4AN6A

Kuntiz type trypsin inhibitor with factor xa inhibitory activity
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
175
structure length
172
Chain Sequence
YTVHDTDGKPVLNNAGQYYILPAKQGKGGGLGLSNDDDGNCPLTVSQTPIDLPIGLPVRFSSRARISHITTALSLNIEFTIAPACAPKPARWRIFNEQSSEKGYTPVKISDDFSSAAPFQIKKFEEDYKLVYCSKSESGERKCVDLGIKIDNRRLVLKEGDPFKVKFKKVDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Dual Inhibitory Role of Tamarind Kunitz Inhibitor (Tki) Against Factor Xa and Trypsin.
pubmed doi rcsb
molecule keywords TRYPSIN INHIBITOR
molecule tags Hydrolase inhibitor
total genus 39
structure length 172
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4an6A00
1HWMB 2ERMA 2LIQA 2R9KB 1RZOB 4IQPA 3WO2A 1V6UA 4I4QA 3BA7A 5F8YA 3PMEA 5DUYA 1FMMS 3FJDA 3Q7YA 3OJ2A 3FUOA 4I2SA 4I1BA 3AKHA 1G9BA 4A7YA 2D7RA 4ENDA 3NJ5A 3HMYA 4LO2C 1T4QA 1TFMB 2UUSA 1SZ6B 1G82A 3BAGA 3ZX7A 1FV3A 3FFZA 3V0AA 4I4OA 1IILA 2GO2A 1EYLA 1HWPB 4Q9PA 3WO4A 1ISWA 3CA3A 1BASA 2Y9GA 1P63A 5E24E 3ZXGA 3ZC9A 3N7JA 4XFTA 2X2TA 1BFBA 3AKFA 2QN4A 1DFQA 1TOOA 4HA2A 1J0SA 4JRAA 4IZXA 2F2FC 3BAOA 3JRRA 2ESUA 4YOLA 2Z48A 1RMLA 1WBAA 2L5XA 3H6QA 5BP5C 4TLPA 1TTUA 3BX1C 4ZBVB 3V0BA 2QYIB 2DRZA 4JP0A 3FJJA 4LO3A 3A23A 3AKGA 1DJSB 4I4SA 1PC8B 4LO7C 3O49A 4I8MA 1QQKA 4GP0A 1AVUA 2DS0A 3MPPG 4LO0C 4P6AA 3KMVA 5D63A 4J23B 3HBWA 5D61A 1TWMA 3D7WB 3QR5A 3F62B 1I1BA 3WO3A 3RMXA 3CAHA 2BEBA 1II4A 3AH2A 3I29B 3P53A 1JT5A 1ISXA 3BA5A 2Q3NB 1DQOA 4II0A 5JLVA 1GGPB 2K4AB 3F1RA 3EF2A 3O4AA 1MC9A 3P6JA 3JUTA 1S0FA 2KI4A 5F90A 3BADA 1DIWA 1JTCA 2Q9XA 4ISRA 3BA4A 3IM6A 4OW4A 4Q9GA 2M49A 2AQZA 2RQ9A 3Q7WA 1PUMB 1V6XA 3PG0A 4I6IA 4J2KA 3P6IA 2K43A 2E4MA 1SR4A 4P0JA 4XKIA 4L4IA 3IIRA 4DEPA 1PUUB 4J2YA 4EFRA 2ZQNA 4USOA 4I3NA 3O4OA 4AN7B 5DZUA 3UD7A 3OGGA 3BTAA 3PHZA 1KNMA 3V79C 4G9NA 4IHZA 3TC2A 4XFSA 1FWUA 3T8SA 5G00A 4G6MA 5GAQA 1ILR1 5FZYA 4FGFA 3ILAA 1G9CA 4P0LA 1BFGA 4QBVA 3VUOA 1FGAA 31BIA 3BRDA 2NTDA 3N7MA 1JLYA 2GZBA 4GP3A 2LIEA 4LO7B 3BRFA 4Z8SB 4I4PA 4USPA 2KH2A 1Q1UA 4I4RA 4IZEA 1YTOA 3FJKA 3BAHA 5BQUA 1ONKB 3PUBA 3R4UA 4EEEB 5JMCA 3A22A 4OUJA 1XHBA 3IM5A 2ET2A 1ITBA 2WBCA 1IT0A 1Z0HA 1WD3A 1IHKA 3LLPA 3AKIA 4ISQA 4OWJA 3CA1A 5EG6C 1DZDA 3H6SE 1D0HA 1EVTA 1YF8B 2D43A 3B9UA 1ISZA 2HZ9A 3IM7A 4EFQA 4Q91A 4IY9A 1FN0A 5EC5A 3A21A 3FJIA 3MALA 1S0DA 4D0TA 2X2SA 3N0KA 4QO3A 1AVXB 4LO1A 5DSSB 4P0KA 4J2SA 3FJCA 4QKSA 3BAQA 2NVHA 4DENA 3CA0A 3NBNA 2D22A 3NBEA 4X3AA 2NYYA 3NBCA 4QKRA 3VSZA 2VXTI 1CE7B 3BAUA 3NBDA 2VSEA 1S0CA 4OWKA 2Z49A 5F8SA 4LO3C 3RTIB 3HALA 3RMYA 2IWTB 3UD9A 3VT1A 1JQZA 3A07A 3AZVA 3OJVA 3RTJB 1HCDA 3CA5A 2Y9XE 3O4BA 3VT2A 1BLDA 2BFHA 2MIBA 4JKQA 4F34A 1MD6A 1TP0A 3H6RB 1YBIA 2FO1A 1G9DA 1FV2A 3I2AA 1R8OA 4I4XA 5BP5A 4OEGA 4J2XA 3FJEA 2RG9B 21BIA 1NUNA 41BIA 4EB2B 1R8NA 5FNXA 5BXSA 4X38A 2FFVA 1G9AA 3AZWA 4AN6A 3CRHA 1XYFA 4ZA3B 1M16A 2VU9A 1WBCA 3HN1A 3V0AB 4FVVA 1JT4A 4R6UB 4KEKA 3ZXDA 4OEEA 1IRPA 1ISYA 1Q03A 1CVSA 1AFCA 2E4MC 3K1XA 3SNVA 1SR4C 3OBRA 4QC4A 4I1EA 3E8LC 5HPZA 3QYDA 3AJ5A 2XOAA 2D24A 4I4VA 3WINA 2VSAA 2NZ9A 1V6WA 2FFUA 5BXTA 2RSTA 1BARA 4GOYA 3WMVA 1PWAA 2I1BA 4QALA 3CA6A 2MC2A 4A7ZA 3AH1A 3O44A 4GOVA 4I37A 5FZUA 3LTQA 4G1RA 3N7KA 1QQLA 4IYBA 1BLAA 2NM1A 4H04A 3V0BB 3W9TA 3VEQA 1AVWB 3OJMA 4IY8A 1XZZA 1HIBA 3VT0A 3POKA 3FGMA 4L4HA 2MLLB 3O4CA 3VWCA 2J3PA 3FJBA 1IRAX 3C9ZA 1I1EA 3S8KA 2AXMA 2KI6B 2YUGA 1EV2A 5DVHA 4QBCA 5BVPI 2BEAA 1PZZA 5BQUC 5FNWA 2HWMA 1RY7A 3FUQA 1K5UA 2ZR1B 4X39A 1TWEA 3AJ6A 4H9WA 3UJ0A 3O4DA 4ZKTB 6I1BA 1W3FA 3AH4A 4Z9WB 3UJ4A 3WA1A 3FJAA 1AVAC 1L2HA 2KLLA 3H6RA 4GAFA 1FWVA 4JKXB 2D44A 3UD8A 5BXPA 3OBTA 1HWOB 1K5VA 1XG6A 4F83A 1DQGA 4G9MA 4ZFUB 2ZQOA 3FJ9A 1WD4A 1DZCA 4KEIA 4KBBA 4LO1C 2DREA 2HW9A 4LO2A 4ZFYB 1M2TB 4G6JA 2VXRA 3CU1B 1Z2VA 1VCLA 1W3AA 1E0OA 2KKIA 4KEJA 5I1BA 5F8WA 4I7IA 3O3QA 4X37A 1HCEA 1IJTA 3CQAA 2VUAA 3FJ8A 4I4UA 2F8XC 1F31A 1QXMA 1Q04A 1W3GA 3N7LA 1DFCA 2F2FA 3CRIA 2D20A 1HKNA 3O5WB 2Y9WC 2D1ZA 4JQ0A 1JLXA 3Q7XA 4QD2C 4EFPA 4OEFA 4ZLBB 3FJHA 4ZGRB 1AF9A 4OWLA 4D0ZA 2P23A 1BFCA 1DLLA 1S0LA 5BXRA 1UPSA 4EKXB 3CA4A 4HJJA 4I0YA 2FDBM 1BFFA 3HSMA 1Z4SA 3I2XA 2D7IA 4LO0A 1RG8A 4KC3A 3WMUA 2D23A 4ZFWB 5D62A 3R4SA 1JT7A 3UDAA 1OQLB 3BAVA 4JAWA 4A7KA 3ZC8A 2AAIB 4WBCA 1JT3A 1YYNA 1FQ9A 5FZZA 3WINC 4HR6C 9ILBA 4D8HA 1N4KA 4GAIA 4DCKC 4CJMA 1BA7A 8I1BA 3IAGC 1S0BA 1A8DA 3BB2A 1V6VA 3VSFA 3BRGC 2FGFA 3FJFA 1YXWA 2IHOA 3CRGA 1S0EA 2Y9FA 4I4YA 3HOMA 1FMZA 5EHAA 3RSJA 4IONA 1HWNB 1S0GA 4LO8B 3S8JA 1TIEA 4XFUA 4I96A 2NP0A 1AXMA 2HWAA 2P39A 1EPWA 1IOBA 1NZKA 3OGFA 1ABRB 4ZOTA 2DRYA 7I1BA 1JY0A 1ISVA 2VLCA 5BOWA 4JPZA 2K8RA 4QD2B 1T9FA 4PC4A 2WRYA 5B2HA 2AFGA
chains in the Genus database with same CATH superfamily
1HWMB 2ERMA 2LIQA 2R9KB 1RZOB 4IQPA 3WO2A 1V6UA 4I4QA 3BA7A 5F8YA 3PMEA 5DUYA 1FMMS 3FJDA 3Q7YA 3OJ2A 3FUOA 4I2SA 4I1BA 3AKHA 1G9BA 4A7YA 2D7RA 4ENDA 3NJ5A 3HMYA 4LO2C 1T4QA 1TFMB 2UUSA 1SZ6B 1G82A 3BAGA 3ZX7A 1FV3A 3FFZA 3V0AA 4I4OA 1IILA 2GO2A 1EYLA 1HWPB 4Q9PA 3WO4A 1ISWA 3CA3A 1BASA 2Y9GA 1P63A 5E24E 3ZXGA 3ZC9A 3N7JA 4XFTA 2X2TA 1BFBA 3AKFA 2QN4A 1DFQA 1TOOA 4HA2A 1J0SA 4JRAA 4IZXA 2F2FC 3BAOA 3JRRA 2ESUA 4YOLA 2Z48A 1RMLA 1WBAA 2L5XA 3H6QA 5BP5C 4TLPA 1TTUA 3BX1C 4ZBVB 3V0BA 2QYIB 2DRZA 4JP0A 3FJJA 4LO3A 3A23A 3AKGA 1DJSB 4I4SA 1PC8B 4LO7C 3O49A 4I8MA 1QQKA 4GP0A 1AVUA 2DS0A 3MPPG 4LO0C 4P6AA 3KMVA 5D63A 4J23B 3HBWA 5D61A 1TWMA 3D7WB 3QR5A 3F62B 1I1BA 3WO3A 3RMXA 3CAHA 2BEBA 1II4A 3AH2A 3I29B 3P53A 1JT5A 1ISXA 3BA5A 2Q3NB 1DQOA 4II0A 5JLVA 1GGPB 3F1RA 2K4AB 3EF2A 3O4AA 1MC9A 3P6JA 3JUTA 1S0FA 2KI4A 5F90A 3BADA 1DIWA 1JTCA 2Q9XA 4ISRA 3BA4A 3IM6A 4OW4A 4Q9GA 2M49A 2AQZA 2RQ9A 3Q7WA 1PUMB 1V6XA 3PG0A 4I6IA 4J2KA 3P6IA 2K43A 2E4MA 1SR4A 4P0JA 4XKIA 4L4IA 3IIRA 4DEPA 1PUUB 4J2YA 4EFRA 2ZQNA 4USOA 4I3NA 3O4OA 4AN7B 5DZUA 3UD7A 3OGGA 3BTAA 3PHZA 1KNMA 3V79C 4G9NA 4IHZA 3TC2A 4XFSA 1FWUA 3T8SA 5G00A 4G6MA 5GAQA 1ILR1 5FZYA 4FGFA 3ILAA 1G9CA 4P0LA 1BFGA 4QBVA 3VUOA 1FGAA 31BIA 3BRDA 2NTDA 3N7MA 1JLYA 2GZBA 4GP3A 2LIEA 4LO7B 3BRFA 4Z8SB 4I4PA 4USPA 2KH2A 1Q1UA 4I4RA 4IZEA 1YTOA 3FJKA 3BAHA 5BQUA 1ONKB 3PUBA 3R4UA 4MZGB 4EEEB 3A22A 4OUJA 1XHBA 5JMCA 3IM5A 2ET2A 1ITBA 2WBCA 1IT0A 1Z0HA 1WD3A 1IHKA 3LLPA 3AKIA 4ISQA 4OWJA 3CA1A 5EG6C 1DZDA 3H6SE 1D0HA 1EVTA 1YF8B 2D43A 3B9UA 1ISZA 2HZ9A 3IM7A 4EFQA 4Q91A 4IY9A 1FN0A 5EC5A 3A21A 3FJIA 3MALA 1S0DA 4D0TA 2X2SA 3N0KA 4QO3A 1AVXB 4LO1A 4MZHA 5DSSB 4P0KA 4J2SA 3FJCA 4QKSA 3BAQA 2NVHA 4DENA 3CA0A 3NBNA 2D22A 3NBEA 4X3AA 2NYYA 3NBCA 4QKRA 3VSZA 2VXTI 1CE7B 3BAUA 3NBDA 2VSEA 1S0CA 4OWKA 2Z49A 5F8SA 4LO3C 3RTIB 3HALA 3RMYA 2IWTB 2NS2A 3UD9A 3VT1A 1JQZA 3A07A 3AZVA 3OJVA 3RTJB 1HCDA 3CA5A 2Y9XE 3O4BA 3VT2A 1BLDA 2BFHA 2MIBA 4JKQA 4F34A 1MD6A 1TP0A 3H6RB 1YBIA 2FO1A 1G9DA 1FV2A 3I2AA 1R8OA 4I4XA 5BP5A 4OEGA 4J2XA 3FJEA 2RG9B 21BIA 1NUNA 41BIA 4EB2B 1R8NA 5FNXA 5BXSA 4X38A 2FFVA 1G9AA 3AZWA 4AN6A 3CRHA 1XYFA 4ZA3B 1M16A 2VU9A 1WBCA 3HN1A 3V0AB 4FVVA 1JT4A 4R6UB 4KEKA 3ZXDA 4OEEA 1IRPA 1ISYA 1Q03A 1CVSA 1AFCA 2E4MC 3K1XA 3SNVA 1SR4C 3OBRA 4QC4A 4I1EA 3E8LC 5HPZA 3QYDA 3AJ5A 2XOAA 2D24A 4I4VA 3WINA 2VSAA 2NZ9A 1V6WA 2FFUA 5BXTA 2RSTA 1BARA 4GOYA 3WMVA 1PWAA 2I1BA 4QALA 3CA6A 2MC2A 4A7ZA 3AH1A 3O44A 4GOVA 4I37A 5FZUA 3LTQA 4G1RA 3N7KA 1QQLA 4IYBA 1BLAA 2NM1A 4H04A 3V0BB 3W9TA 3VEQA 1AVWB 3OJMA 4IY8A 1XZZA 1HIBA 3VT0A 3POKA 3FGMA 4L4HA 2MLLB 3O4CA 3VWCA 2J3PA 3FJBA 1IRAX 3C9ZA 1I1EA 3S8KA 2AXMA 2KI6B 2YUGA 1EV2A 5DVHA 4QBCA 5BVPI 2BEAA 1PZZA 5BQUC 5FNWA 2HWMA 1RY7A 3FUQA 1K5UA 2ZR1B 4X39A 1TWEA 3AJ6A 4H9WA 3UJ0A 3O4DA 4ZKTB 6I1BA 1W3FA 3AH4A 4Z9WB 3UJ4A 3WA1A 3FJAA 1AVAC 1L2HA 2KLLA 3H6RA 4GAFA 4H75A 1FWVA 4JKXB 2D44A 3UD8A 5BXPA 3OBTA 1HWOB 1K5VA 1XG6A 4F83A 1DQGA 4G9MA 4ZFUB 2ZQOA 3FJ9A 1WD4A 1DZCA 4KEIA 4KBBA 4LO1C 2DREA 2HW9A 4LO2A 4ZFYB 1M2TB 4G6JA 2VXRA 3CU1B 1Z2VA 1VCLA 1W3AA 1E0OA 2KKIA 4KEJA 5I1BA 5F8WA 4I7IA 3O3QA 4X37A 1HCEA 1IJTA 3CQAA 4MZFB 2VUAA 3FJ8A 4I4UA 2F8XC 1F31A 1QXMA 1Q04A 1W3GA 3N7LA 1DFCA 2F2FA 3CRIA 2D20A 1HKNA 3O5WB 2Y9WC 2D1ZA 4JQ0A 1JLXA 3Q7XA 4QD2C 4EFPA 4OEFA 4ZLBB 3FJHA 4ZGRB 1AF9A 4OWLA 4D0ZA 2P23A 1BFCA 1DLLA 1S0LA 5BXRA 1UPSA 4UY4A 4EKXB 3CA4A 4HJJA 4I0YA 2FDBM 1BFFA 3HSMA 1Z4SA 3I2XA 2D7IA 4LO0A 1RG8A 4KC3A 3WMUA 2D23A 4ZFWB 5D62A 3R4SA 1JT7A 3UDAA 1OQLB 3BAVA 4JAWA 4A7KA 3ZC8A 2AAIB 4WBCA 1JT3A 1YYNA 1FQ9A 5FZZA 3WINC 4HR6C 9ILBA 4D8HA 1N4KA 4GAIA 4DCKC 4CJMA 1BA7A 8I1BA 3IAGC 1S0BA 1A8DA 3BB2A 1V6VA 3VSFA 3BRGC 2FGFA 3FJFA 1YXWA 2IHOA 3CRGA 1S0EA 2Y9FA 4I4YA 3HOMA 1FMZA 5EHAA 3RSJA 4IONA 1HWNB 1S0GA 4LO8B 3S8JA 1TIEA 4XFUA 4I96A 2NP0A 1AXMA 2HWAA 2P39A 1EPWA 1IOBA 1NZKA 3OGFA 1ABRB 4ZOTA 2DRYA 7I1BA 1JY0A 1ISVA 2VLCA 5BOWA 4JPZA 2K8RA 4QD2B 1T9FA 4PC4A 2WRYA 5B2HA 2AFGA
chains in the Genus database with same CATH topology
1HWMB 2ERMA 2LIQA 2R9KB 1RZOB 4IQPA 3WO2A 1V6UA 4I4QA 3BA7A 5F8YA 3PMEA 5DUYA 1FMMS 3FJDA 3Q7YA 3OJ2A 3FUOA 4I2SA 4I1BA 3AKHA 1G9BA 4A7YA 2D7RA 4ENDA 3NJ5A 3HMYA 4LO2C 1T4QA 1TFMB 2UUSA 1SZ6B 1G82A 3BAGA 3ZX7A 1FV3A 3FFZA 3V0AA 4I4OA 1IILA 2GO2A 1EYLA 1HWPB 4Q9PA 3WO4A 1ISWA 3CA3A 1BASA 2Y9GA 1P63A 5E24E 3ZXGA 3ZC9A 3N7JA 4XFTA 2X2TA 1BFBA 3AKFA 2QN4A 1DFQA 1TOOA 4HA2A 1J0SA 4JRAA 4IZXA 2F2FC 3BAOA 3JRRA 2ESUA 4YOLA 2Z48A 1RMLA 1WBAA 2L5XA 3H6QA 5BP5C 4TLPA 1TTUA 3BX1C 4ZBVB 3V0BA 2QYIB 2DRZA 4JP0A 3FJJA 4LO3A 3A23A 3AKGA 1DJSB 4I4SA 1PC8B 4LO7C 3O49A 4I8MA 1QQKA 4GP0A 1AVUA 2DS0A 3MPPG 4LO0C 4P6AA 3KMVA 5D63A 4J23B 3HBWA 5D61A 1TWMA 3D7WB 3QR5A 3F62B 1I1BA 3WO3A 3RMXA 3CAHA 2BEBA 1II4A 3AH2A 3I29B 3P53A 1JT5A 1ISXA 3BA5A 2Q3NB 1DQOA 4II0A 5JLVA 1GGPB 3F1RA 2K4AB 3EF2A 3O4AA 1MC9A 3P6JA 3JUTA 1S0FA 2KI4A 5F90A 3BADA 1DIWA 1JTCA 2Q9XA 4ISRA 3BA4A 3IM6A 4OW4A 4Q9GA 2M49A 2AQZA 2RQ9A 3Q7WA 1PUMB 1V6XA 3PG0A 4I6IA 4J2KA 3P6IA 2K43A 2E4MA 1SR4A 4P0JA 4XKIA 4L4IA 3IIRA 4DEPA 1PUUB 4J2YA 4EFRA 2ZQNA 4USOA 4I3NA 3O4OA 4AN7B 5DZUA 3UD7A 3OGGA 3BTAA 3PHZA 1KNMA 3V79C 4G9NA 4IHZA 3TC2A 4XFSA 1FWUA 3T8SA 5G00A 4G6MA 5GAQA 1ILR1 5FZYA 4FGFA 3ILAA 1G9CA 4P0LA 1BFGA 4QBVA 3VUOA 1FGAA 31BIA 3BRDA 2NTDA 3N7MA 1JLYA 2GZBA 4GP3A 2LIEA 4LO7B 3BRFA 4Z8SB 4I4PA 4USPA 2KH2A 1Q1UA 4I4RA 4IZEA 1YTOA 3FJKA 3BAHA 5BQUA 1ONKB 3PUBA 3R4UA 4MZGB 4EEEB 3A22A 4OUJA 1XHBA 5JMCA 3IM5A 2ET2A 1ITBA 2WBCA 1IT0A 1Z0HA 1WD3A 1IHKA 3LLPA 3AKIA 4ISQA 4OWJA 3CA1A 5EG6C 1DZDA 3H6SE 1D0HA 1EVTA 1YF8B 2D43A 3B9UA 1ISZA 2HZ9A 3IM7A 4EFQA 4Q91A 4IY9A 1FN0A 5EC5A 3A21A 3FJIA 3MALA 1S0DA 4D0TA 2X2SA 3N0KA 4QO3A 1AVXB 4LO1A 4MZHA 5DSSB 4P0KA 4J2SA 3FJCA 4QKSA 3BAQA 2NVHA 4DENA 3CA0A 3NBNA 2D22A 3NBEA 4X3AA 2NYYA 3NBCA 4QKRA 3VSZA 2VXTI 1CE7B 3BAUA 3NBDA 2VSEA 1S0CA 4OWKA 2Z49A 5F8SA 4LO3C 3RTIB 3HALA 3RMYA 2IWTB 2NS2A 3UD9A 3VT1A 1JQZA 3A07A 3AZVA 3OJVA 3RTJB 1HCDA 3CA5A 2Y9XE 3O4BA 3VT2A 1BLDA 2BFHA 2MIBA 4JKQA 4F34A 1MD6A 1TP0A 3H6RB 1YBIA 2FO1A 1G9DA 1FV2A 3I2AA 1R8OA 4I4XA 5BP5A 4OEGA 4J2XA 3FJEA 2RG9B 21BIA 1NUNA 41BIA 4EB2B 1R8NA 5FNXA 5BXSA 4X38A 2FFVA 1G9AA 3AZWA 4AN6A 3CRHA 1XYFA 4ZA3B 1M16A 2VU9A 1WBCA 3HN1A 3V0AB 4FVVA 1JT4A 4R6UB 4KEKA 3ZXDA 4OEEA 1IRPA 1ISYA 1Q03A 1CVSA 1AFCA 2E4MC 3K1XA 3SNVA 1SR4C 3OBRA 4QC4A 4I1EA 3E8LC 5HPZA 3QYDA 3AJ5A 2XOAA 2D24A 4I4VA 3WINA 2VSAA 2NZ9A 1V6WA 2FFUA 5BXTA 2RSTA 1BARA 4GOYA 3WMVA 1PWAA 2I1BA 4QALA 3CA6A 2MC2A 4A7ZA 3AH1A 3O44A 4GOVA 4I37A 5FZUA 3LTQA 4G1RA 3N7KA 1QQLA 4IYBA 1BLAA 2NM1A 4H04A 3V0BB 3W9TA 3VEQA 1AVWB 3OJMA 4IY8A 1XZZA 1HIBA 3VT0A 3POKA 3FGMA 4L4HA 2MLLB 3O4CA 3VWCA 2J3PA 3FJBA 1IRAX 3C9ZA 1I1EA 3S8KA 2AXMA 2KI6B 2YUGA 1EV2A 5DVHA 4QBCA 5BVPI 2BEAA 1PZZA 5BQUC 5FNWA 2HWMA 1RY7A 3FUQA 1K5UA 2ZR1B 4X39A 1TWEA 3AJ6A 4H9WA 3UJ0A 3O4DA 4ZKTB 6I1BA 1W3FA 3AH4A 4Z9WB 3UJ4A 3WA1A 3FJAA 1AVAC 1L2HA 2KLLA 3H6RA 4GAFA 4H75A 1FWVA 4JKXB 2D44A 3UD8A 5BXPA 3OBTA 1HWOB 1K5VA 1XG6A 4F83A 1DQGA 4G9MA 4ZFUB 2ZQOA 3FJ9A 1WD4A 1DZCA 4KEIA 4KBBA 4LO1C 2DREA 2HW9A 4LO2A 4ZFYB 1M2TB 4G6JA 2VXRA 3CU1B 1Z2VA 1VCLA 1W3AA 1E0OA 2KKIA 4KEJA 5I1BA 5F8WA 4I7IA 3O3QA 4X37A 1HCEA 1IJTA 3CQAA 4MZFB 2VUAA 3FJ8A 4I4UA 2F8XC 1F31A 1QXMA 1Q04A 1W3GA 3N7LA 1DFCA 2F2FA 3CRIA 2D20A 1HKNA 3O5WB 2Y9WC 2D1ZA 4JQ0A 1JLXA 3Q7XA 4QD2C 4EFPA 4OEFA 4ZLBB 3FJHA 4ZGRB 1AF9A 4OWLA 4D0ZA 2P23A 1BFCA 1DLLA 1S0LA 5BXRA 1UPSA 4UY4A 4EKXB 3CA4A 4HJJA 4I0YA 2FDBM 1BFFA 3HSMA 1Z4SA 3I2XA 2D7IA 4LO0A 1RG8A 4KC3A 3WMUA 2D23A 4ZFWB 5D62A 3R4SA 1JT7A 3UDAA 1OQLB 3BAVA 4JAWA 4A7KA 3ZC8A 2AAIB 4WBCA 1JT3A 1YYNA 1FQ9A 5FZZA 3WINC 4HR6C 9ILBA 4D8HA 1N4KA 4GAIA 4DCKC 4CJMA 1BA7A 8I1BA 3IAGC 1S0BA 1A8DA 3BB2A 1V6VA 3VSFA 3BRGC 2FGFA 3FJFA 1YXWA 2IHOA 3CRGA 1S0EA 2Y9FA 4I4YA 3HOMA 1FMZA 5EHAA 3RSJA 4IONA 1HWNB 1S0GA 4LO8B 3S8JA 1TIEA 4XFUA 4I96A 2NP0A 1AXMA 2HWAA 2P39A 1EPWA 1IOBA 1NZKA 3OGFA 1ABRB 4ZOTA 2DRYA 7I1BA 1JY0A 1ISVA 2VLCA 5BOWA 4JPZA 2K8RA 4QD2B 1T9FA 4PC4A 2WRYA 5B2HA 2AFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HWM B;  2ERM A;  2LIQ A;  2R9K B;  1RZO B;  4IQP A;  3WO2 A;  1V6U A;  4I4Q A;  3BA7 A;  5F8Y A;  3PME A;  5DUY A;  1FMM S;  3FJD A;  3Q7Y A;  3OJ2 A;  3FUO A;  4I2S A;  4I1B A;  3AKH A;  1G9B A;  4A7Y A;  2D7R A;  4END A;  3NJ5 A;  3HMY A;  4LO2 C;  1T4Q A;  1TFM B;  2UUS A;  1SZ6 B;  1G82 A;  3BAG A;  3ZX7 A;  1FV3 A;  3FFZ A;  3V0A A;  4I4O A;  1IIL A;  2GO2 A;  1EYL A;  1HWP B;  4Q9P A;  3WO4 A;  1ISW A;  3CA3 A;  1BAS A;  2Y9G A;  1P63 A;  5E24 E;  3ZXG A;  3ZC9 A;  3N7J A;  4XFT A;  2X2T A;  1BFB A;  3AKF A;  2QN4 A;  1DFQ A;  1TOO A;  4HA2 A;  1J0S A;  4JRA A;  4IZX A;  2F2F C;  3BAO A;  3JRR A;  2ESU A;  4YOL A;  2Z48 A;  1RML A;  1WBA A;  2L5X A;  3H6Q A;  5BP5 C;  4TLP A;  1TTU A;  3BX1 C;  4ZBV B;  3V0B A;  2QYI B;  2DRZ A;  4JP0 A;  3FJJ A;  4LO3 A;  3A23 A;  3AKG A;  1DJS B;  4I4S A;  1PC8 B;  4LO7 C;  3O49 A;  4I8M A;  1QQK A;  4GP0 A;  1AVU A;  2DS0 A;  3MPP G;  4LO0 C;  4P6A A;  3KMV A;  5D63 A;  4J23 B;  3HBW A;  5D61 A;  1TWM A;  3D7W B;  3QR5 A;  3F62 B;  1I1B A;  3WO3 A;  3RMX A;  3CAH A;  2BEB A;  1II4 A;  3AH2 A;  3I29 B;  3P53 A;  1JT5 A;  1ISX A;  3BA5 A;  2Q3N B;  1DQO A;  4II0 A;  5JLV A;  1GGP B;  2K4A B;  3F1R A;  3EF2 A;  3O4A A;  1MC9 A;  3P6J A;  3JUT A;  1S0F A;  2KI4 A;  5F90 A;  3BAD A;  1DIW A;  1JTC A;  2Q9X A;  4ISR A;  3BA4 A;  3IM6 A;  4OW4 A;  4Q9G A;  2M49 A;  2AQZ A;  2RQ9 A;  3Q7W A;  1PUM B;  1V6X A;  3PG0 A;  4I6I A;  4J2K A;  3P6I A;  2K43 A;  2E4M A;  1SR4 A;  4P0J A;  4XKI A;  4L4I A;  3IIR A;  4DEP A;  1PUU B;  4J2Y A;  4EFR A;  2ZQN A;  4USO A;  4I3N A;  3O4O A;  4AN7 B;  5DZU A;  3UD7 A;  3OGG A;  3BTA A;  3PHZ A;  1KNM A;  3V79 C;  4G9N A;  4IHZ A;  3TC2 A;  4XFS A;  1FWU A;  3T8S A;  5G00 A;  4G6M A;  5GAQ A;  1ILR 1;  5FZY A;  4FGF A;  3ILA A;  1G9C A;  4P0L A;  1BFG A;  4QBV A;  3VUO A;  1FGA A;  31BI A;  3BRD A;  2NTD A;  3N7M A;  1JLY A;  2GZB A;  4GP3 A;  2LIE A;  4LO7 B;  3BRF A;  4Z8S B;  4I4P A;  4USP A;  2KH2 A;  1Q1U A;  4I4R A;  4IZE A;  1YTO A;  3FJK A;  3BAH A;  5BQU A;  1ONK B;  3PUB A;  3R4U A;  4EEE B;  5JMC A;  3A22 A;  4OUJ A;  1XHB A;  3IM5 A;  2ET2 A;  1ITB A;  2WBC A;  1IT0 A;  1Z0H A;  1WD3 A;  1IHK A;  3LLP A;  3AKI A;  4ISQ A;  4OWJ A;  3CA1 A;  5EG6 C;  1DZD A;  3H6S E;  1D0H A;  1EVT A;  1YF8 B;  2D43 A;  3B9U A;  1ISZ A;  2HZ9 A;  3IM7 A;  4EFQ A;  4Q91 A;  4IY9 A;  1FN0 A;  5EC5 A;  3A21 A;  3FJI A;  3MAL A;  1S0D A;  4D0T A;  2X2S A;  3N0K A;  4QO3 A;  1AVX B;  4LO1 A;  5DSS B;  4P0K A;  4J2S A;  3FJC A;  4QKS A;  3BAQ A;  2NVH A;  4DEN A;  3CA0 A;  3NBN A;  2D22 A;  3NBE A;  4X3A A;  2NYY A;  3NBC A;  4QKR A;  3VSZ A;  2VXT I;  1CE7 B;  3BAU A;  3NBD A;  2VSE A;  1S0C A;  4OWK A;  2Z49 A;  5F8S A;  4LO3 C;  3RTI B;  3HAL A;  3RMY A;  2IWT B;  3UD9 A;  3VT1 A;  1JQZ A;  3A07 A;  3AZV A;  3OJV A;  3RTJ B;  1HCD A;  3CA5 A;  2Y9X E;  3O4B A;  3VT2 A;  1BLD A;  2BFH A;  2MIB A;  4JKQ A;  4F34 A;  1MD6 A;  1TP0 A;  3H6R B;  1YBI A;  2FO1 A;  1G9D A;  1FV2 A;  3I2A A;  1R8O A;  4I4X A;  5BP5 A;  4OEG A;  4J2X A;  3FJE A;  2RG9 B;  21BI A;  1NUN A;  41BI A;  4EB2 B;  1R8N A;  5FNX A;  5BXS A;  4X38 A;  2FFV A;  1G9A A;  3AZW A;  4AN6 A;  3CRH A;  1XYF A;  4ZA3 B;  1M16 A;  2VU9 A;  1WBC A;  3HN1 A;  3V0A B;  4FVV A;  1JT4 A;  4R6U B;  4KEK A;  3ZXD A;  4OEE A;  1IRP A;  1ISY A;  1Q03 A;  1CVS A;  1AFC A;  2E4M C;  3K1X A;  3SNV A;  1SR4 C;  3OBR A;  4QC4 A;  4I1E A;  3E8L C;  5HPZ A;  3QYD A;  3AJ5 A;  2XOA A;  2D24 A;  4I4V A;  3WIN A;  2VSA A;  2NZ9 A;  1V6W A;  2FFU A;  5BXT A;  2RST A;  1BAR A;  4GOY A;  3WMV A;  1PWA A;  2I1B A;  4QAL A;  3CA6 A;  2MC2 A;  4A7Z A;  3AH1 A;  3O44 A;  4GOV A;  4I37 A;  5FZU A;  3LTQ A;  4G1R A;  3N7K A;  1QQL A;  4IYB A;  1BLA A;  2NM1 A;  4H04 A;  3V0B B;  3W9T A;  3VEQ A;  1AVW B;  3OJM A;  4IY8 A;  1XZZ A;  1HIB A;  3VT0 A;  3POK A;  3FGM A;  4L4H A;  2MLL B;  3O4C A;  3VWC A;  2J3P A;  3FJB A;  1IRA X;  3C9Z A;  1I1E A;  3S8K A;  2AXM A;  2KI6 B;  2YUG A;  1EV2 A;  5DVH A;  4QBC A;  5BVP I;  2BEA A;  1PZZ A;  5BQU C;  5FNW A;  2HWM A;  1RY7 A;  3FUQ A;  1K5U A;  2ZR1 B;  4X39 A;  1TWE A;  3AJ6 A;  4H9W A;  3UJ0 A;  3O4D A;  4ZKT B;  6I1B A;  1W3F A;  3AH4 A;  4Z9W B;  3UJ4 A;  3WA1 A;  3FJA A;  1AVA C;  1L2H A;  2KLL A;  3H6R A;  4GAF A;  1FWV A;  4JKX B;  2D44 A;  3UD8 A;  5BXP A;  3OBT A;  1HWO B;  1K5V A;  1XG6 A;  4F83 A;  1DQG A;  4G9M A;  4ZFU B;  2ZQO A;  3FJ9 A;  1WD4 A;  1DZC A;  4KEI A;  4KBB A;  4LO1 C;  2DRE A;  2HW9 A;  4LO2 A;  4ZFY B;  1M2T B;  4G6J A;  2VXR A;  3CU1 B;  1Z2V A;  1VCL A;  1W3A A;  1E0O A;  2KKI A;  4KEJ A;  5I1B A;  5F8W A;  4I7I A;  3O3Q A;  4X37 A;  1HCE A;  1IJT A;  3CQA A;  2VUA A;  3FJ8 A;  4I4U A;  2F8X C;  1F31 A;  1QXM A;  1Q04 A;  1W3G A;  3N7L A;  1DFC A;  2F2F A;  3CRI A;  2D20 A;  1HKN A;  3O5W B;  2Y9W C;  2D1Z A;  4JQ0 A;  1JLX A;  3Q7X A;  4QD2 C;  4EFP A;  4OEF A;  4ZLB B;  3FJH A;  4ZGR B;  1AF9 A;  4OWL A;  4D0Z A;  2P23 A;  1BFC A;  1DLL A;  1S0L A;  5BXR A;  1UPS A;  4EKX B;  3CA4 A;  4HJJ A;  4I0Y A;  2FDB M;  1BFF A;  3HSM A;  1Z4S A;  3I2X A;  2D7I A;  4LO0 A;  1RG8 A;  4KC3 A;  3WMU A;  2D23 A;  4ZFW B;  5D62 A;  3R4S A;  1JT7 A;  3UDA A;  1OQL B;  3BAV A;  4JAW A;  4A7K A;  3ZC8 A;  2AAI B;  4WBC A;  1JT3 A;  1YYN A;  1FQ9 A;  5FZZ A;  3WIN C;  4HR6 C;  9ILB A;  4D8H A;  1N4K A;  4GAI A;  4DCK C;  4CJM A;  1BA7 A;  8I1B A;  3IAG C;  1S0B A;  1A8D A;  3BB2 A;  1V6V A;  3VSF A;  3BRG C;  2FGF A;  3FJF A;  1YXW A;  2IHO A;  3CRG A;  1S0E A;  2Y9F A;  4I4Y A;  3HOM A;  1FMZ A;  5EHA A;  3RSJ A;  4ION A;  1HWN B;  1S0G A;  4LO8 B;  3S8J A;  1TIE A;  4XFU A;  4I96 A;  2NP0 A;  1AXM A;  2HWA A;  2P39 A;  1EPW A;  1IOB A;  1NZK A;  3OGF A;  1ABR B;  4ZOT A;  2DRY A;  7I1B A;  1JY0 A;  1ISV A;  2VLC A;  5BOW A;  4JPZ A;  2K8R A;  4QD2 B;  1T9F A;  4PC4 A;  2WRY A;  5B2H A;  2AFG A; 
#chains in the Genus database with same CATH topology
 1HWM B;  2ERM A;  2LIQ A;  2R9K B;  1RZO B;  4IQP A;  3WO2 A;  1V6U A;  4I4Q A;  3BA7 A;  5F8Y A;  3PME A;  5DUY A;  1FMM S;  3FJD A;  3Q7Y A;  3OJ2 A;  3FUO A;  4I2S A;  4I1B A;  3AKH A;  1G9B A;  4A7Y A;  2D7R A;  4END A;  3NJ5 A;  3HMY A;  4LO2 C;  1T4Q A;  1TFM B;  2UUS A;  1SZ6 B;  1G82 A;  3BAG A;  3ZX7 A;  1FV3 A;  3FFZ A;  3V0A A;  4I4O A;  1IIL A;  2GO2 A;  1EYL A;  1HWP B;  4Q9P A;  3WO4 A;  1ISW A;  3CA3 A;  1BAS A;  2Y9G A;  1P63 A;  5E24 E;  3ZXG A;  3ZC9 A;  3N7J A;  4XFT A;  2X2T A;  1BFB A;  3AKF A;  2QN4 A;  1DFQ A;  1TOO A;  4HA2 A;  1J0S A;  4JRA A;  4IZX A;  2F2F C;  3BAO A;  3JRR A;  2ESU A;  4YOL A;  2Z48 A;  1RML A;  1WBA A;  2L5X A;  3H6Q A;  5BP5 C;  4TLP A;  1TTU A;  3BX1 C;  4ZBV B;  3V0B A;  2QYI B;  2DRZ A;  4JP0 A;  3FJJ A;  4LO3 A;  3A23 A;  3AKG A;  1DJS B;  4I4S A;  1PC8 B;  4LO7 C;  3O49 A;  4I8M A;  1QQK A;  4GP0 A;  1AVU A;  2DS0 A;  3MPP G;  4LO0 C;  4P6A A;  3KMV A;  5D63 A;  4J23 B;  3HBW A;  5D61 A;  1TWM A;  3D7W B;  3QR5 A;  3F62 B;  1I1B A;  3WO3 A;  3RMX A;  3CAH A;  2BEB A;  1II4 A;  3AH2 A;  3I29 B;  3P53 A;  1JT5 A;  1ISX A;  3BA5 A;  2Q3N B;  1DQO A;  4II0 A;  5JLV A;  1GGP B;  3F1R A;  2K4A B;  3EF2 A;  3O4A A;  1MC9 A;  3P6J A;  3JUT A;  1S0F A;  2KI4 A;  5F90 A;  3BAD A;  1DIW A;  1JTC A;  2Q9X A;  4ISR A;  3BA4 A;  3IM6 A;  4OW4 A;  4Q9G A;  2M49 A;  2AQZ A;  2RQ9 A;  3Q7W A;  1PUM B;  1V6X A;  3PG0 A;  4I6I A;  4J2K A;  3P6I A;  2K43 A;  2E4M A;  1SR4 A;  4P0J A;  4XKI A;  4L4I A;  3IIR A;  4DEP A;  1PUU B;  4J2Y A;  4EFR A;  2ZQN A;  4USO A;  4I3N A;  3O4O A;  4AN7 B;  5DZU A;  3UD7 A;  3OGG A;  3BTA A;  3PHZ A;  1KNM A;  3V79 C;  4G9N A;  4IHZ A;  3TC2 A;  4XFS A;  1FWU A;  3T8S A;  5G00 A;  4G6M A;  5GAQ A;  1ILR 1;  5FZY A;  4FGF A;  3ILA A;  1G9C A;  4P0L A;  1BFG A;  4QBV A;  3VUO A;  1FGA A;  31BI A;  3BRD A;  2NTD A;  3N7M A;  1JLY A;  2GZB A;  4GP3 A;  2LIE A;  4LO7 B;  3BRF A;  4Z8S B;  4I4P A;  4USP A;  2KH2 A;  1Q1U A;  4I4R A;  4IZE A;  1YTO A;  3FJK A;  3BAH A;  5BQU A;  1ONK B;  3PUB A;  3R4U A;  4MZG B;  4EEE B;  3A22 A;  4OUJ A;  1XHB A;  5JMC A;  3IM5 A;  2ET2 A;  1ITB A;  2WBC A;  1IT0 A;  1Z0H A;  1WD3 A;  1IHK A;  3LLP A;  3AKI A;  4ISQ A;  4OWJ A;  3CA1 A;  5EG6 C;  1DZD A;  3H6S E;  1D0H A;  1EVT A;  1YF8 B;  2D43 A;  3B9U A;  1ISZ A;  2HZ9 A;  3IM7 A;  4EFQ A;  4Q91 A;  4IY9 A;  1FN0 A;  5EC5 A;  3A21 A;  3FJI A;  3MAL A;  1S0D A;  4D0T A;  2X2S A;  3N0K A;  4QO3 A;  1AVX B;  4LO1 A;  4MZH A;  5DSS B;  4P0K A;  4J2S A;  3FJC A;  4QKS A;  3BAQ A;  2NVH A;  4DEN A;  3CA0 A;  3NBN A;  2D22 A;  3NBE A;  4X3A A;  2NYY A;  3NBC A;  4QKR A;  3VSZ A;  2VXT I;  1CE7 B;  3BAU A;  3NBD A;  2VSE A;  1S0C A;  4OWK A;  2Z49 A;  5F8S A;  4LO3 C;  3RTI B;  3HAL A;  3RMY A;  2IWT B;  2NS2 A;  3UD9 A;  3VT1 A;  1JQZ A;  3A07 A;  3AZV A;  3OJV A;  3RTJ B;  1HCD A;  3CA5 A;  2Y9X E;  3O4B A;  3VT2 A;  1BLD A;  2BFH A;  2MIB A;  4JKQ A;  4F34 A;  1MD6 A;  1TP0 A;  3H6R B;  1YBI A;  2FO1 A;  1G9D A;  1FV2 A;  3I2A A;  1R8O A;  4I4X A;  5BP5 A;  4OEG A;  4J2X A;  3FJE A;  2RG9 B;  21BI A;  1NUN A;  41BI A;  4EB2 B;  1R8N A;  5FNX A;  5BXS A;  4X38 A;  2FFV A;  1G9A A;  3AZW A;  4AN6 A;  3CRH A;  1XYF A;  4ZA3 B;  1M16 A;  2VU9 A;  1WBC A;  3HN1 A;  3V0A B;  4FVV A;  1JT4 A;  4R6U B;  4KEK A;  3ZXD A;  4OEE A;  1IRP A;  1ISY A;  1Q03 A;  1CVS A;  1AFC A;  2E4M C;  3K1X A;  3SNV A;  1SR4 C;  3OBR A;  4QC4 A;  4I1E A;  3E8L C;  5HPZ A;  3QYD A;  3AJ5 A;  2XOA A;  2D24 A;  4I4V A;  3WIN A;  2VSA A;  2NZ9 A;  1V6W A;  2FFU A;  5BXT A;  2RST A;  1BAR A;  4GOY A;  3WMV A;  1PWA A;  2I1B A;  4QAL A;  3CA6 A;  2MC2 A;  4A7Z A;  3AH1 A;  3O44 A;  4GOV A;  4I37 A;  5FZU A;  3LTQ A;  4G1R A;  3N7K A;  1QQL A;  4IYB A;  1BLA A;  2NM1 A;  4H04 A;  3V0B B;  3W9T A;  3VEQ A;  1AVW B;  3OJM A;  4IY8 A;  1XZZ A;  1HIB A;  3VT0 A;  3POK A;  3FGM A;  4L4H A;  2MLL B;  3O4C A;  3VWC A;  2J3P A;  3FJB A;  1IRA X;  3C9Z A;  1I1E A;  3S8K A;  2AXM A;  2KI6 B;  2YUG A;  1EV2 A;  5DVH A;  4QBC A;  5BVP I;  2BEA A;  1PZZ A;  5BQU C;  5FNW A;  2HWM A;  1RY7 A;  3FUQ A;  1K5U A;  2ZR1 B;  4X39 A;  1TWE A;  3AJ6 A;  4H9W A;  3UJ0 A;  3O4D A;  4ZKT B;  6I1B A;  1W3F A;  3AH4 A;  4Z9W B;  3UJ4 A;  3WA1 A;  3FJA A;  1AVA C;  1L2H A;  2KLL A;  3H6R A;  4GAF A;  4H75 A;  1FWV A;  4JKX B;  2D44 A;  3UD8 A;  5BXP A;  3OBT A;  1HWO B;  1K5V A;  1XG6 A;  4F83 A;  1DQG A;  4G9M A;  4ZFU B;  2ZQO A;  3FJ9 A;  1WD4 A;  1DZC A;  4KEI A;  4KBB A;  4LO1 C;  2DRE A;  2HW9 A;  4LO2 A;  4ZFY B;  1M2T B;  4G6J A;  2VXR A;  3CU1 B;  1Z2V A;  1VCL A;  1W3A A;  1E0O A;  2KKI A;  4KEJ A;  5I1B A;  5F8W A;  4I7I A;  3O3Q A;  4X37 A;  1HCE A;  1IJT A;  3CQA A;  4MZF B;  2VUA A;  3FJ8 A;  4I4U A;  2F8X C;  1F31 A;  1QXM A;  1Q04 A;  1W3G A;  3N7L A;  1DFC A;  2F2F A;  3CRI A;  2D20 A;  1HKN A;  3O5W B;  2Y9W C;  2D1Z A;  4JQ0 A;  1JLX A;  3Q7X A;  4QD2 C;  4EFP A;  4OEF A;  4ZLB B;  3FJH A;  4ZGR B;  1AF9 A;  4OWL A;  4D0Z A;  2P23 A;  1BFC A;  1DLL A;  1S0L A;  5BXR A;  1UPS A;  4UY4 A;  4EKX B;  3CA4 A;  4HJJ A;  4I0Y A;  2FDB M;  1BFF A;  3HSM A;  1Z4S A;  3I2X A;  2D7I A;  4LO0 A;  1RG8 A;  4KC3 A;  3WMU A;  2D23 A;  4ZFW B;  5D62 A;  3R4S A;  1JT7 A;  3UDA A;  1OQL B;  3BAV A;  4JAW A;  4A7K A;  3ZC8 A;  2AAI B;  4WBC A;  1JT3 A;  1YYN A;  1FQ9 A;  5FZZ A;  3WIN C;  4HR6 C;  9ILB A;  4D8H A;  1N4K A;  4GAI A;  4DCK C;  4CJM A;  1BA7 A;  8I1B A;  3IAG C;  1S0B A;  1A8D A;  3BB2 A;  1V6V A;  3VSF A;  3BRG C;  2FGF A;  3FJF A;  1YXW A;  2IHO A;  3CRG A;  1S0E A;  2Y9F A;  4I4Y A;  3HOM A;  1FMZ A;  5EHA A;  3RSJ A;  4ION A;  1HWN B;  1S0G A;  4LO8 B;  3S8J A;  1TIE A;  4XFU A;  4I96 A;  2NP0 A;  1AXM A;  2HWA A;  2P39 A;  1EPW A;  1IOB A;  1NZK A;  3OGF A;  1ABR B;  4ZOT A;  2DRY A;  7I1B A;  1JY0 A;  1ISV A;  2VLC A;  5BOW A;  4JPZ A;  2K8R A;  4QD2 B;  1T9F A;  4PC4 A;  2WRY A;  5B2H A;  2AFG A; 
#chains in the Genus database with same CATH homology
 1HWM B;  2ERM A;  2LIQ A;  2R9K B;  1RZO B;  4IQP A;  3WO2 A;  1V6U A;  4I4Q A;  3BA7 A;  5F8Y A;  3PME A;  5DUY A;  1FMM S;  3FJD A;  3Q7Y A;  3OJ2 A;  3FUO A;  4I2S A;  4I1B A;  3AKH A;  1G9B A;  4A7Y A;  2D7R A;  4END A;  3NJ5 A;  3HMY A;  4LO2 C;  1T4Q A;  1TFM B;  2UUS A;  1SZ6 B;  1G82 A;  3BAG A;  3ZX7 A;  1FV3 A;  3FFZ A;  3V0A A;  4I4O A;  1IIL A;  2GO2 A;  1EYL A;  1HWP B;  4Q9P A;  3WO4 A;  1ISW A;  3CA3 A;  1BAS A;  2Y9G A;  1P63 A;  5E24 E;  3ZXG A;  3ZC9 A;  3N7J A;  4XFT A;  2X2T A;  1BFB A;  3AKF A;  2QN4 A;  1DFQ A;  1TOO A;  4HA2 A;  1J0S A;  4JRA A;  4IZX A;  2F2F C;  3BAO A;  3JRR A;  2ESU A;  4YOL A;  2Z48 A;  1RML A;  1WBA A;  2L5X A;  3H6Q A;  5BP5 C;  4TLP A;  1TTU A;  3BX1 C;  4ZBV B;  3V0B A;  2QYI B;  2DRZ A;  4JP0 A;  3FJJ A;  4LO3 A;  3A23 A;  3AKG A;  1DJS B;  4I4S A;  1PC8 B;  4LO7 C;  3O49 A;  4I8M A;  1QQK A;  4GP0 A;  1AVU A;  2DS0 A;  3MPP G;  4LO0 C;  4P6A A;  3KMV A;  5D63 A;  4J23 B;  3HBW A;  5D61 A;  1TWM A;  3D7W B;  3QR5 A;  3F62 B;  1I1B A;  3WO3 A;  3RMX A;  3CAH A;  2BEB A;  1II4 A;  3AH2 A;  3I29 B;  3P53 A;  1JT5 A;  1ISX A;  3BA5 A;  2Q3N B;  1DQO A;  4II0 A;  5JLV A;  1GGP B;  3F1R A;  2K4A B;  3EF2 A;  3O4A A;  1MC9 A;  3P6J A;  3JUT A;  1S0F A;  2KI4 A;  5F90 A;  3BAD A;  1DIW A;  1JTC A;  2Q9X A;  4ISR A;  3BA4 A;  3IM6 A;  4OW4 A;  4Q9G A;  2M49 A;  2AQZ A;  2RQ9 A;  3Q7W A;  1PUM B;  1V6X A;  3PG0 A;  4I6I A;  4J2K A;  3P6I A;  2K43 A;  2E4M A;  1SR4 A;  4P0J A;  4XKI A;  4L4I A;  3IIR A;  4DEP A;  1PUU B;  4J2Y A;  4EFR A;  2ZQN A;  4USO A;  4I3N A;  3O4O A;  4AN7 B;  5DZU A;  3UD7 A;  3OGG A;  3BTA A;  3PHZ A;  1KNM A;  3V79 C;  4G9N A;  4IHZ A;  3TC2 A;  4XFS A;  1FWU A;  3T8S A;  5G00 A;  4G6M A;  5GAQ A;  1ILR 1;  5FZY A;  4FGF A;  3ILA A;  1G9C A;  4P0L A;  1BFG A;  4QBV A;  3VUO A;  1FGA A;  31BI A;  3BRD A;  2NTD A;  3N7M A;  1JLY A;  2GZB A;  4GP3 A;  2LIE A;  4LO7 B;  3BRF A;  4Z8S B;  4I4P A;  4USP A;  2KH2 A;  1Q1U A;  4I4R A;  4IZE A;  1YTO A;  3FJK A;  3BAH A;  5BQU A;  1ONK B;  3PUB A;  3R4U A;  4MZG B;  4EEE B;  3A22 A;  4OUJ A;  1XHB A;  5JMC A;  3IM5 A;  2ET2 A;  1ITB A;  2WBC A;  1IT0 A;  1Z0H A;  1WD3 A;  1IHK A;  3LLP A;  3AKI A;  4ISQ A;  4OWJ A;  3CA1 A;  5EG6 C;  1DZD A;  3H6S E;  1D0H A;  1EVT A;  1YF8 B;  2D43 A;  3B9U A;  1ISZ A;  2HZ9 A;  3IM7 A;  4EFQ A;  4Q91 A;  4IY9 A;  1FN0 A;  5EC5 A;  3A21 A;  3FJI A;  3MAL A;  1S0D A;  4D0T A;  2X2S A;  3N0K A;  4QO3 A;  1AVX B;  4LO1 A;  4MZH A;  5DSS B;  4P0K A;  4J2S A;  3FJC A;  4QKS A;  3BAQ A;  2NVH A;  4DEN A;  3CA0 A;  3NBN A;  2D22 A;  3NBE A;  4X3A A;  2NYY A;  3NBC A;  4QKR A;  3VSZ A;  2VXT I;  1CE7 B;  3BAU A;  3NBD A;  2VSE A;  1S0C A;  4OWK A;  2Z49 A;  5F8S A;  4LO3 C;  3RTI B;  3HAL A;  3RMY A;  2IWT B;  2NS2 A;  3UD9 A;  3VT1 A;  1JQZ A;  3A07 A;  3AZV A;  3OJV A;  3RTJ B;  1HCD A;  3CA5 A;  2Y9X E;  3O4B A;  3VT2 A;  1BLD A;  2BFH A;  2MIB A;  4JKQ A;  4F34 A;  1MD6 A;  1TP0 A;  3H6R B;  1YBI A;  2FO1 A;  1G9D A;  1FV2 A;  3I2A A;  1R8O A;  4I4X A;  5BP5 A;  4OEG A;  4J2X A;  3FJE A;  2RG9 B;  21BI A;  1NUN A;  41BI A;  4EB2 B;  1R8N A;  5FNX A;  5BXS A;  4X38 A;  2FFV A;  1G9A A;  3AZW A;  4AN6 A;  3CRH A;  1XYF A;  4ZA3 B;  1M16 A;  2VU9 A;  1WBC A;  3HN1 A;  3V0A B;  4FVV A;  1JT4 A;  4R6U B;  4KEK A;  3ZXD A;  4OEE A;  1IRP A;  1ISY A;  1Q03 A;  1CVS A;  1AFC A;  2E4M C;  3K1X A;  3SNV A;  1SR4 C;  3OBR A;  4QC4 A;  4I1E A;  3E8L C;  5HPZ A;  3QYD A;  3AJ5 A;  2XOA A;  2D24 A;  4I4V A;  3WIN A;  2VSA A;  2NZ9 A;  1V6W A;  2FFU A;  5BXT A;  2RST A;  1BAR A;  4GOY A;  3WMV A;  1PWA A;  2I1B A;  4QAL A;  3CA6 A;  2MC2 A;  4A7Z A;  3AH1 A;  3O44 A;  4GOV A;  4I37 A;  5FZU A;  3LTQ A;  4G1R A;  3N7K A;  1QQL A;  4IYB A;  1BLA A;  2NM1 A;  4H04 A;  3V0B B;  3W9T A;  3VEQ A;  1AVW B;  3OJM A;  4IY8 A;  1XZZ A;  1HIB A;  3VT0 A;  3POK A;  3FGM A;  4L4H A;  2MLL B;  3O4C A;  3VWC A;  2J3P A;  3FJB A;  1IRA X;  3C9Z A;  1I1E A;  3S8K A;  2AXM A;  2KI6 B;  2YUG A;  1EV2 A;  5DVH A;  4QBC A;  5BVP I;  2BEA A;  1PZZ A;  5BQU C;  5FNW A;  2HWM A;  1RY7 A;  3FUQ A;  1K5U A;  2ZR1 B;  4X39 A;  1TWE A;  3AJ6 A;  4H9W A;  3UJ0 A;  3O4D A;  4ZKT B;  6I1B A;  1W3F A;  3AH4 A;  4Z9W B;  3UJ4 A;  3WA1 A;  3FJA A;  1AVA C;  1L2H A;  2KLL A;  3H6R A;  4GAF A;  4H75 A;  1FWV A;  4JKX B;  2D44 A;  3UD8 A;  5BXP A;  3OBT A;  1HWO B;  1K5V A;  1XG6 A;  4F83 A;  1DQG A;  4G9M A;  4ZFU B;  2ZQO A;  3FJ9 A;  1WD4 A;  1DZC A;  4KEI A;  4KBB A;  4LO1 C;  2DRE A;  2HW9 A;  4LO2 A;  4ZFY B;  1M2T B;  4G6J A;  2VXR A;  3CU1 B;  1Z2V A;  1VCL A;  1W3A A;  1E0O A;  2KKI A;  4KEJ A;  5I1B A;  5F8W A;  4I7I A;  3O3Q A;  4X37 A;  1HCE A;  1IJT A;  3CQA A;  4MZF B;  2VUA A;  3FJ8 A;  4I4U A;  2F8X C;  1F31 A;  1QXM A;  1Q04 A;  1W3G A;  3N7L A;  1DFC A;  2F2F A;  3CRI A;  2D20 A;  1HKN A;  3O5W B;  2Y9W C;  2D1Z A;  4JQ0 A;  1JLX A;  3Q7X A;  4QD2 C;  4EFP A;  4OEF A;  4ZLB B;  3FJH A;  4ZGR B;  1AF9 A;  4OWL A;  4D0Z A;  2P23 A;  1BFC A;  1DLL A;  1S0L A;  5BXR A;  1UPS A;  4UY4 A;  4EKX B;  3CA4 A;  4HJJ A;  4I0Y A;  2FDB M;  1BFF A;  3HSM A;  1Z4S A;  3I2X A;  2D7I A;  4LO0 A;  1RG8 A;  4KC3 A;  3WMU A;  2D23 A;  4ZFW B;  5D62 A;  3R4S A;  1JT7 A;  3UDA A;  1OQL B;  3BAV A;  4JAW A;  4A7K A;  3ZC8 A;  2AAI B;  4WBC A;  1JT3 A;  1YYN A;  1FQ9 A;  5FZZ A;  3WIN C;  4HR6 C;  9ILB A;  4D8H A;  1N4K A;  4GAI A;  4DCK C;  4CJM A;  1BA7 A;  8I1B A;  3IAG C;  1S0B A;  1A8D A;  3BB2 A;  1V6V A;  3VSF A;  3BRG C;  2FGF A;  3FJF A;  1YXW A;  2IHO A;  3CRG A;  1S0E A;  2Y9F A;  4I4Y A;  3HOM A;  1FMZ A;  5EHA A;  3RSJ A;  4ION A;  1HWN B;  1S0G A;  4LO8 B;  3S8J A;  1TIE A;  4XFU A;  4I96 A;  2NP0 A;  1AXM A;  2HWA A;  2P39 A;  1EPW A;  1IOB A;  1NZK A;  3OGF A;  1ABR B;  4ZOT A;  2DRY A;  7I1B A;  1JY0 A;  1ISV A;  2VLC A;  5BOW A;  4JPZ A;  2K8R A;  4QD2 B;  1T9F A;  4PC4 A;  2WRY A;  5B2H A;  2AFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...