4AN2A

Crystal structures of human mek1 with carboxamide-based allosteric inhibitor xl518 (gdc-0973), or related analogs.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
282
structure length
282
Chain Sequence
MALGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDEMANEFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPRPPMAIFELLDYIVNEPPPKLPSAVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
publication title Novel Carboxamide-Based Allosteric Mek Inhibitors: Discovery and Optimization Efforts Toward Xl518 (Gdc-0973)
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 282
sequence length 282
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2012-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4an2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4an2A01
4RC4A 1VYWA 4I4EA 4RWJA 3F5PA 1R39A 5B2KA 3ATSA 3NUNA 5JSMA 3ZLSA 2QOQA 4YU2A 4OAUC 4IWPA 1MRVA 1OBGA 4NFNA 5M08A 5L8JA 4O7TA 3ENMA 4FZ6A 5IA4A 5LCJA 1KSWA 4FSRA 3EQDA 3Q6UA 4HPTE 4H1MA 2YACA 4TNDA 3MFSA 2WTVA 5EYMA 1Q4LA 4O0WA 1FINA 4DBNA 2J0KA 3SHEA 3S00A 3FMNA 5CX9A 1HCLA 2QCSA 3GXLA 4IE9A 3VJNA 3AT2A 2BKZA 3VS6A 5M4UA 3SRVA 2PE2A 5CEMA 2XMYA 4YJUA 3FAAA 4R5SA 5HVYA 3FLSA 2WMUA 3E3BX 3FZPA 2FSMX 3QKKA 4C4EA 4DEHA 3EN4A 1DI8A 3DKCA 4KD1A 3O2MA 4TWPA 3HV7A 3THBA 2X8EA 4UWCA 2I0YA 3A7HA 2W9ZB 4F6WA 3C4CA 4YZMA 4HJOA 3TIZA 3RWQA 1YOLA 4Q2AA 5KMIA 4B9DA 3W18A 4DHFA 1CSNA 4QYFA 4NM0A 5TF9A 4FZDB 2ZM1A 3QL8A 4IEBA 5HIBA 4AA4A 4JR3A 2QQ7A 3QQLA 4RIXB 3ULIA 2VNWA 3SAYA 4NEUA 4EC8A 2W1CA 2NP8A 3GC7A 2JAVA 1OKVA 4HGLA 5AM7A 2Z02A 2PVNA 2QR7A 4JQ7A 1Y6AA 4I23A 1OIUA 2R3IA 2UVZA 2XB7A 2Y4IC 3EZVA 5HE1A 3R8ZA 3RK9A 2I0HA 5L2WA 4KIOA 2IWIA 3I7BA 5KZIA 4DFZE 3UOJA 2BAQA 1GZOA 2H6DA 5DRBA 2J0MB 4QMLA 4GUEA 1B6CB 1PMUA 3UC3A 5LCKA 2JKMA 4ZY6A 4QTDA 5HLPA 4FT3A 1U5QA 1G3NA 3L9LA 3MFRA 2EWAA 3IGGA 3ORLA 4FOCA 3MY5A 3MI9A 1UVRA 2V22A 2JFLA 4FI1A 5CVFA 3ZO2A 3OT3A 4F7NA 3MESA 4BY9E 5EM5A 4EJ7A 4JLCA 1T45A 4FGBA 2GNLA 4QTEA 3C4FA 4TTHB 5LVPA 3WZDA 5AA9A 3QHRA 3LFEA 1E1XA 3BIZA 1KE9A 4JS8A 4EC9A 3LCOA 4KUJA 1UWHA 1OL2A 3QXPA 5LWNA 3E62A 4J71A 4YO4A 4PTEA 4RJ4A 4IM0A 3I4BA 2OJIA 3Q52A 5DFPA 3KCFA 3Q4ZA 1QCFA 5HQ0A 3R30A 3R1NA 2KTYA 5JRSA 3FXWA 3OUKA 1WFCA 3Q4TA 4F9YA 1NT2A 2VWIA 2X7OA 2C0IA 4O2PA 4RZWA 4XLVA 4HVGA 3SGCA 2XNMA 2PVMA 3V5PA 2VTSA 2IZRA 3ZLWA 2ZDUA 1URCA 3QC9A 1T46A 3E8NA 3UVPA 3FZSA 3IECA 3UC4A 5J9YA 2IVUA 3NIZA 3UZTA 3SV0A 3VBVA 5IH5A 2WMVA 4MTAA 3VULA 5IQGA 4RVMA 2GHMA 4CGAA 3A60A 4GG5A 3OWLA 3G6HA 4FK6A 4W8DA 1B39A 1XJDA 2GHLA 3TNQB 1RW8A 4GT3A 5AP5A 1TVOA 3FYJX 4I5CA 2R64A 4S30A 4WRGA 5EHYA 3P7BA 4AE6A 4YSJA 3G2FA 3U6HA 3BQRA 1FBNA 3NNVA 2CNVA 4MF1A 2YA9A 1BYGA 2AYPA 3CKXA 5BVEA 4FTQA 3PUPA 4NW5A 3W8QA 2V0DA 3IO7A 3T9TA 1ZOHA 3M42A 4KIKB 5DOSA 3RHXA 4D1ZA 3LAUA 1IA8A 4W9WA 1YXXA 1H07A 2JDOA 3R8PA 3GQLA 4QPSA 4A4OA 4D4RA 5I9WA 1BLXA 4UZDA 2YEXA 3NW5A 1SVGA 4G16A 4Y73A 4I41A 2Z7SA 4O21A 1YHSA 4B8LA 4YZBA 2I1MA 2YIWA 2OBJA 3AG9A 4L46A 4W4XA 5HORA 2VWVA 3NS9A 3BHTA 4M15A 3NRMA 4YJVA 5FG8A 4FX3A 4O0UA 2VTJA 5IA0A 4IZYA 3VQHA 5KNJA 2WTKB 4GMYA 3O23A 5HOAA 4ASXA 1FVRA 1PXKA 3BEAA 3ZM4A 4OTRA 2CLQA 5FUTA 4U6RA 4OTPA 4NUSA 1IEPA 5J95A 3ZCLA 5KUPA 4DE4A 1WVXA 2CKOA 4TNBA 4M66A 4O6EA 3FQSA 4BICA 2X7FA 4ZIMA 1GNGA 3NNWA 3C4WA 4K8AA 3W55A 3SXRA 3VRZA 4M97A 3OZ6A 4JAIA 3ZC5A 3DOGA 4WNMA 3C7QA 4QQ5A 2VAGA 3QF9A 2ETKA 4MH7A 1RE8A 4WBBB 1R0EA 5HVJA 4JBPA 4D2PA 4MD8E 4DCEA 1OL5A 4TKSA 4UXQA 5CF5A 1IRKA 4CG8A 4X3JA 4ZLYA 4BDHA 4WT6A 4USFA 2W17A 4ERWA 3PZEA 3OBGA 2PE0A 3R2YA 4I0SA 2XVDA 5EDPA 1CDKA 1H0VA 2UZUE 5K0XA 4FEXA 3R04A 4WKQA 2EUFB 4EHVA 4FA2A 3UNKA 2X4FA 4AW5A 4F0FA 4KBCA 2XH5A 2UZDA 5BUIA 3QTQA 4MNEB 4BCGA 3L8PA 3QQKA 3FI3A 4FKLA 3W8LA 4E20A 2JIIA 2O5KA 4JL9A 3ZUTA 2NNWB 3A8XA 4MWIA 2E9UA 3BV2A 4LV5A 5DHJA 1ZOEA 3C5UA 3UPXA 3JR1A 3D7TA 4FKIA 3P08A 4FKQA 2ETMA 3KMMA 4O38A 4GUBA 1FMOE 1Z5MA 3WYYA 3BKBA 4ALWA 3PJ8A 3G0FA 4AW0A 3EN7A 2JDSA 5FP6A 4N4SA 2VTHA 3DZQA 4BDIA 3OS3A 4W4YA 1PXLA 1XH8A 4FL2A 3FZRA 4PY1A 2YITA 3PPZA 4FEQA 3SKCA 3MW1A 5HKMA 2QU5A 4IFCA 3U8WA 3PY3A 3ZZEA 4JQEA 1M2RA 5BYYA 4MAOA 2R3OA 4M12A 4I6QA 5K4JA 3KXNA 3QU0A 4XV9A 3EQBA 2F49A 4HPUE 5F1ZA 3D5WA 2VZ6A 2DYLA 5BUJA 3RNIA 2QR8A 3EFJA 5ETIA 4ASDA 1OVEA 4M13A 3Q9XA 4DC2A 4FIHA 2X1NA 4QP3A 4EK8A 3TV4A 4TW9A 3LOKA 3EYHA 3JVSA 3EQGA 4UXLA 5AAFA 4K0YA 5AA8A 4F7LA 4XHKB 3ANRA 5BMMA 2R0UA 4XBRA 2WEVA 4F64A 4WIHA 4L43A 4KWPA 2PMNX 3ERKA 2RIOA 5HG7A 3OHTA 4BHZA 3ZM9A 2DUVA 3MJ1A 3KXMA 4XG2A 5C1QB 5C8KA 5ANEA 4G34A 4PL4A 4QQJA 4PL5A 4WBOA 3ITZA 3CE3A 5GJGA 4I5MA 1ZMVA 4JXFA 3UGCA 4YURA 2GPHA 4QMWA 5HE2A 4BIBA 2F7XE 4E4MA 3LCDA 1H1WA 3VVHA 4QPAA 1TKIA 5C27A 3LW0A 5HNBA 4R3RA 3UE4A 4FKTA 1FQ1B 4L8MA 1OUYA 3D5UA 2JKKA 4FV0A 4BDJA 4TRLA 1M52A 2HXLA 5HG8A 2B0QA 5IQCA 2W1HA 4FVPA 3G90X 4ZJVA 4XG3A 3R63A 3PA4A 4FUYA 4LMUA 5CNNA 5CZHA 1M7QA 4EK3A 2JBPA 3KF4A 2ITPA 1XO2B 3BELA 2BUJA 3VBYA 3PJ2A 5BVDA 3QTZA 3IKAA 2VTTA 3BEGA 1X8BA 3TEIA 4AT3A 2QODA 2CDZA 1P5EA 4LV8A 4O27B 1KE6A 2VTMA 5BVNA 5HD7A 4EJNA 3GCQA 4TN6A 4WUNA 3N4TA 5ANGA 4RSSA 2UW0A 3UPZA 5GZ9A 4TYIA 2O0UA 4R1VA 1PXIA 2PVJA 4LG4A 2YFXA 4O0TA 2Y6OA 4RT7A 5DWRA 3H9OA 3QZHA 3V3VA 2VD5A 3C9WA 3V5TA 4ZAUA 4FYOA 3I1AA 3CQWA 4GSBA 5KKRC 1OKZA 4TZRA 4EH3A 4FEVA 2XKDA 3MBLA 1OGUA 3DJ7A 2YAKA 4EZ7A 3QQHA 3FMHA 3GFEA 4NCTA 2XRUA 4U42A 4RGJA 4USDA 3QZIA 4NTTA 2UZOA 3CBLA 1YKRA 3KRXA 3NYNA 3KCKA 2XM9A 3KVWA 2QOHA 3EB0A 2C30A 3MB6A 4PMMA 3HAVA 2ZOQA 2OFUA 4BCIA 3LM5A 4DINA 4BBFA 5FTOA 3N9XA 1W0XC 4OBOA 3HRBA 1WZYA 1JBPE 1H8FA 3BPRA 4IX5A 4V05A 5HCXA 1P2AA 1XHAA 3AD6A 4JJRA 4LUDA 3PPJA 4O0YA 5CQWA 2JC6A 4XRJA 3E7OA 1WAKA 2J51A 1Q24A 2H9VA 2OICA 3HV5A 4X2NA 5DNRA 3REPA 4RX5A 3HGKA 2ERZE 4IFGA 4KA3A 5HBEA 2CCHA 2PZPA 1H27A 5KMJA 3ZFMA 3ZDUA 4DH8A 4Z16A 4R78A 3IW4A 3QCXA 4GU6A 4V0GA 3A62A 3W33A 4FKUA 2O2UA 3LCKA 4ZSJA 1O6LA 4EOKA 4QP4A 3NUYA 3RK7A 4FT5A 4WG4A 2W4OA 3P9JA 2C6TA 3ZS5A 4Y95A 3BE9A 4L67A 2F57A 2J0LA 3NAXA 2GMXA 2PVFA 4FBXA 4RZVA 4BTKA 4BB4A 5A6OA 4B99A 2B4SB 2QNJA 2YDKA 3D15A 5IQFA 4YC8A 1YWNA 2P4IA 3QX4A 1FVVA 3EQFA 4EHGA 3LLAA 5IA2A 5KMMA 3ENHA 1W7HA 2C5OA 4X0MA 5AWMA 4ZSGA 3BYMA 5HHWA 3OFMA 3IOPA 5CT7A 1OPKA 2WGJA 5JFWA 3RPVA 4MYGA 3BYUA 4DN5A 2BDFA 4F70A 4F99A 5HNIX 3LXPA 3Q4UA 5AUYA 3OCTA 5L2TA 3PYYA 2PULA 3NDMA 4IWQA 4NJDA 1W8CA 5CEQA 3IONA 3MV5A 4C35A 5LOHA 4YLKA 3AC1A 4RMZA 4I0TA 4N0SA 5TT7A 4UX9A 1OIRA 3C5IA 1FMKA 3F5GA 3TNIA 3MGYA 4D1SA 3D2IA 3FMMA 2B1PA 2XIYA 2GS2A 3DLSA 3OEFX 5LVOA 3MY1A 3TACA 3E64A 3IOKA 5HU3A 3PZHA 4CZTA 4BR3A 2E2BA 2YIRA 5AUZA 4FNXA 3UODA 3VW8A 4I1ZA 4QYEA 3KA0A 5CWZA 4DLIA 2QKWB 4IAIA 4HGEA 1KOAA 2XK4A 4MXXA 2W1EA 3MDYA 1LPUA 4AN3A 3DQWA 3V8SA 2WEIA 4IACA 5M56A 4RJ5A 3P1AA 5C4KA 1KOBA 3EFWA 4FIGA 3DDPA 3AXWA 1KV1A 4IH8A 4WNPA 4IWOA 5DEYA 2BZJA 3E7VA 2IZUA 3F3VA 4IB5A 5JGAA 4NL0A 5DBXA 4O0RA 3OBJA 3LHJA 4X6RA 4BRXA 3C4XA 3D14A 3PSDA 4GV1A 5KHXA 3VBQA 3PFQA 1CTPE 5JKGA 4G6NA 4ACHA 4CCUA 3UO5A 4XYFA 1OIQA 3F88A 2PTKA 2YHVA 1DS5A 3R7GA 1ZYDA 3KK9A 1J3HA 3JY9A 2QD9A 1A9UA 3PLAE 2JD5A 3QKMA 4DG3E 3LXLA 3PWYA 4DFXE 5JFVA 2C5XA 4BDBA 4LGHA 3ZXZA 2Z7QA 1OITA 4GIIA 3PXKA 5BYLA 2O64A 3BYVA 3MY0A 2B54A 3JPVA 2FSLX 4MD9E 4WNKA 5AV3A 3VWAA 4AZTA 5IUHA 4J98A 3U6IA 5EFQA 2ZM3A 4D2WA 5I4NA 5FQDC 4AW2A 1OB3A 4XG7A 1PKDA 3U51A 5M44A 1ATPE 2YISA 2A19B 2C6MA 2F4JA 2PL0A 2C6IA 3JUHA 3MN3A 3GU4A 5HCYA 4BWKA 4CT1A 4QMNA 3SVVA 3KQ7A 2BRGA 1YXUA 4Z55A 5FTQA 4FKOA 4WSQA 3ZU7A 2YCRA 4PX6A 3OW3A 2WB8A 2G15A 4ZTHA 5GNKA 4QMMA 5HI2A 3FPMA 2XF0A 5DN3A 4ZTLA 3D2KA 5H9BA 4J7BA 4NK9A 1YWRA 4AGWA 3QALE 5DPVA 5C01A 2FH9A 4ZEGA 3P79A 2VUWA 3QD3A 4C37A 1MQBA 4BYIA 2X8DA 3UOKA 3LPBA 3OW4A 5CANA 2JKOA 3QUEA 4R3CA 2VO0A 5HBHA 3VRYA 3F3TA 4CKRA 1B38A 1Q8TA 3LFFA 2OK1A 3EJ1A 3UNZA 4W8EA 4DTAA 4GL9A 2GNIA 3AQVA 3V8WA 1V0BA 4AFJA 3ZRKA 4FEWA 3PG3A 4DCAA 2ITQA 5D11A 2PVKA 4AOTA 2W96B 4BTJA 5A4QA 5JT2A 3I7CA 3NCGA 4RIOA 1LUFA 2XKFA 2W9FB 3NVKI 3H4JA 3KY2A 4E93A 3GNIB 4LOPA 4WD5A 3VNTA 5GZAA 5EI2A 1Y57A 1ZYCA 2ETRA 3EFLA 4PDPA 4GJ3A 3MTLA 2FSOX 4J95A 4B0GA 3C1XA 4D4YA 1LEZA 3A7IA 3K2LA 4GFOA 3DPKA 3QCSA 5CI7A 3PTGA 1OZ1A 2VTOA 2X9EA 5L2IA 4FT7A 3N51A 3ODYX 4KABA 3HAMA 4B4LA 1CMKE 2P33A 3E88A 1GOLA 2SRCA 3KRRA 4UB7A 3KXHA 4A9RA 2X6EA 2YCSA 3Q2MA 5BVWA 2HZ0A 2QOKA 2OZOA 2J4ZA 4BVUA 2CN5A 4DA5A 4R3PA 2X7GA 4MBLA 4F9AA 3HV4A 3O7LB 4FVRA 5FM2A 4YJTA 3DKFA 3PWDA 2WO6A 5AP3A 4CMTA 5A6NA 5AV4A 2BILB 3MH2A 4FE2A 4KRCA 5AP2A 4GRBA 3ZO4A 2C6KA 3IW7A 5DA3A 4IAZA 1VEBA 5IF1A 4K18A 1GZKA 3UTOA 2FSTX 1JSVA 4OTFA 4C0TA 4RX9A 3RHKA 3C0GA 2W5BA 3DTWA 3ID6C 4O7ZA 5CVHA 3PRFA 4ZZNA 4IDVA 5BNJA 2PPQA 3HMIA 3PSBA 3M2WA 3AOXA 4X3FB 1ZLTA 2VWBA 3MJ2A 3HMMA 5L8KA 1SVEA 2GS7A 2X2MA 3QC4A 4ANLA 4GU9A 4EOOA 1H28A 4EKKA 5EHLA 4ENYA 5J5TA 2CJMA 5IA1A 2QLUA 3LFBA 3PJCA 1YDTE 2CNUA 3PIZA 1JKLA 4U97A 5ANIA 4PV0A 4CLJA 4I4FA 1WBSA 2XBAA 2RF9A 4XLIA 2R3JA 5F9EA 2DWBA 3GC0A 3POZA 1JKSA 1JPAA 1Q61A 3GCPA 3P86A 3QZGA 5EDQA 3MVLA 5EI6A 3S4QA 4EWQA 5HTBA 5M57A 5G6VA 1H1SA 2GU8A 2JIVA 4BWXA 3PRIA 4X2FA 4E4XA 1PF8A 3HZTA 2PZRA 2YM7A 4JBQA 3E5AA 2ONLC 4TYEA 4DEEA 2XYNA 3GC9A 4FSZA 4LFIA 3R7VA 3ZRMA 5CAQA 3PLSA 3UG1A 3QYWA 4QYGA 4E1ZA 3MS9A 2W0JA 2YDIA 3ZHPC 2WMWA 2OU7A 3GENA 3F2RA 2C5NA 2YM3A 3PVGA 4IX6A 3GC8A 3QLGA 4FG7A 4EQMA 2XIKA 4QP6A 5AP7A 4HVIA 1Z9XA 4IVCA 4YMJA 3BU3A 2WNTA 2VO7A 4O1OA 4F9WA 4I22A 3Q96A 4R8QA 3D4QA 4TWNA 4DAWA 3G51A 4FSMA 4QQCA 1UNLA 3COKA 5KO1A 3LFNA 4M14A 3TN8A 5AEPA 4QYHA 2WELA 4RIXA 3UIBA 3GVUA 5CI6A 5EOBA 4I6BA 5I9XA 3BE2A 3SW7A 2JFMA 2VX1A 3F3WA 2J9MA 2HZNA 1Q99A 3WZKA 4D4VA 2OJ9A 5L4QA 4IAYA 4IVBA 2B7AA 4G1WA 4AUAA 4O1PA 3HYHA 1GZNA 3BI6A 4ZJIA 3UIUA 4ANBA 5CEKA 4DGGA 2XNBA 5L8LA 2NRUA 1K3AA 2XIRA 3QTRA 5FEEA 2VGPA 1JVPP 3E8DA 4FVQA 4L44A 2KULA 4F1OA 3GI3A 2HELA 2C6EA 4EYJA 4BGQA 1P4FA 5HO6A 3H0ZA 4MXAA 4ACDA 4D28A 2WMTA 2YIYA 1J7LA 3PXFA 4TY1A 1GAGA 4QP1A 3V5QA 3G9NA 3FKLA 2PVLA 3BWJA 4R7IA 4UYAA 3UZRA 1FGIA 3NYVA 4QP9A 1PYEA 3RCDA 2CGVA 4L52A 1XR1A 5T3QA 4AZEA 4ANMA 5LVMA 1E9HA 2X9FA 2ITUA 3A61A 5J8IA 1U54A 5HX8A 3W10A 1GZ8A 5CVGA 2I40A 2J0JA 5IG1A 2Y4IB 2J90A 5AP1A 4M67A 4UWYA 1WVYA 2BZIB 4IZAA 3VQUA 2W5HA 2XKCA 4FZFB 4LM5A 2PUIA 3ORTA 3CD3A 3F5XA 2ITNA 3FJQE 3L9NA 5AV0A 3A4PA 3HDNA 4FICA 4FT0A 3ZRLA 4EUUA 4BCOA 2IG7A 4C59A 3BBWA 2WTIA 5TE0A 5CEOA 1XBAA 3KFAA 4YZDA 2GTNA 4DT9A 3HMNA 3II5A 4QP8A 3H9RA 4BWPA 4ZP5A 3FWQA 3VUGA 4O22A 4O7RA 4R5YA 2XYUA 2Z60A 1NVSA 3QTWA 5D12A 5E4HA 4MF0A 3CIKA 2WQOA 3MVJA 4IX4A 3TNHA 3WBLA 3FL5A 5JZJA 3CQUA 4ENXA 5E8ZA 2V7AA 3L9PA 5I9VA 3RPSA 2OXYA 3PA5A 3RZFA 4CNHA 4OGRA 4S33A 4WRSA 4EK6A 3R73A 2B9FA 5ETCA 4I5PA 3QQUA 2WU7A 4FV1A 4ZZOA 4RWKA 4GFGA 5HD4A 2X0GA 2G2FA 3BWFA 4R77A 3V51A 4KIKA 3RMFA 3OOMA 2HYYA 2I7QA 3LVPA 3Q4CA 1Q5KA 3O50A 4YJOA 4M84A 2Y7JA 3SC1A 3QQJA 3AT3A 1BUHA 3R9OA 2WTWA 2ZV7A 1J7UA 4JQ8A 5GIPE 2GHGA 4DLJA 4LOOA 1LP4A 3QRJA 2RFNA 4GW8A 3TZ7A 4FSWA 4D58A 5LARA 4BL1A 3RAIA 4CG9A 4EZ3A 4FTMA 1Q3DA 1MRUA 3QAME 4M0ZA 1O6KA 3KRJA 4F7SA 5IQBA 4ANNA 4FTIA 2W05A 3OUNB 3QA8A 3R01A 5DR2A 3W2PA 3K5UA 3LKMA 2YCQA 4DYMA 3CPBA 1XH5A 3FUPA 3KMUA 1OM1A 2HWOA 2X4ZA 2W1ZA 4BDDA 4C61A 3FMEA 2ITVA 4J8MA 2JBOA 4IC7A 4FOBA 4F1MA 3CTHA 5IQAA 4YC3A 4BF2A 5BMSA 4AN9A 4G6LA 3MTFA 4M68A 5AIRA 2ZAZA 3UP2A 3L9MA 2VNYA 4FV8A 3U55A 1G5SA 2RFEA 1H25A 3ORIA 3Q32A 2BFXA 1VJYA 5BYZA 1G8AA 4BFMA 5M51A 4JAJA 3UVQA 4K9YA 3AC2A 3AMAA 2HZIA 2UW7A 5DGZA 3G5DA 4Y5QA 2HZ4A 4O0XA 4FTRA 1SM2A 4EYMA 4ANOA 1OECA 4QOXA 5AR3A 2BZHB 4NTSA 4RBLA 3FLZA 4FUXA 1JKTA 3MIYA 1FOTA 4FGRA 3LQ5A 3QTIA 3GEQA 4FZ7A 4D5KA 4C4FA 1NW1A 5EQEA 4TYGA 4GYGA 4MNEA 3N4VA 4J52A 3JS2A 5E8YA 3HVCA 4YTIA 4AS0A 3RPYA 4ZTQA 4ZXTA 1WBPA 3GGFA 5LWMA 1H01A 4GK4A 2VTLA 2O63A 5DLSA 5JEBA 4NSTA 4IB0A 4C34A 3E87A 3RINA 4NKSA 4AAAA 3VHEA 4CV8A 3DFAA 3HL7A 3CC6A 3L8VA 3RK5A 4AOIA 3QUDA 4CV9A 4DGLC 4ZLZA 2IJMA 4FTTA 1PXJA 3OVVA 4U43A 3HMOA 5AX3A 4YTFA 4MXOA 4FIEA 4RFYA 4C57A 1NVQA 1UU7A 2E9PA 3NSZA 3O8PA 1OKWA 3TDVA 3FLWA 4IHPA 5E8TA 3WF5A 5IA3A 3PA3A 2B53A 4ASEA 5M53A 2XJ0A 3QD0A 3CPCA 2F2CB 4YJSA 5ANOA 3FMJA 4YZNA 2J5FA 4A4XA 2QO2A 3BBTB 2GS6A 4AGDA 4JRVA 4O7NA 3EQCA 2A1AB 2QO9A 4IM2A 3SOAA 1BMKA 4YBJA 4AW1A 2IW6A 2VN9A 4I3ZA 4FL1A 4FTLA 3VUHA 4ZTMA 3R22A 5JH6A 5HU9A 3NW7A 4NM5A 3TG1A 5A4EA 3UIMA 2VTPA 2WMXA 3CQEA 5CU6A 3QTXA 4IB1A 4IX3A 2PZ5A 1Q8YA 2B55A 3V8TA 2BVAA 5CSVA 2AC3A 5IISA 4Y72A 3AGMA 5IEYA 3ZBXA 4O7VA 3R21A 4M69B 1PHKA 4DGNA 4RG0A 4ZY5A 1IASA 4X2JA 1OPLA 3WZUA 4U7ZA 4CCBA 5IEVA 1AQ1A 1JWHA 4FKGA 2UW3A 4LRJA 4WOVA 3NMUF 2WMRA 4ONAA 4PNIA 3NUXA 5DH3A 3DFCB 4IVDA 1VZOA 1ZYLA 3ZUVA 4D4SA 4UY9A 4RVLA 3U6JA 3LFSA 1STCE 5FXSA 4BDFA 4AWIA 4ZMEA 4E5WA 2FB8A 1JKKA 5E91A 4XNEA 1IAJA 3FLNC 4ACCA 1SNXA 5CAOA 5IQHA 1SMHA 2XKEA 3BHUA 2PMIA 1YOMA 2DS1A 5FEQA 3MH0A 3FL4A 5DR9A 3HECA 3VBTA 4PPBA 2QOCA 5HG9A 3DQXA 3GP0A 4JBVA 3O51A 3Q04A 2VGOA 4FKPA 4BKZA 2OXDA 3R71A 4EK4A 3BLRA 3CD8A 4PRJA 2R3RA 4G17A 4JDJA 4E7WA 4EQCA 1PXPA 4A7CA 4HGTA 3AC5A 3VUDA 3FEGA 3AD4A 5E8VA 5IA5A 4AE9A 3R8VA 1YHVA 2V62A 3T3UA 5EYDA 1J91A 3UJGA 3CR0A 2WTKC 4NM7A 2YERA 5E8XA 5EM7A 3RWPA 5I0BA 4MK0A 2BHHA 3OMVA 4IAFA 2H34A 2WTCA 3P23A 4RQKA 5KX8A 5C8MA 3LJ2A 1QMZA 5EHOA 2C69A 2HENA 3FMDA 3R8MA 1TQMA 3IPHA 5AUUA 1YVJA 5A9UA 2C1BA 3JY0A 3RPOA 5DT3A 2GNFA 4AX8A 3P78A 2WQBA 2ZV8A 3BU5A 4FZAB 4XP0A 2B9HA 5DRDA 4TPTA 5L6WL 2J2IB 5ANKA 5H8EA 2XJ2A 3ZONA 2PSQA 2QO7A 2WOTA 3DB6A 2R7IA 2IW8A 3LCTA 3SXFA 5M4IA 4BKJA 1CM8A 5IQEA 1DAYA 1PMEA 2EVAA 3OTVA 4L00A 4U8ZA 4YO6A 3V04A 3FQEA 1GIHA 3H9FA 5AX9A 2OZAB 2WTDA 4B6LA 2VWUA 4JG8A 5L6PA 2R3KA 3VO3A 4E6QA 4DFBA 1SVHA 4Q5EA 4RFMA 4XOYA 2C3KA 2HAKA 2C6DA 5M55A 5DVRA 4FNWA 4YJQA 2EU9A 2G9XA 2P0CA 3R6XA 4GIHA 4UBAA 5KKRB 3FI2A 3Q9YA 2VTIA 4O7YA 2C0TA 3FKNA 5AJQA 2UVYA 1M14A 2XEZA 3ZSGA 1YI4A 4EH2A 3UBDA 2B9JA 2IZSA 4G2FA 3TV7A 4F1TA 3C13A 3ZLXA 4PF4A 4YC6A 3HP5A 4ZMFA 1XBBA 1YHWA 3F7ZA 2VO6A 4TYHB 5EK7A 4RC2A 4BHNA 4BN1A 3E63A 4XG4A 2A4LA 1LR4A 3E93A 2QOOA 4II5A 3EFKA 2W4KA 3DU8A 3I5NA 4HCVA 4JVGA 5TOZA 3O71A 1JAMA 4DEDA 2Q83A 4XCUA 3FSFA 4H05A 4EH9A 4AA5A 5JGBA 5HIEA 2CMWA 3DBDA 3HRFA 1K9AA 5FBOA 3DK7A 4M3QA 1BX6A 3QHWA 3PDTA 4BDAA 3WE4A 4FIIA 3RJCA 5ETAA 5HEZA 2OJGA 3HV3A 4HZRA 3N4UA 1FPUA 2JIUA 2W99B 1I09A 1UNHA 4P5ZA 2CKPA 3MVHA 3BYOA 3CJGA 4BI0A 3R2BA 1QPEA 1MP8A 3A2CA 2R3NA 4JBOA 4OBQA 2CNQA 3RNYA 2XZSA 3NNUA 3VS3A 5A4CA 3DTCA 3I6WA 1PY5A 1UA2A 4CFMA 3KXXA 3R9RA 3GT8A 1Q62A 3ETAA 4CRSA 4IZ5A 3B8QA 3O17A 2XNNA 3D5XA 5A4TA 4XS2A 2B52A 2IVSA 3DBFA 3DY7A 4E3CA 5JMSA 4OTDA 4L6QA 2W1DA 3KRWA 3WIKA 3BGPA 4HVDA 1UKHA 2VWWA 3U54A 2JDRA 3DAEA 3KVXA 2QONA 4L45A 3FY0A 4I0RA 3RM6A 3VN9A 3UO6A 2XP2A 1G8SA 1XH9A 4H36A 2ZV9A 4KIQA 2Y4PA 4FG8A 4I93A 3CLYA 4RIYB 5CNOA 3ZOSA 4E6AA 3CXWA 1REJA 4U3YA 3JYAA 4HCUA 4ASZA 3DV3A 2WMAA 4JX3A 3KL8A 5HE3A 4BBEA 2W4JA 3GOKA 5AUXA 2FUMA 2XK3A 4KS8A 4QMSA 5DI1A 3HA6A 3ZLYA 4BIDA 4DEAA 4B8MA 4RLKA 3UQCA 3FPQA 4X2KA 3ULZA 2RFSA 4O6LA 3NUAA 1MQ4A 4R1YA 4GVJA 3MPTA 3QUPA 3QTUA 4FTNA 4PDOA 2CPKE 1YW2A 3AT4A 4C4IA 4F09A 4DEIA 4MXCA 3QFVA 3OY1A 3NGAA 4GJ2A 4K1BA 4I21A 2AC5A 4IAAA 4A4LA 4O81A 5EQPA 4TWOA 3LCSA 3OWKA 3DK3A 2V5QA 4O2ZA 3SQQA 1IG1A 3TXOA 2HWPA 4FKRA 4G3EA 4GT4A 4NZWB 4CFVA 2HCKA 4OR5A 4BCPA 5J87A 2C47A 3ACJA 4PP9A 5H8BA 5JN2A 4FTKA 2R2PA 5I9UA 4X6QC 3R1QA 2P55A 3VF8A 4DBXA 4MKCA 1IR3A 3WF6A 4ZS0A 2UZTA 1Y91A 2WAJA 5K5XA 3VUTA 1ZMUA 3QD4A 4RQVA 2OJJA 3IQ7A 2Z7RA 3VS7A 5M06A 2QKRA 2HW7A 2OJFE 2WHBA 4PTGA 1H00A 2IN6A 3I60A 3FI8A 5I9YA 4EL9A 5HICA 4PMSA 4FV3A 3OEZA 3BHHA 5M07A 3PVBA 4WUAA 3UMWA 4C02A 4J97A 5AR4A 2JITA 4FKJA 4TXCA 4FL3A 2GQGA 5CAVA 3TT0A 1ZY4A 2ZV2A 4IJPA 5HO8A 1WBTA 4ZY4A 3BLHA 4PP7A 4QYYA 2RGPA 3ZYAA 2UW5A 3VS1A 4O7LA 3DNDA 4F08A 5E8WA 4F65A 2C1AA 2Z8CA 4HGSA 5KCVA 3BHYA 3UQFA 2WMSA 4UWBA 2UW4A 4CXAA 1H08A 3NLBA 4LRMA 4O84A 1ZYSA 5IQDA 4OT5A 4QPMA 5FP5A 5J7HA 5D1JA 3S3IA 2IVVA 2ITYA 3UP7A 4S2ZA 5M4CA 3A7JA 5L2SA 2OG8A 5EG3A 4YPSA 4RWLA 2PK9A 4IBMA 3I5ZA 3HLLA 4LI5A 4Q9SA 3H10A 4BGHA 4F6UA 5B2MA 3G33A 4E4NA 2X81A 1M17A 4EHEA 2GNJA 3NUUA 2VV9A 4RX8A 2OF2A 1YWVA 2FO0A 1U4DA 4FMQA 5CU3A 1PXMA 4YLJA 3W1FA 3Q6WA 4PUZA 3DXPA 5AP0A 3EHAA 3E92A 4J96A 3FXZA 3UVRA 5LMKA 4BDKA 3QWJA 2RG5A 4X3FA 5J9ZA 3C50A 2E9OA 4NCTC 5LVLA 4C3FA 5EW3A 2BIYA 3MSSA 4G9RA 4QP7A 4BDEA 5DE2A 4A9TA 4O82A 3TNWA 5EW9A 4O86A 2PU8A 5E9EA 2VU3A 1UKIA 2YZAA 3Q9ZA 4XOZA 5E8UA 4U80A 2OI4X 5EW8A 3FMLA 3OXIA 1RDQE 4QTBA 2X39A 3IG7A 4FSQA 5JFSA 1H1PA 3GFWA 2Z2WA 2ACXA 2HIWA 3OP5A 3HDMA 1O6YA 1U46A 4U79A 3TUCA 2G2HA 4P4CA 5LJJA 4KSQA 4YJPA 5AR2A 4QP2A 3VBXA 2DQ7X 2GCDA 3ORZA 5HZNA 3AD5A 2W1GA 3QQFA 4U0IA 4GT5A 5CF4A 2RFDA 3VAPA 3QRUA 4NIFB 4OAVB 1OBDA 4FR4A 2G2IA 3MYGA 1LEWA 3QRTA 5CS6A 3L1SA 2PHKA 3OCSA 1M7NA 2W1IA 4A9YA 1M2PA 4F63A 1NA7A 3CTQA 4W9XA 3IW8A 4XH6A 3T3VA 3OCGA 3F9NA 3TTJA 4CKJA 2C5VA 1ZZLA 3F7WA 3IDCA 4NFMA 4PMTA 2UZNA 3LQ8A 4NH1A 4EKLA 1AGWA 2WU6A 1REKA 2C4GA 2HW6A 5K0KA 3VUMA 1J1CA 5AR8A 2BR1A 3EKKA 4BCJA 3P5KA 4BDGA 1J7IA 3LZBA 5E1SA 4DH3A 4G5PA 4CQEA 4QNAA 5IPJA 3C51A 1IA9A 3KK8A 3QD2B 4CRLA 2VX0A 2J5EA 2FVDA 2NPQA 3RP9A 2XCKA 1KE8A 3VJOA 1H1RA 4E73A 3ET7A 2OF4A 3PY1A 3RPRA 1NXKA 5CTPA 2C3IB 4HZSA 3RBWA 4PWNA 3P7AA 1OL1A 4RWIA 3KEXA 4DFUA 3AGLA 4EZ5A 1Y6BA 4M8TA 2W7XA 3NVMB 2W1FA 1TQIA 2UUEA 5DT4A 3Q2JA 4EOMA 3Q5IA 4CZYB 2E9VA 3GU8A 3BGQA 3UNJA 2FYSA 5IUIA 2O65A 3F3UA 1GIIA 3VW6A 2EXCX 3FI4A 3PE1A 3QGYA 2ERKA 5E90A 3AC3A 4YZ9A 3MIAA 5EM6A 3TZ8A 4LMNA 4TL0A 1I44A 1VR2A 3W16A 5DR6A 2WKMA 3S95A 3COMA 1A48A 4G31A 3QX2A 3UIXA 2ZDTA 4AOJA 1XH7A 4RVTA 5A14A 2YIXA 5JFXA 2UZVA 3EN9A 2WQMA 4J99A 1Q3WA 5JQ8A 2CKEA 2O3PA 5LQFA 1OMWA 4AFEA 4BCQA 3SA0A 3ZSHA 4BKYA 1ZWSA 2IVTA 3FZOA 3TL8A 2G1TA 2GNHA 4FKSA 5EOLA 5CF8A 4RC3A 2R3QA 2B9IA 4N6YA 4FV9A 4QT1A 4R7BA 3NAYA 3PP0A 2WOUA 3V5JA 5M4FA 4D55A 3RAKA 5KHWA 3FE3A 3Q60A 3R02A 4GH2A 4RIWB 2QHMA 4DG0E 2XK6A 3ZMMA 1XBCA 5ICPA 3C4ZA 1V1KA 4IXPA 2Z7LA 2VTNA 3BGZA 5IH6A 5J1WA 5ITAA 4EI4A 1ZXEA 2YIQA 2VTAA 3DAKA 1NY3A 5BX0A 4UMRA 5LMKC 4EOJA 4DGMA 2VTQA 2JDVA 3SD0A 2GSFA 4FNYA 1UWJA 4EOPA 5J5SA 2GNGA 4AGUA 2P2HA 4C8BA 4YUQA 5IQIA 5ANDA 4JG7A 3DNEA 1MUOA 3TUBA 3CGOA 3UYTA 1JQHA 2R3HA 3D7ZA 3VC4A 3LXKA 5EKOA 4MQ1A 4C4HA 1P14A 1R1WA 1R78A 3IDBA 4QMXA 3VBWA 2C0OA 4LOQA 5AP6A 4FEUA 3OY3A 2HY81 1ND4A 3O96A 3LMGA 3RCJA 5JGDA 1P4OA 3OCBA 4MD7E 5I3OA 3OXTA 4MCVA 4AA0A 3E3PA 4X7QA 5HGIA 5J7BA 3DBEA 2P3GX 3PIYA 1U59A 4JI9A 5T6KA 1YDSE 5AV1A 1PMVA 3R83A 5KMOA 4PPAA 4XMOA 3KXZA 4Y46A 4AZVA 2QI8A 2PZIA 4FTJA 2IW9A 4EOQA 2VWZA 2XK8A 4CYIA 3M1SA 4L9IA 3UO4A 2LGCA 1BI8A 2YAAA 4AT4A 2JEDA 4DEBA 4HVSA 1YQJA 4R7HA 3DXQA 4FKWA 4G3DA 1K2PA 2Q0BA 3FMKA 3LFCA 4KIPA 3ORPA 4UMTA 5A3XA 5C03A 5BQ0A 3W2QA 5J79A 3TJDA 4M7IA 4XP3A 1VYZA 4D5HA 2UVXA 2CCIA 3EQIA 4DEGA 1H1QA 3EL7A 4XP2A 4EHZA 2I0EA 1PYXA 3EZRA 2BKKA 3DT1A 2HOGA 4EWHA 4KSPA 3IS5A 3TJCA 4APPA 4C33A 4CLIA 5EI8A 3V5LA 2BCJA 5CXHA 3LQ3A 4UEUA 4HYHA 3NWWA 4O0SA 4XUFA 3R0TA 3BLQA 3HUCA 5K4IA 2OO8X 4P7EA 4CFNA 1IAHA 4S34A 3CGFA 2OSCA 4CZUA 1JNKA 1SNUA 4LL5A 4IAKA 3U4UA 4AXAA 2J50A 4ALUA 3R7YA 4Z3VA 2A0CX 4JRNA 5FXRA 3QGWA 2H8HA 1YI3A 4MHAA 3V01A 4XBUA 5A46A 4IB3A 2R4BA 2F7ZE 3PVWA 2QG5A 5D9HA 5HTIA 4EH7A 4JR7A 4ZSEA 2Y6MA 2Q0NA 2PYWA 2BRBA 2CLXA 4IC8A 4QO9A 5FEDA 4FV2A 4EK5A 2F7EE 5HG5A 2A27A 5F94A 4ORKA 2QOBA 5GZ8A 4U41A 5ETFA 4D2RA 4X2GA 3OROA 3ALOA 4DF3A 3IW5A 2BRMA 2CN8A 1ZY5A 2OW3A 2XNEA 3KULB 2PMOX 3DBCA 3EMGA 2YM6A 2XEYA 3GCSA 2WXVA 2WQEA 3PIXA 3KN6A 2NRYA 4JG6A 4Z7HA 4AU8A 3HUBA 2PMLX 4TWCA 3EH9A 3UQGA 3FLYA 5IZFA 3F66A 3W2OA 5EKNA 2WPAA 4CYJA 3RAWA 3LLTA 2VRXA 1BL7A 2QOLA 2WD1A 4F4PA 5JQ5A 4KS7A 4M69A 4ZK5A 3GB2A 4BZDA 5GINE 2OIBA 3F2NA 4J53A 2BHEA 3NNXA 3KRLA 1ZRZA 4QMQA 3UMXA 5D41A 3QQGA 4RRVA 5GJDA 5HESA 3H3CA 1DM2A 4HYUA 1Q8ZA 3I6UA 3ZH8A 4RPVA 3HRCA 3CKWA 1ZARA 3BV3A 2RL5A 4GK3A 5HCZA 3T8OA 2C6LA 4RJ3A 3LFAA 2CGUA 4WG3A 1ERKA 3GUBA 4IQ6A 4EUTA 4DFNA 1ZZ2A 4BI2A 1U54B 4KRDA 2XS0A 4ZOGA 3FZ1A 5IU2A 3POOA 4DFLA 3CY2A 4QMTA 2OFVA 4CQGA 4BDCA 4MXYA 4A06A 3DA6A 4BBMA 3GCUA 3K5VA 3SRVB 2XK7A 4H3QA 4IMYA 5M09A 5AUVA 4UV0A 5EYCA 1UU3A 2QG7A 4DH5A 3FSKA 3F6XA 3VS2A 5CAPA 4F6SA 3TIYA 3BZ3A 3R7IA 5HNGA 2CSNA 4IWDA 5AV2A 1W98A 4D2TA 4CFWA 4USEA 4XJ0A 5ACKA 4O7SA 3QTSA 2X8IA 4FSTA 3LIJA 2P2IA 1ZAOA 5H8GA 3FZTA 5BUEA 3H0YA 4K77A 4NT4A 4JDIA 3SW4A 4WG5A 3VUIA 4MEDA 5CT0A 4AT5A 4E5BA 5BVOA 3BRBA 3RALA 5ACBC 5L6OA 4QMUA 5F20A 2JLDA 4JDKA 5IDPA 4ITIA 4YJNA 4H58A 3EWHA 3R8UA 2WQNA 4NWMA 4WHZA 5AP4A 4K11A 4RX7A 3TCPA 4WA9A 2GFCA 2BAJA 3HMPA 5C8NA 4L3PA 5CXZA 3KMWA 2EXMA 2HXQA 4XEYA 3LE6A 3VHKA 3MB7A 4DTKA 5FDPA 2BROA 4K2RA 4HCTA 3I0OA 3QRKA 5DT0A 3R9DA 1OUKA 4F0GA 4FT9A 1Q8UA 4LYNA 5IDNA 1Q97A 4AZWA 5CALA 2R3GA 3KU2A 4A9SA 3D83A 3ODZX 4ACMA 5L2QA 2VX3A 2IZTA 1PXOA 2OH0E 2YM8A 3CTJA 5CF6A 2Y9QA 1WBNA 5CSWA 2OZAA 4F9CA 5C4LA 2CHLA 1Y8GA 4NJ3A 5HTCA 5CY3A 1XKKA 4KKGA 4UMQA 3RAHA 2PWLA 4AG8A 3FC1X 1FGKA 4KAOA 4OBPA 3SG9A 3ZXTA 2XCHA 5AM6A 5IKWA 2H96A 2Y8OA 4GKHA 4TT7A 2ZB1A 4FSUA 1L3RE 3NPCA 4BIEA 4O0VA 5CEPA 3R1SA 2JDTA 3PY0A 4KINA 4UZHA 1YRPA 3V6SA 2XJ1A 4DH1A 4CFFA 4EBWA 2R9SA 4MQ2A 4CFXA 3MWUA 3NEWA 2PUUA 5FLFA 4TYHA 3U87A 3NX8A 4JIAA 2UZWE 3MPAA 2GQRA 1YOJA 2W06A 3A7GA 2R3LA 3FBVA 1H24A 5I3RA 3CP9A 5KZ0A 4FV5A 4I5HA 3NW6A 4WNOA 3TDWA 2UW6A 5CLPA 4FTAA 5I5ZA 2ITOA 2LAVA 2A2AA 2R7BA 3AMBA 1WBWA 3LM0A 3ORXA 4HVHA 4PMPA 4PQNA 2R3FA 3HKOA 4KKHA 5CQUA 3ZSIA 3GU6A 3LMHA 2QU6A 2ZVAA 3I81A 5BPYA 3R00A 2I0VA 4BCNA 2XBJA 3MA3A 2ITXA 3K3JA 1WBOA 3PSCA 4GVAA 3KB7A 5J1VA 3LMIA 4L3JA 3VUKA 5HX6A 3WF7A 4C4JA 3ZBFA 2RSVA 3PJ1A 5JK3A 3FV8A 1ZMWA 5K3YA 4ANQA 3AC8A 3PG1A 1PJKA 2BAKA 2OIQA 2XA4A 4C3PA 3CS9A 3BQCA 4PNKA 4H3PA 2BZKB 3FC2A 4YPDA 3EN6A 3ROCA 4DFYA 4BI1A 5CSHA 4AN2A 4AZSA 2GTMA 2J7TA 4JNWA 5CEIA 1AD5A 4C3RA 3WZEA 3L8SA 3B2TA 4QNYA 2C3JA 3ZO1A 4C36A 1KUTA 1BL6A 4ZSAA 1PXNA 3DJ6A 3P7CA 4CKIA 5I9ZA 3HP2A 4NKAA 3JXWA 3MFUA 4S32A 4QQTA 1APME 5JZNA 2ZM4A 3FYKX 4FYNA 4AGCA 1E1VA 1RQQA 1JSUA 4RJ8A 3R7OA 4EOSA 4RIYA 3CSVA 5HIDA 3BCEA 3V5WA 1W84A 3TKHA 1UNGA 3BX5A 4G3CA 3A8WA 5B0XA 4OUCA 2RKUA 2AUHA 2YN8A 2XUUA 3G15A 3HEGA 4MX9A 2I6LA 5HLNA 1Y8YA 2JGZA 2QC6A 3OOGA 3ORNA 4IDTA 4P5QA 3DS6A 4IZ7A 3R7EA 2XNPA 3ALNA 4LQMA 1QL6A 2G01A 2ITTA 4ZSLA 4YP8A 4ARKA 4D2VA 2VWXA 3RM7A 4GEOA 2QLQA 5DEWA 1L8TA 2OLCA 2BTSA 4G9CA 1YXVA 2CGWA 4YHFA 5F4NA 1CKIA 4ZTSA 3AMYA 5G1XA 3MH1A 1UU9A 2R3PA 5HVKA 3MFTA 3W2CA 3TWJA 4Y83A 1W83A 4I20A 2OXXA 4UMUA 3F82A 4ZLOA 1YDRE 3PE2A 4CD0A 4ACGA 3R8LA 3A7FA 4O96A 4A07A 3DGKA 3S2PA 3RKBA 5FRIA 3P4KA 4D9TA 5FTGA 3HV6A 4W4VA 3DXNA 3FLQA 4IW0A 2PVHA 3DBQA 3DLZA 4MXZA 5A54A 4XG9A 3D7TB 4HYSA 3OC1A 3WF9A 4E6DA 4MBIA 2YABA 4QTCA 5C26A 4ZTNA 2PY3A 3EN5A 3QRIA 4GCJA 5C9CA 4EORA 4K6ZA 5FD2A 3KN5A 2UZBA 3ZFYA 2UW8A 4R6VA 3CY3A 5DMZA 2CKQA 4ANSA 2YLEA 5AFVA 2C3LA 5BVFA 5A4LA 5CU2A 5IMEA 3EQPA 3QCYA 3PXRA 4BYJA 4S31A 1KE7A 4AZFA 4ZS4A 4ERKA 3GCVA 4BCMA 4GK2A 5CZIA 4DGOA 4I6FA 4KKEA 1HCKA 3IDPA 2PVYA 2XM8A 2YM4A 3MVMA 2BDWA 4I24A 3EYGA 5GHVA 4U40A 1KV2A 3MH3A 3ORKA 3P0MA 5IEXA 1OL7A 2UZLA 3CEKA 3NUPA 5CU4A 2OIDA 4J8NA 2PZYA 3G0EA 3R9NA 1WVWA 3F69A 4E5AX 2PVRA 2WZJA 4F9BA 3SG8A 4QMVA 3R9HA 4AP7A 4EH8A 2R5TA 4MWHA 1F5QA 4YHJA 3SXSA 4IANA 3UG2A 2BRNA 5LXMA 1XQZA 4NU1A 4P90A 3QZFA 3SOCA 5TO8A 4FSNA 3LJ1A 3WILA 2WFYA 3ELJA 4OT6A 3OTUA 1JOWB 4RFZA 5H3QA 2BDJA 3NCZA 4AQCA 4XG6A 4Q9ZA 4UMPA 4FIFA 4BTMA 4K33A 2Y0AA 4XV3A 3DCVA 4H3BA 4JOAA 3ZO3A 3COIA 3ATTA 5GIOE 4TYJA 1XH6A 1CKPA 3QA0A 4YNEA 3RZBA 3T9IA 2BRHA 2VO3A 2HY0A 4HNIA 5E7RA 3W2SA 4CSVA 4CVAA 2X2LA 1JLUE 1W82A 4BZOA 2PE1A 4RA4A 1KE5A 1DI9A 2QOIA 3KF7A 3QBNA 5EDRA 3SX9A 4DTBA 4OTIA 5B2LA 5JRQA 1A06A 4PDYA 4MVFA 5D10A 1SZMA 1V0PA 5EH0A 1QPJA 3V6RA 4FTUA 4OTWA 3MA6A 4ZJJA 1DAWA 1NVRA 5CYIA 4NM3A 2YWVA 1XH4A 3TUDA 3ZZWA 3CCNA 5FDXA 3S0OA 3NZ0A 3QWKA 4YSMA 5HE0A 4L7SA 5HO7A 4D1XA 2NO3A 3K54A 5CENA 3R7UA 3QYZA 3WZJA 4C2VA 4YZCA 1OKYA 4YHTA 4BZNA 4KBAA 2ZMCA 1V0OA 4G3FA 1BKXA 3ROYA 3E8CA 3LXNA 3B2WA 5B7VA 1Z57A 3G9LX 4NIFA 4CEGA 4XV1A 2BIKB 5KBQA 4J1RA 3F61A 4B7TA 5T68A 3GOPA 3R1YA 3ZTXA 4MBJA 3WF8A 5LVNA 2YM5A 1BI7A 2JAMA 4NW6A 3WYXA 1UU8A 4N70A 4PDSA 2REIA 4CTCA 4DITA 3I79A 2C5YA 2UZEA 1HOWA 2ITWA 4YLLA 4W4WA 3FDNA 3WI6A 2XNGA 3TNPC 2XIXA 3HNGA 5E8SA 1M2QA 4JT3A 4N6ZA 4E6CA 4QMPA 4PPCA 4YBKA 5D7AA 2BFYA 3UDBA 3L8XA 4YNOA 2F2UA 4GKIA 1OL6A 4JIKA 4YTCA 3VS0A 5F95A 4CT2A 4DG2E 2ONLA 2EXEA 3DK6A 3BHVA 1FVTA 2BPMA 3AC4A 4RJ7A 3VIDA 3EKNA 4U45A 3U9NA 1Q8WA 3DKOA 4YTHA 3IGOA 2ZMDA 5GJFA 3Q9WA 2WMQA 5HLWA 1JSTA 4V0GB 4C4GA 2OH4A 4XV2A 3RI1A 3ANQA 2GFSA 5CAUA 1RJBA 3GQIA 4FODA 4HYIA 3WE8A 4FC0A 5H2UA 3NUSA 4EOLA 4BC6A 4C2WA 3D9VA 5D7VA 2YCFA 4L3LA 4QMZA 3QXOA 4L68A 5AR7A 5FBNC 4YR8A 4Y8DA 5AUTA 3OG7A 3WIGA 4FV7A 4Y5HA 4FNZA 3PPKA 2GDOA 3IW6A 2XK9A 2OKRA 2YDJA 3KKVA 3NYOA 4ITJA 5AR5A 1H4LA 1KWPA 3EL8A 4G3GA 5KBRA 3R28A 4DT8A 2ZB0A 2OGVA 4OLIA 1SYKA 3OXZA 3QCQA 4OW8A 4UYNA 3RGFA 4EH4A 5CASA 4NYEA 4Z7GA 1WBVA 1WCCA 2CGXA 3EIDA 4E26A 5AAEA 3O0GA 2V55A 3PJ3A 4E8AA 4F0IA 2FGIA 3EQHA 4RLLA 4G5JA 3TM0A 1PKGA 4KBKA 2EB3A 5CSPA 4CTBA 3U9CA 3ZUUA 4MNFA 2QURA 4Y85A 3E8EA 3SLSA 4N57A 5IUGA 4U5JA 4FSYA 2C68A 3F3ZA 2XRWA 2O8YA 3ZC6A 5IMXA 3EQRA 3TZMA 2E9NA 4LGGA 4OTGA 1XWSA 5K5NA 3NIEA 4RJ6A 4ZZMA 1CKJA 1S9JA 3MPMA 3NR9A 3FHRA 4RIWA 3ZDIA 3HX4A 4IADA 3CJFA 4GFMA 4FIJA 4RA5A 3DKGA 2BMCA 3ZEPA 4A9UA 5DYJA 3GBZA 3O8UA 4Q5HA 5E92A 4O83A 2YJSA 4L01A 2J0IA 5TKDA 1H26A 2PUPA 4FV6A 4ID7A 2W5AA 3UYSA 3PVUA 1R0PA 4IJ9A 3FHIA 5CU0A 4KB8A 3ZFXA 2QHNA 4IIRA 3LFDA 4YJRA 3COHA 4PL3A 5DG5A 5IH4A 4Z9LA 5BVKA 3C0IA 3TI1A 2WTJA 4AACA 4P2KA 4HNFA 4QD6A 4M0YA 4G6OA 2V7OA 2YWPA 1QPDA 3VS5A 1URWA 4BCKA 2C6OA 3PP1A 5J9LA 3D94A 5ANJA 3U4WA 3BU6A 3DB8A 2X6DA 4FG9A 3OD6X 1F0QA 5FWKK 5FGKA 4D0XA 3FKOA 4APCA 5LMAA 2R0IA 3G6GA 2BTRA 4ALVA 2BALA 4GS6A 1PMNA 1S9IA 4QMYA 4C7TA 3TKIA 3GU7A 3PXYA 5KMNA 4WSYA 1TQPA 4EH6A 3S1HA 4L42A 2RG6A 3HA8A 5FXQA 4YGAA 4I92A 4FK3A 5AMNA 2X2KA 5EM8A 3VF9A 2ZJWA 4ZTRA 5KMLA 4WO5A 3D5VA 1R3CA 5DIAA 4F7JA 3VS4A 4L53A 4H39A 3FXXA 3UOHA 1EH4A 3UOLA 2UW9A 4FV4A 4LUEA 4XG8A 3W2RA 4ITHA 3DZOA 3PXZA 4BCHA 1YXSA 5KE0A 3C0HA 4QTAA 3KREA 2ITZA 3F2AA 2HK5A 1GY3A 1YI6A 5AIKA 4CMUA 1YXTA 1PRYA 4O91A 3OF0A 4JX7A 3PXQA 4I6HA 2JKQA 4V04A 3RVGA 3TTIA 1ZYJA 2R3MA 2FA2A 1J1BA 2UV2A 3F5UA 4CMOA 5AUWA 3EOCA 2ZYBA 3A99A 4LGDA 4U44A 5CSXA 5FM3A 4EQUA 4EONA 4FTOA 4XRLA 4D0WA 4EH5A 2PUNA 3NYXA 3JVRA 4QMOA 2ESMA 4L7FA 4V01A 2IO6A 4X21A 3Q3BA 3OWPA 4BGGA 2J6MA 3DJ5A 3FQHA 3QLFA 4HOKA 5LMBA 3IK3A 2WIHA 4UALA 3GU5A 2GQSA 3O8TA 4OTHA 1GIJA 1PW2A 4DH7A 4EEVA 1OIYA 1WMKA 4CFUA 3OT8A 3DAJA 4KNBA 3RTPA 3KGAA 4EBVA 4FF8A 3TV6A 2OWBA 5EQYA 4AF3A 5AAGA 2WIPA 4X3FC 3SDJA 4D9UA 4IM3A 4C58A 1H0WA 4QRCA 5EYKA 3K3IA 3Q5ZA 4GYIA 4U9AA 3W32A 5K9IA 3BYSA 2VWYA 2QOFA 4C38A 3ZEWA 4C62A 3A4OX 2YZLA 4LRKA 1QPCA 3LFQA 5E1EA 1GJOA 3DDQA 3TZ9A 3WOWA 3TKUA 3H30A 2WMBA 1MRYA 4XX9A 4E4LA 2IPXA 3KC3A 5L3AA 4U3ZA 1F3MC 2EB2A 1OPJA 3KULA 4EOIA 3D0EA 3O7LD 4RVKA 4UN0C 4O7WA 1U5RA 2XNOA 1OI9A 2YJRA 3OWJA 4JDHA 3WARA 4H1JA 5TR6A 4HW7A 3ACKA 4I94A 5KMKA 4FKVA 3C4EA 4D2SA 4LL0A 4PTCA 1O9UA 2XIZA 4U81A 2F9GA 2VTRA 3KXGA 1Q41A 5AADA 3LJ0A 1UV5A 3I0QA 1ZOGA 2QVSE 2YLFA 4BCFA 4OTQA 3FY2A 4IVAA 5HBJA 3UZPA 3Q53A 3ORMA 3QKLA 4FTCA 3M11A 3B8RA 4BTFA 4GG7A
chains in the Genus database with same CATH superfamily
4RC4A 1VYWA 4I4EA 4RWJA 3F5PA 1R39A 5B2KA 3ATSA 3NUNA 5JSMA 3ZLSA 2QOQA 4YU2A 4OAUC 4IWPA 1MRVA 1OBGA 4NFNA 5M08A 5L8JA 4O7TA 3ENMA 4FZ6A 5IA4A 5LCJA 1KSWA 4FSRA 3EQDA 3Q6UA 4HPTE 4H1MA 2YACA 4TNDA 3MFSA 2WTVA 5EYMA 1Q4LA 4O0WA 1FINA 4DBNA 2J0KA 3SHEA 3S00A 3FMNA 5CX9A 1HCLA 2QCSA 3GXLA 4IE9A 3VJNA 3AT2A 2BKZA 3VS6A 5M4UA 3SRVA 2PE2A 5CEMA 2XMYA 4YJUA 3FAAA 4R5SA 5HVYA 3FLSA 2WMUA 3E3BX 3FZPA 2FSMX 3QKKA 4C4EA 4DEHA 3EN4A 1DI8A 3DKCA 4KD1A 3O2MA 4TWPA 3HV7A 3THBA 3BLAA 2X8EA 4UWCA 2I0YA 3A7HA 2W9ZB 4F6WA 3C4CA 4YZMA 4HJOA 3TIZA 3RWQA 1YOLA 4Q2AA 5KMIA 4B9DA 3W18A 4DHFA 1CSNA 4QYFA 4NM0A 5TF9A 4FZDB 2ZM1A 3QL8A 4IEBA 5HIBA 4AA4A 4JR3A 2QQ7A 3QQLA 4RIXB 3ULIA 2VNWA 3SAYA 4NEUA 4EC8A 2W1CA 2NP8A 3GC7A 2JAVA 1OKVA 4HGLA 5AM7A 2Z02A 2PVNA 2QR7A 4JQ7A 1Y6AA 4I23A 1OIUA 2R3IA 2UVZA 2XB7A 2Y4IC 3EZVA 4F78A 5HE1A 3R8ZA 3RK9A 2I0HA 5L2WA 4KIOA 2IWIA 3I7BA 5KZIA 4DFZE 3UOJA 2BAQA 4BJJA 1GZOA 1OGYA 2H6DA 5DRBA 2J0MB 4QMLA 4GUEA 1B6CB 1PMUA 3UC3A 5LCKA 2JKMA 4ZY6A 4QTDA 5HLPA 4FT3A 1U5QA 1G3NA 3L9LA 3MFRA 2EWAA 3IGGA 3ORLA 4FOCA 3MY5A 3MI9A 1UVRA 2V22A 2JFLA 4FI1A 5CVFA 3ZO2A 3OT3A 4F7NA 3MESA 4BY9E 5EM5A 4EJ7A 4JLCA 1T45A 4FGBA 2GNLA 4QTEA 3C4FA 4TTHB 5LVPA 3WZDA 5AA9A 3QHRA 3LFEA 1E1XA 3BIZA 1KE9A 4JS8A 4EC9A 3KIOC 3LCOA 1ST0A 4KUJA 1UWHA 1OL2A 3QXPA 5LWNA 3E62A 4J71A 4YO4A 4PTEA 4RJ4A 4IM0A 3I4BA 2OJIA 3Q52A 5DFPA 3KCFA 3Q4ZA 1QCFA 5HQ0A 3R30A 3R1NA 2KTYA 5JRSA 3FXWA 3OUKA 1WFCA 3Q4TA 4F9YA 1NT2A 2VWIA 2X7OA 2C0IA 4O2PA 4RZWA 4XLVA 4HVGA 3SGCA 2XNMA 2PVMA 3V5PA 2VTSA 2IZRA 3ZLWA 2ZDUA 1URCA 3QC9A 1T46A 3E8NA 3UVPA 3FZSA 3IECA 3UC4A 5J9YA 2IVUA 3NIZA 3UZTA 3SV0A 3VBVA 5IH5A 2WMVA 2XAOA 4MTAA 3VULA 5IQGA 4RVMA 2GHMA 4CGAA 3A60A 4GG5A 3OWLA 3G6HA 4FK6A 4W8DA 1B39A 1XJDA 2GHLA 3TNQB 1RW8A 4GT3A 5AP5A 1TVOA 3FYJX 4I5CA 2R64A 4S30A 4WRGA 5EHYA 3P7BA 4AE6A 4YSJA 3G2FA 3U6HA 3BQRA 1FBNA 3NNVA 2CNVA 4MF1A 2YA9A 1BYGA 2AYPA 3CKXA 5BVEA 4FTQA 3PUPA 4NW5A 3W8QA 2V0DA 3IO7A 3T9TA 1ZOHA 3M42A 4KIKB 5DOSA 3RHXA 4D1ZA 3LAUA 1IA8A 4W9WA 1YXXA 1H07A 2JDOA 3R8PA 3GQLA 2X0QA 4QPSA 4A4OA 4D4RA 1BLXA 5I9WA 4UZDA 2YEXA 3NW5A 1SVGA 4G16A 4Y73A 4I41A 2Z7SA 4O21A 1YHSA 4B8LA 4YZBA 2I1MA 2YIWA 2OBJA 3AG9A 4L46A 4W4XA 5HORA 2VWVA 3NS9A 3BHTA 4M15A 3NRMA 4YJVA 5FG8A 4FX3A 4O0UA 2VTJA 5IA0A 4IZYA 3VQHA 5KNJA 2WTKB 4GMYA 3O23A 5HOAA 4ASXA 1FVRA 1PXKA 3BEAA 3ZM4A 4OTRA 2CLQA 5FUTA 4U6RA 4OTPA 4NUSA 1IEPA 5J95A 3ZCLA 5KUPA 4DE4A 1WVXA 2CKOA 4TNBA 4M66A 4O6EA 3FQSA 4BICA 2X7FA 4ZIMA 1GNGA 3NNWA 3C4WA 4K8AA 3W55A 3SXRA 3VRZA 4M97A 3OZ6A 4JAIA 3ZC5A 3DOGA 4WNMA 3C7QA 4QQ5A 2VAGA 3QF9A 2ETKA 4MH7A 1RE8A 4WBBB 1R0EA 5HVJA 4JBPA 4D2PA 4MD8E 4DCEA 1OL5A 4TKSA 4UXQA 5CF5A 1IRKA 4CG8A 4X3JA 4ZLYA 4BDHA 4WT6A 4USFA 2W17A 4ERWA 3PZEA 3OBGA 2PE0A 3R2YA 4I0SA 2XVDA 5EDPA 1CDKA 1H0VA 2UZUE 2A98A 5K0XA 4FEXA 3R04A 4WKQA 2EUFB 4EHVA 4FA2A 3UNKA 2X4FA 4AW5A 4F0FA 4KBCA 2XH5A 2UZDA 5BUIA 3QTQA 4MNEB 4BCGA 3L8PA 3QQKA 3FI3A 4FKLA 3W8LA 4E20A 2JIIA 2O5KA 4JL9A 3ZUTA 2NNWB 3A8XA 4MWIA 2E9UA 3BV2A 4LV5A 5DHJA 1ZOEA 3C5UA 3UPXA 3JR1A 3D7TA 4FKIA 3P08A 4FKQA 2ETMA 3KMMA 4O38A 4GUBA 1FMOE 1Z5MA 3WYYA 3BKBA 4ALWA 3PJ8A 3G0FA 4AW0A 3EN7A 2JDSA 5FP6A 4N4SA 2VTHA 3DZQA 4BDIA 3OS3A 4W4YA 1PXLA 1XH8A 4FL2A 3FZRA 4PY1A 2YITA 3PPZA 4FEQA 3SKCA 3MW1A 5HKMA 2QU5A 4IFCA 3U8WA 3PY3A 3ZZEA 4JQEA 1M2RA 5BYYA 4MAOA 2R3OA 4M12A 4I6QA 1G8KA 5K4JA 4FRFA 3KXNA 3QU0A 4XV9A 3EQBA 2F49A 4HPUE 5F1ZA 3D5WA 2VZ6A 2DYLA 5BUJA 3RNIA 2QR8A 3EFJA 5ETIA 4ASDA 1OVEA 4M13A 2IEWA 3Q9XA 4DC2A 4FIHA 2X1NA 4QP3A 4EK8A 3TV4A 4TW9A 3LOKA 3EYHA 3JVSA 3EQGA 4UXLA 5AAFA 4K0YA 5AA8A 4F7LA 4XHKB 3ANRA 5BMMA 2R0UA 4XBRA 2WEVA 4F64A 4WIHA 4L43A 4KWPA 2PMNX 3ERKA 2RIOA 5HG7A 3OHTA 4BHZA 3ZM9A 2DUVA 3MJ1A 3KXMA 4XG2A 5C1QB 5C8KA 5ANEA 4G34A 4PL4A 4QQJA 4PL5A 4WBOA 3ITZA 3CE3A 5GJGA 4I5MA 1ZMVA 4JXFA 3UGCA 4YURA 2GPHA 4QMWA 4QDEA 5HE2A 4BIBA 2F7XE 4E4MA 3LCDA 1H1WA 3VVHA 4QPAA 1TKIA 5C27A 3LW0A 5HNBA 4R3RA 3UE4A 4FKTA 1FQ1B 4L8MA 1OUYA 3D5UA 2JKKA 4FV0A 4BDJA 4TRLA 1M52A 2HXLA 5HG8A 2B0QA 5IQCA 2W1HA 4FVPA 3G90X 4ZJVA 4XG3A 3R63A 3PA4A 4FUYA 4LMUA 5CNNA 5CZHA 1M7QA 4EK3A 2JBPA 3KF4A 2ITPA 1XO2B 3BELA 2BUJA 3VBYA 3PJ2A 5BVDA 3QTZA 3IKAA 2VTTA 3BEGA 1X8BA 3TEIA 4AT3A 2QODA 2CDZA 1P5EA 4LV8A 4O27B 1KE6A 2VTMA 5BVNA 5HD7A 4EJNA 3GCQA 4TN6A 4WUNA 3N4TA 5ANGA 4RSSA 2UW0A 3UPZA 5GZ9A 4TYIA 2O0UA 4R1VA 1PXIA 2PVJA 3NFGB 4LG4A 2YFXA 4O0TA 2Y6OA 4RT7A 5DWRA 3H9OA 3QZHA 3V3VA 2VD5A 3C9WA 3V5TA 4ZAUA 4FYOA 3I1AA 3CQWA 4GSBA 5KKRC 1OKZA 4TZRA 4EH3A 4FEVA 2XKDA 3MBLA 1OGUA 3DJ7A 2YAKA 4EZ7A 3QQHA 3FMHA 3GFEA 4NCTA 2XRUA 4U42A 4RGJA 4USDA 3QZIA 4NTTA 2UZOA 3CBLA 1YKRA 3KRXA 3NYNA 3KCKA 2XM9A 3KVWA 3BL7A 2QOHA 3EB0A 2C30A 3MB6A 4PMMA 3HAVA 2ZOQA 2OFUA 4BCIA 3LM5A 4DINA 4BBFA 5FTOA 3N9XA 1W0XC 4OBOA 3HRBA 1WZYA 1JBPE 1H8FA 3BPRA 4IX5A 4V05A 5HCXA 1P2AA 1XHAA 3AD6A 4JJRA 4LUDA 3PPJA 4O0YA 5CQWA 2JC6A 4XRJA 3E7OA 1WAKA 2J51A 1Q24A 2H9VA 2OICA 3HV5A 4X2NA 5DNRA 3REPA 4RX5A 3HGKA 2ERZE 4IFGA 4KA3A 5HBEA 2CCHA 2PZPA 1H27A 5KMJA 3ZFMA 3ZDUA 4DH8A 4Z16A 4R78A 3IW4A 3QCXA 4GU6A 4V0GA 3A62A 3W33A 4FKUA 2O2UA 3LCKA 4ZSJA 1O6LA 4EOKA 4QP4A 3NUYA 3RK7A 4FT5A 4WG4A 2W4OA 3P9JA 2C6TA 3ZS5A 4Y95A 3BE9A 4L67A 2F57A 2J0LA 3NAXA 2GMXA 2PVFA 4FBXA 4RZVA 4BTKA 4BB4A 5A6OA 4B99A 2B4SB 2QNJA 2YDKA 3D15A 5IQFA 4YC8A 1YWNA 2P4IA 3QX4A 1FVVA 3EQFA 4EHGA 3LLAA 5IA2A 5KMMA 3ENHA 1W7HA 2C5OA 4X0MA 5AWMA 4DHJA 4ZSGA 3BYMA 5HHWA 3OFMA 3IOPA 5CT7A 1OPKA 2WGJA 5JFWA 3RPVA 4MYGA 3BYUA 4DN5A 2BDFA 4F70A 4F99A 5HNIX 3LXPA 3Q4UA 5AUYA 3OCTA 5L2TA 3PYYA 2PULA 3NDMA 4IWQA 4NJDA 1W8CA 5CEQA 3IONA 3MV5A 4C35A 5LOHA 4YLKA 3AC1A 4RMZA 4I0TA 4N0SA 5TT7A 4UX9A 1OIRA 3C5IA 1FMKA 3F5GA 3TNIA 3MGYA 4D1SA 3D2IA 3FMMA 2B1PA 2XIYA 2GS2A 3DLSA 3OEFX 5LVOA 3MY1A 3TACA 3E64A 3IOKA 5HU3A 3PZHA 4CZTA 4BR3A 2E2BA 2YIRA 5AUZA 4FNXA 3UODA 3VW8A 4I1ZA 4QYEA 3KA0A 5CWZA 4DLIA 2QKWB 4IAIA 4HGEA 1KOAA 2XK4A 4MXXA 2W1EA 3MDYA 1LPUA 4AN3A 3DQWA 3V8SA 2WEIA 4IACA 5M56A 4RJ5A 3P1AA 5C4KA 1KOBA 3EFWA 4FIGA 3DDPA 3AXWA 1KV1A 4IH8A 4WNPA 4IWOA 5DEYA 2BZJA 3E7VA 2IZUA 3F3VA 4IB5A 5JGAA 4NL0A 5DBXA 4O0RA 3OBJA 3LHJA 4X6RA 4BRXA 3C4XA 3D14A 3PSDA 4GV1A 5KHXA 3VBQA 3PFQA 1CTPE 5JKGA 4G6NA 4ACHA 4CCUA 3UO5A 4XYFA 1OIQA 3F88A 2PTKA 2YHVA 1DS5A 3R7GA 3AKKA 1ZYDA 3KK9A 1J3HA 3JY9A 2QD9A 1A9UA 3PLAE 2NYAA 2JD5A 3QKMA 4DG3E 3LXLA 3PWYA 4DFXE 5JFVA 2C5XA 4BDBA 4LGHA 3ZXZA 2Z7QA 1OITA 4GIIA 3PXKA 5BYLA 2O64A 3BYVA 3MY0A 2B54A 4I6LA 3JPVA 2FSLX 4MD9E 4WNKA 5AV3A 3VWAA 4AZTA 5IUHA 4J98A 3U6IA 5EFQA 2ZM3A 4D2WA 5I4NA 5FQDC 4AW2A 1OB3A 4XG7A 1PKDA 3U51A 5M44A 1ATPE 2YISA 2A19B 2C6MA 2F4JA 2PL0A 2C6IA 3JUHA 3MN3A 3GU4A 5HCYA 4BWKA 4CT1A 4QMNA 3SVVA 3KQ7A 2BRGA 1YXUA 4Z55A 5FTQA 4FKOA 4WSQA 3ZU7A 2YCRA 4PX6A 3OW3A 2WB8A 2G15A 4ZTHA 5GNKA 4QMMA 5HI2A 3FPMA 2XF0A 5DN3A 4ZTLA 3D2KA 5H9BA 4J7BA 4NK9A 1YWRA 4AGWA 3QALE 5DPVA 5C01A 2FH9A 4ZEGA 3P79A 2VUWA 3QD3A 4C37A 1MQBA 4BYIA 2X8DA 3UOKA 3LPBA 3OW4A 5CANA 2JKOA 3QUEA 4R3CA 2VO0A 5HBHA 3VRYA 3F3TA 4CKRA 1B38A 1Q8TA 3LFFA 2OK1A 3EJ1A 3UNZA 4W8EA 4DTAA 4GL9A 2GNIA 3AQVA 3V8WA 1V0BA 4AFJA 3ZRKA 4FEWA 3PG3A 4DCAA 2ITQA 5D11A 2PVKA 4AOTA 2W96B 4BTJA 5A4QA 5JT2A 3I7CA 3NCGA 4RIOA 1LUFA 2XKFA 2W9FB 3NVKI 3H4JA 3KY2A 4E93A 3GNIB 4LOPA 4WD5A 3VNTA 5GZAA 5EI2A 1Y57A 1ZYCA 2ETRA 3EFLA 4PDPA 4GJ3A 3MTLA 2FSOX 4J95A 4B0GA 3C1XA 4D4YA 3W0MA 1LEZA 3A7IA 3K2LA 4GFOA 3DPKA 3QCSA 5CI7A 3PTGA 1OZ1A 2VTOA 2X9EA 4O4CA 4FT7A 3N51A 5L2IA 3ODYX 4KABA 3HAMA 4B4LA 1CMKE 2P33A 3E88A 1GOLA 2SRCA 3KRRA 4UB7A 3KXHA 4A9RA 2X6EA 2YCSA 3Q2MA 5BVWA 3VONA 2HZ0A 2QOKA 2OZOA 2J4ZA 4BVUA 2CN5A 4DA5A 4R3PA 2X7GA 4MBLA 4F9AA 3HV4A 3O7LB 4FVRA 5FM2A 4YJTA 3DKFA 3PWDA 2WO6A 5AP3A 4CMTA 5A6NA 5AV4A 2BILB 3MH2A 4FE2A 4KRCA 5AP2A 4GRBA 3ZO4A 1XMLA 2C6KA 3IW7A 5DA3A 4IAZA 1VEBA 5IF1A 4K18A 1GZKA 3UTOA 2FSTX 1JSVA 4OTFA 4C0TA 4RX9A 3RHKA 3C0GA 2W5BA 3DTWA 3ID6C 4O7ZA 5CVHA 3PRFA 4ZZNA 4IDVA 5BNJA 2PPQA 3HMIA 3PSBA 3M2WA 3AOXA 4X3FB 1ZLTA 2VWBA 3MJ2A 3HMMA 5L8KA 1SVEA 2GS7A 2X2MA 3QC4A 4ANLA 4GU9A 4EOOA 1H28A 4EKKA 5EHLA 4ENYA 5J5TA 2CJMA 5IA1A 2QLUA 3LFBA 3PJCA 1YDTE 1G8JA 3PIZA 2CNUA 1JKLA 4U97A 5ANIA 4PV0A 4CLJA 4I4FA 1WBSA 2XBAA 2RF9A 4XLIA 2R3JA 5F9EA 2DWBA 4DHIB 3GC0A 3POZA 1JKSA 1JPAA 1Q61A 3GCPA 3P86A 3QZGA 5EDQA 3MVLA 5EI6A 3S4QA 4EWQA 5HTBA 5M57A 5G6VA 1H1SA 2GU8A 2JIVA 4BWXA 3PRIA 4X2FA 4E4XA 1PF8A 3HZTA 2PZRA 2YM7A 4JBQA 3E5AA 2ONLC 4TYEA 4DEEA 2XYNA 3GC9A 4FSZA 4LFIA 3R7VA 3ZRMA 5CAQA 3PLSA 3UG1A 3QYWA 4QYGA 4E1ZA 3MS9A 2W0JA 2YDIA 3ZHPC 2WMWA 2OU7A 3GENA 3F2RA 2C5NA 2YM3A 3PVGA 4IX6A 3GC8A 3QLGA 4FG7A 4EQMA 2XIKA 4QP6A 5AP7A 4HVIA 1Z9XA 4IVCA 4YMJA 3BU3A 2WNTA 2VO7A 4O1OA 4F9WA 4I22A 3Q96A 4R8QA 3D4QA 4TWNA 4DAWA 3G51A 4FSMA 4QQCA 1UNLA 3COKA 5KO1A 3LFNA 4M14A 3TN8A 5AEPA 4QYHA 2WELA 4RIXA 3UIBA 3GVUA 5CI6A 5EOBA 4I6BA 5I9XA 3BE2A 3SW7A 2JFMA 2VX1A 3F3WA 2J9MA 2HZNA 1Q99A 3WZKA 4D4VA 2OJ9A 5L4QA 4IAYA 4IVBA 2B7AA 4G1WA 4AUAA 4O1PA 3HYHA 1GZNA 3BI6A 4ZJIA 3UIUA 4ANBA 5CEKA 4DGGA 2XNBA 5L8LA 2NRUA 1K3AA 2XIRA 3QTRA 5FEEA 2VGPA 1JVPP 3E8DA 4FVQA 4L44A 2KULA 4F1OA 3GI3A 2HELA 2C6EA 4EYJA 4BGQA 3W0QA 1P4FA 5HO6A 3H0ZA 4MXAA 4ACDA 4D28A 2WMTA 2YIYA 1J7LA 3PXFA 4TY1A 1GAGA 4QP1A 3V5QA 3G9NA 3FKLA 2PVLA 3BWJA 4R7IA 4UYAA 3UZRA 1FGIA 3NYVA 4QP9A 1PYEA 3RCDA 2CGVA 4L52A 1XR1A 5T3QA 4AZEA 4ANMA 5LVMA 1E9HA 2X9FA 2ITUA 3A61A 5J8IA 1U54A 5HX8A 3W10A 1GZ8A 5CVGA 2I40A 2J0JA 5IG1A 2Y4IB 2J90A 5AP1A 4M67A 4UWYA 1WVYA 2BZIB 4IZAA 3VQUA 2W5HA 2XKCA 3BL9A 4FZFB 4LM5A 2PUIA 3ORTA 3CD3A 3F5XA 2ITNA 3FJQE 3L9NA 5AV0A 3A4PA 3HDNA 4FICA 4FT0A 3ZRLA 4EUUA 4BCOA 2IG7A 4C59A 3BBWA 2WTIA 5TE0A 5CEOA 1XBAA 3KFAA 4YZDA 2GTNA 4DT9A 3HMNA 3II5A 4QP8A 3H9RA 4BWPA 4ZP5A 3FWQA 3VUGA 4O22A 4O7RA 4R5YA 2XYUA 2Z60A 1NVSA 3QTWA 5D12A 5E4HA 4MF0A 3CIKA 2WQOA 3MVJA 4IX4A 3TNHA 3WBLA 3FL5A 5JZJA 3CQUA 4ENXA 5E8ZA 2V7AA 3L9PA 5I9VA 3RPSA 2OXYA 3PA5A 3RZFA 4CNHA 4OGRA 4S33A 4WRSA 4EK6A 3R73A 2B9FA 5ETCA 4I5PA 3QQUA 2WU7A 4FV1A 4ZZOA 4RWKA 4GFGA 5HD4A 2X0GA 2G2FA 3BWFA 4R77A 3V51A 4KIKA 3RMFA 3OOMA 2HYYA 2I7QA 3LVPA 3Q4CA 1Q5KA 3O50A 4YJOA 4M84A 2Y7JA 3SC1A 3QQJA 3AT3A 1BUHA 3R9OA 2WTWA 2ZV7A 1J7UA 4JQ8A 5GIPE 2GHGA 4DLJA 4LOOA 1LP4A 3QRJA 2RFNA 4GW8A 3TZ7A 4FSWA 4D58A 5LARA 4BL1A 3RAIA 4CG9A 4EZ3A 4FTMA 1Q3DA 1MRUA 3QAME 4M0ZA 1O6KA 3KRJA 4F7SA 5IQBA 4ANNA 4FTIA 2W05A 3OUNB 3QA8A 3R01A 5DR2A 3W2PA 3K5UA 1W2DA 3LKMA 2YCQA 4DYMA 3CPBA 1XH5A 3FUPA 3KMUA 1OM1A 2HWOA 2X4ZA 2W1ZA 4BDDA 4C61A 3FMEA 2ITVA 4J8MA 2JBOA 4IC7A 4FOBA 4F1MA 3CTHA 5IQAA 4YC3A 4BF2A 5BMSA 1XMMA 4AN9A 4G6LA 3MTFA 4M68A 4AXDA 5AIRA 2ZAZA 3UP2A 3L9MA 2VNYA 4LV7A 4FV8A 3U55A 1G5SA 2RFEA 1H25A 3ORIA 3Q32A 2BFXA 1VJYA 5BYZA 1G8AA 4BFMA 5M51A 4JAJA 3UVQA 4K9YA 3AC2A 3AMAA 2HZIA 2UW7A 5DGZA 3G5DA 4Y5QA 2HZ4A 4O0XA 4FTRA 1SM2A 4EYMA 4ANOA 1OECA 4QOXA 5AR3A 2BZHB 4NTSA 4RBLA 3FLZA 4FUXA 1JKTA 3MIYA 1FOTA 4FGRA 3TMOA 3LQ5A 3QTIA 3GEQA 4FZ7A 4D5KA 4C4FA 1NW1A 5EQEA 4TYGA 4GYGA 4MNEA 3N4VA 4J52A 3JS2A 5E8YA 3HVCA 4YTIA 4AS0A 3RPYA 4ZTQA 4ZXTA 1WBPA 3GGFA 5LWMA 1H01A 4GK4A 2VTLA 2O63A 5DLSA 5JEBA 4NSTA 4IB0A 4C34A 3E87A 3RINA 4NKSA 4AAAA 3VHEA 4CV8A 3DFAA 3HL7A 3CC6A 3L8VA 3RK5A 4AOIA 3QUDA 4CV9A 4DGLC 4ZLZA 2IJMA 4FTTA 1PXJA 3OVVA 4U43A 3HMOA 5AX3A 4YTFA 4MXOA 4FIEA 4RFYA 4C57A 1NVQA 1UU7A 2E9PA 3NSZA 3O8PA 1OKWA 3TDVA 3FLWA 4IHPA 5E8TA 3WF5A 5IA3A 3PA3A 2B53A 3UDSA 4ASEA 3ML1A 5M53A 2XJ0A 3QD0A 3CPCA 2F2CB 4YJSA 5ANOA 3FMJA 4YZNA 2J5FA 4A4XA 2QO2A 3BBTB 2GS6A 4AGDA 4JRVA 4O7NA 3EQCA 2A1AB 2QO9A 4IM2A 3SOAA 1BMKA 4YBJA 4AW1A 2IW6A 4DDGA 2VN9A 4I3ZA 4FL1A 4FTLA 3VUHA 4ZTMA 3R22A 5JH6A 5HU9A 3NW7A 4NM5A 3TG1A 5A4EA 3UIMA 2VTPA 2WMXA 3CQEA 5CU6A 3QTXA 4IB1A 4IX3A 2PZ5A 1Q8YA 2B55A 3V8TA 2BVAA 5CSVA 2AC3A 5IISA 4Y72A 3AGMA 5IEYA 3ZBXA 4O7VA 3R21A 4M69B 1PHKA 4DGNA 4RG0A 4ZY5A 1IASA 4X2JA 1OPLA 3WZUA 4U7ZA 4CCBA 5IEVA 1AQ1A 1JWHA 4FKGA 2UW3A 4LRJA 4WOVA 3NMUF 2WMRA 4ONAA 4PNIA 3NUXA 5DH3A 3DFCB 4IVDA 1VZOA 1ZYLA 3ZUVA 4D4SA 4UY9A 4RVLA 3U6JA 3LFSA 1STCE 5FXSA 4BDFA 4AWIA 4ZMEA 4E5WA 2FB8A 1JKKA 5E91A 4XNEA 1IAJA 3FLNC 4ACCA 1SNXA 5CAOA 5IQHA 1SMHA 2XKEA 3BHUA 2PMIA 1YOMA 2DS1A 5FEQA 3MH0A 3FL4A 5DR9A 3HECA 3VBTA 4PPBA 2QOCA 5HG9A 3DQXA 3GP0A 4JBVA 3O51A 3Q04A 2VGOA 4FKPA 4BKZA 2OXDA 3R71A 4EK4A 3BLRA 3CD8A 4PRJA 2R3RA 4G17A 4JDJA 4E7WA 4EQCA 1PXPA 4A7CA 4HGTA 3AC5A 3VUDA 3FEGA 3AD4A 5E8VA 5IA5A 4AE9A 3R8VA 1YHVA 2V62A 3T3UA 5EYDA 1J91A 3UJGA 3CR0A 2WTKC 4NM7A 2YERA 5E8XA 5EM7A 3RWPA 5I0BA 4MK0A 2BHHA 3OMVA 4IAFA 2H34A 2WTCA 3P23A 4RQKA 5KX8A 5C8MA 3LJ2A 1QMZA 5EHOA 2C69A 2HENA 3FMDA 3R8MA 1TQMA 3IPHA 5AUUA 1YVJA 5A9UA 2C1BA 3JY0A 3RPOA 5DT3A 2GNFA 4AX8A 3P78A 2WQBA 2ZV8A 3BU5A 4FZAB 4XP0A 2B9HA 5DRDA 4TPTA 5L6WL 2J2IB 5ANKA 5H8EA 2XJ2A 3ZONA 2PSQA 2QO7A 2WOTA 3DB6A 2R7IA 2IW8A 3LCTA 3SXFA 5M4IA 4BKJA 1CM8A 5IQEA 1DAYA 1PMEA 2EVAA 3OTVA 4L00A 4U8ZA 4YO6A 3V04A 3FQEA 1GIHA 2ZFYA 3H9FA 5AX9A 2OZAB 2WTDA 4B6LA 2VWUA 4JG8A 5L6PA 2R3KA 3VO3A 4E6QA 4DFBA 1SVHA 4Q5EA 4RFMA 4XOYA 2C3KA 2HAKA 2C6DA 5M55A 5DVRA 4FNWA 4YJQA 2EU9A 2G9XA 2P0CA 3R6XA 4GIHA 4UBAA 5KKRB 3FI2A 3Q9YA 2VTIA 4O7YA 2C0TA 3FKNA 5AJQA 2UVYA 1M14A 2XEZA 3ZSGA 1YI4A 4EH2A 3UBDA 2B9JA 2IZSA 4G2FA 3TV7A 4F1TA 3C13A 3ZLXA 4PF4A 4YC6A 3HP5A 4ZMFA 1XBBA 1YHWA 3F7ZA 2VO6A 4TYHB 5EK7A 4RC2A 4BHNA 4BN1A 3E63A 4XG4A 2A4LA 1LR4A 3E93A 2QOOA 4II5A 3EFKA 2W4KA 3DU8A 3I5NA 4HCVA 4JVGA 5TOZA 3O71A 1JAMA 4DEDA 2Q83A 4XCUA 3FSFA 4H05A 4EH9A 4AA5A 5JGBA 5HIEA 2CMWA 3DBDA 3HRFA 1K9AA 5FBOA 3DK7A 4M3QA 1BX6A 3QHWA 3PDTA 4BDAA 3WE4A 4FIIA 3RJCA 5ETAA 5HEZA 2OJGA 3HV3A 4HZRA 3N4UA 1FPUA 2JIUA 2W99B 1I09A 1UNHA 4P5ZA 2CKPA 3MVHA 3BYOA 3CJGA 4BI0A 3R2BA 1QPEA 1MP8A