4AN2A

Crystal structures of human mek1 with carboxamide-based allosteric inhibitor xl518 (gdc-0973), or related analogs.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
282
structure length
282
Chain Sequence
b'MALGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDEMANEFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPRPPMAIFELLDYIVNEPPPKLPSAVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
publication title Novel Carboxamide-Based Allosteric Mek Inhibitors: Discovery and Optimization Efforts Toward Xl518 (Gdc-0973)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 282
sequence length 282
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2012-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4an2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4an2A01
4BWXA 3DBQA 3H4JA 5CENA 1H01A 1OGUA 3A4OX 5ANDA 2YERA 3FQSA 4WG4A 1DI9A 4MH7A 3TV4A 2XYUA 4V05A 1W98A 3DXPA 3H10A 5HO8A 3Q6UA 4HYIA 4YGAA 3FI8A 2WTDA 2UZBA 3SG9A 5EHYA 1W83A 2VWWA 4D4YA 2OO8X 3COKA 3DQXA 1YXXA 4JIAA 4M8TA 1BKXA 3LXPA 2WMVA 5HNBA 1LR4A 2XNEA 4EH6A 5AP4A 3W1FA 2WXVA 4C62A 1ZMWA 4EH5A 1WVXA 1XH8A 4IWOA 3QA0A 4LRMA 5HLNA 3U6HA 4IBMA 4ACGA 1U54B 4ACMA 3DB6A 3P7BA 2XJ2A 4OT6A 3HMIA 4RIOA 5LVPA 1OUYA 1KE8A 3C50A 4QP7A 1H07A 4DINA 4RFYA 4EOQA 3QX2A 3IQ7A 2VN9A 4FTAA 4RWJA 3UTOA 3S2PA 3UIUA 4YR8A 1OL6A 5FP5A 3PE1A 3GB2A 4EUUA 3PWYA 3H0YA 4QTDA 3NR9A 2I1MA 2OW3A 4PNKA 1YQJA 3QCYA 1YDTE 4OTIA 3POOA 2P3GX 4I0TA 3DT1A 3U87A 4EWQA 4KKHA 1DM2A 2FSMX 2BUJA 4C3RA 4DT9A 3MY1A 3L8SA 2WEIA 3CCNA 4BBEA 4ZTHA 2W4JA 4D2RA 1OBGA 5AJQA 5B2MA 3MDYA 4QYFA 4O0WA 2Y0AA 3R2BA 5LCKA 2GTNA 1KSWA 5IMXA 3U8WA 3IPHA 1LEWA 2OZAA 2ZV2A 3P5KA 5H8BA 2QLQA 4YURA 3NUNA 2JAMA 3OWKA 5IA2A 4DBXA 4YPDA 5T68A 2JEDA 1A9UA 2QHNA 4NW6A 5JGDA 4FYOA 4BCHA 1HOWA 2F7XE 4A07A 4RIWB 4EWHA 3BE2A 5JFWA 4NIFB 5AUTA 2PE0A 4XOYA 1Q5KA 4YTHA 5EI8A 4UX9A 4A9YA 4BHNA 5IA0A 1YOLA 4B7TA 5AADA 5EW8A 1SNUA 4WD5A 5FXRA 4FGRA 4I20A 3FL4A 1G8SA 5CX9A 3LJ1A 3Q2MA 4R1VA 1YKRA 4FV9A 4ZXTA 2OIBA 4C4FA 5FXSA 5L8LA 4AAAA 3HYHA 4AGCA 4XEYA 3ETAA 5E1SA 2JAVA 1AGWA 1KV2A 4EHVA 3VQHA 5JQ5A 4FG7A 5IPJA 2OZOA 4XLIA 5DVRA 5DNRA 4CGAA 4BCFA 3OCTA 4IFGA 4U79A 4KD1A 3D5WA 4D58A 4FOBA 2GQGA 3F5UA 5I9WA 1XO2B 2V62A 4DF3A 4MTAA 3HZTA 5ACKA 1YXUA 4IVAA 5EQYA 2WMQA 3HLLA 2IO6A 5IA3A 3RWQA 2X1NA 1R3CA 3JYAA 4QMSA 3H9FA 5HD4A 4OTHA 5F20A 4BF2A 4R7BA 3VBTA 2WQEA 4CZYB 4KS7A 4ZJIA 4F7LA 3GUBA 4JXFA 3EFKA 1APME 1DAWA 1QPCA 4CRSA 5HKMA 3R9DA 4EC8A 4IZ7A 5CEQA 2O8YA 2PMNX 4IHPA 3ZXZA 2DUVA 3JR1A 4C4IA 3QUPA 3G5DA 3WYYA 1H1RA 3I5NA 4JRNA 4RZWA 4AA0A 4FVQA 3LJ2A 4C35A 4FR4A 3LLAA 5AM7A 3VVHA 4RLLA 3GU4A 4A9UA 5HO7A 4KIOA 2VZ6A 5M57A 4YJQA 3CR0A 4A4LA 4J8NA 4FNXA 4XG7A 1WBNA 4OUCA 3RJCA 1M17A 4EZ5A 5HZNA 4DHFA 4J98A 5IMEA 4QQ5A 5H2UA 4QMLA 2UVZA 4NEUA 3O0GA 3ZSIA 3T3VA 3MESA 3DTWA 4O2ZA 2WTKC 3NYVA 3KY2A 3QKKA 4KWPA 4CNHA 4YC3A 5HTIA 5LCJA 2UZDA 5EG3A 2REIA 4LMUA 3VHEA 2P0CA 5HNGA 4FIIA 3AXWA 4APCA 2FYSA 5M4CA 3OD6X 4GYIA 4X2GA 3C51A 3M42A 3O71A 5C1QB 1JWHA 4FKJA 5E1EA 5IDNA 3SC1A 4GCJA 3OF0A 5IH4A 1W82A 3U6IA 2VNYA 3JS2A 3TG1A 4DFNA 4KKEA 5LQFA 5AV3A 3KRLA 3ORXA 3NUYA 3P7CA 4G6NA 4F1OA 4QMWA 3C4XA 3RPRA 3RAIA 3MY5A 2QVSE 4FOCA 4R5YA 4MNEA 2XMYA 4D4VA 4MBJA 4JG8A 4I22A 2H8HA 4PL3A 2GHMA 5J95A 3E3BX 2CGWA 3NAXA 4H39A 4AGDA 2W05A 3C4WA 1OMWA 4FTMA 4AT3A 4OTRA 4WUAA 4EOLA 5IUHA 5EW9A 4M84A 3PWDA 1Q99A 1KOAA 2BR1A 3JUHA 2PYWA 4I92A 3OW4A 1REKA 3PZHA 4ALVA 5AWMA 4O91A 4AOIA 4J1RA 2NPQA 4CZTA 4EHGA 3EN9A 1IRKA 2B1PA 4NM0A 1KE6A 4O0TA 4IB3A 4O6LA 3R8LA 3S0OA 2BTRA 3EJ1A 1A06A 3EQBA 4I1ZA 4I41A 5CEOA 3BQRA 4BCPA 2HCKA 1UV5A 5CT7A 1ZYJA 2YWPA 4CFXA 1YDRE 4M3QA 1OIQA 3KVWA 2ETKA 3BHVA 4ZS0A 3ZC6A 5BVEA 2PVMA 3NNWA 2YM8A 3D2IA 4RT7A 5BVKA 5IDPA 2QO9A 2Z7RA 4F4PA 4ZMEA 4E4MA 4U40A 1UU3A 3QCXA 5HG9A 4ZLZA 5CAOA 1UNHA 2O64A 3FXXA 4QMYA 1JKTA 2EXCX 5FTQA 5E90A 4DTBA 3H30A 3UJGA 1KOBA 3PIXA 2CLXA 4FSMA 4EH4A 4FK3A 4FT0A 4IVCA 1FGKA 4JBQA 4ZTMA 2UW7A 4CFVA 1P5EA 3A62A 2R9SA 2WAJA 3HEGA 3LCKA 1YHWA 2C0OA 5ANKA 5KMIA 5E8WA 1K9AA 3KXGA 2A2AA 2YIYA 3QC9A 4RIXA 4YBKA 2ERZE 3F69A 2XIRA 3DA6A 4RIYB 3GCVA 2C5VA 4E5BA 1UNLA 2P4IA 2NP8A 4HGEA 4KRDA 4DFBA 1PKGA 3TZ7A 1BL6A 1RE8A 4XV3A 5FDPA 4YNEA 2PMOX 1FVVA 4TW9A 3V5PA 1Z5MA 4G6OA 5BVDA 4IB0A 5CZIA 3NW7A 3EKKA 3R9OA 3QTWA 4AT4A 5EYMA 5FM3A 4BCQA 1ZOGA 3QCQA 5D10A 1GAGA 5HCYA 3W2CA 2WQBA 3OC1A 4DEHA 1H1WA 4KIKB 4CQEA 3SAYA 4RIYA 4ACHA 4WG5A 2IVSA 3BEGA 3C1XA 3QD2B 2C3KA 4AOTA 2QURA 5DI1A 2QOOA 3S3IA 5ETCA 4X6QC 5CF8A 2R3JA 3DGKA 4QMZA 2X8IA 3CY2A 3FMHA 2O2UA 1Y57A 2GNIA 3MPMA 2IW6A 3E64A 3GENA 3TDWA 3AQVA 3FMKA 5ETFA 1MQ4A 2XCKA 2ZDUA 4U80A 2RKUA 4X3JA 4EORA 5AA8A 3UQFA 4D2VA 3MH1A 4FV5A 3KCFA 5IEVA 5K5NA 1J7IA 1OECA 2GQSA 3UZRA 4KIKA 3PXKA 4FIEA 4ITIA 3V5JA 2PUPA 3GC7A 5DT3A 3BHHA 1QPJA 3DKCA 4HVDA 2IVUA 1WCCA 5EYCA 4F6SA 3P78A 4H3PA 2O5KA 3UPXA 5JN2A 5AAFA 5TKDA 3WYXA 3QXOA 4NFNA 4GEOA 4O96A 5CEMA 4FX3A 3NYOA 2BKZA 1HCLA 5L2TA 2XNBA 4WT6A 2W5AA 3A7IA 4J7BA 4XP2A 4R7HA 4FV4A 3QRTA 1XBBA 4MCVA 1NVSA 4OTGA 3I79A 4TWOA 3VS5A 2NRYA 3RPSA 3ZC5A 3HP5A 2WQNA 4YZDA 4C58A 3BI6A 3ALNA 1JKSA 1FOTA 4HPUE 1XH4A 5DYJA 4NFMA 3TXOA 1GJOA 3QGWA 4CCBA 4F7NA 1U46A 3V5QA 4FKWA 4OW8A 4QT1A 2QLUA 4XG8A 3DNEA 2VTTA 5DWRA 3W10A 2VO7A 2YLEA 4UY9A 3K3JA 4ANQA 2XNPA 2PY3A 3PVGA 4BZDA 4EBWA 4MXYA 3UYSA 5IA4A 3TACA 5AR5A 3NAYA 3AC2A 4LGHA 2OKRA 3HUCA 2W7XA 1O6LA 4C33A 3MB6A 2JKMA 2OIQA 4FNWA 2VV9A 4FE2A 4YJTA 2HWOA 3CGOA 4GSBA 5HVJA 2JIIA 1A48A 4NUSA 1V0OA 1JAMA 3E8CA 3FLZA 4C34A 3BHUA 1FMKA 3TCPA 4YJSA 4U3ZA 5J9YA 5AIRA 1BX6A 4ANMA 3OOGA 4WNPA 3AD4A 3AMBA 3JPVA 4WIHA 4TYHA 1ZOHA 4QD6A 4TWNA 4BYIA 3OFMA 3AT3A 4CV8A 4IZYA 4CMOA 4TL0A 4WKQA 3A60A 3QAME 4I6FA 3C4FA 3EHAA 3DQWA 3LFFA 3L8VA 2C69A 2XIKA 3ORKA 2J90A 5HVYA 4BGHA 5JSMA 3TEIA 3C5UA 5A4EA 3QZGA 2IZRA 3V6SA 4RSSA 2CPKE 2WD1A 5C03A 3QALE 5EQPA 2QU5A 3VS3A 3PA4A 2WMWA 4U45A 1UWHA 2BZIB 3DCVA 3EL7A 3GCPA 3HV4A 3MVLA 3Q5ZA 3VULA 2XNGA 4C61A 2OIDA 4PUZA 4AA4A 4NWMA 1VJYA 1ZYSA 3O7LB 2WTWA 4IAFA 4ZTRA 3V01A 1DI8A 4KIQA 4LGGA 4M14A 3KXZA 4U81A 5CSVA 5AP0A 5KKRB 2IZTA 5KMMA 4G1WA 4YO4A 4ORKA 4RQKA 1ERKA 4AU8A 4F9WA 2ERKA 4DAWA 2ZYBA 4IDVA 1PF8A 3C4EA 2GS2A 3ELJA 5E8VA 3FY0A 3FZPA 3PA3A 5C26A 4ZLOA 1JVPP 2ZM3A 3U4UA 4GYGA 1OI9A 2RFDA 3SRVA 3RALA 3P1AA 1OM1A 3TJDA 3BIZA 4J53A 4QRCA 3SXRA 3PG1A 1NW1A 5BMSA 4H3BA 4FTOA 4FZDB 2VO3A 3SD0A 3DPKA 4QP4A 4CKIA 3IDPA 4O7WA 3CGFA 2XK9A 3OWPA 3VS4A 5TO8A 1H8FA 3I6UA 3QQJA 3G9LX 3F3WA 2CN5A 2OJ9A 4L44A 1LEZA 1SVEA 3BX5A 5CVHA 5M44A 3CQUA 3AC8A 3EB0A 3HMOA 1NVRA 5JMSA 4CFFA 5KCVA 4KAOA 2XK3A 2RIOA 3DOGA 3TZ9A 1PMEA 5CZHA 5AA9A 2F49A 2X6EA 1GZ8A 3S00A 3R8VA 3WOWA 2QOKA 4D0XA 4IDTA 2OK1A 4FICA 3HECA 3F3UA 3FV8A 4MQ2A 1OB3A 1WVWA 2AUHA 2CN8A 4PRJA 1ZZ2A 4L7FA 4DH7A 4LMNA 2X8DA 2ZMDA 3F6XA 4BCJA 5C27A 3D94A 3C13A 4RVMA 4TTHB 5BQ0A 1H25A 5HG8A 1UKHA 4GFOA 3TM0A 2OFUA 4JAJA 3UQGA 4QNYA 3AC1A 3QRUA 4O7NA 2YM4A 4BGGA 4BI0A 3VC4A 4PMMA 3CC6A 3BELA 3EN5A 2CGXA 4FSNA 4CFNA 5D12A 4ZIMA 3BHTA 1P2AA 3IECA 3Q96A 4YPSA 3PP1A 4FTJA 3GGFA 5FG8A 4AW0A 2R5TA 5FWKK 2YLFA 3ZLXA 4MXXA 4BZNA 1YXVA 3GU6A 3L9NA 3TIZA 4O22A 4RJ5A 4ENYA 3K5UA 3KRRA 3NGAA 4BHZA 4D1XA 1PYXA 3F66A 3JXWA 4HCVA 3VRZA 3RM6A 3ZUVA 5TT7A 1MQBA 3VQUA 2VX1A 2PTKA 1YXTA 2UZNA 4E7WA 5IQAA 3FZRA 4M97A 4D1ZA 4E1ZA 3LE6A 3WE8A 4RC2A 3N51A 2JKKA 2X7GA 3MFRA 4R6VA 3PXFA 3NUAA 2XIYA 5K3YA 3QWKA 2GTMA 3CE3A 4TN6A 5HNIX 3BYVA 5M09A 3I0OA 4WBBB 3QKMA 2OH0E 5CEKA 4V01A 5IEYA 2BROA 4BCOA 4JOAA 2YFXA 5DRDA 4F65A 5CASA 3F2AA 5HCXA 4ANBA 4IAIA 4FKIA 4W9WA 4CEGA 2CKPA 5AX9A 3FZOA 5D1JA 3DBEA 4I93A 3PP0A 4CKJA 4W4VA 4I21A 4D2PA 4C8BA 3TUCA 3HA6A 2PUUA 1TKIA 3FHIA 4BDJA 4CFUA 5JT2A 2QOCA 3I6WA 3R30A 2CSNA 1CKIA 2QHMA 3NUXA 3R7IA 3AC5A 1MRUA 4YTCA 3KQ7A 4MX9A 5GJDA 3U51A 5IUIA 4F9BA 4RC4A 5B7VA 2ZVAA 1CTPE 4NTTA 2GQRA 4D9TA 3PXYA 5KZ0A 3P7AA 4V0GB 4G17A 3G9NA 5E7RA 4EEVA 1OL7A 2G9XA 2PMLX 1WBWA 4G3GA 2B9IA 5I3OA 4YSJA 2W4KA 3OHTA 2CGVA 5LWNA 4O0RA 5ANIA 3TN8A 1GY3A 5F4NA 4X2KA 4NKAA 4FT9A 4LOPA 2Y9QA 3TL8A 4U0IA 3V8SA 5JFVA 2CKOA 2YN8A 4O83A 4ZK5A 2WTJA 3KRJA 4XLVA 4ASXA 5BX0A 3E8NA 2B9FA 2ITYA 2Z7QA 4ASDA 4FNYA 1ATPE 3PZEA 2J5EA 2IPXA 1PXOA 3KXXA 3RNIA 4MBIA 2BPMA 3BV3A 3Q32A 4ONAA 2A0CX 3MPTA 2JIVA 4KBAA 2WFYA 1L8TA 4PQNA 2JDOA 2HWPA 3C4ZA 5EI6A 3ORLA 4WSQA 3FSKA 2VGOA 3UMWA 1QMZA 4RVKA 3QQGA 1M2PA 5DH3A 2GS7A 2YA9A 3EQRA 4WA9A 4FA2A 2QI8A 3KA0A 4YTFA 3ZM4A 4TPTA 4G6LA 1UKIA 4RJ8A 2GU8A 2ZV8A 3ZONA 2WQOA 4UMUA 4D5HA 2HZ4A 3IONA 5CAQA 2G2FA 2JGZA 1PJKA 1Y6AA 4Z3VA 1IA9A 1PXNA 3V5WA 4BDHA 4E4XA 4F6UA 2CNQA 3NW6A 4LG4A 4MXCA 4FEVA 5AUXA 1YI4A 4C3PA 4C36A 4EK8A 3P9JA 3G33A 3SDJA 3Q5IA 3MGYA 5ACBC 2WKMA 3FUPA 1XBCA 3VUDA 4BVUA 4ZSJA 1FVTA 1P4OA 3R7GA 2JD5A 4GMYA 4D28A 3VO3A 2YM5A 3OVVA 1ND4A 4W8DA 3CIKA 3CXWA 4ZTNA 2XP2A 3FSFA 3O50A 3OROA 4XG4A 3PY0A 4D4SA 3RPVA 2XJ0A 3HMNA 4D55A 4C0TA 5A6NA 2WMAA 2ITOA 4EONA 4NZWB 3LMIA 2IZSA 5F1ZA 3W2PA 2I0VA 4JQ8A 4C38A 4K1BA 3TNHA 4ENXA 4XP3A 4YJNA 3R7YA 3O2MA 2WOTA 2PVKA 3QHRA 4AZSA 4CFWA 2VTHA 4EZ3A 3FAAA 4RJ6A 3HAMA 4B4LA 1M2RA 1CSNA 3P0MA 3ZUUA 3CS9A 3VS0A 4ZZOA 3R9RA 4EOIA 4BRXA 2F7EE 2YIRA 3R7EA 4DE4A 4K8AA 4FV1A 4DFZE 4QQTA 3GQLA 5CALA 5AP2A 4JLCA 1ZY4A 4EJNA 3KN6A 4AF3A 3NUPA 4OTDA 4X0MA 2R3OA 3RHXA 4D5KA 2YZLA 4DTAA 2V7AA 4QPSA 3I7CA 3QUDA 3PY3A 4Y85A 3LFBA 3IW8A 5AR8A 4N57A 3DKFA 1YWRA 1UU9A 2XRWA 3MN3A 3CP9A 3Q9YA 2BCJA 3QRJA 2IG7A 2XEZA 3A2CA 3CD3A 4RJ3A 4F70A 2RFEA 3BBWA 3O51A 2C1BA 3EH9A 3PSCA 5L2IA 1DAYA 2H34A 3C9WA 3ZRLA 2I0EA 3MTFA 3IO7A 4GRBA 3D4QA 4FGBA 3L8PA 3EQCA 2Q0NA 3D5XA 5I9YA 4WOVA 5HG5A 1U5RA 5HU9A 3TI1A 1YRPA 2QONA 1WBSA 4GT3A 2UZLA 2QOQA 4EYMA 4E4NA 4FUYA 4XH6A 2F9GA 2VWIA 1OVEA 3VHKA 2E9UA 4BDEA 3DXNA 2GNJA 4LYNA 3G0FA 4OGRA 1JSVA 2PVRA 2WTVA 3GOPA 4CT1A 2R3GA 4DEAA 3AT4A 2C5YA 3R02A 4BTJA 1Q3WA 4ZEGA 4ZOGA 3EYGA 3OP5A 5AUZA 2QOLA 1OITA 3RKBA 4L6QA 3G6GA 4M12A 5AAGA 5D9HA 3BLQA 3HV3A 4PP9A 5LARA 2PPQA 3HMPA 4Q9ZA 5J9LA 4IC8A 1NY3A 2XKDA 4NJ3A 2O3PA 2PZ5A 5J7BA 4ZY4A 4CCUA 1V0BA 4RJ4A 5CF5A 5LXMA 1OKZA 3ID6C 2W99B 3CTQA 1J91A 4L42A 4FF8A 5DR6A 4M13A 4E73A 1U54A 1QPEA 4GJ3A 4UN0C 4WBOA 3QL8A 4IEBA 4IX4A 3R8PA 2YIQA 1WFCA 3HAVA 2HW6A 1SM2A 3DBFA 3NUUA 3G2FA 1ZMVA 5DEWA 1H26A 2NNWB 3W2RA 3KKVA 3WILA 5JGAA 3QTSA 3LVPA 2G2HA 4A06A 3EZVA 3ZXTA 4E26A 2QNJA 2OF4A 1PXIA 2Q0BA 3TV7A 5B2LA 1H27A 2XK8A 4GFGA 4LRJA 5HBEA 4C2WA 4PMPA 3PLAE 4QMVA 3D15A 2BAKA 4K6ZA 2B9JA 2XF0A 4CFMA 4O7VA 3DLSA 2PVFA 3MSSA 1IEPA 4PV0A 3O8UA 2BRMA 3QTIA 3R83A 5AP6A 4AZEA 2FH9A 4MXAA 5TE0A 2HYYA 3VBXA 4BTKA 4DGNA 3PTGA 4RWKA 3ZHPC 3TNPC 1Y8GA 3LM5A 3ORNA 1FQ1B 2UW9A 5E8ZA 5H3QA 3W55A 3ZLSA 3EIDA 2X6DA 2BAQA 3C0GA 2G1TA 2RFSA 2XIXA 4FTIA 4IZ5A 5J7HA 5HX6A 3F5XA 3GU8A 3Q3BA 2C3JA 3I7BA 4RIWA 4NIFA 4DFLA 4GKIA 1IR3A 4W9XA 4DC2A 2C5NA 4DGGA 2EVAA 1MP8A 1MRVA 1LP4A 4BDGA 1KE9A 2YM3A 4EYJA 3EQHA 3ZCLA 5E92A 4UMPA 3THBA 5IZFA 3QQLA 4IJ9A 2J51A 5J79A 1I44A 3BU6A 5EDQA 3RCDA 3DV3A 3W8QA 3G6HA 3QTRA 3FLWA 5KMJA 5DMZA 4XV1A 3RZBA 1BLXA 5LVLA 2ITVA 3HV6A 4EH8A 1OL1A 2YM7A 4IACA 2W4OA 4KKGA 4RMZA 3WZUA 4RQVA 3SXFA 2OFVA 1GIHA 3RZFA 1J3HA 3ULZA 2W1CA 2BALA 1Q8TA 5CAPA 4S2ZA 4WRGA 4MXOA 3QFVA 4F99A 4O7SA 1Q8ZA 1B39A 4II5A 5KE0A 4W4WA 4DFXE 4FC0A 3EYHA 4GL9A 3WZKA 4FEUA 4BB4A 1VEBA 5EW3A 3UP7A 4L46A 1IG1A 1KE7A 3LOKA 2FSOX 5KBQA 5CU4A 4FTUA 2Z60A 3V6RA 5JRSA 2HY81 2J50A 4HYUA 5FEEA 4YJUA 4NM3A 5DR9A 5FP6A 3Q4ZA 5CNOA 2ZJWA 3UDBA 1IASA 3WF7A 2P2HA 3DTCA 5L2WA 5ITAA 4KSPA 3ORTA 2DS1A 4AQCA 2FSTX 5LVOA 5HORA 2X7OA 3FJQE 5DPVA 4KABA 4XHKB 5DT0A 3LLTA 4YZNA 3SOAA 3E3PA 1YHSA 5HGIA 4FTNA 4DEDA 4NW5A 3CJFA 2C5XA 1JLUE 5J8IA 1YWVA 5D7AA 2PULA 2J6MA 3GI3A 3MH2A 2XA4A 3FI2A 3NPCA 4GK2A 2PE1A 3POZA 1SVGA 3DKGA 5F95A 4ACDA 4DLJA 4GFMA 4L45A 1XBAA 5JQ8A 3KRXA 3MVMA 1BUHA 2UW5A 3Q6WA 3R01A 2H9VA 4IE9A 2WMSA 3M2WA 2ITWA 3EFWA 3QLGA 3FWQA 3LJ0A 2ZV7A 4MHAA 4Y72A 4Y8DA 1YI6A 3A99A 3IS5A 3ZDUA 4U5JA 1Q8UA 4S33A 5BYZA 3LXNA 4FZ6A 4O7YA 4KNBA 5IQIA 3R8UA 5EDRA 3RVGA 2XUUA 1H24A 2W1FA 3UOHA 1ZLTA 1YVJA 3V5TA 4CYJA 5CF6A 2QR8A 2VUWA 5HD7A 3R1NA 4FI1A 1Y8YA 4RZVA 4QNAA 1SVHA 4AN2A 5HI2A 4FV6A 1K3AA 2A27A 3FY2A 4FV3A 4FZFB 4ZP5A 3E5AA 3KVXA 3CSVA 2CKQA 3IDBA 3UO6A 3PA5A 2Y7JA 3PIYA 3AG9A 4D4RA 4IXPA 3ZO2A 2XKCA 5A54A 4FTKA 3E92A 3HRCA 1Q3DA 1UU7A 3R21A 4K11A 4E3CA 4ZJJA 4CLJA 2AC3A 2CDZA 5I9XA 2GFSA 3QYZA 2WU7A 2W5HA 2BTSA 3VRYA 4IX3A 4EQMA 5I4NA 2VD5A 5FDXA 3ULIA 2WMXA 2XEYA 5E4HA 2GS6A 5HTCA 1BI8A 1K2PA 3LFDA 4N0SA 5A4QA 2F2UA 1RQQA 2C1AA 4FBXA 3NS9A 4J71A 4BC6A 1UNGA 2XZSA 5KO1A 3W16A 2G01A 3ET7A 4LRKA 4NH1A 4LM5A 3BQCA 1OKVA 4FV8A 4PL4A 2XM8A 4BCIA 4C02A 4DCEA 2J5FA 2R7IA 5KKRC 3SW7A 3ZYAA 5HEZA 5IQEA 4L8MA 3ROYA 1XH9A 2BFXA 4ALWA 2PUIA 3A7JA 4FKRA 2P55A 4ZSEA 3SLSA 4L52A 3RNYA 1BL7A 3GXLA 1JSUA 3ENMA 3HL7A 3ZTXA 4D1SA 3B2WA 3MBLA 4QMTA 4UXLA 3R1SA 1Q8WA 4PX6A 1VYZA 3S1HA 2X4FA 3FKLA 3MVHA 4JL9A 3TZMA 1WBTA 3HMMA 4JRVA 5L2QA 5T3QA 3DJ7A 2VTPA 5GINE 1PXJA 4FT7A 2ZM1A 3HVCA 3ZS5A 4DA5A 4B9DA 4C4HA 3UYTA 3GFWA 4WNOA 2XJ1A 3DK7A 4JX3A 4C7TA 5AR4A 1Y91A 3L9PA 4PL5A 1KWPA 3AC3A 4EJ7A 4GT5A 2JKOA 5E8SA 1ZXEA 3A4PA 1OPJA 4Z9LA 5BVWA 4ZJVA 3FQHA 4Y46A 5GZAA 4O7LA 4CXAA 2C0IA 3ROCA 1EH4A 1Q4LA 2E9NA 2RF9A 3RAHA 2QOHA 4QMPA 3RWPA 4O0VA 5IEXA 2I40A 5AV0A 4E93A 4YZCA 3LFNA 4HCUA 1M2QA 4UALA 2J7TA 4O7RA 4DGOA 3COHA 4M67A 4BIBA 3D83A 2XCHA 4JG7A 3VUMA 3DDQA 4OTQA 4D0WA 5L3AA 3R7UA 4ERWA 4D2SA 1T46A 3IW5A 2JKQA 3PG3A 4AG8A 4F08A 2V0DA 4YJVA 1REJA 2VTMA 3AGMA 3HRBA 1M7NA 4BIEA 4IANA 3VF9A 4X7QA 3IKAA 4O6EA 4QP8A 3RP9A 3GBZA 2X4ZA 1W0XC 3PY1A 4R3PA 3VS7A 4F7SA 3DAEA 4F0IA 3NYNA 5AR2A 1PXKA 2QKWB 2R2PA 3BYMA 5E8XA 2WIHA 4DT8A 2X8EA 1H1PA 2BRGA 2VWUA 5CSPA 3IDCA 4WUNA 5FEDA 2OWBA 3OEZA 4TYEA 5AP3A 5K0KA 3R0TA 2W1DA 4QP9A 3DB8A 4JQ7A 3OXZA 3RTPA 2WZJA 3CQWA 4FSZA 4AW1A 3N4UA 4Q9SA 4FZ7A 5A14A 5HICA 1FBNA 4EKLA 3C0IA 4C4JA 1MRYA 3LW0A 4EK4A 1Q41A 2X2KA 5CWZA 5C4LA 4LFIA 5CSXA 3LIJA 3SQQA 3TV6A 1P14A 4OBPA 2QOIA 4DBNA 4FEXA 4EHZA 3MWUA 3FBVA 3ZH8A 5LOHA 3UG1A 3VS2A 3QTUA 4IAZA 5ANJA 4FG9A 3RMFA 2OF2A 2VTAA 3BGQA 4LUDA 4P4CA 5CSHA 4IFCA 3WF9A 3TNQB 4ZSAA 4S32A 2C3IB 1Q97A 3WIGA 4BDIA 3UGCA 4NL0A 3E87A 3NSZA 3O8TA 2J0LA 4UV0A 3R2YA 3OG7A 3BGPA 4CMTA 1JKKA 4UWCA 4AE9A 1O9UA 4TXCA 3ZLYA 4O0YA 3ZM9A 3FC1X 4GK3A 2PZIA 3OWJA 3OT8A 4IVDA 4JJRA 2YACA 4HCTA 3VJOA 4FTTA 4C3FA 1TQMA 2O65A 1FGIA 2PVLA 4RPVA 1OKWA 5JZNA 4O7TA 4L43A 2E9OA 5DG5A 1BYGA 5CVFA 2UV2A 2W9ZB 5FQDC 5IQDA 4PF4A 3UIXA 2Y4IC 3V5LA 2GPHA 1CKJA 1TVOA 4RA5A 4IZAA 1SZMA 4USDA 4FTQA 3HA8A 3ZSHA 4BCMA 3SG8A 3TUBA 5H9BA 3I0QA 3KXNA 4BDKA 3LFCA 4FT5A 3EQIA 3LCOA 5LMAA 3MH3A 3VN9A 3U6JA 3O17A 4LL0A 3OY3A 4K33A 4GJ2A 4HNFA 5AUWA 1PRYA 3NVKI 2XNMA 3BBTB 3E8EA 2W5BA 3VS6A 3F7ZA 1RDQE 3O23A 5F94A 5IQCA 5FGKA 4RX8A 5EHLA 3F3TA 3Q2JA 3EQFA 4G9CA 4DLIA 4EH9A 4HGSA 4M69B 2WNTA 3LCDA 4I6QA 5DEYA 3UO4A 3V51A 3DZOA 4TY1A 4UYNA 3RGFA 5CU6A 1WBVA 4AACA 4MXZA 2W1EA 4B0GA 3GCUA 4DG0E 3DU8A 3GCSA 3R9NA 2J2IB 2R3HA 4FSWA 3U4WA 5M08A 3QZFA 4X3FB 1YI3A 3L8XA 4AOJA 4I4FA 4RRVA 3QQFA 2Y6OA 2VWVA 3VUIA 3TKHA 3FMDA 1H28A 2C5OA 3I60A 3LCSA 5I3RA 1URCA 3KK8A 4G3CA 1V1KA 5CU2A 3NNUA 2YCRA 4HGLA 4WO5A 5DGZA 4YU2A 5AFVA 5EQEA 1JOWB 3VUKA 4HVGA 3BKBA 5HLWA 3FYJX 4GT4A 3NIEA 4HGTA 4P5ZA 2W9FB 5E8UA 1W84A 4GG7A 4AW2A 3SOCA 4RGJA 1L3RE 3QF9A 4AGUA 3PE2A 4I5PA 2RFNA 3MH0A 4RJ7A 5JEBA 4Y73A 3MW1A 2VWYA 4GV1A 5AM6A 1O6KA 5KHXA 3UPZA 2GMXA 2HENA 4UWYA 4YNOA 3D5VA 1IAHA 4OT5A 4ZAUA 5DOSA 3SVVA 3TZ8A 4DN5A 1LUFA 2ITXA 5K5XA 5AUUA 2OG8A 4FTLA 2F2CB 2R3MA 5GIOE 5IUGA 3PXQA 3PDTA 3DBCA 4CG9A 5K0XA 4CLIA 5IQFA 1GZKA 3B8RA 2H96A 4O27B 2WEVA 4BKYA 2PZPA 4YJPA 5DIAA 4X2JA 3FMJA 5CNNA 2QC6A 5FBNC 4AGWA 3DFAA 2QU6A 4QP3A 3FMEA 5HIDA 3D7ZA 4RG0A 4RWLA 1ZARA 3ODZX 4G5PA 3TTIA 5KX8A 4KB8A 2YDJA 3UNKA 4U7ZA 5K4IA 1QPDA 2LGCA 2UZVA 3LFQA 4L9IA 1OIYA 3ALOA 2ITPA 4BDDA 4FK6A 4EQCA 4PMSA 2PK9A 4I0RA 4J8MA 2J0JA 3R73A 4M0ZA 2GHLA 2GDOA 4MWIA 1W8CA 3Q04A 3EMGA 5IH5A 2JDTA 2ITUA 4YC8A 4CMUA 5GIPE 4EZ7A 4MQ1A 5HU3A 3QRKA 4FYNA 3ORIA 5DLSA 4EC9A 1GIIA 3Q4CA 4AZWA 3ITZA 5EH0A 5HHWA 1H00A 3FZTA 3CEKA 4WG3A 4AT5A 5HE1A 3ZSGA 2JFMA 2J0MB 4USEA 4YLJA 5M06A 2B54A 3MB7A 3Q52A 4NCTC 2LAVA 3TT0A 4KIPA 2NRUA 3T9IA 3D14A 1Q62A 3UOLA 3VNTA 4EKKA 5JZJA 3AD5A 1RW8A 4G3FA 2VO0A 1FVRA 3F9NA 3ZDIA 3UZPA 4M66A 3BV2A 4EH3A 4G3EA 4Y5QA 5JH6A 3ORPA 4G5JA 5AIKA 2CCIA 3K3IA 4EK3A 1TQIA 2C68A 3LMHA 4G16A 2VX0A 3OY1A 2EU9A 3LQ5A 3Q4UA 5C4KA 4CRLA 5LJJA 5EKNA 4MF1A 4XBRA 4BDAA 3PJ2A 4RFZA 3ZFMA 2B0QA 2XS0A 4KS8A 3QXPA 3FMNA 1Q8YA 4ZY6A 4YZBA 4FKVA 3JY0A 4TKSA 5C01A 2F7ZE 4CVAA 5E8YA 2VRXA 4YP8A 5J87A 4BYJA 3F5PA 4XG6A 3P79A 2YISA 4M0YA 3GP0A 3R04A 3F82A 5FM2A 3ZUTA 5J9ZA 3OEFX 2IVTA 3NCZA 4TYIA 2BZJA 5AEPA 4XMOA 5LWMA 3QZHA 4X2NA 4DEEA 1PXMA 4S31A 4CT2A 4XRLA 5B2KA 4A7CA 4RX5A 4EOSA 5DE2A 5I9VA 3QZIA 3WZJA 4ARKA 2XK7A 2BFYA 4AZVA 3WBLA 3VBYA 5JFXA 4FKGA 4AN3A 2UZUE 5J5SA 4DEGA 1WVYA 4V0GA 5EM8A 4GS6A 3EQDA 4JBOA 3LFAA 3VAPA 3ZEPA 3QGYA 4NM5A 2P33A 4FKUA 4BWPA 5HIEA 2A19B 5EOBA 3SW4A 3SV0A 4BBFA 4F09A 5FEQA 4R78A 1KV1A 1UWJA 1OZ1A 2OBJA 3PYYA 3Q4TA 3HV7A 3C0HA 3DY7A 2WMBA 4E6CA 1OKYA 5C9CA 4EK6A 3MFUA 4U42A 2VTJA 4IX5A 1GZNA 4KUJA 4QP1A 4I5CA 2VAGA 4GVAA 3QA8A 3VUHA 1WBOA 3IGGA 5CI6A 4FNZA 4QTEA 5L4QA 3EN6A 1H0WA 2BRBA 3MIAA 4APPA 4PDSA 4JR3A 4OTWA 4IAKA 3NYXA 3BWJA 3PSBA 4J99A 3R8MA 2PMIA 3RCJA 3V8WA 1P4FA 2QG5A 2WGJA 3R63A 4QPAA 3DXQA 4BGQA 4O7ZA 5A4LA 3RPOA 5AP1A 1NA7A 4BY9E 3I4BA 3FPMA 2YDKA 4QYHA 5IG1A 3N4VA 4TWPA 3N9XA 4XX9A 5E8TA 4ZZMA 3ZZEA 4MYGA 4C57A 4IAYA 4EOOA 1UU8A 2A1AB 4MF0A 4XOZA 3OTUA 1PMVA 4DH5A 5A9UA 3PPZA 2VX3A 2W1GA 3OUKA 1FPUA 4IM2A 3B2TA 4FV7A 2PZRA 2OXXA 3QD4A 4AUAA 4UZDA 5KMKA 5K4JA 2X9EA 5HE2A 4R77A 3QTZA 1V0PA 3IW6A 4U3YA 4L00A 3NNVA 3FKNA 2HZ0A 3NDMA 2B55A 1XHAA 1XH5A 3MJ1A 4JI9A 5BUJA 3HKOA 4O21A 4LOOA 3SA0A 1GZOA 1S9JA 3OCGA 4Z16A 5BYYA 3VIDA 3HDNA 4C4GA 5L2SA 2JDRA 4DEBA 4ZMFA 4L3PA 5IA5A 4ANLA 5CXZA 3KMUA 2XIZA 4TWCA 5CQUA 2I7QA 3KFAA 4KA3A 3LAUA 3LXKA 2WIPA 2QO2A 4AA5A 3ZO4A 3U54A 2XBJA 3PVBA 3UC4A 4ANSA 4F63A 5LVMA 5FBOA 3W2QA 4QMXA 3KULB 4U97A 5HX8A 3HNGA 2X0GA 3I5ZA 5ANOA 3GCQA 3PXRA 3D7TB 3C4CA 3R1YA 4H36A 3A8XA 4E5WA 3FDNA 5FLFA 3D2KA 2UVXA 3P23A 3QYWA 5A46A 2YHVA 2ITQA 5M4UA 4O81A 1VZOA 2QQ7A 3E63A 4FV0A 4MD9E 2W17A 5DN3A 4JDKA 4R3CA 5AUVA 4QTBA 2XB7A 2CCHA 1ZZLA 1X8BA 4JG6A 4GU6A 2CKEA 2QCSA 3TUDA 1H1SA 5TF9A 2VTQA 4XJ0A 2X81A 3U9NA 4PY1A 4E20A 2E9PA 5BNJA 3RHKA 4EOPA 2NO3A 3D7TA 2OH4A 4FSTA 4NCTA 3UIBA 3LQ8A 2PUNA 2BHEA 4YO6A 5B0XA 2YITA 3A7GA 3K5VA 4L3LA 1NXKA 4R5SA 3DFCB 4EBVA 3B8QA 2QD9A 2OJJA 1IAJA 5ETIA 3NZ0A 1M52A 4K9YA 5ETAA 5A3XA 3ZRMA 1TQPA 2CHLA 4NK9A 1XH6A 3QBNA 3VS1A 3VW6A 4WNKA 4KBKA 5J1WA 2YCSA 1G8AA 4W4XA 2V22A 2PVJA 1QL6A 3D0EA 4OAUC 4DG3E 5E9EA 5IA1A 3TWJA 3VJNA 2BRHA 4FSYA 2BMCA 4YJOA 4OBQA 3Q9ZA 4J52A 4HW7A 5AV1A 2YIWA 4PWNA 4FEQA 5IQHA 5LMKC 2I0HA 2YCQA 3LM0A 3MA3A 4Y95A 2E2BA 4EI4A 4QP6A 5CSWA 3H9RA 4WRSA 1F5QA 4JAIA 3EQPA 5CTPA 3OBJA 5EM5A 3CD8A 3KN5A 3DNDA 3QQKA 4JDJA 5AV4A 3FZSA 2V55A 4ZSGA 3ZO1A 1GOLA 5GJGA 3FI3A 3SX9A 3ZBFA 1F3MC 5DR2A 4FIJA 4RX7A 4BDCA 3QUEA 5EYKA 3OZ6A 1YOJA 4LGDA 4ZTLA 2W1IA 2Z2WA 3AMYA 4F0GA 4DH1A 4QP2A 2FO0A 4M68A 1CMKE 1JKLA 2OZAB 3GC8A 4N6ZA 5AR7A 4ITHA 3HX4A 3LMGA 1OUKA 4IM3A 4WHZA 3U55A 3REPA 3G0EA 3OOMA 4MD8E 1H4LA 1PHKA 3KRWA 3R22A 4QYYA 3ZZWA 4U6RA 2R3KA 1BMKA 2Y6MA 4FSUA 3ZO3A 4UYAA 5DT4A 5BVOA 3K2LA 5EHOA 4EHEA 2HIWA 3ANRA 4PDPA 4AS0A 4M15A 4HVHA 5BUEA 3FLNC 3PJCA 5KMLA 4HYSA 1BI7A 3NEWA 2C47A 3R1QA 4AFJA 4E8AA 2WELA 2Z02A 4G9RA 3CPCA 4TYGA 4IIRA 3WF5A 4PTGA 4I6HA 5CU3A 4JVGA 4JNWA 1E9HA 1Q24A 1XH7A 4JT3A 1OL2A 2EUFB 4DYMA 5HCZA 3PIZA 4PPCA 2EB3A 4IADA 2BDWA 3UC3A 4X21A 5HBJA 4GVJA 4IX6A 2WQMA 2C6EA 3FL5A 4ZTSA 2IW9A 3R9HA 1H08A 1JQHA 3W2SA 5M07A 4EUTA 4U43A 2B52A 3G51A 4BDBA 1MUOA 1PW2A 2XNOA 4IB5A 5EKOA 3R28A 3HUBA 4UMRA 2WTIA 4O0UA 1FMOE 2ZOQA 4FT3A 3NMUF 4RLKA 2YJRA 3QX4A 2C6IA 1OPKA 2UW4A 1CM8A 4KSQA 1OL5A 4H1MA 3S4QA 2OU7A 4B8MA 1Z9XA 2FA2A 2VGPA 2UZWE 3UIMA 3ZBXA 3S95A 4QTAA 3KCKA 2BVAA 3TDVA 2YWVA 4FKPA 5H8GA 4L68A 4EH7A 2WMRA 1XQZA 3F7WA 2RL5A 3OXIA 2C6TA 2XK4A 4U44A 3WE4A 2UZOA 4AP7A 3SGCA 4L67A 4IWDA 4CYIA 2R3QA 3JY9A 5CAVA 4LV5A 1QCFA 3VUTA 3ZFXA 3NVMB 4BI1A 5BVNA 4U9AA 5D41A 5C8NA 2JFLA 3AD6A 2UUEA 4IWPA 4UEUA 4XS2A 5EYDA 4EOKA 3QLFA 1XKKA 3LKMA 5BMMA 3R6XA 2BKKA 4Y83A 4UBAA 1U4DA 1YWNA 2RG6A 3EL8A 4YBJA 4F9CA 4F64A 4MD7E 4B99A 3H9OA 2HZIA 2XVDA 2HXQA 3PPJA 2J9MA 4K18A 4ZTQA 3EN4A 4BWKA 4YTIA 4Q5HA 4TNDA 4I0SA 2CGUA 3SKCA 4FL1A 2CNVA 4H05A 4LI5A 2C6MA 4I24A 3UQCA 3TNIA 3PRFA 4NTSA 4A9TA 4AN9A 5I9UA 3DJ5A 1YHVA 3BPRA 3KXHA 3DAKA 4AE6A 3LQ3A 1YXSA 2OLCA 2J4ZA 3KF4A 4QYGA 5KZIA 5CLPA 5M4FA 3LCTA 4Z55A 4CZUA 4MNEB 5LVNA 4HYHA 3EFJA 1VR2A 5L8JA 4GIHA 1ZAOA 2EWAA 3FXWA 5JFSA 3MYGA 2ITNA 1SMHA 2ZAZA 4GU9A 2W0JA 4BN1A 4WSYA 4TT7A 4AX8A 5KNJA 2VO6A 5M4IA 1VYWA 5L6WL 4RFMA 3EWHA 4K77A 3F3ZA 1UVRA 3ACJA 3AT2A 4H1JA 4KRCA 2C6DA 2E9VA 2OSCA 2GNLA 5HE0A 4FZAB 5C8KA 3CLYA 3QRIA 2UZEA 4IB1A 2QOFA 5LMKA 1PY5A 3QTQA 1R0PA 2JBOA 3GQIA 1GNGA 2DWBA 3BHYA 2XKFA 1ZYDA 2IWIA 4MK0A 3WI6A 4E4LA 1ZOEA 5JRQA 2Z7SA 1F0QA 5IQGA 2VWZA 4YZMA 4IAAA 4RC3A 3I1AA 3COIA 5IF1A 2YIXA 2CLQA 3BWFA 5CU0A 3PVWA 4NM7A 5FTOA 3OS3A 5AP7A 3L9MA 3I81A 5AP5A 3GEQA 2BZKB 3V04A 3BLHA 3LZBA 2J0IA 3IOPA 3BCEA 3GOKA 3GU5A 2R3FA 3UP2A 3DZQA 3M11A 5EI2A 4O86A 4QYEA 1T45A 3ORMA 3R7VA 3T3UA 5E91A 3OMVA 5AMNA 3UMXA 4E5AX 4IJPA 2FB8A 3EQGA 4LL5A 4XG2A 5HVKA 4FEWA 4X3FC 2C30A 4C4EA 4V04A 5HG7A 3QQUA 4BFMA 4F0FA 2GNGA 4AW5A 4BTMA 3UOKA 2VTSA 4O82A 1PKDA 4MNFA 2HY0A 2WU6A 4I4EA 4QMMA 4I3ZA 2YDIA 4RIXB 4DG2E 5KUPA 2WO6A 4QQJA 3RI1A 5HOAA 3UNZA 3AOXA 4EL9A 3H3CA 5AUYA 4KBCA 4AWIA 4R8QA 2OXYA 4O0XA 3P08A 3GC0A 4FMQA 5FUTA 3JVSA 3PJ8A 5I0BA 3RINA 3Q9XA 1ZY5A 4NJDA 5EM6A 4I5MA 3MFTA 1J7LA 4N70A 3WZDA 3WF6A 4O84A 4QMQA 2W96B 2IZUA 4XV9A 4JDHA 4YLKA 3RPYA 4A9SA 2FSLX 1G5SA 4HZRA 3DK6A 4L01A 2XKEA 4JBPA 5GZ9A 2HW7A 2ZMCA 3KREA 4J96A 3DDPA 3T8OA 4ANOA 4AZTA 4CQGA 4USFA 1JNKA 5TOZA 5G6VA 2PVNA 4XRJA 3FI4A 2RGPA 4GIIA 5I5ZA 3IG7A 2PZYA 3GT8A 4GK4A 5TR6A 3LXLA 4JS8A 2ZB0A 4D9UA 2A4LA 5IISA 4ITJA 5C8MA 4N4SA 4OLIA 1YOMA 4P5QA 1ZWSA 2ITZA 3DBDA 3E7VA 2UW6A 2Y4PA 4C2VA 5HTBA 4EK5A 2HK5A 3HRFA 4UXQA 4X2FA 2YAKA 4HNIA 5HIBA 2WHBA 5CEIA 2ETMA 3FE3A 3FLQA 1JPAA 1OIUA 2C6KA 4LOQA 4O2PA 3H0ZA 2BDJA 4YHTA 3LFEA 3QD0A 2WB8A 3PFQA 2QO7A 2QKRA 2X2LA 5A4TA 3N4TA 2VTLA 5IQBA 4TRLA 1WZYA 4BKZA 1URWA 1H1QA 4JDIA 4JQEA 3MI9A 3CBLA 5D11A 4JR7A 2OJFE 3RK7A 2PVYA 1ZRZA 2CMWA 3F3VA 3MVJA 2OGVA 4FV2A 3E93A 4TZRA 1R0EA 3P86A 4DEIA 5AV2A 4CKRA 2WTKB 2X2MA 1YW2A 2R7BA 3OCBA 3UNJA 4P90A 2UW3A 1B38A 4RVTA 3CTJA 2BIYA 4FL3A 5M55A 4YSMA 4BI2A 2BDFA 4CV9A 4XYFA 5BVFA 2Z8CA 2UZTA 4Q5EA 3MIYA 1UA2A 4FKSA 2FUMA 2R3IA 2CNUA 2ONLC 2X39A 3IW7A 3KL8A 2UW8A 4H58A 3BYOA 4R3RA 1PXLA 3L9LA 3OW3A 1RJBA 4ZZNA 3W2OA 5J1VA 4FL2A 4RX9A 3QCSA 4MAOA 3M1SA 2ZDTA 2BIKB 5DHJA 4S34A 2QR7A 3Q53A 3JVRA 4XUFA 2C3LA 3E62A 5IU2A 4FKQA 4AZFA 2IN6A 1OIRA 2QG7A 4F9AA 3SHEA 4M7IA 1NT2A 5CI7A 3RAWA 2VNWA 5F9EA 1H0VA 3ACKA 3WIKA 4OR5A 4R1YA 4TYHB 3UE4A 5L6PA 4J95A 3COMA 4RBLA 3VUGA 2OJGA 5DFPA 2YABA 3O7LD 2XH5A 3QKLA 5K9IA 3PLSA 2P2IA 2IW8A 1PMNA 2R0UA 2HXLA 3NW5A 3TNWA 4IVBA 3FHRA 5FRIA 2FGIA 3TTJA 2PU8A 1JSTA 4OBOA 2YCFA 4F9YA 5GNKA 5KBRA 3WF8A 4GUEA 3U9CA 3QD3A 2YM6A 3FPQA 3CTHA 5HBHA 4ZLYA 3RBWA 1W7HA 3FZ1A 4EQUA 1U59A 2BILB 2WMUA 1CDKA 4FKLA 4GG5A 5FTGA 1OBDA 3CPBA 4FSRA 3ODYX 4N6YA 5GHVA 2ITTA 3CKWA 3EKNA 3HP2A 4NT4A 3GNIB 4JIKA 4H3QA 4O0SA 4FSQA 4J97A 2HAKA 4DITA 3MFSA 3D9VA 4I5HA 3SRVB 4A9RA 2VTOA 4QO9A 4PNIA 4M69A 5EM7A 3OXTA 4DGLC 1J1BA 2W1ZA 1M7QA 5M51A 4XG3A 3MJ2A 5CVGA 5A4CA 3PJ1A 4UMTA 3V8TA 3ZU7A 4DH8A 4FVRA 3NUSA 3ZRKA 3MV5A 2CJMA 3CQEA 4LQMA 4X3FA 4GUBA 1OPLA 5GJFA 3W32A 4GKHA 5EOLA 4BKJA 2Y8OA 5JGBA 4XG9A 3HGKA 4L53A 4HPTE 3MS9A 2C6OA 3CJGA 4TYJA 3PXZA 1J1CA 1GIJA 2GHGA 1ZYLA 3VBQA 3NNXA 1WMKA 4CSVA 2PVHA 3KU2A 2R3RA 4LUEA 2HOGA 1FINA 3E8DA 2C0TA 1KUTA 4R7IA 1CKPA 4S30A 2SRCA 4MEDA 3VBVA 4XCUA 3GU7A 3ZMMA 3LHJA 2ETRA 1DS5A 2JDVA 3UOJA 3NIZA 3PUPA 1I09A 1O6YA 2ESMA 3KC3A 4ANNA 2VTNA 2BZHB 3TKIA 4BR3A 3AGLA 4F1TA 1WBPA 4I6BA 3NLBA 4RWIA 3VF8A 4ZS4A 1E1XA 3VWAA 4PPAA 3BU5A 2DQ7X 4HZSA 3ZEWA 5IKWA 2B7AA 3MPAA 4PTCA 2J0KA 4JX7A 4B6LA 5L6OA 2KULA 2Q83A 3KF7A 4XNEA 1B6CB 3FQEA 4UB7A 4BZOA 2VTRA 2O63A 2OJIA 3DS6A 4MWHA 1STCE 5HESA 4MBLA 2AC5A 3HDMA 4F7JA 4NU1A 3KGAA 1PXPA 4QOXA 4ALUA 4DGMA 4NSTA 2B4SB 2G2IA 4DFUA 2R3PA 4IM0A 5I9ZA 5FXQA 2JDSA 3F61A 1E1VA 1KE5A 3GFEA 5CS6A 5ANEA 4O1PA 4ACCA 4MVFA 4Z7HA 3BGZA 4XP0A 5DA3A 4YLLA 4CTCA 3E88A 2QODA 3EN7A 4G34A 4AFEA 2WTCA 4BDFA 3RM7A 5CYIA 3II5A 3F88A 3BYUA 3BYSA 4IC7A 2XK6A 4HOKA 5G1XA 5KMOA 3ATSA 2VTIA 2AYPA 1PYEA 3O8PA 2I0YA 5M53A 4PDYA 3OBGA 3IOKA 5FD2A 1G3NA 3ZFYA 4BL1A 2RG5A 2VWXA 4W4YA 5CXHA 3G15A 3EZRA 3TKUA 3BLRA 2Z7LA 4MKCA 5EDPA 4X6RA 1U5QA 3DLZA 3BU3A 3TJCA 1XWSA 4ID7A 2GFCA 2RSVA 3BEAA 4LV8A 5AX3A 5HE3A 2G15A 2V5QA 2YZAA 4QTCA 3FXZA 4BICA 3QTXA 2W06A 3F5GA 3GVUA 4BIDA 2V7OA 4D2WA 3RK9A 4FIHA 2JLDA 2XYNA 2O0UA 3KXMA 4Z7GA 1Y6BA 2VWBA 2ONLA 3K54A 4UWBA 2YEXA 4KINA 3UG2A 1ZYCA 3E7OA 5GZ8A 5IH6A 3R71A 3F2NA 3OT3A 1M14A 3GC9A 2HELA 2R3NA 1R39A 4YHJA 4EOJA 4CG8A 1AQ1A 3EOCA 4FODA 4YHFA 3ZOSA 4IH8A 2F57A 5DBXA 5H8EA 5HLPA 3FMMA 4FTCA 3NCGA 3IGOA 2BHHA 3QC4A 4UMQA 3W8LA 4QMOA 5BPYA 4DCAA 3DKOA 1Q61A 3MA6A 4PMTA 4TNBA 3R7OA 2ACXA 1XJDA 4ASEA 2Y4IB 5A6OA 4Y5HA 2EXEA 4QMUA 2H6DA 5JK3A 4C59A 4IQ6A 3ZLWA 3KK9A 4YUQA 5EK7A 2DYLA 4PDOA 2JIUA 4P7EA 3A61A 4ZY5A 3PJ3A 3W18A 3A7HA 3UZTA 3ENHA 4BCGA 2C4GA 2XNNA 2JBPA 4U8ZA 4FVPA 4I94A 2PHKA 4QMNA 5CEPA 3V3VA 3C5IA 2UW0A 4CTBA 1J7UA 5CY3A 3UBDA 3P4KA 3W33A 2YAAA 4W8EA 4NKSA 5EFQA 3KMWA 2OI4X 3A8WA 4OTFA 5BYLA 2QOBA 3ERKA 4PP7A 3LFSA 4L3JA 1ZMUA 1LPUA 4F6WA 2B53A 2WMTA 2UVYA 2HZNA 5HO6A 2IVVA 2R4BA 3RK5A 3FKOA 4FG8A 4FTRA 1PMUA 4G3DA 4C37A 4HVSA 1R1WA 1YDSE 2PSQA 5CF4A 2WOUA 5BUIA 3FLYA 4RA4A 3NWWA 5CANA 4GW8A 1HCKA 2PL0A 3IW4A 3BE9A 4HJOA 3MY0A 4CD0A 3O96A 2EB2A 3PSDA 3WZEA 2C6LA 2OXDA 5ANGA 4D2TA 3UVPA 4G31A 4YMJA 3LPBA 3FC2A 3FMLA 3FYKX 4B8LA 3NRMA 4F1MA 3OTVA 4E6QA 5AR3A 4RVLA 3AC4A 4BCNA 5KHWA 2F4JA 2GNHA 4DH3A 4BBMA 3A7FA 3FLSA 4UZHA 1Z57A 5HQ0A 4OAVB 3QHWA 4FKTA 3CY3A 2ZV9A 3DJ6A 4G2FA 2R64A 3L1SA 3Q60A 3CKXA 3ANQA 1IA8A 1NVQA 4K0YA 4AXAA 5CT0A 3R8ZA 2I6LA 4DFYA 2X7FA 3UO5A 5ICPA 3KEXA 4WNMA 4A4OA 4NYEA 4EH2A 2R3LA 4JBVA 2OICA 2PWLA 3KB7A 4ZSLA 3ATTA 4FKOA 3UVQA 4K2RA 3DAJA 4ERKA 4O38A 4FIFA 2ZM4A 5L8KA 2FVDA 2VU3A 2PE2A 4FIGA 2KTYA 4E6DA 4L7SA 3VBWA 3MTLA 2W1HA 3ORZA 2YJSA 4DTKA 4GH2A 1R78A 1S9IA 4Q2AA 2GNFA 3EFLA 3QQHA 3IK3A 2X9FA 4A4XA 4O1OA 3OWLA 3BRBA 5CAUA 5KMNA 2ZB1A 4OTPA 3FEGA 2EXMA 3PRIA 4QPMA 5DRBA 4IMYA 4PPBA 3VW8A 2XM9A 4XBUA 3UODA 3HV5A 3T9TA 3QU0A 2R0IA 4BTFA 4YC6A 5D7VA 1XR1A 2GSFA 2XBAA 5M56A 3KULA 2BRNA 1AD5A 3AMAA 3PPKA 3NX8A 3G90X 4P2KA 4XV2A 4PTEA 4ASZA 4E6AA 3OUNB 1SNXA 4IW0A 4YZ9A 1SYKA 2IJMA 3R00A 4QQCA 3RAKA 3WARA 4YJRA 1WAKA 2BAJA 2XRUA 1JBPE 4U41A 5T6KA 4HVIA 3PVUA 2WPAA 2JC6A 3BZ3A 3QWJA 5JKGA 4FUXA 3Q9WA 4I23A 2GCDA 2B9HA 3DK3A 3SXSA 3UVRA 5LMBA 4IWQA 5J5TA 3OCSA 2JITA 3TIYA 4BCKA 5AAEA 3F2RA 3KMMA 4EOMA 5CQWA 3C7QA 3D5UA
chains in the Genus database with same CATH superfamily
4BWXA 3DBQA 3H4JA 5CENA 1H01A 1OGUA 3A4OX 5ANDA 2YERA 3FQSA 4WG4A 1DI9A 4MH7A 3TV4A 2XYUA 4V05A 1W98A 3DXPA 3H10A 5HO8A 3Q6UA 4HYIA 4YGAA 3FI8A 2WTDA 2UZBA 3SG9A 5EHYA 1W83A 2VWWA 4D4YA 2OO8X 3COKA 3DQXA 1YXXA 4JIAA 4M8TA 1BKXA 3LXPA 2WMVA 5HNBA 1LR4A 2XNEA 4EH6A 5AP4A 3W1FA 2WXVA 4C62A 1ZMWA 4EH5A 1WVXA 1XH8A 4IWOA 3QA0A 4LRMA 5HLNA 3U6HA 4IBMA 4ACGA 1U54B 4ACMA 3DB6A 3P7BA 2XJ2A 4OT6A 3HMIA 4RIOA 5LVPA 1ST0A 1OUYA 1KE8A 3C50A 4QP7A 1H07A 4DINA 4RFYA 4EOQA 3QX2A 3IQ7A 2VN9A 4FTAA 4RWJA 3UTOA 3S2PA 3UIUA 4YR8A 1OL6A 5FP5A 3PE1A 3GB2A 4EUUA 3PWYA 3H0YA 4QTDA 3NR9A 2I1MA 2OW3A 4PNKA 1YQJA 3QCYA 1YDTE 4OTIA 3POOA 2P3GX 4I0TA 3DT1A 3U87A 1W2CA 4EWQA 4KKHA 1DM2A 2FSMX 2BUJA 4C3RA 4DT9A 3MY1A 3L8SA 2WEIA 3CCNA 4BBEA 4ZTHA 2W4JA 4D2RA 1OBGA 5AJQA 5B2MA 3MDYA 4QYFA 4O0WA 2Y0AA 3R2BA 5LCKA 2GTNA 1KSWA 5IMXA 3U8WA 3IPHA 1LEWA 2OZAA 2ZV2A 3P5KA 5H8BA 2QLQA 4YURA 3NUNA 2JAMA 3OWKA 5IA2A 4DBXA 4YPDA 5T68A 2JEDA 1A9UA 2QHNA 4NW6A 5JGDA 4FYOA 4BCHA 1HOWA 2F7XE 4A07A 4RIWB 4EWHA 3BE2A 5JFWA 4NIFB 5AUTA 2PE0A 4XOYA 2NYAA 1Q5KA 4YTHA 5EI8A 4UX9A 4A9YA 4BHNA 5IA0A 1YOLA 4B7TA 5AADA 5EW8A 1SNUA 4WD5A 5FXRA 4FGRA 4I20A 3FL4A 1G8SA 5CX9A 3LJ1A 3Q2MA 4R1VA 1YKRA 4FV9A 4ZXTA 2OIBA 4C4FA 5FXSA 5L8LA 4AAAA 3HYHA 4AGCA 4XEYA 3ETAA 5E1SA 2JAVA 1AGWA 1KV2A 4EHVA 3VQHA 5JQ5A 4FG7A 5IPJA 2OZOA 4XLIA 3AKKA 5DVRA 5DNRA 4CGAA 4BCFA 3OCTA 4IFGA 4U79A 4KD1A 3D5WA 4D58A 4FOBA 2GQGA 3F5UA 5I9WA 1XO2B 2V62A 4DF3A 4MTAA 3HZTA 5ACKA 1YXUA 4IVAA 5EQYA 2WMQA 3HLLA 2IO6A 5IA3A 3RWQA 2X1NA 1R3CA 3JYAA 4QMSA 3H9FA 5HD4A 4OTHA 5F20A 4BF2A 4R7BA 4DHJA 3VBTA 2WQEA 4CZYB 4KS7A 4ZJIA 4F7LA 3GUBA 4JXFA 3EFKA 1APME 1DAWA 1QPCA 4CRSA 5HKMA 3R9DA 4EC8A 4IZ7A 5CEQA 2O8YA 2PMNX 4IHPA 3ZXZA 2DUVA 3JR1A 4C4IA 3QUPA 3G5DA 3WYYA 1H1RA 3I5NA 4JRNA 4RZWA 4AA0A 4FVQA 5BV3A 3LJ2A 4C35A 4FR4A 3LLAA 5AM7A 3VVHA 2X0QA 4RLLA 3GU4A 4A9UA 5HO7A 4KIOA 2VZ6A 5M57A 4YJQA 3CR0A 4A4LA 4J8NA 4FNXA 4XG7A 1WBNA 4OUCA 3RJCA 1M17A 4EZ5A 5HZNA 4DHFA 4J98A 5IMEA 4QQ5A 5H2UA 4QMLA 2UVZA 4NEUA 3O0GA 3ZSIA 3T3VA 3MESA 3DTWA 4O2ZA 2WTKC 3NYVA 3KY2A 3QKKA 4KWPA 4CNHA 4YC3A 5HTIA 5LCJA 2UZDA 5EG3A 2REIA 4LMUA 3VHEA 2P0CA 5HNGA 4FIIA 3AXWA 4APCA 2FYSA 5M4CA 3OD6X 4GYIA 4X2GA 3C51A 3M42A 3O71A 5C1QB 1JWHA 4FKJA 5E1EA 5IDNA 3SC1A 4GCJA 3OF0A 5IH4A 1W82A 3U6IA 2VNYA 3JS2A 3TG1A 4DFNA 4QEBA 4KKEA 5LQFA 5AV3A 3KRLA 3ORXA 3NUYA 3P7CA 4G6NA 4F1OA 4QMWA 3C4XA 3RPRA 3RAIA 3MY5A 2QVSE 4FOCA 4R5YA 4MNEA 2XMYA 4D4VA 4MBJA 4JG8A 4I22A 2H8HA 4PL3A 2GHMA 5J95A 3E3BX 2CGWA 3NAXA 4H39A 4AGDA 2W05A 3C4WA 1OMWA 4FTMA 4AT3A 4OTRA 4WUAA 4EOLA 5IUHA 5EW9A 3BL9A 4M84A 3PWDA 1Q99A 1KOAA 2BR1A 3JUHA 2PYWA 4I92A 3OW4A 1REKA 3PZHA 4ALVA 5AWMA 4O91A 4AOIA 4J1RA 2NPQA 4CZTA 4EHGA 3EN9A 1IRKA 2B1PA 4NM0A 1KE6A 4O0TA 4IB3A 4O6LA 3R8LA 3S0OA 2BTRA 3EJ1A 1A06A 3EQBA 4I1ZA 4I41A 5CEOA 3BQRA 4BCPA 2HCKA 1UV5A 5CT7A 1ZYJA 2YWPA 4CFXA 1YDRE 4M3QA 1OIQA 3KVWA 2ETKA 3BHVA 4ZS0A 3ZC6A 5BVEA 2PVMA 3NNWA 2YM8A 3D2IA 4FRFA 4RT7A 5BVKA 5IDPA 2QO9A 2Z7RA 4F4PA 4ZMEA 4E4MA 4U40A 1UU3A 3QCXA 5HG9A 4ZLZA 5CAOA 1UNHA 2O64A 3FXXA 4QMYA 1JKTA 2EXCX 5FTQA 5E90A 4DTBA 3H30A 3UJGA 1KOBA 3PIXA 2CLXA 4FSMA 4EH4A 4FK3A 4FT0A 4IVCA 1FGKA 4JBQA 4ZTMA 2UW7A 4CFVA 3W0SA 1P5EA 3A62A 2R9SA 2WAJA 3HEGA 3LCKA 1YHWA 2C0OA 5ANKA 5KMIA 5E8WA 1K9AA 3KXGA 2A2AA 2YIYA 3QC9A 4RIXA 4YBKA 2ERZE 3F69A 2XIRA 3DA6A 4RIYB 3GCVA 2C5VA 4E5BA 1UNLA 2P4IA 2NP8A 4HGEA 4KRDA 4DFBA 1PKGA 3TZ7A 1BL6A 1RE8A 4XV3A 5FDPA 4YNEA 2PMOX 1FVVA 4TW9A 3V5PA 1Z5MA 4G6OA 5BVDA 4IB0A 5CZIA 3NW7A 3EKKA 3R9OA 3QTWA 4AT4A 5EYMA 5FM3A 4BCQA 1ZOGA 3QCQA 5D10A 1GAGA 5HCYA 3W2CA 2WQBA 3OC1A 4DEHA 1H1WA 4KIKB 4CQEA 3SAYA 4RIYA 4ACHA 4WG5A 2IVSA 3BEGA 3C1XA 3QD2B 2C3KA 4AOTA 2QURA 5DI1A 2QOOA 3S3IA 5ETCA 4X6QC 5CF8A 2R3JA 3DGKA 4QMZA 2X8IA 3CY2A 3FMHA 2O2UA 1Y57A 2GNIA 3MPMA 2IW6A 3E64A 3GENA 3TDWA 3AQVA 3FMKA 5ETFA 1MQ4A 2XCKA 2ZDUA 4U80A 2RKUA 4X3JA 4EORA 5AA8A 3UQFA 4D2VA 3MH1A 4FV5A 3KCFA 5IEVA 5K5NA 1J7IA 1OECA 2GQSA 3UZRA 4KIKA 3PXKA 4FIEA 4ITIA 3V5JA 2PUPA 3GC7A 5DT3A 3BHHA 2XAOA 1QPJA 3VONA 3DKCA 4HVDA 2IVUA 1WCCA 5EYCA 4F6SA 3P78A 4H3PA 3PUFC 2O5KA 3UPXA 5JN2A 3W0OA 5AAFA 5TKDA 3WYXA 3QXOA 4NFNA 4GEOA 4O96A 5CEMA 4FX3A 3NYOA 2BKZA 1HCLA 5L2TA 2XNBA 4WT6A 2W5AA 3A7IA 4J7BA 4XP2A 4R7HA 4FV4A 1XMLA 3QRTA 1XBBA 4MCVA 1NVSA 4OTGA 3I79A 4TWOA 3VS5A 2NRYA 3RPSA 3ZC5A 3HP5A 2WQNA 2AQXA 4YZDA 4C58A 3BI6A 3ALNA 1JKSA 1FOTA 4HPUE 1XH4A 5DYJA 4NFMA 3TXOA 1GJOA 3QGWA 4CCBA 4F7NA 1U46A 3V5QA 4FKWA 4OW8A 4QT1A 2QLUA 4XG8A 3DNEA 2VTTA 5DWRA 3W10A 2VO7A 2YLEA 4UY9A 3K3JA 4ANQA 2XNPA 2PY3A 3PVGA 4BZDA 4EBWA 4MXYA 3UYSA 5IA4A 3TACA 5AR5A 3NAYA 3AC2A 4LGHA 2OKRA 3HUCA 2W7XA 1O6LA 4C33A 3MB6A 2JKMA 2OIQA 4FNWA 2VV9A 2XARA 4FE2A 4YJTA 2HWOA 3CGOA 4GSBA 3BLAA 5HVJA 2JIIA 1A48A 4NUSA 1V0OA 1JAMA 3E8CA 3FLZA 4C34A 3BHUA 1FMKA 3TCPA 4YJSA 4U3ZA 5J9YA 5AIRA 1BX6A 4ANMA 3OOGA 4WNPA 3AD4A 3AMBA 3JPVA 4WIHA 4TYHA 1ZOHA 4QD6A 4TWNA 4BYIA 3OFMA 3AT3A 4CV8A 4IZYA 4CMOA 4TL0A 4WKQA 3A60A 3QAME 4I6FA 3C4FA 3EHAA 3DQWA 3LFFA 3L8VA 2C69A 2XIKA 3ORKA 2J90A 5HVYA 4BGHA 5JSMA 3TEIA 3C5UA 5A4EA 3QZGA 2IZRA 3V6SA 4RSSA 2CPKE 2WD1A 5C03A 3QALE 5EQPA 2QU5A 3VS3A 3PA4A 2WMWA 4U45A 1UWHA 2BZIB 3DCVA 3EL7A 3GCPA 3HV4A 3MVLA 3Q5ZA 3VULA 2XNGA 4C61A 2OIDA 4PUZA 4AA4A 4NWMA 1VJYA 1ZYSA 3O7LB 2WTWA 4IAFA 4ZTRA 3V01A 1DI8A 4KIQA 4LGGA 4M14A 3KXZA 4U81A 5CSVA 5AP0A 5KKRB 2IZTA 5KMMA 4G1WA 4YO4A 4ORKA 4RQKA 1ERKA 4AU8A 4F9WA 2ERKA 4DAWA 2ZYBA 4IDVA 1PF8A 3C4EA 2GS2A 3ELJA 5E8VA 3FY0A 3FZPA 3PA3A 5C26A 4ZLOA 1JVPP 2ZM3A 3U4UA 4GYGA 1OI9A 2RFDA 3SRVA 3RALA 3P1AA 1OM1A 3TJDA 3BIZA 4J53A 4QRCA 3SXRA 3PG1A 1NW1A 5BMSA 4H3BA 4FTOA 4FZDB 2VO3A 3SD0A 3DPKA 4QP4A 4CKIA 3IDPA 2X0OA 4O7WA 3CGFA 2XK9A 3OWPA 3VS4A 5TO8A 1H8FA 3I6UA 3QQJA 3G9LX 3F3WA 2CN5A 2OJ9A 4L44A 1LEZA 1SVEA 3BX5A 5CVHA 5M44A 3CQUA 3AC8A 3EB0A 3HMOA 1NVRA 5JMSA 4CFFA 5KCVA 4KAOA 2XK3A 2RIOA 3DOGA 3TZ9A 1PMEA 5CZHA 5AA9A 3AKLA 2F49A 2X6EA 1GZ8A 3S00A 3R8VA 3WOWA 2QOKA 4D0XA 4IDTA 2OK1A 2XAMA 4FICA 3HECA 3F3UA 3FV8A 4MQ2A 1OB3A 1WVWA 2AUHA 2CN8A 4PRJA 1ZZ2A 4L7FA 4DH7A 4LMNA 2X8DA 2ZMDA 3F6XA 4BCJA 5C27A 3D94A 3C13A 4RVMA 4TTHB 5BQ0A 1H25A 5HG8A 1UKHA 4GFOA 3TM0A 2OFUA 4JAJA 3UQGA 4QNYA 3AC1A 3QRUA 4O7NA 2YM4A 4BGGA 4BI0A 3VC4A 4PMMA 3CC6A 3BELA 3EN5A 2CGXA 4FSNA 4CFNA 5D12A 4ZIMA 3BHTA 1P2AA 3IECA 3Q96A 4YPSA 4BJJA 3PP1A 4FTJA 3GGFA 5FG8A 4AW0A 2R5TA 5FWKK 2YLFA 3ZLXA 4MXXA 4BZNA 1YXVA 3GU6A 3L9NA 3TIZA 4O22A 4RJ5A 4ENYA 4DDGA 3K5UA 3KRRA 3NGAA 4BHZA 4D1XA 1PYXA 3F66A 3JXWA 4HCVA 3VRZA 3RM6A 3ZUVA 5TT7A 1MQBA 3VQUA 2VX1A 2PTKA 1YXTA 2UZNA 4E7WA 5IQAA 3FZRA 4M97A 4D1ZA 4E1ZA 3LE6A 3WE8A 4RC2A 3N51A 2JKKA 2X7GA 3MFRA 4R6VA 3PXFA 3NUAA 2XIYA 5K3YA 3QWKA 3NFGB 2GTMA 3CE3A 4TN6A 5HNIX 3BYVA 5M09A 3I0OA 4WBBB 3QKMA 2OH0E 5CEKA 4V01A 5IEYA 2BROA 4BCOA 4JOAA 2YFXA 5DRDA 4F65A 5CASA 3F2AA 5HCXA 4ANBA 4IAIA 4FKIA 4W9WA 4CEGA 2CKPA 5AX9A 3FZOA 5D1JA 3DBEA 4I93A 3PP0A 4CKJA 4W4VA 4I21A 4D2PA 4C8BA 3TUCA 3HA6A 2PUUA 1TKIA 3FHIA 4BDJA 4CFUA 5JT2A 2QOCA 3I6WA 3R30A 2CSNA 1CKIA 2QHMA 3NUXA 3R7IA 3AC5A 1MRUA 4YTCA 3KQ7A 4MX9A 5GJDA 3U51A 5IUIA 4F9BA 4RC4A 5B7VA 2ZVAA 1CTPE 4NTTA 2GQRA 4D9TA 3PXYA 5KZ0A 3P7AA 4V0GB 4G17A 3G9NA 5E7RA 4EEVA 1OL7A 2G9XA 2PMLX 1WBWA 4G3GA 2B9IA 5I3OA 4YSJA 2W4KA 3OHTA 2CGVA 5LWNA 4O0RA 5ANIA 3TN8A 2AEGA 1GY3A 5F4NA 4X2KA 4NKAA 4FT9A 4LOPA 2Y9QA 3TL8A 4U0IA 3V8SA 5JFVA 2CKOA 2YN8A 4O83A 4ZK5A 2WTJA 3KRJA 4XLVA 4ASXA 5BX0A 3E8NA 2B9FA 2ITYA 2Z7QA 4ASDA 4FNYA 1ATPE 3PZEA 2J5EA 2IPXA 1PXOA 3KXXA 3RNIA 4MBIA 2BPMA 3BV3A 3Q32A 4ONAA 2A0CX 3MPTA 2JIVA 4KBAA 2WFYA 1L8TA 4PQNA 2JDOA 2HWPA 3C4ZA 5EI6A 3ORLA 4WSQA 3FSKA 4AXCA 2VGOA 3UMWA 1QMZA 4RVKA 3QQGA 1M2PA 5DH3A 2GS7A 2YA9A 3EQRA 4WA9A 4FA2A 2QI8A 3KA0A 4YTFA 3ZM4A 4TPTA 4G6LA 1UKIA 4RJ8A 2GU8A 2ZV8A 3ZONA 2WQOA 4UMUA 4D5HA 2HZ4A 3IONA 5CAQA 2G2FA 2JGZA 1PJKA 1Y6AA 4Z3VA 1IA9A 1PXNA 3V5WA 4BDHA 4E4XA 4F6UA 2CNQA 3NW6A 4LG4A 4MXCA 4FEVA 5AUXA 1YI4A 4C3PA 4C36A 4EK8A 3P9JA 3G33A 3SDJA 3Q5IA 3MGYA 5ACBC 2WKMA 3FUPA 1XBCA 3VUDA 4BVUA 4ZSJA 1FVTA 1P4OA 3R7GA 2JD5A 4GMYA 4D28A 3VO3A 2YM5A 3OVVA 1ND4A 4W8DA 3CIKA 3CXWA 4ZTNA 2XP2A 3FSFA 3O50A 3OROA 4XG4A 3PY0A 4D4SA 3RPVA 2XJ0A 3HMNA 4D55A 4C0TA 5A6NA 2WMAA 2ITOA 4EONA 4NZWB 3LMIA 2IZSA 5F1ZA 3W2PA 2I0VA 4JQ8A 4C38A 4K1BA 3TNHA 4ENXA 4XP3A 4YJNA 3R7YA 3O2MA 2WOTA 2PVKA 3QHRA 4AZSA 4CFWA 2VTHA 4EZ3A 3FAAA 4RJ6A 3HAMA 4B4LA 1M2RA 1CSNA 3P0MA 3ZUUA 3CS9A 3VS0A 4ZZOA 3R9RA 4EOIA 4BRXA 2F7EE 2YIRA 3R7EA 4DE4A 4K8AA 4FV1A 4DFZE 4QQTA 3GQLA 5CALA 5AP2A 4JLCA 1ZY4A 4EJNA 3KN6A 4AF3A 3NUPA 4OTDA 4X0MA 2R3OA 3RHXA 4D5KA 2YZLA 4DTAA 2V7AA 4QPSA 3I7CA 3QUDA 3PY3A 4Y85A 3LFBA 4LV7A 3IW8A 5AR8A 4N57A 3DKFA 1YWRA 1UU9A 2XRWA 3MN3A 3CP9A 3Q9YA 2BCJA 3QRJA 2IG7A 2XEZA 3A2CA 3CD3A 4RJ3A 4F70A 2RFEA 3BBWA 3O51A 2C1BA 3EH9A 3PSCA 5L2IA 1DAYA 2H34A 3C9WA 3ZRLA 2I0EA 3MTFA 3IO7A 4GRBA 3D4QA 4FGBA 3L8PA 3EQCA 2Q0NA 3D5XA 5I9YA 4WOVA 5HG5A 1U5RA 5HU9A 3TI1A 1YRPA 2QONA 1WBSA 4GT3A 2UZLA 2QOQA 4EYMA 4E4NA 4FUYA 4XH6A 2F9GA 2VWIA 1OVEA 3VHKA 2E9UA 4BDEA 3DXNA 2GNJA 4LYNA 3G0FA 4OGRA 1JSVA 2PVRA 2WTVA 3GOPA 4CT1A 2R3GA 4DEAA 3AT4A 2C5YA 3R02A 4BTJA 1Q3WA 4ZEGA 4ZOGA 3EYGA 3OP5A 5AUZA 3ML1A 2QOLA 1OITA 3RKBA 4L6QA 3G6GA 4M12A 2IEWA 5AAGA 3W0QA 5D9HA 3BLQA 3HV3A 4PP9A 5LARA 2PPQA 3HMPA 4Q9ZA 5J9LA 4IC8A 1NY3A 2XKDA 4NJ3A 2O3PA 2PZ5A 5J7BA 4ZY4A 4CCUA 1V0BA 4RJ4A 5CF5A 5LXMA 1OKZA 3ID6C 2W99B 3CTQA 1J91A 4L42A 4FF8A 5DR6A 4M13A 4E73A 1U54A 1QPEA 4GJ3A 4UN0C 4WBOA 3QL8A 4IEBA 4IX4A 3R8PA 2YIQA 1WFCA 3HAVA 2HW6A 1SM2A 3DBFA 3NUUA 3G2FA 1ZMVA 5DEWA 1H26A 2NNWB 3W2RA 3KKVA 3WILA 5JGAA 3QTSA 3LVPA 2G2HA 4A06A 3EZVA 3ZXTA 4E26A 2QNJA 2OF4A 1PXIA 2Q0BA 3TV7A 5B2LA 1H27A 2XK8A 4GFGA 4LRJA 5HBEA 4C2WA 4PMPA 3PLAE 4QMVA 3D15A 2BAKA 4K6ZA 2B9JA 2XF0A 4CFMA 4O7VA 3DLSA 2PVFA 3MSSA 1IEPA 4PV0A 3O8UA 2BRMA 3QTIA 3R83A 5AP6A 4AZEA 2FH9A 4MXAA 5TE0A 2HYYA 3VBXA 4BTKA 4DGNA 3PTGA 4RWKA 3ZHPC 3TNPC 1Y8GA 3LM5A 3ORNA 1FQ1B 2UW9A 5E8ZA 5H3QA 3W55A 3ZLSA 3EIDA 2X6DA 2BAQA 3C0GA 2G1TA 2RFSA 2XIXA 4FTIA 4IZ5A 5J7HA 5HX6A 3F5XA 3GU8A 3Q3BA 2C3JA 3I7BA 4RIWA 4NIFA 4DFLA 4GKIA 4DHIB 1IR3A 4W9XA 4DC2A 2C5NA 4DGGA 2EVAA 1MP8A 1MRVA 1LP4A 4BDGA 1KE9A 2YM3A 4EYJA 3EQHA 3ZCLA 5E92A 4UMPA 3THBA 5IZFA 3QQLA 4IJ9A 2J51A 5J79A 1I44A 3BU6A 5EDQA 3RCDA 3DV3A 3W8QA 3G6HA 3QTRA 3FLWA 5KMJA 5DMZA 4XV1A 3RZBA 1BLXA 5LVLA 2ITVA 3HV6A 4EH8A 1OL1A 2YM7A 4IACA 2W4OA 4KKGA 4RMZA 3WZUA 4RQVA 3SXFA 2OFVA 1GIHA 3RZFA 1J3HA 3ULZA 2W1CA 2BALA 1Q8TA 5CAPA 4S2ZA 4WRGA 4DDIA 4MXOA 3QFVA 4F99A 4O7SA 1Q8ZA 1B39A 4II5A 5KE0A 4W4WA 3AKJA 4DFXE 4FC0A 3EYHA 4GL9A 3WZKA 4FEUA 4BB4A 1VEBA 5EW3A 3UP7A 4L46A 1IG1A 1KE7A 3LOKA 2FSOX 5KBQA 5CU4A 4FTUA 2Z60A 3V6RA 5JRSA 2HY81 2J50A 4HYUA 5FEEA 4YJUA 4NM3A 5DR9A 5FP6A 3Q4ZA 5CNOA 2ZJWA 3UDBA 1IASA 3WF7A 2P2HA 3DTCA 5L2WA 5ITAA 4KSPA 3ORTA 3BL7A 2DS1A 4AQCA 2FSTX 5LVOA 5HORA 2X7OA 3FJQE 5DPVA 4KABA 4XHKB 5DT0A 3LLTA 4YZNA 3SOAA 3E3PA 1YHSA 5HGIA 4FTNA 4DEDA 4NW5A 3CJFA 2C5XA 1JLUE 5J8IA 1YWVA 5D7AA 2PULA 2J6MA 3GI3A 3MH2A 2XA4A 3FI2A 3NPCA 4GK2A 2PE1A 3POZA 1SVGA 3DKGA 5F95A 4ACDA 4DLJA 4GFMA 4L45A 1XBAA 5JQ8A 3KRXA 3MVMA 1BUHA 2UW5A 3Q6WA 3R01A 2H9VA 4IE9A 2WMSA 3M2WA 2ITWA 3EFWA 3QLGA 3FWQA 3LJ0A 2ZV7A 4MHAA 4Y72A 4Y8DA 1YI6A 3A99A 3IS5A 3ZDUA 4U5JA 1Q8UA 4S33A 5BYZA 3LXNA 4FZ6A 4O7YA 4KNBA 5IQIA 3R8UA 5EDRA 3RVGA 2XUUA 1H24A 2W1FA 3UOHA 1ZLTA 1YVJA 3V5TA 4CYJA 5CF6A 2QR8A 2VUWA 5HD7A 3R1NA 4FI1A 1Y8YA 4RZVA 4QNAA 1SVHA 4AN2A 5HI2A 4FV6A 1K3AA 2A27A 3FY2A 4FV3A 4FZFB 4ZP5A 3E5AA 3KVXA 3CSVA 2CKQA 3IDBA 3UO6A 3PA5A 2Y7JA 3PIYA 3AG9A 4D4RA 4IXPA 3ZO2A 4AXDA 2XKCA 5A54A 4FTKA 3E92A 3HRCA 1Q3DA 1UU7A 3R21A 4K11A 4E3CA 4ZJJA 4CLJA 2AC3A 2CDZA 5I9XA 2GFSA 3QYZA 2WU7A 2W5HA 2BTSA 3VRYA 4IX3A 4EQMA 5I4NA 2VD5A 5FDXA 3ULIA 2WMXA 2XEYA 5E4HA 2GS6A 5HTCA 1BI8A 1K2PA 3LFDA 4N0SA 5A4QA 2F2UA 1RQQA 2C1AA 4FBXA 3NS9A 4J71A 4BC6A 1OGYA 1UNGA 2XZSA 5KO1A 3W16A 2G01A 3ET7A 4LRKA 4NH1A 4LM5A 3BQCA 1OKVA 4FV8A 4PL4A 2XM8A 4BCIA 4C02A 4DCEA 2J5FA 2R7IA 5KKRC 3SW7A 3ZYAA 5HEZA 5IQEA 4L8MA 3ROYA 1XH9A 2BFXA 4ALWA 2PUIA 3A7JA 4FKRA 2P55A 4ZSEA 3SLSA 4L52A 3RNYA 1BL7A 3GXLA 1JSUA 3ENMA 3HL7A 3ZTXA 4D1SA 3B2WA 3MBLA 4QMTA 4UXLA 3R1SA 1Q8WA 4PX6A 1VYZA 3S1HA 2X4FA 3FKLA 3MVHA 4JL9A 3TZMA 1WBTA 3HMMA 4JRVA 5L2QA 5T3QA 3DJ7A 2VTPA 5GINE 1PXJA 4FT7A 2ZM1A 3HVCA 3ZS5A 4DA5A 4B9DA 4C4HA 3O5AA 3UYTA 3GFWA 4WNOA 2XJ1A 3DK7A 4JX3A 4C7TA 5AR4A 1Y91A 3L9PA 4PL5A 1KWPA 3AC3A 4EJ7A 4GT5A 2JKOA 5E8SA 1ZXEA 3A4PA 1OPJA 4Z9LA 5BVWA 4ZJVA 3FQHA 4Y46A 5GZAA 4O7LA 4CXAA 2C0IA 3ROCA 1EH4A 1Q4LA 2E9NA 2RF9A 3RAHA 2QOHA 4QMPA 3RWPA 4O0VA 5IEXA 2I40A 5AV0A 4E93A 4YZCA 3LFNA 4HCUA 1M2QA 4UALA 2J7TA 4O7RA 4DGOA 3COHA 4M67A 4BIBA 3D83A 2XCHA 4JG7A 3VUMA 3DDQA 4OTQA 4D0WA 5L3AA 3R7UA 4ERWA 4D2SA 1T46A 3IW5A 2JKQA 3PG3A 4AG8A 4F08A 2V0DA 4YJVA 1REJA 2VTMA 3AGMA 3HRBA 1M7NA 4BIEA 4IANA 3VF9A 4X7QA 3IKAA 4O6EA 4QP8A 3RP9A 3GBZA 2X4ZA 1W0XC 3PY1A 4R3PA 3VS7A 4F7SA 3DAEA 4F0IA 3UDSA 3NYNA 5AR2A 1PXKA 2QKWB 2R2PA 3BYMA 5E8XA 2WIHA 4DT8A 2X8EA 1H1PA 2BRGA 2VWUA 5CSPA 3IDCA 4WUNA 5FEDA 2OWBA 3OEZA 4TYEA 5AP3A 5K0KA 3R0TA 2W1DA 4QP9A 3DB8A 4JQ7A 3OXZA 3RTPA 2WZJA 3CQWA 4FSZA 4AW1A 3N4UA 4Q9SA 4FZ7A 5A14A 5HICA 1FBNA 4EKLA 3C0IA 4C4JA 1MRYA 3LW0A 4EK4A 1TZDA 1Q41A 2X2KA 5CWZA 5C4LA 4LFIA 5CSXA 3LIJA 3SQQA 3TV6A 1P14A 4OBPA 2QOIA 4DBNA 4FEXA 4EHZA 3MWUA 3FBVA 3ZH8A 5LOHA 3UG1A 3VS2A 3QTUA 4IAZA 5ANJA 4FG9A 3RMFA 2OF2A 2VTAA 3BGQA 4LUDA 4P4CA 5CSHA 4IFCA 3WF9A 3TNQB 4ZSAA 4S32A 2C3IB 1Q97A 3WIGA 4BDIA 3UGCA 4NL0A 3E87A 3NSZA 3O8TA 2J0LA 4UV0A 3R2YA 3OG7A 3BGPA 4CMTA 1JKKA 4UWCA 4AE9A 1O9UA 4TXCA