4AN2A

Crystal structures of human mek1 with carboxamide-based allosteric inhibitor xl518 (gdc-0973), or related analogs.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
282
structure length
282
Chain Sequence
MALGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDEMANEFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPRPPMAIFELLDYIVNEPPPKLPSAVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Carboxamide-Based Allosteric Mek Inhibitors: Discovery and Optimization Efforts Toward Xl518 (Gdc-0973)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
total genus 90
structure length 282
sequence length 282
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2012-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4an2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4an2A01
3R7EA 2WMBA 3VO3A 4MF1A 4AT4A 2BHHA 2C5YA 2B9JA 1ZYSA 4F0IA 3CXWA 1WBPA 1A48A 5H8BA 3L9MA 3TIZA 3FQHA 3GU6A 1E9HA 2ONLA 3A2CA 5T68A 3MY5A 2Z8CA 2WFYA 2WGJA 3HMNA 3O23A 4MXZA 4QMUA 2XNBA 4E20A 4BWKA 2UZBA 1IA9A 3IOPA 2UW5A 3OCGA 4LGGA 2QOFA 3OD6X 4MCVA 4PDOA 2PULA 5AUWA 5G1XA 4CMTA 4YURA 4JDKA 3I81A 3RZFA 4BIEA 3DK6A 5J1VA 4LGDA 2F57A 3GNIB 4AP7A 4MNEA 2B0QA 3MH2A 4U79A 4FZDB 4QQTA 4DBXA 4TYHB 2XM8A 3NW7A 1PF8A 2X7OA 3VN9A 3K3JA 3MN3A 4ALVA 2IN6A 2YM3A 2EB2A 2XNPA 3FZSA 4FG8A 2J5FA 2ETMA 4GRBA 4I0RA 5CQUA 3RAHA 5A14A 4XG8A 3R8VA 4JX7A 5HVYA 4JVGA 2SRCA 5T6KA 4ACCA 4KBAA 4DEHA 4DLJA 4EH6A 3BWJA 4I1ZA 3ID6C 3LFNA 2RFNA 1WBOA 3O7LB 2X39A 1STCE 3NW6A 5ANKA 4CFFA 2CN8A 2HZ4A 2BIKB 3E7VA 5HICA 3SX9A 3A62A 4MVFA 4D2RA 2QU5A 2BROA 4L01A 4RX8A 3OMVA 3VS3A 4RT7A 2VO6A 4DH5A 5E4HA 3ITZA 2EUFB 3MFSA 3SXFA 2ZV8A 4QMQA 2ZYBA 3COIA 3MW1A 5AV0A 5HD7A 1BKXA 4E3CA 2F2UA 4A7CA 4ZY5A 1T45A 1YI6A 4WNKA 4FSQA 4DFUA 1WVYA 3QLGA 5EM7A 4YLLA 2PWLA 2OW3A 3R28A 4G17A 4A4OA 4AQCA 3C9WA 3V01A 4FSMA 4BCMA 4BYIA 4M7IA 4G16A 5JN2A 2VWBA 3QKMA 3QYWA 3ORPA 3BBWA 4APCA 3C0HA 1U59A 3K5UA 3R83A 3KF7A 3BU5A 2XKEA 2OK1A 3LE6A 4WD5A 4QTDA 5HIDA 2JAVA 4WRGA 2C5XA 2OF4A 5E8UA 4ZTQA 4DHFA 2WHBA 1YXSA 4BI2A 3PSDA 4X2KA 3ODZX 5CWZA 4OW8A 2I0EA 2XK9A 3BU6A 3CE3A 2PVJA 1SM2A 4HNFA 2B54A 4JG6A 4R8QA 4XP0A 4K6ZA 4R3PA 4CZTA 4ASZA 1ZZ2A 5DFPA 1YVJA 3K54A 4BGHA 4AFEA 3ACJA 3CIKA 1YXTA 2BZKB 2P55A 5AFVA 2BDWA 4CXAA 1OUKA 2PUUA 5DR6A 4DTKA 4F7NA 2BZJA 4OR5A 4RPVA 2J0JA 3JS2A 2OGVA 4KKEA 4RC4A 1FINA 5HGIA 4EI4A 4FIJA 2ITOA 4D58A 1EH4A 4RIWA 4EOPA 5EI2A 4RX5A 3TZ8A 2C3KA 2XUUA 2YM6A 1ATPE 4BDKA 3M1SA 5BVNA 5IISA 5CYIA 1R78A 2X6EA 1PXMA 4C38A 4GMYA 4MHAA 1KE7A 4YNOA 2XBJA 3BU3A 4FVPA 2PE0A 2X7FA 5C4LA 4F9YA 4QP2A 3VAPA 2XKDA 4AA5A 3WI6A 2VNWA 2O5KA 2YLEA 1P4FA 2VN9A 5M56A 3ZXTA 2UZLA 3R2BA 5IA1A 3L8SA 2W1GA 5CEQA 1U54B 5J87A 4M13A 4R5SA 5CEPA 2XJ1A 2ZM4A 3NUYA 1M2QA 3EIDA 4FSUA 3CTHA 1NVQA 4FE2A 2NRYA 3MVHA 3TNPC 4D2TA 3IECA 4YO6A 4FG9A 5IH4A 3HLLA 4L8MA 4D1ZA 3SDJA 4QNAA 3DU8A 5E90A 1PYEA 4TW9A 5E8XA 4X2FA 3SA0A 2WTCA 4LQMA 4UYNA 5LCJA 4J7BA 3PRFA 5A4LA 3UOLA 4CV9A 3T9IA 4BN1A 1FVTA 3DXNA 5CF5A 4QTEA 5K9IA 2WU6A 4EYJA 5AX9A 4ZOGA 3QTRA 5BVWA 4AN2A 4ZTLA 3FQEA 2H96A 2ITVA 3EMGA 3WARA 3UNZA 3WZEA 4TPTA 2CKQA 4LV8A 4Z7GA 4QRCA 2AYPA 4NYEA 3ZO2A 5AP4A 3FMLA 4WNOA 1J7UA 2X4FA 4FNYA 2A0CX 4L53A 5E8SA 2OJ9A 4MNFA 3QKKA 4MQ1A 4WKQA 5AUUA 3ORZA 4R77A 1BMKA 5M06A 1WVWA 3LM5A 3LQ8A 2OO8X 1W82A 2ZB1A 3MDYA 3R04A 4S31A 3U55A 1URCA 3TACA 3FJQE 4O1PA 5CT7A 5JFSA 4I5MA 3E8CA 5K5XA 2J2IB 3BEAA 4L9IA 3DBEA 3HRBA 2XIRA 4WG5A 2KULA 3QX4A 3QX2A 1F5QA 3E87A 4GUEA 1OUYA 4C57A 4PMMA 3L9LA 3F3TA 4NK9A 3KK8A 2OBJA 3NIEA 3O8TA 4I6HA 2YZLA 3THBA 4X6QC 2W9ZB 2CNQA 2W99B 1IASA 3PUPA 5EYMA 2I0VA 4MNEB 3UVPA 1URWA 3C13A 3FBVA 5K3YA 4FSWA 5HEZA 1X8BA 4XX9A 1KSWA 2OJGA 5AP0A 3ORKA 5HU3A 3BBTB 4NTSA 3QAME 3QFVA 2F49A 3R8PA 1FQ1B 4UMUA 3PDTA 2OIQA 3W8LA 4EC9A 3W32A 2VTMA 3B2WA 2AC3A 3ZLWA 4YSJA 1PW2A 3OWKA 3DLZA 4FG7A 2R0IA 4FKTA 4C4IA 5A4CA 4O7YA 4LGHA 3KF4A 4C4EA 3Q4ZA 2QOOA 4X6RA 4E6DA 3EFLA 4DT8A 1Q41A 3OS3A 3F3VA 3WE8A 4RWJA 3UBDA 2C6MA 3PP1A 4FTLA 2Y4PA 4YHJA 5HORA 4KSQA 5LMKA 4W9WA 4E5BA 2XF0A 3EFKA 5F94A 3OWPA 4FTKA 4AW0A 3R7GA 4QNYA 4GL9A 3QRIA 2OZOA 2CHLA 4BCFA 2YCQA 3EWHA 4A9UA 4BBFA 3OY1A 3PXRA 3DQXA 3WF9A 1Y8GA 2RF9A 4BGQA 1GJOA 3C7QA 5AP1A 4YJOA 4BFMA 4OUCA 3TZ7A 3W2OA 2JD5A 2JBPA 4R7IA 3RTPA 1PXPA 4FV8A 5HQ0A 2ZM3A 1PKGA 3H4JA 1QPDA 5EI8A 3NUUA 4ZK5A 3T3UA 5EQYA 3QUDA 2VWZA 3DAKA 3DTCA 3MPTA 3TI1A 4D1SA 5FTQA 3GFWA 5LVMA 3V5PA 1YXXA 3R21A 2QG5A 4B6LA 3OCSA 2PMIA 3LFCA 3PWYA 5AP7A 3UQCA 3HMMA 3DS6A 3ZCLA 5CAVA 4QMZA 3EN4A 2BZIB 3FI3A 1GNGA 3W18A 3OOGA 5E8VA 2VX0A 2YITA 3PXZA 4FVRA 2IW6A 3E8EA 1B39A 2WOTA 3PJCA 4YBKA 3UG2A 4D0WA 3MPMA 4C33A 4F9WA 1NT2A 3ZFYA 4DG3E 3RBWA 3W33A 4BCGA 1E1XA 3O8UA 3GC0A 2UVYA 3KULA 4YJVA 2PE1A 3RGFA 4ANOA 2VUWA 5DG5A 4OAVB 4W4WA 4O2PA 2X8DA 5JSMA 2YIXA 4EHGA 3ZRKA 5J7BA 5F9EA 4O7LA 2RFEA 5GNKA 4BHZA 2X2MA 3C4XA 4BCPA 5IUHA 5GZ9A 5HOAA 4XEYA 2C5VA 1JVPP 1YXUA 3BCEA 3G33A 3MSSA 4YR8A 5LXMA 3NVMB 3NYNA 4E1ZA 2Z7QA 1PMEA 2H9VA 2WTIA 4F6UA 4IWQA 4I5HA 3UIMA 3VUDA 3A4OX 4DF3A 5AV1A 3EL8A 3SV0A 4TKSA 4XV9A 3QCQA 4ZMFA 3QA8A 3OY3A 2CGVA 4DN5A 3BI6A 5ANEA 3HV3A 4OLIA 4AGDA 3C0GA 4FODA 3VRYA 5IUIA 3UOHA 4TY1A 3VBQA 4AZTA 3CQUA 1OL6A 5IEVA 3SXRA 4RLLA 2XS0A 5HD4A 5AAFA 5AAEA 1W98A 2UZOA 2ZB0A 4O96A 4HVIA 5IDNA 4L68A 4JDHA 2BHEA 4EHZA 1GIIA 5ETFA 4YMJA 2J0MB 3D5XA 4PL3A 2EB3A 3DGKA 3KREA 4PP7A 4DEEA 2HWPA 4CD0A 3GU5A 5C8KA 3COKA 3JUHA 2CKEA 2VNYA 4AX8A 4FIEA 1PXNA 2Z60A 4N70A 3MPAA 4E6CA 4QP9A 4YTFA 3U6JA 3MFTA 2W1DA 3QL8A 2HY81 3OWJA 1CSNA 3IW4A 3FI8A 2UUEA 5EDPA 4IBMA 2OFVA 4EOQA 4DFXE 3H3CA 2HZIA 5DN3A 3U54A 5CTPA 4BCNA 3BLHA 3UZRA 4TWOA 5AMNA 3KU2A 4YC8A 4OTQA 3RAIA 5CZHA 3HDMA 3PY1A 1YWNA 1NVSA 2P0CA 4IFGA 1UA2A 2OICA 3QTQA 4MYGA 2QOQA 5AR2A 4USFA 3KCFA 3R1QA 2OZAA 3IONA 5HX8A 3OC1A 3ORNA 3QYZA 3ATSA 1GIJA 3AXWA 4KKGA 3TL8A 5AEPA 2B52A 3TV4A 2UZWE 4BDBA 1NXKA 3FZRA 4UMTA 4O6EA 1SVEA 4FKUA 1Q3DA 3ZOSA 5IMEA 4J1RA 2PVNA 4E4LA 3D83A 4DFBA 2PVLA 4EOKA 5BYLA 1B38A 3WF7A 3QC4A 2XA4A 4H3PA 5HBEA 3ZO4A 4AW5A 5IQHA 4YPSA 2YJSA 5AP2A 4XG6A 2YJRA 3EHAA 5DVRA 1Z57A 3PY3A 4X3FB 4AGWA 2XKCA 4CTCA 5KMIA 4JQ8A 4WHZA 3AC5A 3CBLA 2WMTA 3D15A 4QO9A 2ITZA 1J1CA 3D2KA 3ZMMA 1BL6A 4DG2E 2IPXA 4JDIA 2C6EA 1O9UA 3Q60A 2X81A 3A60A 3CJGA 3KRXA 3W2QA 4OGRA 5AV4A 4C7TA 3GCPA 5IQBA 2X6DA 3S2PA 1P5EA 4D4RA 4PV0A 4Q9SA 5CVHA 4BDHA 3Q4CA 3G15A 2QO7A 3FWQA 3NLBA 3HAMA 5FM2A 3NNWA 3ZM4A 2WELA 3EQDA 1G5SA 2Z7LA 3AOXA 3K2LA 5I9UA 4JG8A 2LAVA 4ANBA 4FEVA 4UX9A 4QYFA 3EOCA 5J9LA 4FUYA 2GSFA 4MKCA 1LEWA 5BYYA 3DBQA 5JK3A 3EN7A 3RK5A 2Y0AA 4GV1A 2XEYA 2OF2A 5H8GA 1ZMUA 4HYIA 3TWJA 5HNGA 3KL8A 2IZSA 3AMYA 1H01A 2VTHA 3FYJX 4JBVA 1JSUA 2C0IA 4ZTNA 4IJPA 1UU7A 4C59A 5BMSA 2WO6A 3LAUA 3OOMA 2XMYA 4P90A 2BFYA 4U97A 4EORA 2BDFA 3DNEA 4NFNA 1ZLTA 2YAAA 3ZZEA 5JGAA 4FMQA 5IMXA 4GSBA 3IDPA 5EK7A 3NCZA 4QP4A 3OBGA 1H4LA 4XYFA 3D7TA 3ZC5A 4GU9A 4O21A 4UEUA 4YJSA 4KWPA 4O0UA 1G8SA 3RCJA 4BDJA 1U5RA 2VWXA 2XJ2A 2G1TA 4EHEA 1OPKA 3QRJA 4PRJA 5KUPA 3KA0A 3DJ7A 3B8RA 4IZ7A 5FP6A 3RK9A 4ORKA 4DINA 1U5QA 2WB8A 4NUSA 1WAKA 4XOYA 3FYKX 4RBLA 3AD6A 3MH3A 5L2IA 3V8WA 4JG7A 4HGSA 3R22A 4AOJA 1IAJA 3E3PA 4HGEA 4QYEA 4ZJIA 5A4QA 4XG3A 3MA3A 2IW9A 4F1OA 3P7BA 3GCSA 3UNJA 5B2KA 4E26A 5AJQA 2BALA 1Q97A 2X2KA 3AC3A 3VC4A 3ZS5A 1OL1A 2G2FA 4GJ3A 4C02A 2UVZA 2RIOA 3P5KA 4EWQA 4RWLA 3R7VA 3RWQA 1R0EA 2GNGA 3GC7A 4RVKA 3SQQA 4AN9A 4FV6A 4FTOA 2ONLC 4ALUA 4F6SA 1ZZLA 1MQBA 5FG8A 4EONA 3AMAA 4F1MA 3HA8A 5CU3A 2BTSA 4NM7A 5TKDA 3BHYA 3F88A 3R01A 4AZSA 5HIBA 3DJ6A 1YW2A 4HVGA 3F3ZA 4O7SA 5J8IA 2GS6A 3HV5A 4KNBA 5I0BA 1CMKE 2C1BA 4IAYA 2PVFA 2A19B 4BYJA 3OZ6A 4YZ9A 3W2CA 2E9NA 2OZAB 2HENA 3U9NA 3P23A 3RHXA 4HGTA 4EOJA 3NUAA 3A7JA 4OBOA 5CNOA 3OXTA 5DE2A 3S0OA 4ENYA 1MRVA 5KCVA 4OTGA 4L46A 3GBZA 4ZSJA 2DWBA 5EM5A 3PIXA 2YDIA 3UP2A 3WYYA 1CM8A 2PMLX 1ZOEA 3EQRA 4DITA 2W06A 3HV6A 4QYYA 1PXLA 2BRMA 3ANRA 1YDSE 1J91A 3FXWA 5HESA 3FXZA 5LQFA 4B8MA 4OTPA 4NM0A 4IVCA 4M12A 1YXVA 4EK5A 2IZTA 3GT8A 4OT5A 4DEDA 4EH5A 1WBNA 4N4SA 4ITJA 1BYGA 1Q5KA 5AP3A 3ZXZA 2YACA 3HKOA 5HE1A 3DDQA 4G6LA 5AUVA 2NP8A 2VTSA 4EJ7A 3VUMA 3HMPA 3LQ3A 4XRJA 4W4YA 2QNJA 5FTOA 4RGJA 5DR2A 4WG3A 2CDZA 4KS8A 3KC3A 5HE0A 4CNHA 4FBXA 1QPJA 3SW4A 5B7VA 3FZTA 1MRUA 3CY2A 3ALNA 3IG7A 4AZWA 4RX9A 4HCUA 4D28A 4GFOA 1NVRA 4S33A 3WE4A 4X0MA 2C3JA 3FKOA 3SXSA 3BPRA 2W1ZA 3OUNB 1M14A 1OM1A 3G9NA 3OEFX 5BUIA 2YEXA 3OW3A 3Q9YA 2ZDUA 3CSVA 3HRFA 5A54A 4Y5QA 3BELA 1DS5A 2E9PA 2PVMA 1Q8YA 3ODYX 1S9JA 3D5WA 3LFFA 4U7ZA 2HXQA 5D9HA 3AT3A 4ZSLA 3UO5A 4DG0E 5A46A 1R1WA 4KBKA 4ZSGA 3E92A 1U4DA 4FK3A 3POOA 4C3RA 1DAYA 2FVDA 1XH8A 3EYHA 4H39A 2JDVA 4NKSA 4NWMA 4QTAA 3JPVA 3R8MA 4E4XA 1HOWA 3D2IA 5CAUA 2HYYA 5KZ0A 1YHWA 2E9VA 2UZNA 3L8VA 4KINA 5CZIA 3NCGA 1IEPA 1JNKA 3FI2A 3R8UA 3QALE 5A6OA 3NAXA 3MWUA 4CLIA 3PRIA 5LMAA 3HYHA 4PPBA 3R9NA 1WBWA 3QF9A 3HGKA 2J6MA 4P5QA 2XNNA 4RMZA 4RZVA 3FXXA 3R02A 3QCYA 4H3QA 3IDBA 4WG4A 4C58A 1QPCA 3Q2MA 4UXLA 5JGDA 2A27A 2B9IA 4E8AA 1OIYA 4LYNA 4KRDA 4KB8A 2FGIA 5CF6A 2VO7A 4FV7A 3ZBFA 1Q61A 3MFRA 5EW8A 1YOJA 3COHA 4O83A 1J3HA 2C6LA 2J0KA 2QOLA 2CCIA 4LMNA 3WYXA 3NUPA 4BTKA 2XRWA 5LWMA 1KV2A 5AP5A 2WIHA 4QPSA 1F0QA 1GAGA 3LLTA 4IAFA 4TZRA 5EKOA 4CRLA 4X2GA 2V5QA 4I21A 4YTIA 1AGWA 2HWOA 3PVWA 5IKWA 2ZAZA 4L44A 2XCHA 4NTTA 2JKOA 4I94A 2I6LA 3GOKA 3L8XA 4DT9A 5FDPA 3QTXA 5BVFA 5HTIA 4RLKA 3DLSA 1PXIA 1FMKA 3LXKA 3R8ZA 4NL0A 3AD4A 3PP0A 4FKOA 4IC7A 3NMUF 3CTQA 5KBQA 4O27B 5HVKA 2CCHA 4K8AA 2Z7RA 1ZOHA 3KXGA 3NUNA 3M42A 4FGBA 4FYNA 1YI3A 4MWIA 3ZLYA 4ZS4A 4DFYA 5ETAA 5F4NA 4DGNA 4EUUA 2VV9A 3H30A 4GS6A 3VBVA 4ZY6A 4ACGA 4QMNA 3M2WA 4K0YA 4HGLA 4CYJA 3QXOA 5LJJA 4BCIA 3VUIA 3R30A 1YWRA 2QLUA 4QP7A 2XRUA 1H1PA 3QGYA 3FLZA 2UW7A 2ERKA 3P79A 4WBOA 1GZNA 3ORIA 3TV6A 5JQ5A 4ZMEA 1LPUA 5AP6A 1OL5A 2IG7A 3VBTA 3HNGA 3QD3A 3DK3A 2QOIA 3WOWA 2JAMA 4Q2AA 1V0PA 1UU3A 3DKOA 4G5JA 4KD1A 4RQVA 4WNMA 1YQJA 3T8OA 4RVLA 3DCVA 5D41A 5BNJA 2X9EA 2G9XA 3QD2B 4Z3VA 3DBFA 5J7HA 4V01A 4UV0A 4GK3A 4CFMA 4U5JA 3UNKA 4YHFA 4Q5HA 4BC6A 1H1SA 1O6KA 3C4ZA 4L3LA 3V6RA 5LMBA 1KUTA 3DXPA 2QO2A 3EQFA 3PVBA 3FLQA 4ZTHA 2Y4IB 5C9CA 3CC6A 3QQKA 5EG3A 2XZSA 4QMVA 4RFYA 3ZRMA 2RSVA 3TEIA 5HBJA 3ZM9A 3BYVA 4B4LA 1YKRA 2J5EA 5CSHA 4BDEA 2R3HA 3NPCA 5HO8A 5L8JA 4FSYA 3RZBA 3V8TA 5DYJA 3NYXA 3EFWA 4FIFA 4CG8A 3P7CA 2V0DA 4BTJA 4ERWA 4KIKA 2IW8A 3TUBA 2R3KA 3F5UA 4ERKA 2OJFE 2OSCA 4KAOA 3UO4A 3UMXA 5AV3A 2BAJA 5CANA 3QTIA 5H9BA 4CTBA 4LOPA 5B2LA 4QTCA 3IPHA 1OIRA 1I09A 5CEMA 5C4KA 3OXIA 3FSFA 5AUTA 4DE4A 5IH6A 4YZCA 3KMWA 4GFMA 4F7JA 4O0TA 2B4SB 4W8DA 1JAMA 3R73A 5HKMA 5AIRA 4KKHA 4H1MA 4RC3A 2XJ0A 3MH0A 4UY9A 3QTSA 3CGOA 4I23A 2XYNA 4M3QA 2BKKA 3RNYA 4E5AX 1UKHA 4WT6A 2UW4A 2WMWA 4CEGA 4G6NA 4F0GA 2YM8A 4BTMA 4QOXA 5C27A 4Q9ZA 4I41A 4C37A 4XBUA 3UDBA 4EH4A 4X3JA 4YP8A 4DA5A 2XK6A 1SVGA 4MD8E 1KE5A 5BUJA 2CMWA 3F2NA 1UVRA 4F6WA 3LCSA 1ZMVA 2ERZE 4YGAA 5DMZA 3MY1A 5HLNA 5IQCA 2V7AA 2JEDA 4FICA 1Y6AA 2IWIA 3KRRA 5E1SA 4MX9A 4BDAA 4WRSA 5BYZA 2IJMA 4JAIA 2C47A 2Y6OA 4YJPA 3ZUUA 3E5AA 3L8PA 4XP3A 2WD1A 1JWHA 4FC0A 4IC8A 1DI8A 3QQFA 4U44A 3U8WA 4BBMA 5CU0A 4O7VA 3KXZA 1E1VA 4XMOA 3UPZA 4O6LA 4MK0A 4MXCA 4YUQA 4IAZA 4YJUA 1NY3A 2BAKA 1CDKA 1NA7A 3NEWA 1L8TA 2OXDA 2YN8A 4PL5A 5KZIA 5CSVA 1FBNA 4JLCA 3D5VA 3RINA 1XJDA 1QMZA 2EWAA 4TWNA 4GUBA 3RM7A 3EZVA 3PXKA 4L6QA 1SMHA 4M68A 4EOMA 2JDOA 4EKKA 3PXQA 5J5TA 3H9RA 3UG1A 4M14A 3Q3BA 2RGPA 2NO3A 2F2CB 3CD3A 4YZNA 3VF9A 3ZTXA 4OBQA 3RPSA 4O0SA 2W5HA 4F9BA 3N4TA 2H6DA 2WPAA 4RIXA 3OT8A 4BCJA 3WZDA 1J7LA 1OBDA 4FSTA 4ZZMA 3DXQA 1J1BA 1V1KA 3I4BA 4O7TA 2P2IA 2Y6MA 4TNDA 4AFJA 1O6YA 4JL9A 5AUXA 4DFNA 4FKPA 4YC6A 1RQQA 5E1EA 5TT7A 2PMNX 3PE2A 4PWNA 3D5UA 1XBAA 4FZAB 2X4ZA 3OEZA 3QQGA 3DDPA 3PJ1A 3NR9A 4XOZA 5HG9A 1PJKA 3R9DA 4FK6A 4PMPA 5BPYA 1UWJA 3ZEPA 2R3LA 2UW8A 5ICPA 5L2TA 3S00A 2BCJA 3R71A 4IAIA 2Z7SA 3N4UA 3KCKA 4EH9A 5E8WA 1OZ1A 2B7AA 5KHXA 1JLUE 3SC1A 3EN9A 4I4FA 4A9YA 3UTOA 3U4UA 2VTTA 4YJNA 4PNIA 2QO9A 3H9OA 3R00A 2GQGA 1DAWA 2GHMA 1QCFA 1QPEA 2GS7A 3CPCA 5F20A 3V5LA 4E6AA 4NT4A 3PA4A 5DPVA 3BYSA 3VUGA 4IDVA 2QONA 4MD9E 3TKHA 4WIHA 3DKFA 4NJ3A 1OKZA 2PZPA 4FNZA 3PVGA 4TRLA 1OBGA 2UW3A 1Z5MA 2WQBA 3HUBA 4B7TA 4YLJA 3O8PA 4ZY4A 5KKRB 4DGGA 1M2RA 1OKYA 4AA4A 4RVTA 1UV5A 4RRVA 4C4HA 3BZ3A 4AF3A 4DCEA 5I9ZA 4RJ5A 3O71A 4L3PA 2QI8A 1JKKA 3MESA 1Y8YA 3VNTA 5FTGA 4RIYB 5AWMA 5D11A 4J97A 3A7IA 3EH9A 3EB0A 4JDJA 4DBNA 2ITXA 4U42A 2PUPA 3NWWA 5DHJA 3VQUA 3F5XA 3P4KA 4LL0A 3TTIA 4RIYA 4DGLC 1PYXA 2FYSA 3E64A 3JVSA 3VHEA 3ENMA 4FT3A 2C5NA 4IAKA 3DNDA 4R3RA 4U41A 3RPYA 5FEEA 4FKSA 1JPAA 3BGQA 3GU7A 1BI7A 4ITIA 4MAOA 4XV1A 4RIWB 3DA6A 3Q4TA 3RP9A 3FL5A 3UODA 4AT3A 3KK9A 3VS2A 2WZJA 1OIQA 3GU4A 4FT0A 5HX6A 2WNTA 3CP9A 4IM0A 1OB3A 4GVJA 3KEXA 4D55A 4EBWA 3QUEA 4R3CA 3O96A 4WSYA 4N0SA 4YLKA 3QTWA 2GDOA 4J95A 4IACA 3LJ2A 3V8SA 5A3XA 2YZAA 4AGCA 1H1QA 2R2PA 3KXMA 3OWLA 3I60A 4K1BA 2YDKA 4IXPA 4PMTA 3V6SA 1YOMA 3ZEWA 4EK4A 5BQ0A 2B1PA 3W2SA 3TDVA 2W05A 4UMRA 1YDRE 3R9RA 3EQCA 2E9UA 2QHNA 3NNVA 2C6DA 4DTBA 1VYZA 3WZUA 2VGOA 2W4KA 3OTVA 3HECA 1JOWB 3MBLA 4G9RA 4UXQA 4WNPA 3R9OA 1RE8A 2BFXA 2WQEA 1W7HA 3L9PA 4FV0A 1XH7A 5TOZA 3WF6A 5CF8A 5ITAA 3PXYA 4G5PA 3E7OA 4I93A 5EFQA 4NW6A 3QD0A 4UBAA 2W1HA 5ANJA 5HIEA 3GEQA 1G8AA 1OVEA 4U3YA 5EM8A 5GHVA 2W7XA 2EU9A 3LCTA 3REPA 4GG7A 2W9FB 3QD4A 4FV4A 2CNVA 1RJBA 3BHVA 4FTQA 3W10A 4E4NA 3W2PA 2FSLX 1MUOA 3UOKA 3VS1A 4FSZA 3KRJA 2PUIA 5DIAA 4R7BA 4U45A 2B9HA 4MXXA 4ZEGA 2YM4A 4D2SA 4CKJA 5CAOA 3IW6A 3F7ZA 3LFQA 4B8LA 4NW5A 2GTNA 1XH5A 3DT1A 4ACMA 4HCTA 4DEAA 3ZLSA 3IO7A 5DOSA 4CFNA 4JIAA 3SRVB 5JFXA 2EXMA 2UZVA 3TJDA 5HVJA 3VBWA 3V04A 1ZYJA 2PPQA 4FKJA 4FZFB 1V0OA 5L6PA 1PXJA 2PTKA 2IVVA 3MB6A 2JITA 3NZ0A 4K2RA 4I20A 2J0IA 2VTRA 3ORXA 4R5YA 3A7FA 4GIIA 4LUEA 4XG9A 2QOCA 5ACKA 4FTUA 4C34A 1XKKA 2WMRA 4CZYB 2E9OA 5AR7A 4IVBA 4HPTE 5CQWA 4C8BA 4S34A 4YTHA 1UWHA 3HUCA 3QZGA 4JIKA 3MS9A 2OJJA 4FKRA 4V0GA 4AACA 3QLFA 4I92A 4K18A 5JEBA 4CQGA 4LOQA 2I0YA 2JDSA 5FXSA 4AWIA 1TVOA 2GU8A 4MQ2A 3FAAA 2GHGA 4M66A 4V04A 3I0OA 3MVMA 2FH9A 5CEIA 3BKBA 4M8TA 1TQPA 2R4BA 3NIZA 3CD8A 4IB0A 2QCSA 5HCZA 3H9FA 3RCDA 3D94A 4EC8A 4O7RA 2BZHB 4ZTSA 5ANDA 4HVDA 5D7AA 4KSPA 3SOAA 2VO3A 4ZTRA 3GXLA 4F0FA 4CFVA 4BCQA 3VS4A 2VZ6A 4KIKB 4XHKB 1Z9XA 1OITA 1Q4LA 4BKJA 5L6WL 3COMA 5CEKA 2UW6A 3V5JA 3A7HA 2JC6A 2BTRA 4K9YA 1ZARA 3DQWA 4L3JA 4B99A 1W83A 5IA0A 3I1AA 4LM5A 4TYHA 5I9VA 1GY3A 3GOPA 1VR2A 4H05A 3FY2A 3CR0A 4UN0C 3GGFA 2UW9A 4JBQA 1CKIA 1PXKA 3PFQA 4TYIA 2ESMA 2QD9A 3GVUA 3ZZWA 2DUVA 4GT5A 2J0LA 4PTCA 3RKBA 3P9JA 3GI3A 5JGBA 4ZAUA 3GB2A 4CRSA 2NRUA 2C5OA 3QZHA 4GK4A 4ZXTA 4Z7HA 3PPZA 4AGUA 5L6OA 5TE0A 4KABA 2HIWA 1VZOA 2WMAA 2VTLA 3DK7A 2FSTX 2ZMDA 3KXHA 2G01A 5J95A 3KVWA 4BZNA 3NX8A 3BE2A 5I5ZA 2R5TA 3FZ1A 3BYMA 3HMIA 1YRPA 3M11A 2WEIA 3AD5A 3KXXA 2QODA 3AQVA 3GQLA 4X2NA 5FLFA 4BDIA 3P86A 4EZ5A 5CXHA 1LP4A 1JSVA 3ERKA 3NUXA 4R1YA 3Q32A 4U9AA 4D5HA 1IG1A 4RA4A 4F99A 3FEGA 4OTIA 3QA0A 4CZUA 4RIOA 5HE3A 4F63A 5EKNA 5LWNA 3N4VA 5AR4A 4D2WA 4G9CA 4C4FA 1JQHA 3QQHA 5BVOA 1SYKA 1OKVA 3EQGA 4BKYA 3UVQA 3BGPA 5T3QA 4U43A 3ELJA 3TJCA 3V5WA 3FLWA 3TUDA 4J53A 3PTGA 1OIUA 5LVNA 2VWWA 3QUPA 2GQRA 3ZRLA 4FL1A 1WBSA 2W4OA 4G2FA 3VWAA 2F7ZE 4AW2A 2XM9A 4IH8A 3VBYA 2ZJWA 5E8YA 3FSKA 4P5ZA 1PHKA 5DH3A 2CN5A 3TKUA 4ZLZA 5EOBA 3TNIA 3FI4A 3GCQA 2OJIA 3T3VA 4O7WA 2QQ7A 3TTJA 3DB8A 3DKGA 3IDCA 5EDQA 5FBOA 3NGAA 5I3OA 3QWKA 3QTUA 1XH4A 3DBDA 2BAQA 4C2VA 1UKIA 2ITPA 4N6ZA 3DAJA 3V5QA 2XKFA 3ZFMA 3RALA 5KMOA 2GNHA 3QHWA 4ITHA 4QMPA 4EQCA 3UJGA 3FL4A 5B0XA 4ANSA 2QC6A 4LFIA 4GEOA 4RZWA 3Q2JA 5LCKA 1FGIA 2W96B 3LKMA 1QL6A 3NSZA 3TUCA 5G6VA 4F4PA 3RPVA 2PY3A 2YFXA 3O0GA 1BL7A 4K77A 4DC2A 3EQBA 4ANLA 4YNEA 4D4SA 4Z16A 2O65A 3HZTA 4BCHA 2QKRA 4IB3A 3KB7A 4NFMA 2HZNA 3O7LD 4QP1A 3F5GA 3KRLA 4IZ5A 4NCTA 3PA5A 3POZA 1Q99A 2P2HA 2YHVA 3FC1X 4I0SA 4BBEA 1ZAOA 3QQUA 3OUKA 4FI1A 4IWDA 2XNMA 3VHKA 3JXWA 5KHWA 1VJYA 5D1JA 3I6UA 4FV2A 2OXYA 2R64A 5K4JA 2RFDA 5K4IA 5TR6A 3VUTA 4DFZE 4DH7A 4EK8A 3U87A 3U6HA 4YJTA 5DR9A 1OKWA 2PE2A 4AOTA 2QKWB 3H0YA 2B9FA 4IQ6A 4LRMA 4I22A 5FBNC 2V62A 1M7NA 4TN6A 4GYIA 4A9RA 4ASDA 5BVKA 4QP6A 4EH7A 4O91A 5AR5A 4FX3A 4IB1A 2A4LA 4BDCA 3Q9XA 1BUHA 3FMEA 5A9UA 1ND4A 5M4FA 1KV1A 1XBBA 4IJ9A 5DEWA 3HRCA 4Y5HA 3SD0A 3QZIA 2YIWA 3OCTA 5HLPA 4RWKA 3TT0A 2PZRA 3A8WA 1ZYLA 3HA6A 4RIXB 2VAGA 2WQOA 1ZY4A 1M2PA 5HHWA 3RI1A 1MRYA 4NJDA 2VTAA 2UZDA 5CVFA 4IB5A 3ZHPC 2P3GX 2J50A 3RJCA 3A99A 2JLDA 4W4XA 1XQZA 5GZ8A 1HCLA 2ITUA 5JRQA 3UP7A 5L2SA 5M4IA 2OI4X 4V0GB 3F5PA 5EHOA 4MXOA 3MFUA 5JFVA 2QVSE 3CTJA 2RG5A 3LIJA 2EVAA 2WQNA 2PVKA 5CX9A 3ROYA 4DTAA 1KE9A 2WMUA 3HX4A 5BX0A 2GNLA 3VS5A 2PZYA 3EL7A 3PA3A 3GQIA 1FVVA 3HL7A 4EKLA 1IR3A 4QYHA 3AC8A 5IEXA 4Z9LA 4FTMA 3UO6A 3PG3A 3HVCA 5HU9A 1PRYA 4FV1A 1KOAA 3FLNC 4RFZA 1YI4A 1Y6BA 3SOCA 3ZUTA 3I5NA 1Q8TA 3O17A 5LVPA 4FR4A 3PJ3A 1KE8A 3K5VA 3NUSA 1CTPE 4WO5A 3IW7A 3UOJA 2ITWA 3TN8A 1XWSA 4DH3A 3QRTA 1FGKA 2XIKA 5IU2A 4FIHA 4O0RA 5E8ZA 4PF4A 3BWFA 4A4LA 4FKIA 2PVHA 1WBTA 3LM0A 3MYGA 4LMUA 5KMMA 4CV8A 4EZ7A 1O6LA 1WCCA 2X1NA 3G2FA 5FWKK 5FD2A 3PE1A 4RVMA 2GNFA 3Q53A 1WFCA 4PQNA 4HJOA 4BCOA 3FMNA 3FHRA 4CG9A 3E62A 4WUNA 4FIIA 4IEBA 3JY9A 3F6XA 4ZSEA 4S30A 3R2YA 4Y72A 4WA9A 4ZIMA 1R3CA 4AOIA 1SVHA 4QQCA 2PL0A 5M09A 2JIVA 3FV8A 3LFSA 4J8NA 4E6QA 4XBRA 4BVUA 4L42A 3C50A 2GNIA 1H00A 3GENA 4IVDA 1REKA 2H34A 3PYYA 5D7VA 5IZFA 3N51A 1Q24A 4ZS0A 4EK3A 5HNBA 5IA3A 2VWUA 5BMMA 4BDDA 3HV7A 2QG7A 4FEXA 4DEBA 3EN5A 3SRVA 3H10A 4FOCA 4TYEA 5JH6A 5FXRA 2ZDTA 5AAGA 3DZQA 3FMMA 5J5SA 4IWOA 4AE9A 4B0GA 2VX3A 3FLYA 5EDRA 2OKRA 1WVXA 4BL1A 2Y9QA 2PVYA 3EFJA 3O2MA 3I5ZA 4RFMA 3R7YA 4AU8A 1U46A 1KE6A 2XYUA 2O64A 4EH2A 4UWBA 4Y95A 5FEDA 4FA2A 1UNGA 4NCTC 2ZV9A 2PU8A 2V7OA 2QHMA 4LRKA 2YCSA 3CEKA 4XV2A 1J7IA 4RWIA 4QMOA 4G6OA 2PZIA 4M67A 2YIYA 1XH9A 3P78A 3UGCA 5EI6A 2YISA 2XEZA 5M07A 1VYWA 3ORMA 4C4JA 3HEGA 5AUYA 1P14A 2VWYA 5L3AA 2Q0NA 4DGOA 3Q4UA 5AX3A 5FEQA 3F9NA 4QMXA 3ROCA 4EOOA 1GZOA 5ACBC 3O51A 4FIGA 4YO4A 4ALWA 4I0TA 2X9FA 4JQEA 1A06A 2CPKE 3BQRA 4BI1A 2R0UA 3H0ZA 3F2AA 4L67A 4QMLA 2HAKA 1ZMWA 2X0GA 5I9WA 3LHJA 3Q9ZA 4I3ZA 4IW0A 4HYSA 5AR3A 2XH5A 3MJ2A 4A9SA 2ZV7A 3OFMA 4NZWB 3F3WA 1XO2B 5ANIA 3ZSGA 5K5NA 2I40A 2EXEA 5BUEA 4W8EA 3EJ1A 2VU3A 5K0XA 4BZDA 3WF5A 4FZ7A 1PMNA 5HO7A 1WBVA 4IE9A 2PUNA 3LCDA 5CSXA 3OF0A 3VRZA 4D1XA 4PP9A 3I79A 3OT3A 1UU8A 2WMVA 5BVEA 3QQJA 2C3IB 3FPQA 3E3BX 4R78A 4ZZNA 3ULIA 2UZUE 1PMVA 4NSTA 3D14A 3NS9A 4YJQA 1SNUA 4QQ5A 5ANOA 4BR3A 5HBHA 5D10A 1H25A 3UE4A 3FC2A 1F3MC 3BV2A 4OAUC 4RJ7A 4F1TA 3ULZA 2ACXA 4AG8A 3E8NA 4DFLA 4FNXA 3A8XA 3KRWA 3E63A 4I6FA 1W8CA 2WMQA 4P7EA 2W4JA 4D9UA 3NRMA 4IADA 3UC4A 5FM3A 5LVLA 2YIRA 4U8ZA 1UU9A 2ITQA 4FEWA 2YLFA 4F9CA 1OL7A 4E7WA 1DM2A 4KS7A 5BVDA 4O81A 3W16A 3CCNA 3I7BA 2QR7A 3LMGA 3VIDA 3VW8A 4ASEA 4EL9A 2W1IA 3C0IA 3TCPA 5EQPA 2J9MA 2QOBA 4DYMA 3DTWA 4CGAA 4A9TA 3QGWA 1H0VA 4W4VA 5IA5A 4F08A 3RPRA 4JBOA 4RJ8A 3DFCB 3HP2A 5DEYA 4IMYA 3UIUA 4Q5EA 3VS7A 1GOLA 1LEZA 2BUJA 2VTJA 2XIXA 3LJ0A 4BZOA 4TL0A 2OH0E 4Y73A 2G2IA 3ZBXA 4BWXA 4ZJVA 2W1FA 1LUFA 3PVUA 4XG4A 3LJ1A 4I24A 5IPJA 3ORLA 3R6XA 4A06A 4DAWA 2GHLA 2RKUA 3UMWA 5AA8A 2BDJA 1ZY5A 2F7XE 4TWCA 1FVRA 3PPKA 5CS6A 2X2LA 2F7EE 4ASXA 4EOLA 2Y4IC 3QCXA 2RFSA 3VS6A 2ETRA 2JIIA 2VWIA 4IWPA 5LARA 3I0QA 3RM6A 4O82A 3ZU7A 3EKKA 5CSWA 1H28A 1YDTE 2G15A 3QHRA 4HCVA 2WTKC 3TG1A 3CQEA 4CFXA 1SNXA 4W9XA 1JBPE 5EYKA 1JKSA 2WTWA 4YBJA 4O86A 4UALA 4XJ0A 4JBPA 2BPMA 3OP5A 3QZFA 2O8YA 1OL2A 4QPAA 4QP8A 5KNJA 3SVVA 3OBJA 4LV5A 3LQ5A 4MF0A 3UYSA 3BGZA 1M52A 4FTTA 3TNQB 2UVXA 4F7LA 4ZZOA 5HTCA 3R1SA 3W55A 2W17A 4R6VA 2X8IA 3ANQA 4WUAA 4CT1A 1DI9A 1FPUA 3FPMA 3KKVA 1SZMA 3SLSA 2F9GA 3TKIA 2WTVA 2VRXA 2OLCA 2P33A 3JY0A 4N6YA 2OWBA 2OXXA 2R3RA 2REIA 4YC3A 4D4VA 3QXPA 4L43A 1Q8ZA 2FB8A 2YWVA 3BIZA 1H26A 1OGUA 2GQSA 3CKXA 3PSCA 5CF4A 1Y57A 3V5TA 4XCUA 3IGOA 4II5A 4MTAA 3QKLA 3GCUA 5DGZA 5I3RA 5DRDA 3SHEA 3PSBA 3KY2A 3G6GA 3LPBA 3U51A 4CSVA 3CJFA 4G3GA 2JDTA 4LOOA 1UNHA 4NU1A 4ANQA 3LFBA 3FKLA 5IQDA 3VF8A 4AE6A 4BCKA 3QTZA 4FV5A 4TYJA 4FYOA 4XLVA 3OROA 2CLQA 4Y85A 2R3JA 3ZO1A 3F61A 1PXOA 3GFEA 3P0MA 5GJFA 5JMSA 2IVTA 1ZRZA 2OG8A 2CKOA 2VTPA 4C62A 4EJNA 2LGCA 1XH6A 1W84A 2WEVA 5FXQA 5F1ZA 4XNEA 3RPOA 4GKHA 4MD7E 4FKQA 4TWPA 4X3FA 1CKJA 5KE0A 4I6BA 3VJOA 4H1JA 1P4OA 4LI5A 1BLXA 3Q5IA 3SW7A 4CT2A 1OECA 3ZC6A 2OU7A 2NNWB 4L45A 4EZ3A 5M4CA 2YIQA 5CSPA 3ALOA 2W5BA 3Q96A 3HV4A 3DOGA 3WILA 1KWPA 4XG7A 3E8DA 3OVVA 3W8QA 4JQ7A 4IZAA 1H27A 3D0EA 3GC8A 4CCUA 5E9EA 4GIHA 4BY9E 1Q62A 1U54A 2FA2A 2R3QA 2VTNA 5CALA 4XS2A 5AM6A 4FGRA 4PDSA 2C6OA 3RVGA 5M44A 1WMKA 4CLJA 3DB6A 4JNWA 4U40A 3P1AA 4AW1A 2YERA 2XB7A 4CQEA 4JAJA 2O3PA 3MGYA 2Z2WA 1ZYDA 4UZHA 3PY0A 2C68A 2HK5A 4OT6A 4TTHB 5CEOA 3G0FA 3NDMA 4BDGA 5L2WA 3DY7A 4OTWA 4QYGA 3FE3A 4HYUA 3F7WA 2BRNA 2VD5A 3OTUA 2C6IA 5GJDA 4X21A 3FY0A 4V05A 1Y91A 2HZ0A 3KULB 4IDTA 3VQHA 4HZRA 4D9TA 4DGMA 1R39A 4F09A 1PY5A 4ZTMA 3FZOA 3LCOA 4FSRA 3I6WA 3PZEA 1JKLA 3OHTA 3Q6UA 4M0YA 4M69B 4HVHA 1G3NA 3DFAA 3LZBA 5HNIX 5GIOE 2AUHA 2YM5A 1HCKA 4N57A 3ZFXA 4NEUA 1L3RE 3Q52A 4PPAA 3R63A 3HAVA 3G9LX 3G0EA 3EN6A 1AD5A 4JS8A 4OTHA 2CGXA 2WIPA 4NIFB 4ZSAA 4YZMA 5CY3A 3LMIA 4PX6A 2QR8A 4M84A 3TNWA 1IA8A 2QOKA 5EHYA 4FTAA 4EBVA 5FQDC 4ARKA 4RJ3A 4BGGA 2XBAA 2FSOX 4AZFA 4BHNA 5H8EA 2BIYA 2IZRA 4O22A 3PJ8A 2OFUA 4L52A 4RSSA 2KTYA 5DWRA 3ATTA 2XK3A 3DZOA 5AV2A 4I5PA 4RQKA 4BI0A 5H2UA 4PTEA 5M08A 5J9YA 3C1XA 3UQGA 2QURA 2RL5A 3ZYAA 2I7QA 2DYLA 3MTLA 3OW4A 2QLQA 1ZOGA 3FMHA 3MV5A 4Z55A 4D2VA 1IAHA 4EOSA 5LOHA 4FL2A 4X2JA 4EEVA 5FUTA 2GS2A 2JIUA 5AADA 5EYCA 4R1VA 4WBBB 4M69A 4KIQA 2XK8A 4HW7A 4XLIA 3OG7A 2BKZA 4A4XA 1Q8UA 3AGLA 3C51A 5JZNA 3TNHA 4FTIA 4FTRA 4KUJA 4IHPA 1OMWA 3R1YA 4CKRA 5IF1A 3HMOA 1B6CB 4FKGA 3R0TA 3CS9A 4NKAA 5IQFA 4FNWA 5M53A 3PWDA 5FP5A 3I7CA 3ZDUA 1H8FA 2J51A 4OTDA 4FUXA 3DAEA 3IQ7A 2HXLA 2UZTA 2X8EA 3DJ5A 3ORTA 3ZDIA 1BX6A 3SGCA 4FKWA 1P2AA 3BYUA 3KXNA 2CLXA 3S3IA 2GPHA 2BR1A 5JQ8A 3GUBA 4HOKA 4G3FA 5J9ZA 3L1SA 3U9CA 2C69A 2XIZA 5C03A 2JDRA 2UV2A 3MJ1A 4M15A 4QTBA 2YDJA 3Q04A 3ZO3A 3WBLA 4UMQA 4MEDA 3W1FA 3G6HA 4BB4A 3TIYA 3MIAA 4WOVA 1UNLA 4C0TA 5KMLA 4JX3A 4GT3A 5KKRC 1H1RA 1ZWSA 3IGGA 4S32A 3BLRA 3V3VA 5KMNA 3N9XA 5DBXA 4I5CA 4UWCA 3MVLA 3NNXA 2E2BA 3EQHA 1H24A 4PMSA 2WQMA 1S9IA 1JKTA 2FSMX 1MP8A 4FTJA 3W2RA 5CU4A 2C3LA 5CU6A 3EYGA 5CI7A 2JKKA 4CMUA 3EQPA 4KBCA 4E73A 2C30A 4IIRA 1PKDA 4FV9A 4RC2A 2H8HA 5EQEA 3HDNA 3CGFA 4LUDA 4G1WA 4PDPA 4BTFA 3II5A 2W5AA 4JR3A 4QPMA 4ID7A 4QMMA 4AZVA 4MXAA 2OIBA 5DT4A 4F64A 3QWJA 3IW8A 3FQSA 5HE2A 2R3FA 1K3AA 2PK9A 4P4CA 4BWPA 1M17A 4IM2A 2V22A 5EW9A 3WZKA 3C4WA 5IQIA 4DH1A 2DS1A 4L7SA 4K11A 4A07A 4FOBA 4AS0A 1OI9A 2GFCA 4FT5A 5F95A 4EOIA 2YM7A 4CFWA 1YOLA 4XUFA 4U80A 4JJRA 5K0KA 5M4UA 3PLAE 4IANA 5CI6A 3E88A 4KIOA 4KRCA 4XV3A 4YTCA 3KMMA 4ZJJA 2R9SA 4E5WA 1NW1A 4FV3A 4O84A 1BI8A 2ZMCA 2V55A 4BRXA 2PHKA 3B8QA 3PPJA 4QD6A 4XRLA 4BF2A 3DV3A 5GINE 2JKMA 3R9HA 5JRSA 2IO6A 2PMOX 5GJGA 2R7IA 4X7QA 4BKZA 4TYGA 5GZAA 4CKIA 4USEA 3NNUA 3LVPA 4HNIA 1K2PA 4QMYA 3UIBA 2C6TA 1LR4A 4O38A 4RX7A 4JXFA 5EOLA 3NYOA 2IZUA 3FMKA 5CT0A 3VW6A 4HYHA 3A7GA 3D7ZA 4FVQA 3ZH8A 3T9TA 5C1QB 3WIKA 5C8MA 4B9DA 4EK6A 5CASA 3UQFA 2ETKA 4U6RA 4C61A 2W1EA 3CQWA 3F3UA 3EKNA 3NAYA 4YZBA 5CAQA 1ZYCA 5DNRA 3UZPA 4J8MA 4MXYA 3FLSA 4AZEA 3BHUA 2GMXA 3UIXA 4F9AA 4O7NA 2A2AA 2VX1A 1KOBA 3JVRA 3FUPA 4MBLA 4ZP5A 5CXZA 3D9VA 5IQAA 3FMJA 3BV3A 4D2PA 5HI2A 4YHTA 2RG6A 5E92A 4O7ZA 3KGAA 4UMPA 4RJ6A 1GZKA 3F82A 3QC9A 4YSMA 4O0YA 3PIZA 5J1WA 4XG2A 3TDWA 4JR7A 3OCBA 5A4TA 4G3EA 4BIBA 4PTGA 5HCXA 2XCKA 1H1WA 1OPLA 3ET7A 3F66A 4O2ZA 5DLSA 3P7AA 2WU7A 5DI1A 4GKIA 3VUHA 4M97A 4ANMA 3VULA 2I0HA 3PJ2A 2FUMA 4H58A 5DRBA 2J7TA 1XR1A 3KN6A 3WIGA 5CAPA 3GU8A 3PXFA 3S1HA 3LFEA 4Y83A 2XIYA 3FKNA 4D0XA 4QQJA 4MWHA 4GVAA 4UWYA 3SAYA 2HELA 2PSQA 4LRJA 4APPA 3IK3A 5EH0A 3LMHA 1H08A 3IOKA 1YWVA 4HZSA 5LMKC 5AM7A 3VUKA 4C3FA 4JRNA 3RK7A 2R7BA 3CKWA 2PVRA 5JKGA 3KFAA 2HW6A 3D7TB 5FRIA 3IKAA 5IEYA 3C5IA 2JKQA 3GCVA 3ZONA 3C4EA 3DKCA 5AUZA 4D4YA 4F70A 2YCRA 2Z02A 3P08A 3UC3A 3AMBA 1FMOE 1ERKA 2FO0A 3C4CA 2XNEA 3C4FA 5EW3A 3RAKA 1GIHA 3B2TA 1V0BA 5M57A 4LG4A 2VO0A 1CKPA 4ACDA 2C0OA 4G3CA 5TF9A 3TZ9A 4C3PA 4AUAA 5L8KA 2CKPA 2JBOA 4MBIA 4FTNA 5IA2A 4YZDA 1OPJA 3BYOA 2I1MA 2CNUA 2F4JA 4I6QA 4O0VA 4AN3A 3LOKA 3ZUVA 3EZRA 4F65A 4NM3A 5IQEA 2YABA 1I44A 4GH2A 4IM3A 3VS0A 2VGPA 3TV7A 3VBXA 3ZSIA 3RHKA 4GJ2A 4UYAA 4PDYA 4TXCA 4AXAA 4ANNA 4DCAA 4M0ZA 4YJRA 4TNBA 2DQ7X 3BLQA 2CJMA 3MA6A 3U4WA 2YWPA 3JR1A 3LLAA 3MH1A 2XK7A 3RAWA 3K3IA 3MTFA 5C8NA 5KMJA 2GTMA 3D4QA 4GFGA 3U6IA 4JT3A 4IX3A 2JFLA 5IH5A 3JYAA 3R8LA 2UZEA 4G31A 4S2ZA 2BRHA 4FKLA 4C35A 3SG9A 1WZYA 2BMCA 3MB7A 3G5DA 3E93A 2O2UA 3AT2A 2C6KA 4EHVA 1ZXEA 4AAAA 4FZ6A 4XH6A 1R0PA 2VTIA 4XP2A 2Q0BA 3BQCA 2OH4A 2XVDA 3A4PA 3BHHA 3IS5A 3PZHA 2IVUA 4O1OA 4RJ4A 1YHSA 3AT4A 4NM5A 5E91A 4FEUA 2P4IA 4RG0A 3FDNA 4PY1A 5E7RA 5HG5A 5M51A 3UPXA 4USDA 3MI9A 4EUTA 4G34A 5IQGA 1H0WA 3LFDA 4EQUA 4Y8DA 5ANGA 4UZDA 1TKIA 1REJA 2Y7JA 3FMDA 2WMSA 2O0UA 4NIFA 2WXVA 2G2HA 4PUZA 4CMOA 4PL4A 3KMUA 5KO1A 5IA4A 2PZ5A 3UVRA 3HP5A 3Q5ZA 2GCDA 1TQMA 4RA5A 4GT4A 4GU6A 1A9UA 3EQIA 2CSNA 1JSTA 2O63A 3O50A 4D5KA 5IDPA 5AIKA 3NVKI 2NPQA 2WTKB 1VEBA 3ENHA 3WZJA 5CENA 5HLWA 3R7OA 3LFAA 4R7HA 3NYVA 5D12A 2X7GA 2Y8OA 4L00A 4C2WA 3PG1A 5HZNA 2XNOA 3TXOA 2UW0A 3R7UA 3DBCA 3FHIA 4E93A 4J99A 2HOGA 5L2QA 4DEGA 2HW7A 3F69A 5I9YA 2ITYA 4IZYA 4OTFA 3WF8A 2R3PA 4IX4A 4IFCA 5CNNA 3AC4A 4MBJA 2AC5A 3G90X 5I4NA 3TZMA 1H07A 2BVAA 1GZ8A 1RDQE 4KIPA 2CGWA 5KBRA 4CCBA 5IUGA 5DT3A 3AC1A 5DA3A 4IX5A 3VJNA 3BX5A 3KQ7A 3QQLA 4J71A 5J79A 5GIPE 5FDXA 5L8LA 5KMKA 4IX6A 2VTQA 3R1NA 4GW8A 4IAAA 1XHAA 3ZSHA 2ITTA 3PIYA 5HG8A 4JRVA 4H3BA 2J90A 2WKMA 3MIYA 4J98A 4O0WA 1K9AA 4ZLYA 2PYWA 4P2KA 3V51A 3AGMA 5C26A 4ONAA 1T46A 2W0JA 2VTOA 2IVSA 3GC9A 4KA3A 4EWHA 2WOUA 1RW8A 4JOAA 3QRKA 5A6NA 5EHLA 2WMXA 2ZM1A 1TQIA 1IRKA 2B55A 4K33A 4E4MA 2J4ZA 3KVXA 4QP3A 2ITNA 2JFMA 5JT2A 4CFUA 3SKCA 2ZVAA 2R3MA 3NW5A 4EH8A 3LXNA 1M7QA 3LXLA 4JI9A 4U3ZA 5C01A 3UZTA 1Q3WA 4BDFA 3IW5A 4FF8A 2YAKA 3UYTA 4IVAA 2GNJA 2W1CA 2XP2A 3L9NA 4MH7A 4J52A 5CVGA 5ETIA 1AQ1A 3SG8A 4O0XA 4GG5A 5DT0A 3QCSA 3QBNA 3LCKA 2HCKA 4BICA 4AA0A 5AR8A 4WSQA 4F7SA 2WAJA 3BHTA 2QU6A 4UB7A 3TM0A 3ACKA 4ENXA 5B2MA 3CPBA 4EQMA 4ACHA 4FSNA 2YCFA 3OXZA 3A61A 5EYDA 4FT9A 4FEQA 3RMFA 4PPCA 2BRGA 3Q6WA 4FTCA 4LL5A 3KN5A 3Q9WA 2XNGA 4OTRA 4X3FC 3LW0A 2C4GA 3BRBA 3S4QA 2QOHA 2JGZA 2ZOQA 4CVAA 3CLYA 4HPUE 2B53A 3VVHA 3GP0A 3AG9A 3RWPA 1YHVA 2R3NA 3QU0A 2C1AA 3DPKA 2WTDA 1MQ4A 4QMWA 3RNIA 5H3QA 4ZLOA 1Q8WA 2CGUA 4OBPA 2HY0A 3LXPA 4G3DA 4DEIA 5E8TA 5LVOA 2C0TA 3QRUA 3BE9A 4H36A 4CYIA 4Y46A 3G51A 4YPDA 4DH8A 2GFSA 4HVSA 1PMUA 2R3OA 5HG7A 4GK2A 3C5UA 3MY0A 5FGKA 5A4EA 5L4QA 5EM6A 5I9XA 5KX8A 5JZJA 4QMSA 1FOTA 4FL3A 4GYGA 4BIDA 5HTBA 4EYMA 3R7IA 4TT7A 3AC2A 1XBCA 4C4GA 2ZV2A 2XK4A 4GCJA 4C36A 3ZLXA 4EH3A 3PLSA 2A1AB 4J96A 5CU2A 5HO6A 2R3IA 2R3GA 3MVJA 4U81A 5CLPA 2Q83A 1APME 4NH1A 3FZPA 5JFWA 4QMTA 5IG1A 2EXCX 4U0IA 4PNKA 2OIDA 4QT1A 2BRBA 2VWVA 3S95A 4AT5A 5TO8A 2WTJA 4FKVA 4L7FA 4I4EA 5HCYA 4YU2A 5AA9A 3F2RA 5M55A 4DLIA 3CY3A 3ETAA 5ETCA 2YA9A 4FT7A 1W0XC 3BEGA 2BILB
chains in the Genus database with same CATH superfamily
3R7EA 2WMBA 3VO3A 4MF1A 4AT4A 2BHHA 2C5YA 2B9JA 1ZYSA 4F0IA 3CXWA 1WBPA 1A48A 5H8BA 3L9MA 3TIZA 3FQHA 3GU6A 1E9HA 2ONLA 3A2CA 5T68A 3MY5A 2Z8CA 2WFYA 2WGJA 3HMNA 3O23A 4MXZA 4QMUA 2XNBA 4E20A 4BWKA 2UZBA 1IA9A 3IOPA 2UW5A 3OCGA 4LGGA 2QOFA 3OD6X 4MCVA 4PDOA 2PULA 5AUWA 5G1XA 4CMTA 4YURA 3VONA 4JDKA 3I81A 3RZFA 4BIEA 3DK6A 5J1VA 4LGDA 2F57A 3GNIB 4AP7A 4MNEA 2B0QA 3MH2A 4U79A 4FZDB 4QQTA 4DBXA 4TYHB 2XM8A 3NW7A 1PF8A 2X7OA 3VN9A 3K3JA 3MN3A 4ALVA 2IN6A 2YM3A 2EB2A 2XNPA 3FZSA 4FG8A 2J5FA 2ETMA 4GRBA 4I0RA 5CQUA 3RAHA 5A14A 4XG8A 3R8VA 4JX7A 5HVYA 4JVGA 2SRCA 5T6KA 4ACCA 4KBAA 4DEHA 4DLJA 4EH6A 3BWJA 4I1ZA 3ID6C 3LFNA 2RFNA 1WBOA 3O7LB 2X39A 1STCE 3NW6A 5ANKA 4CFFA 2CN8A 2HZ4A 2BIKB 3E7VA 5HICA 3SX9A 3A62A 4MVFA 4D2RA 2QU5A 2BROA 4L01A 4RX8A 3OMVA 3VS3A 4RT7A 2VO6A 4DH5A 5E4HA 3ITZA 2EUFB 3MFSA 3SXFA 2ZV8A 4QMQA 2ZYBA 3COIA 3MW1A 5AV0A 5HD7A 1BKXA 4E3CA 2F2UA 4A7CA 4ZY5A 1T45A 1YI6A 4WNKA 4FSQA 4DFUA 1WVYA 3QLGA 5EM7A 4YLLA 2PWLA 2OW3A 3R28A 4G17A 4A4OA 4AQCA 3C9WA 3V01A 4FSMA 4BCMA 4BYIA 4M7IA 4G16A 5JN2A 2VWBA 3QKMA 3QYWA 3ORPA 3BBWA 4APCA 3C0HA 1U59A 3K5UA 3R83A 3KF7A 3BU5A 2XKEA 2OK1A 3LE6A 4WD5A 4QTDA 5HIDA 2JAVA 4WRGA 2C5XA 2OF4A 5E8UA 4ZTQA 4DHFA 2WHBA 1YXSA 4BI2A 3PSDA 4X2KA 3ODZX 5CWZA 4OW8A 2I0EA 2XK9A 3BU6A 3CE3A 2PVJA 1SM2A 4HNFA 2B54A 4JG6A 4R8QA 4XP0A 4K6ZA 4R3PA 4CZTA 4ASZA 1ZZ2A 5DFPA 1YVJA 3K54A 4BGHA 4AFEA 2XAMA 3ACJA 3CIKA 1YXTA 2BZKB 4F78A 2P55A 5AFVA 2BDWA 4CXAA 1OUKA 2PUUA 5DR6A 4DTKA 4F7NA 2BZJA 4OR5A 4RPVA 2J0JA 3JS2A 2OGVA 4KKEA 4RC4A 1FINA 5HGIA 4EI4A 4FIJA 2ITOA 4D58A 1EH4A 4RIWA 4EOPA 5EI2A 4RX5A 3TZ8A 2C3KA 2XUUA 2YM6A 1ATPE 4BDKA 3M1SA 5BVNA 5IISA 5CYIA 1R78A 2X6EA 1PXMA 4C38A 4GMYA 4MHAA 1KE7A 4YNOA 2XBJA 3BU3A 4FVPA 2PE0A 2X7FA 5C4LA 4F9YA 4QP2A 3VAPA 2XKDA 4AA5A 3WI6A 2VNWA 2O5KA 2YLEA 1P4FA 2VN9A 5M56A 3ZXTA 3TMOA 2UZLA 3R2BA 5IA1A 3L8SA 2W1GA 5CEQA 1U54B 5J87A 4M13A 4R5SA 5CEPA 2XJ1A 2ZM4A 3NUYA 1M2QA 3EIDA 4FSUA 3CTHA 1NVQA 4FE2A 2NRYA 3MVHA 3TNPC 4D2TA 3IECA 4YO6A 4FG9A 5IH4A 3HLLA 4L8MA 4D1ZA 3SDJA 4QNAA 3DU8A 5E90A 1PYEA 4TW9A 5E8XA 4X2FA 3SA0A 2WTCA 4QEBA 4LQMA 4UYNA 5LCJA 4J7BA 3PRFA 5A4LA 3UOLA 4CV9A 3T9IA 4BN1A 1FVTA 3DXNA 5CF5A 4QTEA 5K9IA 2WU6A 4EYJA 5AX9A 4ZOGA 3QTRA 5BVWA 4AN2A 4ZTLA 3FQEA 2H96A 2ITVA 3EMGA 3WARA 3UNZA 3WZEA 4TPTA 2CKQA 4LV8A 4Z7GA 4QRCA 2AYPA 4NYEA 3ZO2A 5AP4A 3FMLA 4WNOA 1J7UA 2X4FA 4FNYA 2A0CX 4L53A 5E8SA 2OJ9A 4MNFA 3QKKA 4MQ1A 4WKQA 5AUUA 3ORZA 4R77A 1BMKA 5M06A 1WVWA 3LM5A 3LQ8A 2OO8X 1W82A 2ZB1A 3MDYA 3R04A 4S31A 3U55A 1URCA 3TACA 3FJQE 4O1PA 5CT7A 5JFSA 4I5MA 3E8CA 5K5XA 2J2IB 3BEAA 4L9IA 3DBEA 3HRBA 2XIRA 4WG5A 2KULA 3QX4A 3QX2A 1F5QA 3E87A 4GUEA 1OUYA 4C57A 4PMMA 3L9LA 3F3TA 4NK9A 3KK8A 2OBJA 3NIEA 3O8TA 4I6HA 2YZLA 3THBA 4X6QC 2W9ZB 2CNQA 4JMQA 2W99B 1IASA 3PUPA 5EYMA 2I0VA 4MNEB 3UVPA 1URWA 3C13A 3FBVA 5K3YA 4FSWA 5HEZA 1X8BA 4XX9A 1KSWA 2OJGA 5AP0A 3ORKA 5HU3A 3BBTB 4BJJB 4NTSA 3QAME 3QFVA 2F49A 3R8PA 1FQ1B 4UMUA 3PDTA 2OIQA 3W8LA 4EC9A 3W32A 2VTMA 3B2WA 2AC3A 3ZLWA 4YSJA 1PW2A 3OWKA 3DLZA 4FG7A 2R0IA 4FKTA 4C4IA 5A4CA 4O7YA 4LGHA 3KF4A 4C4EA 3Q4ZA 2QOOA 4X6RA 4E6DA 3EFLA 4DT8A 1Q41A 3OS3A 3F3VA 3WE8A 4RWJA 1VLRA 3UBDA 2C6MA 3PP1A 4FTLA 2Y4PA 4YHJA 5HORA 4KSQA 5LMKA 4W9WA 4E5BA 2XF0A 3EFKA 5F94A 3OWPA 4FTKA 4AW0A 3R7GA 4QNYA 4GL9A 3QRIA 2OZOA 2CHLA 4BCFA 2YCQA 3EWHA 4A9UA 4BBFA 3OY1A 3PXRA 3DQXA 3WF9A 1Y8GA 2RF9A 4BGQA 1GJOA 3C7QA 5AP1A 4YJOA 4BFMA 4OUCA 3TZ7A 3W2OA 2JD5A 2JBPA 4R7IA 3RTPA 1PXPA 4FV8A 5HQ0A 2ZM3A 1PKGA 3H4JA 1QPDA 5EI8A 3NUUA 4ZK5A 3T3UA 3AKKA 3QUDA 5EQYA 2VWZA 3DAKA 3DTCA 2A98A 3MPTA 3TI1A 4D1SA 5FTQA 3GFWA 5LVMA 3V5PA 1YXXA 3R21A 2QG5A 4B6LA 3OCSA 2PMIA 3LFCA 3PWYA 5AP7A 3UQCA 3HMMA 3DS6A 3ZCLA 5CAVA 4QMZA 3EN4A 2BZIB 3FI3A 1GNGA 3W18A 3OOGA 5E8VA 2VX0A 2YITA 3PXZA 4FVRA 2IW6A 3E8EA 1B39A 2WOTA 3PJCA 4YBKA 3UG2A 4D0WA 3MPMA 4C33A 4F9WA 1NT2A 3ZFYA 4DG3E 1W2FA 3RBWA 3W33A 4BCGA 1E1XA 3O8UA 3GC0A 2UVYA 3KULA 4YJVA 2PE1A 3RGFA 4ANOA 2VUWA 5DG5A 4OAVB 4W4WA 4O2PA 2X8DA 5JSMA 2YIXA 4EHGA 3ZRKA 5J7BA 5F9EA 4O7LA 2RFEA 5GNKA 4BHZA 2X2MA 3C4XA 4BCPA 5IUHA 5GZ9A 5HOAA 4XEYA 2C5VA 1JVPP 1YXUA 3BCEA 3G33A 3MSSA 4YR8A 5LXMA 3NVMB 3NYNA 4E1ZA 2Z7QA 1PMEA 2H9VA 2WTIA 4F6UA 4IWQA 4I5HA 3UIMA 3VUDA 3A4OX 4DF3A 5AV1A 3EL8A 3SV0A 4TKSA 4XV9A 3QCQA 4ZMFA 3QA8A 3OY3A 2CGVA 4DN5A 3BI6A 5ANEA 3HV3A 4OLIA 4AGDA 3C0GA 4FODA 3VRYA 5IUIA 3UOHA 4TY1A 3VBQA 4AZTA 3CQUA 1OL6A 5IEVA 3SXRA 4RLLA 2XS0A 5HD4A 5AAFA 5AAEA 1W98A 2UZOA 2ZB0A 4O96A 4HVIA 5IDNA 4L68A 4JDHA 2BHEA 4EHZA 1GIIA 5ETFA 4YMJA 2J0MB 3D5XA 4PL3A 2EB3A 3DGKA 3KREA 4PP7A 4DEEA 2HWPA 4CD0A 3GU5A 5C8KA 3COKA 3JUHA 2CKEA 2VNYA 4AX8A 4FIEA 1PXNA 2Z60A 4N70A 3MPAA 4E6CA 4QP9A 4AXCA 4YTFA 3U6JA 3MFTA 2W1DA 3QL8A 2HY81 3OWJA 1CSNA 3IW4A 3FI8A 2UUEA 5EDPA 4IBMA 2OFVA 4EOQA 4DFXE 3H3CA 2HZIA 5DN3A 3U54A 5CTPA 4BCNA 3BLHA 3UZRA 4TWOA 5AMNA 3KU2A 4YC8A 4OTQA 4AAYA 3RAIA 5CZHA 3HDMA 3PY1A 1YWNA 1NVSA 2P0CA 4IFGA 1UA2A 2OICA 3QTQA 4MYGA 2QOQA 5AR2A 4USFA 3KCFA 3R1QA 2OZAA 3IONA 5HX8A 3OC1A 3ORNA 3QYZA 3ATSA 1GIJA 3AXWA 4KKGA 3TL8A 5AEPA 4MUQA 2B52A 3TV4A 2UZWE 4BDBA 1NXKA 3FZRA 4UMTA 4O6EA 1SVEA 4FKUA 1Q3DA 4AXFA 3ZOSA 5IMEA 4J1RA 2PVNA 4E4LA 3D83A 4DFBA 2PVLA 4EOKA 5BYLA 1B38A 3WF7A 3QC4A 2XA4A 4H3PA 5HBEA 3ZO4A 4AW5A 5IQHA 4YPSA 2YJSA 5AP2A 4XG6A 2YJRA 3EHAA 5DVRA 1Z57A 3PY3A 4X3FB 4AGWA 2XKCA 4CTCA 5KMIA 4JQ8A 4WHZA 3AC5A 3CBLA 2WMTA 3D15A 4QO9A 2ITZA 1J1CA 3D2KA 3ZMMA 1BL6A 4DG2E 2IPXA 4JDIA 2C6EA 1O9UA 3Q60A 2X81A 3A60A 3CJGA 3KRXA 3W2QA 4OGRA 5AV4A 4C7TA 3GCPA 5IQBA 2X6DA 3S2PA 1P5EA 4D4RA 4PV0A 4Q9SA 5CVHA 4BDHA 3Q4CA 3G15A 2QO7A 3FWQA 3NLBA 3HAMA 5FM2A 3NNWA 3ZM4A 2WELA 3EQDA 1G5SA 2Z7LA 3AOXA 3K2LA 5I9UA 4JG8A 2LAVA 4ANBA 4FEVA 4UX9A 4QYFA 3EOCA 5J9LA 4FUYA 2GSFA 4MKCA 1LEWA 5BYYA 3DBQA 5JK3A 3EN7A 3RK5A 2Y0AA 4GV1A 2XEYA 2OF2A 5H8GA 1ZMUA 4HYIA 3TWJA 5HNGA 3KL8A 2IZSA 3AMYA 1H01A 2VTHA 3FYJX 4JBVA 1JSUA 2C0IA 4ZTNA 4IJPA 1UU7A 4C59A 5BMSA 2WO6A 3LAUA 3OOMA 2XMYA 4P90A 2BFYA 4U97A 4EORA 2BDFA 3DNEA 4NFNA 1ZLTA 2YAAA 3ZZEA 5JGAA 4FMQA 5IMXA 4GSBA 3IDPA 5EK7A 3NCZA 4QP4A 3OBGA 1H4LA 4XYFA 3D7TA 3ZC5A 4GU9A 4O21A 4UEUA 4YJSA 4KWPA 4O0UA 1G8SA 3RCJA 4BDJA 1U5RA 2VWXA 2XJ2A 2G1TA 4EHEA 1OPKA 3QRJA 1G8JA 4PRJA 5KUPA 3KA0A 3DJ7A 3B8RA 4IZ7A 5FP6A 3RK9A 4ORKA 4DINA 1U5QA 2WB8A 4NUSA 1WAKA 4XOYA 3FYKX 4RBLA 3AD6A 3MH3A 5L2IA 3V8WA 4JG7A 4HGSA 3R22A 4AOJA 1IAJA 3E3PA 4HGEA 4QYEA 4ZJIA 5A4QA 4XG3A 3MA3A 2IW9A 4F1OA 3P7BA 3GCSA 3UNJA 5B2KA 4E26A 5AJQA 3BL9A 2BALA 1Q97A 2X2KA 3AC3A 3VC4A 3ZS5A 1OL1A 2G2FA 4GJ3A 4C02A 2UVZA 2RIOA 3P5KA 4EWQA 4RWLA 3R7VA 3RWQA 1R0EA 2GNGA 3GC7A 4RVKA 3SQQA 4AN9A 4FV6A 4FTOA 2ONLC 4ALUA 4F6SA 1ZZLA 1MQBA 5FG8A 4EONA 3AMAA 4F1MA 3HA8A 5CU3A 2BTSA 4NM7A 1ST0A 5TKDA 3BHYA 3F88A 3R01A 4AZSA 3KIOC 5HIBA 3DJ6A 1YW2A 4HVGA 3F3ZA 4O7SA 5J8IA 2GS6A 3HV5A 4KNBA 5I0BA 1CMKE 2C1BA 4IAYA 2PVFA 2A19B 4BYJA 3OZ6A 4YZ9A 3W2CA 2E9NA 2OZAB 2HENA 3U9NA 3P23A 3RHXA 4HGTA 4EOJA 3NUAA 3A7JA 4OBOA 5CNOA 3OXTA 5DE2A 3S0OA 4ENYA 1MRVA 5KCVA 4OTGA 4L46A 3GBZA 4ZSJA 2DWBA 5EM5A 3PIXA 2YDIA 3UP2A 3WYYA 1CM8A 2PMLX 1ZOEA 3EQRA 4DITA 2W06A 3HV6A 4QYYA 1PXLA 2BRMA 3ANRA 1YDSE 1J91A 3FXWA 5HESA 3FXZA 5LQFA 4B8MA 4OTPA 4NM0A 4IVCA 4M12A 1YXVA 4EK5A 2IZTA 3GT8A 4OT5A 4DEDA 4EH5A 1WBNA 4N4SA 4ITJA 1BYGA 1Q5KA 5AP3A 3ZXZA 2YACA 3HKOA 5HE1A 3DDQA 4G6LA 5AUVA 2NP8A 2VTSA 4EJ7A 3VUMA 3HMPA 3LQ3A 4XRJA 4W4YA 2QNJA 5FTOA 4RGJA 5DR2A 4WG3A 2CDZA 4KS8A 3KC3A 5HE0A 4CNHA 4FBXA 1QPJA 3SW4A 5B7VA 3FZTA 1MRUA 3CY2A 3ALNA 3IG7A 4AZWA 4RX9A 4HCUA 4D28A 4GFOA 1NVRA 4S33A 3WE4A 4X0MA 2C3JA 3FKOA 3SXSA 3BPRA 2W1ZA 3OUNB 1M14A 1OM1A 3G9NA 3OEFX 5BUIA 2YEXA 3OW3A 3Q9YA 2ZDUA 3CSVA 3HRFA 5A54A 4Y5QA 3BELA 1DS5A 2E9PA 2PVMA 1Q8YA 3ODYX 1S9JA 3D5WA 3LFFA 4U7ZA 2HXQA 5D9HA 2X0PA 3AT3A 4ZSLA 3UO5A 4DG0E 5A46A 1R1WA 4KBKA 4ZSGA 3E92A 1U4DA 4FK3A 3POOA 4C3RA 1DAYA 2FVDA 1XH8A 3EYHA 4H39A 2JDVA 4NKSA 4NWMA 4QTAA 3JPVA 3R8MA 4E4XA 1HOWA 3D2IA 5CAUA 2HYYA 5KZ0A 1YHWA 2E9VA 2UZNA 3L8VA 4KINA 5CZIA 3NCGA 1IEPA 1JNKA 3FI2A 3R8UA 3QALE 5A6OA 3NAXA 3MWUA 4CLIA 3PRIA 5LMAA 3HYHA 4PPBA 3R9NA 1WBWA 3QF9A 3HGKA 2J6MA 4P5QA 2XNNA 4RMZA 4RZVA 3FXXA 3R02A 3QCYA 4H3QA 3IDBA 4WG4A 4C58A 1QPCA 3Q2MA 4UXLA 5JGDA 2A27A 2B9IA 4E8AA 1OIYA 4LYNA 4KRDA 4KB8A 2FGIA 5CF6A 2VO7A 4FV7A 3ZBFA 1Q61A 3MFRA 5EW8A 1YOJA 3COHA 4O83A 1J3HA 2C6LA 2J0KA 2QOLA 2CCIA 4LMNA 3WYXA 3NUPA 4BTKA 2XRWA 5LWMA 1KV2A 5AP5A 2WIHA 4QPSA 1F0QA 1GAGA 3LLTA 4IAFA 4TZRA 5EKOA 4CRLA 4X2GA 2V5QA 4I21A 4YTIA 1AGWA 2HWOA 3PVWA 5IKWA 2ZAZA 4L44A 2XCHA 4NTTA 2JKOA 4I94A 2I6LA 3GOKA 3L8XA 4DT9A 5FDPA 3QTXA 5BVFA 5HTIA 4RLKA 3DLSA 1PXIA 1FMKA 3LXKA 3R8ZA 4NL0A 3AD4A 3PP0A 4FKOA 4IC7A 3NMUF 3CTQA 1TZDA 5KBQA 4O27B 5HVKA 2CCHA 4K8AA 2Z7RA 1ZOHA 3KXGA 3NUNA 3M42A 4FGBA 4FYNA 1YI3A 4MWIA 3ZLYA 4ZS4A 4DFYA 5ETAA 5F4NA 4DGNA 4EUUA 2VV9A 3H30A 4GS6A 3VBVA 4ZY6A 4ACGA 4QMNA 3M2WA 4K0YA 4HGLA 4CYJA 3QXOA 5LJJA 4BCIA 3VUIA 3R30A 1YWRA 2QLUA 4QP7A 2XRUA 1H1PA 3QGYA 3FLZA 2UW7A 2ERKA 3P79A 4WBOA 1GZNA 3ORIA 3TV6A 5JQ5A 4ZMEA 1LPUA 5AP6A 1OL5A 2IG7A 3VBTA 3HNGA 3QD3A 3DK3A 2QOIA 3WOWA 2JAMA 4Q2AA 1V0PA 1UU3A 3DKOA 4G5JA 4KD1A 4RQVA 4WNMA 1YQJA 3T8OA 4RVLA 3DCVA 5D41A 5BNJA 2X9EA 2G9XA 3QD2B 4Z3VA 3DBFA 5J7HA 4V01A 4UV0A 4GK3A 4CFMA 4U5JA 3UNKA 4YHFA 4Q5HA 4BC6A 1H1SA 1O6KA 3C4ZA 4L3LA 3V6RA 5LMBA 1KUTA 3DXPA 2QO2A 3EQFA 3PVBA 3FLQA 4ZTHA 2Y4IB 5C9CA 3CC6A 3QQKA 5EG3A 2XZSA 4QMVA 4RFYA 3ZRMA 2RSVA 3TEIA 5HBJA 3ZM9A 3BYVA 4B4LA 1YKRA 2J5EA 5CSHA 4BDEA 2R3HA 3NPCA 5HO8A 5L8JA 4FSYA 3RZBA 3V8TA 5DYJA 3NYXA 3EFWA 4FIFA 4CG8A 3P7CA 2V0DA 4BTJA 4ERWA 4KIKA 2IW8A 3TUBA 2R3KA 3F5UA 4ERKA 2OJFE 2OSCA 4KAOA 3UO4A 3UMXA 5AV3A 2BAJA 5CANA 3QTIA 5H9BA 4CTBA 4LOPA 5B2LA 4QTCA 3IPHA 1OIRA 1I09A 5CEMA 5C4KA 3OXIA 3FSFA 5AUTA 4DE4A 5IH6A 2IF8A 4YZCA 3KMWA 4GFMA 4F7JA 4O0TA 2B4SB 4W8DA 1JAMA 3R73A 5HKMA 5AIRA 4KKHA 4H1MA 4RC3A 2XJ0A 3MH0A 4UY9A 3QTSA 3CGOA 4I23A 2XYNA 4M3QA 2BKKA 3RNYA 4E5AX 1UKHA 4WT6A 2UW4A 2WMWA 4CEGA 4G6NA 4F0GA 2YM8A 4BTMA 4QOXA 5C27A 4Q9ZA 4I41A 4C37A 4XBUA 3UDBA 4EH4A 4X3JA 4YP8A 4DA5A 2XK6A 1SVGA 4MD8E 1KE5A 5BUJA 2CMWA 3F2NA 1UVRA 4F6WA 3LCSA 1ZMVA 2ERZE 4YGAA 5DMZA 3MY1A 5HLNA 5IQCA 2V7AA 2JEDA 4FICA 1Y6AA 2IWIA 3KRRA 5E1SA 4MX9A 4BDAA 4WRSA 5BYZA 2IJMA 4JAIA 2C47A 2Y6OA 4YJPA 3ZUUA 3E5AA 3L8PA 4XP3A 2WD1A 1JWHA 4FC0A 4IC8A 1DI8A 3QQFA 4U44A 3U8WA 4BBMA 5CU0A 4O7VA 3KXZA 1E1VA 4XMOA 3UPZA 4O6LA 4MK0A 4MXCA 4YUQA 4IAZA 4YJUA 1NY3A 2BAKA 1CDKA 1NA7A 3NEWA 1L8TA 2OXDA 2YN8A 4PL5A 4O4BB 5CSVA 1W2DA 5KZIA 1FBNA 4JLCA 3D5VA 3RINA 1XJDA 1QMZA 2EWAA 4TWNA 4GUBA 3RM7A 3EZVA 3PXKA 4L6QA 1SMHA 4M68A 4EOMA 2JDOA 4EKKA 3PXQA 5J5TA 3H9RA 4FRFA 4M14A 3UG1A 3Q3BA 2RGPA 2NO3A 2F2CB 3CD3A 4YZNA 3VF9A 3ZTXA 4OBQA 3RPSA 4O0SA 2W5HA 4F9BA 3N4TA 2H6DA 2WPAA 4RIXA 3OT8A 4BCJA 3WZDA 1J7LA 1OBDA 4FSTA 4ZZMA 3DXQA 1J1BA 1V1KA 3I4BA 4O7TA 2P2IA 2Y6MA 4TNDA 4AFJA 1O6YA 4JL9A 4DHJA 5AUXA 4DFNA 4FKPA 4YC6A 1RQQA 5E1EA 5TT7A 2PMNX 3PE2A 4PWNA 3D5UA 1XBAA 4FZAB 2X4ZA 3OEZA 3QQGA 3DDPA 3PJ1A 3NR9A 4XOZA 5HG9A 1PJKA 3R9DA 4FK6A 4PMPA 5BPYA 4DHZA 1UWJA 3ZEPA 2R3LA 2UW8A 5ICPA 5L2TA 3S00A 2ZFYA 2BCJA 3R71A 4IAIA 2Z7SA 3N4UA 3KCKA 4EH9A 5E8WA 1OZ1A 2B7AA 5KHXA 1JLUE 3SC1A 3EN9A 4I4FA 4A9YA 3UTOA 3U4UA 2VTTA 4YJNA 4PNIA 2QO9A 3H9OA 3R00A 2GQGA 1DAWA 2GHMA 1QCFA 1QPEA 2GS7A 3CPCA 5F20A 3V5LA 4E6AA 4NT4A 3PA4A 5DPVA 3BYSA 2AEGA 3VUGA 4IDVA 3AKJA 2QONA 4MD9E 3TKHA 4WIHA 3DKFA 4NJ3A 1OKZA 2PZPA 4FNZA 3PVGA 4TRLA 1OBGA 2UW3A 1Z5MA 2WQBA 3HUBA 4B7TA 4YLJA 3O8PA 4ZY4A 5KKRB 4DGGA 1M2RA 1OKYA 4AA4A 4RVTA 1UV5A 4RRVA 4C4HA 3BZ3A 4AF3A 4DCEA 5I9ZA 4RJ5A 3O71A 4L3PA 2QI8A 1JKKA 3MESA 1Y8YA 3VNTA 5FTGA 4RIYB 5AWMA 5D11A 4J97A 3A7IA 3EH9A 3EB0A 4JDJA 4DBNA 2ITXA 4U42A 2PUPA 3NWWA 5DHJA 3VQUA 3F5XA 3P4KA 4LL0A 3TTIA 4RIYA 4DGLC 1PYXA 2FYSA 3E64A 3JVSA 3VHEA 3ENMA 4FT3A 2IEWA 2C5NA 4IAKA 3DNDA 4R3RA 4U41A 3RPYA 5FEEA 4FKSA 1JPAA 3BGQA 3GU7A 1BI7A 4ITIA 4MAOA 4XV1A 4RIWB 3DA6A 3Q4TA 3RP9A 3FL5A 3UODA 4AT3A 3KK9A 3VS2A 2WZJA 1OIQA 3GU4A 4FT0A 5HX6A 2WNTA 3CP9A 4IM0A 1OB3A 4GVJA 3KEXA 4D55A 4EBWA 3QUEA 4R3CA 3O96A 4WSYA 4N0SA 4YLKA 3QTWA 2GDOA 4J95A 4IACA 3LJ2A 3V8SA 5A3XA 2YZAA 4AGCA 1H1QA 2R2PA 3KXMA 3OWLA 3I60A 4K1BA 2YDKA 4IXPA 4PMTA 3V6SA 1YOMA 3ZEWA 4EK4A 5BQ0A 2B1PA 3W2SA 3TDVA 2W05A 4UMRA 1YDRE 3R9RA 3EQCA 2E9UA 2QHNA 3NNVA 2C6DA 4DTBA 1VYZA 3WZUA 2VGOA 2W4KA 3OTVA 3HECA 1JOWB 3MBLA 4G9RA 4UXQA 4WNPA 3R9OA 1RE8A 2BFXA 2WQEA 1W7HA 3L9PA 4FV0A 1XH7A 5TOZA 3WF6A 5CF8A 5ITAA 3PXYA 4G5PA 3E7OA 4I93A 5EFQA 4NW6A 3QD0A 4UBAA 2W1HA 5ANJA 5HIEA 3GEQA 1G8AA 1OVEA 4U3YA 5EM8A 5GHVA 2W7XA 2EU9A 3LCTA 3REPA 4GG7A 2W9FB 3QD4A 4FV4A 2CNVA 1RJBA 3BHVA 4FTQA 3W10A 4E4NA 3W2PA 2FSLX 1MUOA 3UOKA 3VS1A 4FSZA 3KRJA 2PUIA 5DIAA 4R7BA 4U45A 2B9HA 4MXXA 4ZEGA 2YM4A 4D2SA 4CKJA 5CAOA 3IW6A 3F7ZA 3LFQA 4B8LA 4NW5A 2GTNA 1XH5A 3DT1A 4ACMA 4HCTA 4DEAA 3ZLSA 3IO7A 5DOSA 4CFNA 4JIAA 3SRVB 5JFXA 2EXMA 2UZVA 3TJDA 5HVJA 3VBWA 3V04A 1ZYJA 2PPQA 4FKJA 4FZFB 1V0OA 5L6PA 1PXJA 2PTKA 2IVVA 3MB6A 2JITA 3NZ0A 4K2RA 4I20A 2J0IA 2VTRA 3ORXA 4R5YA 3A7FA 4GIIA 4LUEA 4XG9A 2QOCA 5ACKA 4FTUA 4C34A 1XKKA 2WMRA 4CZYB 2E9OA 5AR7A 1TFFA 1W2CA 4HPTE 4IVBA 5CQWA 4C8BA 4S34A 4YTHA 1UWHA 3HUCA 3QZGA 4JIKA 3MS9A 2OJJA 4FKRA 4V0GA 4AACA 3QLFA 4I92A 4K18A 5JEBA 4CQGA 4LOQA 2I0YA 2JDSA 5FXSA 4AWIA 1TVOA 2GU8A 4MQ2A 3FAAA 2GHGA 4M66A 4V04A 3I0OA 3MVMA 2FH9A 5CEIA 3BKBA 4M8TA 1TQPA 2R4BA 3NIZA 3CD8A 4DDIA 4IB0A 2QCSA 5HCZA 3H9FA 3RCDA 2NYAA 3D94A 4EC8A 4O7RA 2BZHB 4ZTSA 5ANDA 4HVDA 5D7AA 4KSPA 3SOAA 2VO3A 4ZTRA 3GXLA 4F0FA 4CFVA 4BCQA 3VS4A 2VZ6A 4KIKB 4XHKB 1Z9XA 1OITA 1Q4LA 4BKJA 5L6WL 3COMA