AJL A;  4C48 B;  3DSW A;  4DLO A;  1HX8 A;  4N5C A;  1E8W A;  3OTN A;  3UKR G;  2X6H A;  2YIN A;  3Q9N C;  2EQX A;  3SF4 A;  4WWN A;  5JJ6 A;  4DUI A;  4GU5 A;  3ASG A;  2VGY A;  1N94 A;  2LNI A;  2CG2 A;  4I6J A;  2XCB A;  3ZN3 A;  3MJW A;  4BES A;  3APC A;  3SNX A;  1TEZ A;  4EZJ A;  4M7C A;  5CED B;  1KZP A;  3CHP A;  4CT4 A;  4F7A A;  1IYG A;  3DSS A;  3O4Z A;  4RG9 A;  4JHR A;  4GCN A;  5G04 C;  5D0O D;  5CRV A;  3GZ1 A;  1X81 A;  4G8K A;  5ENT D;  3J5Q B;  4F1S A;  1D8D A;  4EPZ A;  1A5E A;  4L2Y A;  4JA9 A;  3ML8 A;  3E30 A;  4G1T A;  5CCM A;  3I4G A;  3OXG A;  2GRO B;  3DEO A;  1MQS A;  3Q7F A;  4FLB A;  2DWZ A;  3Q73 A;  1N4S A;  3CHM A;  3SZ7 A;  3Q15 A;  3QKY A;  1U3D A;  3CLJ A;  4JHJ A;  3ZHE A;  3HVE B;  3FFL A;  1HFA A;  5G2N A;  5FQ6 A;  3OXF A;  2MRI A;  3TJP A;  4BY6 A;  3MV3 B;  2QFC A;  4YDO A;  3NB2 A;  3FEX A;  2A4Z A;  4U0S A;  1YMP A;  2GW1 A;  3UIO C;  4N3B A;  5DIZ A;  4N3C A;  3CKB A;  5EN5 D;  3KEZ A;  3TG5 A;  3ABK E;  3KSQ A;  3CEQ A;  4E85 A;  3PEV B;  3BG1 B;  3CVN A;  3CK8 A;  4GPK A;  4XX5 A;  5FJY A;  3MKQ A;  2XEV A;  4K5C A;  3CV0 A;  3RRM B;  1H2V C;  4UI9 J;  1OWO A;  5CEC B;  4PUC A;  2F37 A;  4K03 A;  4D10 C;  4I1O B;  2BF0 X;  3PH0 C;  2BED A;  5FIN A;  2GRR B;  4LER A;  2IOS A;  2I6H A;  2V5F A;  2KCL A;  1N4R A;  1L5J A;  4WWO A;  1NZN A;  5EIB E;  1FVH A;  1IHB A;  4K5B A;  2LSV A;  2DBA A;  2YHC A;  3D9K A;  4GTS A;  5KNG A;  3AG2 E;  1HF8 A;  3Q7A A;  2RG8 A;  4ANW A;  5BUZ A;  5IY5 E;  5FQ7 A;  3FY4 A;  2LAI A;  1SA4 A;  3TWV A;  5ARF A;  4UWL A;  4X8Q A;  1FVF A;  2WVI A;  1HG5 A;  4GYY A;  4CRW A;  3BQO A;  1EF1 C;  3PRE A;  3ASD A;  4E6H A;  3CR3 A;  4HNA D;  3PZ3 A;  2WXI A;  1JCS A;  3CVX A;  3EHM A;  3NBN B;  2LUH A;  2EIM E;  1QQE A;  3TXN A;  1UOH A;  3HDX A;  4AY5 A;  4CDR A;  1INZ A;  2XZT G;  3PVL A;  5KBA A;  3T8M A;  3OAW A;  4A55 A;  1MX2 A;  3ESK A;  5ANR A;  4LNU D;  3FUI A;  2FO1 E;  3VLE A;  1HXI A;  1TN7 A;  5ENS D;  5A6C A;  4C0M A;  4Q94 A;  3R9A B;  2WXM A;  3SI5 A;  2XHE A;  4LCT A;  2MYO A;  2DVW A;  3VLD A;  3KD7 A;  4FJY A;  3SD5 A;  3V2X A;  3FTU A;  4GA2 A;  4U8H A;  4BFR A;  3MX3 A;  3U4T A;  4CGV A;  3IHV A;  1DVP A;  3CVL A;  3BU8 A;  1IQU A;  2A5E A;  3FWV A;  4OAV B;  2P9K G;  4GYW A;  2H6G A;  3CVP A;  3ZKJ A;  5JJT A;  1FT2 A;  3ZIM A;  1S64 A;  2L0T B;  3PE3 A;  4NQ0 A;  3HXE A;  3Q78 A;  5AN8 A;  4DI4 A;  4B94 A;  1LD8 A;  2X6J A;  3UM0 A;  1O1T A;  4FJZ A;  3D9O A;  3LVR E;  4FHJ A;  3AS8 A;  4KYO B;  2RFM A;  4HQD A;  4J8F A;  5HI7 A;  4OAU C;  3QWP A;  5AQ9 A;  3TXM A;  1OUV A;  1MX4 A;  3C3O A;  3V79 K;  4BX8 A;  3U9W A;  4N2Q A;  2OVF A;  4HI8 A;  3DSV A;  3SFX A;  3JXJ A;  2R2L A;  3FUL A;  3I5P A;  1TNY A;  1ZB1 A;  3SFY A;  1WDY A;  1ZBP A;  3DWL G;  4UWK A;  2PQR A;  1N11 A;  1N54 A;  4BER A;  3X2Q E;  4GTO A;  5AQ7 A;  5D0Q D;  3WXX A;  3TAX A;  3D9P A;  3U64 A;  2WXR A;  5G04 J;  1H6P A;  3R7R A;  5EX0 A;  2WXO A;  3S7B A;  4G23 A;  3MV2 B;  2BKK B;  4JPS A;  3GYZ A;  1JCQ A;  3ZXP A;  3FP3 A;  2V5Q C;  5ITZ F;  3FUF A;  4HRM B;  2Y4T A;  4JL0 A;  2XEE A;  3AG4 E;  4IRU A;  4J8D A;  2XPZ A;  2ETA A;  4EEC A;  2AWI A;  1H2T C;  3HXD A;  1Y8M A;  4NUR A;  4CDN A;  3JCK C;  2PQN A;  4XEI G;  3NOC D;  4WNG A;  2A5U A;  4JC8 A;  1D9S A;  4P29 A;  3KS2 A;  4GZ5 A;  3PEU B;  2JEK A;  5BXU A;  1NP7 A;  3ZU7 B;  4HRN A;  1KPS B;  4RLY A;  2WXJ A;  4AJW A;  3HVE A;  3NF1 A;  4LUN U;  1QYM A;  2QZA A;  2R05 A;  3LEW A;  1TJF A;  2OCC E;  3S7J A;  4RQI A;  1XNF A;  1HU3 A;  3CGH A;  2WQH A;  4HOQ A;  4EHM A;  4ZFH A;  4J8E A;  3LVQ E;  3FUK A;  2P58 C;  3TWT A;  2DYS E;  4G24 A;  1Z5S C;  3FUH A;  4KVO A;  5KCM A;  4UWG A;  3FTV A;  4RVB A;  1S63 A;  4YVO A;  3ABL E;  4C9B B;  1QBQ A;  3LS8 A;  2F8Y A;  5CCL A;  3Q4A B;  2OVB A;  4EZK A;  2B6C A;  4APF A;  1X5B A;  2WXK A;  3T5X A;  4OYS A;  2LAH A;  3DPD A;  1H2U A;  4GYO A;  3L17 A;  5KJL A;  2Y4U A;  2JLB A;  3Q47 B;  3D9N A;  1IXV A;  3JXI A;  3JUE A;  4HB5 A;  4ANV A;  4BT9 A;  4EQF A;  5BT1 A;  3LDZ A;  3FU3 A;  4DX6 D;  3CHO A;  2R17 C;  3L13 A;  4GB9 A;  4F3V A;  3U66 A;  2ZXW E;  2OEV A;  5HRY A;  3ZUV B;  3PS6 A;  4HLL A;  5JA4 D;  1JPL A;  2VSN A;  3FUD A;  2FEZ A;  3CHR A;  3TWR A;  2YHE A;  1TJC A;  3HIZ A;  4OVV A;  2IO2 C;  4BX9 A;  2J09 A;  4DX5 D;  2XGO A;  4JHK A;  3DSX A;  1B89 A;  1DNP A;  4HOR A;  2XGS A;  4FLH A;  5BW8 C;  3ENE A;  1SZA A;  1EDU A;  2F0Y A;  3FUE A;  3DST A;  3GZ2 A;  2OOE A;  5J08 A;  1E8X A;  1TNZ A;  1H19 A;  2EIK E;  4F6R D;  1XGW A;  4XI9 A;  3QK0 A;  1OCR E;  2M63 A;  4AIF A;  3AJI A;  2YQ8 A;  4ILH B;  1PC2 A;  1DCE A;  3TWW A;  3B95 A;  3Q75 A;  4H7X A;  1YYH A;  4GPM A;  5LX8 A;  3PRZ A;  2WB2 A;  5ANL A;  1MYO A;  1JCR A;  2C0M A;  4Y6W A;  3NZU A;  4CGW A;  3ZGQ A;  4ME2 A;  2C2L A;  3IHY A;  5E75 A;  4O60 A;  3MA5 A;  2GRN B;  3SFZ A;  1E7V A;  5AAO A;  4NRH B;  2MHK A;  4CT0 A;  1P5Q A;  5EKQ D;  1SW6 A;  4RSY A;  4HFG A;  2PM7 A;  3LY7 A;  3CQG B;  3RO3 A;  4G8L A;  3UT4 A;  2GGF A;  4ZHB A;  4V3I A;  2HM8 A;  4M3O A;  1N0Q A;  5T3R A;  3QAR A;  2KZT B;  1LD7 A;  2P9U G;  4Z68 A;  3OXL A;  3S7F A;  3SQV A;  3NZS A;  4U0Z A;  3TL5 A;  3HXF A;  1O5M A;  2JAB A;  4BEP A;  4TRQ A;  4HRL A;  3DSU A;  2WXN A;  4GA0 A;  4J6I A;  2PZI A;  3IV0 A;  4B8C B;  1QNF A;  3K9I A;  4PS3 A;  4KZ0 A;  4UQY A;  3TWS A;  3CKC A;  4DK5 A;  3TWX A;  4PS8 A;  4LEU A;  3U3W A;  3PZ4 A;  4N5Q A;  1OCC E;  3VTY A;  5KJM A;  1QZ2 A;  2WXP A;  4JXT A;  2WQ7 A;  4WWP A;  3UT8 A;  4N39 A;  2WXG A;  4TUM A;  3JQ1 A;  3E32 A;  3D9J A;  4U0U A;  2IO3 C;  3ESL A;  4ILG A;  1JWG A;  3FH7 A;  3WG7 E;  1LTX A;  4FP7 A;  4DX1 A;  5FWQ A;  2KCV A;  4WUY A;  4Q96 A;  3I4R B;  3FEY A;  5FIO A;  5G05 J;  2CFZ A;  4MRU A;  3MKR A;  4FC8 A;  1N4Q A;  1UJJ A;  1K1A A;  4I43 A;  2P9L G;  2WPV A;  3L54 A;  4DLQ A;  4LSZ E;  3P2B A;  4YVQ C;  4LNG A;  4BTB A;  4ACL A;  2RKK A;  3ZEF A;  5BPP A;  4EZL A;  5LCW C;  1OWM A;  2L9B A;  3L22 A;  1V55 E;  1TNU A;  1V54 E;  4UUC A;  2I9C A;  2J4D A;  2C0L A;  1GW6 A;  5CEA A;  2J08 A;  4A3T A;  2BTD A;  1S70 B;  2XEN A;  2R02 A;  2VSX E;  3V2O A;  3MGB A;  3EIQ C;  2H6F A;  1N95 A;  3HG0 D;  2QYJ A;  2XS1 A;  2UY1 B;  1HZ4 A;  5G55 A;  4A1S A;  2XRY A;  3CSF A;  4GTT A;  4O1O A;  1G3N B;  2NXP A;  3Q79 A;  3R7Q A;  1AP7 A;  2GRL A;  4GTR A;  2H6H A;  5D2M C;  4XKB A;  3GW4 A;  4L2L A;  3FH8 A;  2I1J A;  4IN3 B;  3PZ2 A;  4CEM A;  3EHQ A;  2Y0B G;  4TXQ A;  2XZD G;  3EU5 A;  3ZYL A;  2R59 A;  3L9T A;  3CK7 A;  4J0U A;  5BV0 A;  1MZC A;  3HXB A;  1NA0 A;  4KBQ A;  3SY2 A;  1NFI E;  3CVW A;  3CVY A;  2KAT A;  4JW1 A;  2ZGG A;  3D9M A;  4U96 D;  3IEG A;  2X6K A;  2NSZ A;  3NQP A;  3ULE G;  3AU4 A;  3FDH A;  4L23 A;  4EBA A;  1KT0 A;  5LP0 A;  2X3M A;  5KJK A;  2HO1 A;  2BKG A;  3KAE A;  2WMO A;  3LJ3 A;  5AJD A;  1TN6 A;  2KC7 A;  1E7U A;  5M72 A;  1S0P A;  1YA0 A;  2XPI A;  3CQC B;  3DPY A;  4F53 A;  3QC1 A;  3TG4 A;  4Y6C A;  3T5V A;  1H6K A;  1NA3 A;  4DX7 D;  1WAO 1;  4U8V D;  2IQC A;  2RFA A;  4TV3 A;  3CIA A;  4BTA A;  1MX6 A;  3HYM B;  3MYV A;  3RRN B;  1IKN D;  3Q49 B;  3JUI A;  2OEW A;  2R5S A;  3FTZ A;  3PZD A;  4GTQ A;  3I3N A;  3RAU A;  4BET A;  1UN8 A;  1WG0 A;  2MOW A;  4BWR A;  5EYL A;  5EDS A;  3SO8 A;  4PH4 B;  4FUL A;  4TXP A;  3TWU A;  1O1R A;  4YDE A;  3B7S A;  2WQ6 A;  2R03 A;  2PNN A;  5KNH D;  2CFU A;  2PL2 A;  3ASF A;  2LO6 A;  3HRA A;  3L82 A;  3BG0 B;  3ONK A;  3UTM A;  4A63 B;  4FA6 A;  4XIF A;  4YND A;  2FI7 A;  4ATZ D;  1VDY A;  4WNE A;  2WXF A;  2VGE A;  3EUV A;  1U3C A;  1UJK A;  4AP2 A;  1KZO A;  2HYZ A;  4HS2 A;  3AS5 A;  5FTP A;  4ANX A;  5CMW A;  3LKU A;  1BI7 B;  3ZYQ A;  5ENP D;  3CVU A;  3BUA A;  4QQI A;  4MKT A;  3QNK A;  1OCZ E;  2KZT A;  4DJA A;  3FU0 A;  5T4Y A;  5FZQ A;  2IOL A;  2V4L A;  4HXI A;  2AVP A;  2PM6 A;  1OWL A;  4HOU A;  4I1M A;  1BD8 A;  5JHB A;  4AEZ C;  3J5P A;  2IJG X;  2QYU A;  3FU6 A;  4GMJ A;  2DYR E;  2ZGD A;  1BPO A;  2GRQ B;  4U04 A;  1OCO E;  2XS8 A;  2Q7F A;  3DXM G;  1IHG A;  3QWV A;  4I17 A;  4K5A B;  2DCP A;  3CK9 A;  3ASN E;  3ULQ A;  4I2W A;  3ML9 A;  1SA5 A;  2DZN A;  4U07 A;  3PNL B;  4JEU A;  5ENQ D;  1UG3 A;  1TYQ G;  1W3B A;  3ONL A;  4JZY A;  3CST A;  1ELK A;  1OWP A;  4BSX A;  4J8Y A;  3S7D A;  4FU3 A;  2VTB B;  2XCC A;  5ENO D;  5LCW J;  1MHQ A;  5J90 A;  2J07 A;  3HHM A;  5HKP A;  5H7P A;  2J49 A;  2E2E A;  4J8S A;  5B1A E;  3O48 A;  3CVQ A;  3UMV A;  1D8E A;  2Y69 E;  5HQ8 A;  4AM9 A;  5FZR A;  3UM2 A;  4CDM A;  4G26 A;  4EBA G;  3UQ3 A;  3LYA A;  4JEH A;  3EJN A;  5CMY A;  2UY1 A;  3TGO A;  2YNQ A;  3ZYK A;  3FTS A;  5CHE E;  5BV1 A;  4ACK A;  3ASO E;  4DPR A;  4HOT A;  3FTY A;  4ILI A;  3GZS A;  2LXL A;  3UUX A;  3QWW A;  4I9C A;  4KZC A;  1HO8 A;  3NOG D;  4U95 D;  4AV7 A;  1ELR A;  2EIL E;  3IKO B;  2ZIS A;  2LXM A;  3LJN A;  3FUJ A;  1U2V G;  4MBG A;  5A7D B;  5C2Y A;  3LY8 A;  4CZ2 D;  4O6F A;  3APD A;  4HBD A;  3ZNG A;  5ENR D;  3C3Q A;  3B7R L;  3AG1 E;  3E37 A;  3QB2 A;  3AU5 A;  2KBX A;  3S2A A;  5EID A;  2HE0 A;  3PUK A;  2ETC A;  3ZW3 A;  4CYM D;  2XQ0 A;  3G2V A;  2L6B A;  3ABM E;  2GRP B;  3PDN A;  4A1G A;  2KCK A;  1H0A A;  2I2O A;  2UWJ G; 
#chains in the Genus database with same CATH homology
 3FTX A;  3PNT B;  4A1S A;  2XRY A;  1FCH A;  4Q69 A;  4APO A;  3FUL A;  3IBE A;  3I5P A;  3CSF A;  4C0E A;  3Q5M A;  4LRZ A;  3LCA A;  3CHQ A;  5AYW D;  3RRU A;  2NXP A;  3R7Q A;  4KMO A;  1ZBP A;  4PDX A;  3SBS A;  4UWK A;  4GZ3 A;  2PQR A;  2GRL A;  2XGM A;  3RK6 A;  4QFV A;  4XKB A;  3GW4 A;  3LPZ A;  4L2L A;  3P1U A;  3FH8 A;  2I1J A;  1N54 A;  4I1A A;  4IN3 B;  4CEM A;  3L16 A;  2VSY A;  3C98 A;  3SGH A;  2XRZ A;  3FUN A;  2DIW A;  1N52 A;  1Z3X A;  1KLX A;  4NAC A;  5D0Q D;  3WXX A;  2CHX A;  2R59 A;  3TAX A;  3ZYL A;  4JVS A;  4ANU A;  4IYP A;  1SZ9 A;  3D9P A;  3U64 A;  2WXR A;  3CK7 A;  4J0U A;  5G04 J;  5FQ8 A;  4HLE A;  5BV0 A;  3VTX A;  4HVB A;  2OND A;  3QJZ A;  1NA0 A;  4RG6 A;  3R7R A;  3G2S A;  2HR2 A;  4G2V A;  4KBQ A;  5EX0 A;  4KXK B;  2WXO A;  3S7B A;  3EDT B;  3MV2 B;  4G23 A;  4B8A A;  4JPS A;  3CVW A;  4GML A;  3BEE A;  2KAT A;  3CVY A;  4JW1 A;  3GYZ A;  3LY9 A;  2CG3 A;  3MCX A;  4XI0 A;  2FO7 A;  1E96 B;  3D9M A;  3ZYM A;  2L0I A;  3FP3 A;  1HG2 A;  3IEG A;  2VGX A;  2X6K A;  3FUF A;  2NSZ A;  2AXZ A;  3NQP A;  3G2T A;  2Y4T A;  4JL0 A;  3ZPJ A;  3AU4 A;  3B13 A;  1ELW A;  3E4B A;  1E90 A;  3MEK A;  3LXU X;  4UI9 K;  3EIJ A;  2V8S E;  4IRU A;  3FDH A;  1LF8 A;  2XPZ A;  4J8D A;  4MLP A;  4L23 A;  4EBA A;  4EEC A;  1KT0 A;  3RKV A;  5LP0 A;  2X3M A;  2AWI A;  4GA1 A;  2IFU A;  4GZC A;  4B89 A;  2KM4 A;  1H2T C;  3RU0 A;  4KT6 B;  1Y8M A;  2VJ8 A;  1HS6 A;  4NUR A;  4CCA A;  1Y6I A;  3EHN A;  5AJL A;  4CDN A;  5KJK A;  3JCK C;  2I1K A;  2HO1 A;  2PQN A;  2RD0 A;  5FZS A;  3KAE A;  4DLO A;  2WMO A;  1HX8 A;  4N5C A;  4U63 A;  4WNG A;  2A5U A;  3LJ3 A;  4JC8 A;  4GCO A;  5AJD A;  1E8W A;  2KC7 A;  4P29 A;  1E7U A;  4I6E A;  5M72 A;  3KS2 A;  3SBT B;  3OTN A;  1S0P A;  4GZ5 A;  1YA0 A;  2XPI A;  3G2W A;  3VLF A;  2X6H A;  3PEU B;  2JEK A;  2YIN A;  1NP7 A;  2GRM A;  2EQX A;  3QOU A;  3SF4 A;  4WWN A;  5JJ6 A;  4URK A;  3CQC B;  4GZ6 A;  4XZ4 A;  2WXJ A;  3JQ0 A;  4F53 A;  3QC1 A;  3UPV A;  4GU5 A;  1OWN A;  4ABN A;  3ASG A;  2VGY A;  4AJW A;  2LNI A;  4WAF A;  3TG4 A;  3HVE A;  2CHZ A;  4Y6C A;  2IF4 A;  3NF1 A;  4LUN U;  2CG2 A;  4I6J A;  2XCB A;  3ZN3 A;  3T5V A;  1EYH A;  3LEW A;  1PY1 A;  1TJF A;  1H6K A;  2WXH A;  3S7J A;  3MJW A;  1XNF A;  1HU3 A;  1NA3 A;  3CGH A;  1WAO 1;  2WQH A;  4HOQ A;  3APC A;  3SNX A;  2IQC A;  1TEZ A;  4EZJ A;  4BT8 A;  4TV3 A;  3CIA A;  4BTA A;  4A3V A;  5A23 A;  3HYM B;  3MYV A;  3RRN B;  3CHP A;  4J8E A;  3LVQ E;  4CT4 A;  3Q49 B;  4F7A A;  5FT9 A;  1Z6T A;  1IYG A;  3FUK A;  3O4Z A;  3JUI A;  2P58 C;  2R5S A;  3FTZ A;  4JHR A;  4RG9 A;  4GCN A;  2AXU A;  3PZD A;  4G24 A;  3DBS A;  3FUH A;  4KVO A;  5KCM A;  4UWG A;  3FTV A;  5D0O D;  5G04 C;  3I3N A;  4RVB A;  4KVM A;  1UN8 A;  5AEN A;  3GZ1 A;  1E8Y A;  1EPU A;  2MOW A;  4YVO A;  4C9B B;  4OVU A;  4UWH A;  4BWR A;  2FBN A;  4WNF A;  5EDS A;  2VGX B;  3LS8 A;  4PH4 B;  4FUL A;  3FU5 A;  4F1S A;  4EPZ A;  4K0R A;  4L1B A;  2ION A;  2VQ2 A;  5CCL A;  3Q4A B;  5EX3 A;  3B7S A;  2WQ6 A;  2OVB A;  4EZK A;  4L2Y A;  4JA9 A;  4APF A;  3ML8 A;  1X5B A;  4G1T A;  5CCM A;  2CFU A;  3I4G A;  2WXK A;  3OXG A;  2ILR A;  3T5X A;  2PL2 A;  3ASF A;  2LO6 A;  1MQS A;  4OYS A;  2LAH A;  3DPD A;  1H2U A;  4GYO A;  3L17 A;  3BG0 B;  3ONK A;  4FLB A;  4FA6 A;  2Y4U A;  5KJL A;  1Z3Y A;  2JLB A;  2X6I A;  3Q47 B;  3PUJ A;  3CHM A;  3D9N A;  4XIF A;  1JWF A;  4YND A;  3SZ7 A;  2AXV A;  3URZ A;  3JYS A;  2FI7 A;  4ANV A;  4BT9 A;  4EQF A;  1VDY A;  5BT1 A;  5T8I A;  3RIB A;  3LDZ A;  4WNE A;  3Q15 A;  3FU3 A;  3CHO A;  3QKY A;  2L6J A;  2WXF A;  1U3D A;  2R17 C;  3QAQ A;  3CLJ A;  3L13 A;  4GB9 A;  5LOZ A;  4F3V A;  1E8Z A;  4JHJ A;  1U3C A;  1UJK A;  3ZHE A;  4AP2 A;  3U66 A;  1WY6 A;  2HYZ A;  4HS2 A;  3AS5 A;  5FTP A;  2E0I A;  4ANX A;  3HVE B;  3FFL A;  3PS6 A;  5CMW A;  1HFA A;  1JPL A;  2VSN A;  3FUD A;  3LKU A;  5G2N A;  2FEZ A;  5FQ6 A;  2AW6 A;  3CHR A;  3OXF A;  2MRI A;  1HZ4 A;  2YHE A;  3TJP A;  5JJ7 A;  1TJC A;  4BY6 A;  3ZYQ A;  3MV3 B;  3SHF A;  3HIZ A;  2QFC A;  1SQM A;  2ZU6 B;  3CVU A;  4OVV A;  2VTB A;  3FEX A;  2A4Z A;  4U0S A;  4G25 A;  4BX9 A;  2J09 A;  2VSO E;  4MKT A;  2GW1 A;  2OV8 A;  2XGO A;  5KJN A;  3QNK A;  4N3B A;  5DIZ A;  4JHK A;  4N3C A;  3CKB A;  1B89 A;  1DNP A;  3KEZ A;  4HOR A;  2XGS A;  3TG5 A;  3PE4 A;  2KZT A;  2QY7 A;  4DJA A;  4FLH A;  3FU0 A;  5BW8 C;  3CEQ A;  3ENE A;  4E85 A;  4FAD A;  2X38 A;  1SZA A;  3PEV B;  5T4Y A;  3BG1 B;  1EDU A;  4N3A A;  3FH5 A;  5FZQ A;  2IOL A;  3CVN A;  3FUE A;  3CK8 A;  4GPK A;  4XX5 A;  5FJY A;  2V4L A;  3GZ2 A;  4HXI A;  2AVP A;  3MKQ A;  2OOE A;  2XEV A;  2PM6 A;  2WM9 A;  3CV0 A;  3RRM B;  1OWL A;  4GAA A;  1H2V C;  4HOU A;  4UI9 J;  1IQR A;  4I1M A;  1OWO A;  5JHB A;  4AEZ C;  4PUC A;  5J08 A;  2IJG X;  2V0P A;  1E8X A;  3FU6 A;  4K03 A;  5ENN A;  4AXH A;  4GMJ A;  1HH8 A;  4D10 C;  1H19 A;  1XGW A;  4I1O B;  4XI9 A;  1BPO A;  3QK0 A;  4I6G A;  3B7T A;  4U04 A;  2LSU A;  2BF0 X;  2M63 A;  3ZVV A;  3PH0 C;  2Q7F A;  4AIF A;  4FHK A;  4XE0 A;  5BNW A;  3L08 A;  4UQZ A;  1IHG A;  2YQ8 A;  4ILH B;  3QWV A;  4LER A;  1PC2 A;  4I17 A;  2IOS A;  2I6H A;  2DCP A;  4WND A;  3CK9 A;  2V5F A;  2KCL A;  4H7X A;  5FQ4 A;  3ULQ A;  4AY6 A;  1L5J A;  4WWO A;  5LX8 A;  3APF A;  3ML9 A;  4I2W A;  3PRZ A;  1NZN A;  3RJV A;  4U07 A;  2WB2 A;  3N71 A;  2BUG A;  3PNL B;  4H7Y A;  5ANL A;  1FVH A;  3CHS A;  3MZL B;  2C0M A;  4Y6W A;  4JEU A;  3NZU A;  4CGW A;  3ZGQ A;  1UG3 A;  4ME2 A;  2C2L A;  3IHY A;  5E75 A;  3MA5 A;  2LSV A;  2DBA A;  2YHC A;  3D9K A;  3ZHE B;  5ARG A;  3SFZ A;  1W3B A;  4DI3 A;  1HF8 A;  1E7V A;  2RG8 A;  4ANW A;  3ONL A;  5BUZ A;  4NRH B;  2MHK A;  4JZY A;  3CST A;  4CT0 A;  4XKC A;  1P5Q A;  5EKQ D;  5FQ7 A;  3FY4 A;  1ELK A;  1OWP A;  2LAI A;  4ATG A;  2WMN A;  4RSY A;  4HFG A;  5ARF A;  4BSX A;  5E76 A;  2PM7 A;  3LY7 A;  4UWL A;  3S7D A;  4TUU A;  3CQG B;  3RO3 A;  1FVF A;  2WVI A;  4FU3 A;  1HG5 A;  1PAQ A;  3RO2 A;  4GYY A;  4CRW A;  3UT4 A;  2VTB B;  2GGF A;  1EF1 C;  3PRE A;  3ASD A;  4E6H A;  2XCC A;  3CR3 A;  4L7T A;  4V3I A;  3ASH A;  2HM8 A;  4M3O A;  5LCW J;  1MHQ A;  5T3R A;  3UX4 A;  4UQX A;  2J07 A;  5J90 A;  3CVV A;  3HHM A;  2WXI A;  3QAR A;  2KZT B;  3CVX A;  2J49 A;  3OXL A;  3S7F A;  3EHM A;  3B7U X;  3NZS A;  2WXL A;  1ZU2 A;  2E2E A;  4J8S A;  4U0Z A;  3O48 A;  3TL5 A;  3CVQ A;  1QQE A;  3TXN A;  3UMV A;  3HDX A;  4AY5 A;  3MKQ B;  4CDR A;  5HQ8 A;  4AM9 A;  1INZ A;  2FUL A;  4TRQ A;  3PVL A;  2WXN A;  4GA0 A;  3T8M A;  3OAW A;  5DBK A;  4J6I A;  4A55 A;  5FZR A;  2PZI A;  3ESK A;  5ANR A;  3FUI A;  3IV0 A;  3L6A A;  1HE8 A;  4UI9 C;  3VLE A;  4CDM A;  5C1D A;  3FHE A;  1HXI A;  4G26 A;  4B8C B;  4PS7 A;  5A6C A;  4C0M A;  4Q94 A;  3R9A B;  1QNF A;  2WXM A;  4EBA G;  3UQ3 A;  3SI5 A;  2XHE A;  3K9I A;  4PS3 A;  4LCT A;  5G05 C;  3QDN A;  4G11 A;  3LYA A;  4KZ0 A;  4UQY A;  4JEH A;  3EJN A;  3CKC A;  4DK5 A;  3VLD A;  4PS8 A;  5CMY A;  4LEU A;  3KD7 A;  3U3W A;  2UY1 A;  3TGO A;  2VYI A;  4IUL A;  4FJY A;  2J9Q A;  4R7L A;  3SD5 A;  3VTY A;  2YNQ A;  3ZYK A;  5KJM A;  1QZ2 A;  2WXP A;  3FTS A;  5CHE E;  3FTU A;  4JXT A;  2WQ7 A;  4GA2 A;  4U8H A;  4WWP A;  3UT8 A;  3D9I A;  4BFR A;  4N39 A;  3MX3 A;  2WXG A;  4I9E A;  5BV1 A;  3U4T A;  5LFA A;  3JQ1 A;  4CGV A;  3IHV A;  3D9J A;  4U0U A;  4ACK A;  4N2S A;  1DVP A;  3CVL A;  2CHW A;  3ESL A;  5AIJ A;  4ILG A;  1IQU A;  1JWG A;  3FWV A;  4DPR A;  3FH7 A;  4HOT A;  2NC9 A;  3FTY A;  3ZFW A;  4ILI A;  4AOF A;  4FP7 A;  3GZS A;  3UUX A;  2Y3A A;  3QWW A;  5FWQ A;  4I9C A;  2KCV A;  4GYW A;  4WUY A;  3D9L A;  2XPY A;  4Q96 A;  3I4R B;  5JHA A;  3FEY A;  4KZC A;  1HO8 A;  5G05 J;  2CFZ A;  2X6F A;  3CVP A;  3FUM A;  4MRU A;  3MKR A;  4FC8 A;  4AV7 A;  5JJT A;  3ZIM A;  1ELR A;  1KT1 A;  1UJJ A;  2L0T B;  4I2Z A;  4I43 A;  4UWF A;  2WPV A;  3L54 A;  4DLQ A;  3PE3 A;  3IKO B;  4NQ0 A;  3P2B A;  4YVQ C;  3ZXS A;  4BTB A;  3FUJ A;  4ACL A;  4HOS A;  3ZEF A;  5A7D B;  4DI4 A;  5BPP A;  3D3M A;  4EZL A;  5C2Y A;  4GZD A;  5LCW C;  3ZRH A;  4B94 A;  1OWM A;  2L9B A;  3L22 A;  2X6J A;  3LY8 A;  4JA7 A;  4O6F A;  3APD A;  4FJZ A;  4B0Z A;  3D9O A;  3B7R L;  3UT7 A;  3LVR E;  1JUQ A;  4MS6 A;  2I9C A;  1WM5 A;  2J4D A;  3QB2 A;  3AU5 A;  4FHJ A;  3S2A A;  2C0L A;  1GW6 A;  3AS8 A;  4KYO B;  3PUK A;  3ZW3 A;  3AS4 A;  3FTW A;  1A17 A;  2J08 A;  4J8F A;  5HI7 A;  4A3T A;  2BTD A;  2XQ0 A;  1UN9 A;  2VSX E;  2WXQ A;  3G2V A;  3MGB A;  3QWP A;  3TXM A;  4W9R A;  3EIQ C;  4AVX A;  3G2U A;  2IU1 A;  1OUV A;  3PDN A;  4A1G A;  2KCK A;  2FF4 A;  1H0A A;  2J4B A;  4BX8 A;  1UW4 B;  3U9W A;  4N2Q A;  2I2O A;  2OVF A;  2UY1 B;  2UWJ G;  5G55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...