4ANFA

Structure of the ornithine carbamoyltransferase from mycoplasma penetrans with a p23 space group
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
342
structure length
342
Chain Sequence
MPVNLKGRSLDSLLNFTTEEVQHLIDLSIDLKKAKYQGLHINNRPLVGKNIAILFQKDSTRTRCAFEVAASDLGAGVTYIGPSGSNMGKKESIEDTAKVLGRFYDGIEFRGFAQSDVDALVKYSGVPVWNGLTDDEHPTQIIADFMTMKEKFGNLKNKKIVFIGDYKNNVGVSTMIGAAFNGMHVVMCGPDNYKNEIDKNVLAKCIELFKRNGGSLRFSTDKILAAQDADVIYTDVWVSLGEPFELFDKRIGELKNFQVDMNMIKAAKNDVIFLHCLPAFHDDHTSFSKEVATTLGAKYPIVAKGEMEVTDEVFQSLHNKAFDQAENRMHSIKAIILSTIGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of the Enzymes Composing the Arginine Deiminase Pathway in Mycoplasma Penetrans.
pubmed doi rcsb
source organism Mycoplasma penetrans
molecule tags Transferase
molecule keywords ORNITHINE CARBAMOYLTRANSFERASE, CATABOLIC
total genus 127
structure length 342
sequence length 342
chains with identical sequence B, C, D
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4anfA02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4anfA01
4AMUA 4OH7A 1PVVA 3L06A 2OTCA 4KGXA 5G1NA 2FZCA 2QG9A 4AT1A 3M5DA 2FZKA 1DXHA 1ML4A 1XJWA 3TPFA 2RGWA 3MPUA 1I5OA 3GRFA 2YFKA 2AIRA 4KH0A 2BE9A 4F04A 3AT1A 4KGVA 4FYWA 1RAIA 1ORTA 4IV5A 2G7MC 4A8PA 3KZNA 1RAGA 9ATCA 2W37A 3L05A 2P2GA 5G1PA 1TUGA 3D6NB 4WTOA 1F1BA 3Q98A 4JFRA 2FG7C 1AKMA 3M4NA 4H31A 1TTHA 2BE7A 8AT1A 5ILQA 3R7FA 2AT1A 1R0CA 1R0BA 4JHXA 1OTHA 1EZZA 1JS1X 4KH1A 3M4JA 3NPMA 4KGZA 4AM8A 3LXMA 3E2PA 4A8TA 4A8HA 3R7LA 3M5CA 1TU0A 1RABA 3TXXA 2I6UA 4E2FA 2A0FA 4FYXA 1PG5A 1RAFA 2IPOA 1FVOA 1RAEA 1A1SA 1ACMA 8ATCA 4EP1A 1DUVG 1C9YA 2FZGA 3L04A 1ZA2A 4JQOA 1FB5A 4FYYA 3GD5A 4FYVA 5G1OA 3UPDA 2H3EA 1D09A 1AT1A 1VLVA 4ANFA 7AT1A 1Q95A 2HSEA 4EKNB 1NBEA 3CSUA 1EP9A 2FG6C 3KZMA 2ATCA 1RACA 1RADA 2QGFA 4BJHB 3D7SA 1EKXA 2EF0A 6AT1A 3L02A 5AT1A 1ZA1A 1RAHA 3KZKA 4NF2A 1SKUA 3R7DA 4F2GA 3KZOA 1RAAA 4KWTA 3SDSA 3KZCA
chains in the Genus database with same CATH superfamily
1HEUA 3UCFA 4UFOA 2C5HA 3C1AA 3DOEA 1UAGA 3KOZA 1GG2A 1E9CA 4KUHA 8GPBA 2ZI5A 1PK9A 4FHZA 3O9VA 3VBCA 1XFDA 3LY5A 4JVLA 2CFCA 2JGRA 1U2EA 3IQGX 4V0NA 1V8BA 3IP3A 1IVYA 4R31A 2GN0A 3NC0C 4IMJB 2NO9A 4Z2AA 2R1TB 1QP4A 5A9RA 3MJDA 1Y9EA 2X1VA 4K1LA 3M33A 3I8XA 4PINA 1FTNA 2AQHA 1HMYA 1LNZA 1E1CB 1XCMA 3GZNB 1UZAA 3F8TA 2Y93A 4IWNA 3STUA 4AN4A 3EGCA 1XLVA 2JLQA 4PVDA 3FMIA 2O2DA 1YVEI 3BFXA 3CQ9A 1LI7A 2WJVA 3QKTA 4FFVA 3BE5A 5EWJA 2XT9A 5EVCA 3ZWDA 2GM5A 5D7BA 2Q6LA 4G0UA 4BX2A 2CN1A 3ST7A 2ID8A 3LPNA 4JEHA 4TWIA 3LK6A 4X6XA 2WPDD 5ALKA 1XA3A 4CIAA 2WAYA 3TD6A 2H2IA 3IOYA 3UJPA 3WLJA 1HR0B 4RF3A 2I6XA 5M04A 4QBGB 1CUXA 4KBYA 2HSWA 3BZUA 4KLNA 2Y66A 1UC5B 1P2TA 4HDSA 1XMIA 5AXAA 3I73A 4BHTA 3HSSA 2H5LA 4UM5A 1IXYA 3TNJA 2H1CA 3COZA 3H1FA 1ZM9A 3PICA 4FOLA 4I9HA 3DD5A 4J9VA 4Q0MA 4OHYA 2RONA 2XNCA 3E48A 4WXMA 4JZYA 2RK4A 2R8PA 4QG7A 1LPMA 4ZT2A 4H15A 3WGYA 2WSYB 1KQFA 2XLCA 1MB9A 2OGTA 1GNPA 1S4MA 2AKAB 5TXGA 2I7XA 4DRXA 3EUFA 5DO9A 4TLEA 4FFNA 4XM1A 3EVAA 1U81A 5DYGA 3BD8A 3FYHA 3QXGA 3CE9A 1A9RA 2QROA 1UBRS 4J0HA 4KN6A 4AKTA 2R4QA 3K70B 2QUKA 3EMDA 4DR3B 2MSCB 4BC0A 1QYXA 4JAVC 4WT7A 5T5QA 4CWAA 1Z74A 3DAGA 1H69A 3FDXA 1FP6A 2B35A 3W5VA 2R8OA 3NORA 2YWRA 2WZCA 5JI3E 1GKYA 5EP1A 2R25B 4BN0A 1J97A 1H8HD 1U8YA 2FR8C 2WAOA 2VCYA 1E9SA 4ISBA 4FCWA 4D4LA 1P60A 4ESVA 1FYDA 3DUFB 2XD4A 4GPZA 2W58A 4DIEA 4AZ3A 4MKRA 5DDIP 1RM0A 2WPDA 3OHMA 1NY5A 1RS0A 1UJ4A 4KV7A 4V39A 5ALOA 4BB9A 4DF3A 3O91A 1J1IA 1SD5A 2YC2C 3EXEB 4YGXB 2LP4Y 1H2HA 4ZYYA 1BFUA 1AK1A 2XCUA 4FLMA 2PNFA 3LSYA 1XNJA 5LUBA 1C4WA 2QTGA 3AR9A 2BFEB 4G1VA 1K27A 2PTGA 1CVLA 3HN2A 1EJ0A 2IHTA 2Z3ZA 1B6SA 3T5DA 1O9HA 1ECCA 2IU6A 4OJMX 4DM3A 2BGNA 2REXB 3DDSA 3JYLA 4MGKR 4NRDA 3WGTA 1E1DA 4FX5A 4S04A 2JH8A 2IUTA 1C14A 1RHJA 1NT4A 5LQAA 4II7A 1VSBA 2C7BA 2M6LA 5G40A 5CCEA 3SXPA 1X7HA 5K45A 3HJGA 4HZGA 2J5RA 1D2HA 3I9V1 3NDPA 4O29A 2F67A 4UQPA 1Z6ZA 1DO2A 5T3YA 1GA4A 1IAVA 3RJMA 1WXQA 4FMCF 3UGJA 4CI9A 1OSNA 4MRMA 3B3JA 1ZJ4A 1I1HA 3BG5A 4EVIA 1SVUA 3PXAA 1MH9A 3E81A 3EDRA 4Q3AA 1TYDE 3RIYA 3UWOA 2ZXUA 1PS8A 2PJZA 5DT9A 3U1TA 1Z7WA 3AONB 2I8CA 4NCXA 1R27A 3IEKA 5DXJA 5CLLA 3IEUA 3DVSX 1IVNA 4K40A 5E2IA 5F1PA 2UU9B 2VPZA 4JP8A 1FSSA 4L4SA 4BGDA 4YDQA 4NABA 2RGDA 1K5HA 5CJPA 1FMJA 1YO6A 3R3UA 1HXHA 4EHFA 5A5DA 4W5QA 3IOMA 4TLCA 4KO2S 4MHOA 5DNDA 5IN4A 4FGLA 3GJXC 1TMKA 3FHLA 5JZSA 4C5AA 2GF2A 1QIJA 1XVUA 4MINA 1X94A 4J6EA 3HBLA 1NJ8A 3ONNA 3EXHC 5JAIA 5C8VA 1ESCA 2VA9A 1P0IA 4M9CA 5CPBA 3M6FA 3RT7A 1OWOA 3F0TA 3U9TA 1UWLA 1VPWA 1TM4E 1YVDA 1XNGA 2EAUA 2O3TA 2P2LA 1PV4A 2Z6QA 4Q18A 1RPNA 2O2YA 2ZFUA 4GSLA 3RTAA 4D9EA 5FJJA 4CTJA 3WLLA 3V9PA 4GO1A 4AZWA 1GAEO 3ZKWB 2Z8YM 3KLBA 4COOA 3ORRA 1DO0A 4ONEA 3EFHA 2H2AA 4XX0B 1Z8DA 3NHKA 5K3CA 4PX9A 3FDIA 3KWFA 4HAYA 3W1EA 1DEXA 2DUMA 3FF4A 2JHCA 1VKNA 3M2TA 3R3SA 4G4JA 4YJGB 3QBEA 1G8PA 4JFAA 3FZQA 2P6RA 1E20A 4KNVA 1PBNA 3D3WA 4EJMA 1QPBA 3JVDA 3A32A 2LCQA 3UOWA 2JFZA 4LTNA 4NBUA 4LF8B 3LBNA 4DDHA 1GT6A 1OILA 1JDBC 2A4KA 5FUBA 2HRZA 2OZEA 3GRVA 3O1IC 3THWB 1E66A 3AHGA 3GIWA 1UL1X 4BQIA 3J81k 3M6WA 3WYEA 3K8QA 1H4QA 1PEKE 3FNQA 2R4TA 2IYRA 2Z4TA 4GSYA 4RTNA 4XFJA 2C3UA 3B13B 4XPIA 4KU4A 3WQBA 1NVXQ 3D3WB 4WXEA 5BWCA 1LBEA 2OR3A 3H2YA 3GXOA 2PCLA 3WFZA 4BVBA 1WL8A 4DV6B 1QH1A 3CX7A 1GPJA 1Y3BE 4HO1X 1R4MA 3OIFA 3P2MA 3ROTA 2DQSA 2AWOA 2HJWA 2ZIVB 2DKFA 1G291 2YXNA 5TT1A 1JHPA 2CYAA 3WOHA 2CHGA 2ZIFA 1NX6A 2AUNA 1IBRA 5CNIA 4BO6A 5HKKD 5IWCA 1E6MA 1KR5A 1SIBE 1I7PA 3I76A 1CPYA 3IOBA 3L1KA 3O4VA 4D3SA 5ENVA 1WS6A 3RUPA 3EHEA 4MGIR 4A4DA 2YVUA 1XQ1A 4D4IA 2IIVA 4ACBA 3T7DA 1VI5A 2CT8A 3PVZA 5GZ6A 5BWNA 3BRWD 1QZZA 1JFLA 3WKCA 4GOJA 1DAIA 1UPCA 3NDBB 4LRWA 2PYIA 2WWHA 2AR0A 2GESA 2GFIA 2PBLA 1NA5A 1ENPA 3W05A 4E5YA 1YZFA 3BDIA 2X0DA 2NVUB 2EJCA 4HB2A 2C83A 1PK7A 5EL0A 5FHQA 3IEVA 2GHTA 1UDBA 1SPXA 4MVJF 2VLBA 2FDCA 1UFRA 1ZMTA 2NNWB 3L06A 4FQ5A 1CY4A 5BSFA 1JWAB 4OUKX 2Q8PA 1MFPA 2CD7A 2G71A 4X3PA 3UBMA 1BCRA 1A5AB 4E1AA 4JI7B 5GZ3A 3IQZA 4MUGA 1KSFX 4WACA 2FEWB 1MQAA 1CUFA 1Z8NA 5G0UA 2OORC 3BXOA 3STWA 5BSKA 3C1OA 2VZ0A 4XW2A 4UNRA 4R8KA 2BEKA 1RQ7A 2IY8A 5BR4A 5FOSA 2WP0A 4JJZA 4WY5A 4BQFA 3JATB 1DS6A 1DBIA 1UZUA 2BFFA 2ODNA 1PO7A 5I3ZA 4RE6A 1MJGM 4Q7JB 2OZLA 1Z28A 2YXPX 5J3JA 5E6UA 1EX7A 3GEPA 2C8VA 1OXVA 2REOA 5J63A 3WGIA 4YJ2B 3AO0B 2VEOA 1XPJA 1U6KA 3ZE6A 1EI9A 1ZEJA 3WY9A 4CDGA 5HUQA 1IWPB 4RUKA 2XCSB 5IC6A 4V0KA 1M67A 2ZM6B 2B6HA 3NASA 1ZRHA 2FOLA 3ENVA 3EUEA 4HATA 3VGPA 1QRUA 1QG6A 5DMXA 4TV8F 5I7UA 3QUTA 5I4IA 1M0TA 1P29A 2G67A 3T3IA 4DVJA 1T2DA 2EFYA 4HXGA 1RI3A 2I3BA 4L51A 4YI5A 5AKIA 1KQPA 4YP1A 621PA 5KC9A 4DB2A 2C9CA 1W4BA 3ZU6A 2Z8XA 4OB7A 4RVSA 5GADl 2AR7A 4ARUA 3B7WA 4IDPA 2H8KA 5E3JA 5JXHA 2WABA 2ZTHA 1ZU5A 2I71A 4KAJA 1YR9A 3SMVA 5E0KB 1SCUB 5JFGA 1O9GA 1T0UA 1GRVA 3PXUA 5IAGA 1DCMA 5EMHA 3V9AA 4GI1A 5KYXB 3G0DA 3N87A 4F0JA 1P18A 1HQCA 4RIIA 3GJQA 1UFQA 3MUNA 4OI2A 3F96A 2JL1A 1Y6GA 1GQFA 1ICEA 1O58A 4JB0A 1VKRA 2GD1O 1TKBA 2WC1A 1LQ2A 1Z8HA 1T0BA 4Q1DA 3H84A 1JV2B 3HN6A 3LWZA 4H2DA 4YMTA 1DJMA 5JPCA 3HBFA 3S2IA 2WKSA 1M1YA 1EEXB 3I9LA 2X19A 4MRSA 3DOFA 4S24A 1XWFA 2V7QA 3PLAE 1XL0A 5HBRA 3ISTA 5IASA 1UBSB 1UM8A 4J1QA 1USWA 4EAAA 2JGJA 3DZ8A 3GLFA 1M1YB 1ZGHA 2OESA 2O6HA 3T5CA 3WMGA 1H66A 4L07A 5F51A 3TLKA 3QWFA 2IYQA 4DC9A 2BC9A 3TXAA 1H6CA 4N82A 4OHUA 3A37A 3N8IA 5LA6A 3U37A 4CLXA 1TQDA 2ILVA 3R8FA 1LGYA 4KQXA 1A9TA 4YBZA 2P5SA 2A35A 4P3YA 1IEVA 2FFBA 2IPNA 2WG1A 4UMFA 4UMEA 4W8GA 5L3SA 3JZMA 2CMDA 2VXYA 2HA7A 5JY6A 2XOKD 2HMUA 4KXVA 2EBFX 1Q50A 1E7YA 3ACBA 3P8ZA 3DXXA 4YJ2F 2B30A 4NXMB 2VPQA 3CLRC 2FRVA 5CIYA 1Y33E 3PP8A 4K0RA 1YJ8A 3HLKA 2EZ9A 1ZKMA 1AMNA 2NADA 3QLVA 5C34B 3AEZA 3C4VA 3L01A 1OV4A 1CLEA 3ZDAA 3V1NA 3E05A 5G53C 3TQCA 3MJHA 1MB0A 2AA3A 2JF0A 3K94A 3M6XA 1FW8A 2LBPA 1N7GA 2GEDA 2X22A 4M53A 3GVPA 4KYVA 4UHDA 3JQ9C 2D2VA 5AJZA 4JL6A 4BBPA 1V7PC 4URVR 3NBAA 4Q4AB 4G25A 2ZAGA 3PTLA 1Z75A 5E38A 3AVWA 1YQGA 4M6WA 5BNTA 1GRRA 5BPFA 3SXJA 4DIUA 1ND5A 2NV2B 3JR3A 3IP8A 1WBDA 1MB2A 4KDCA 3H5VA 1Z73A 1AQ6A 2W2NA 4U6QA 1ECLA 1VDZA 3NTRA 3X1MA 5C9ZA 2WAAA 2CDAA 1INLA 1CJSA 4QE3A 3VSDA 1TZMA 3ASVA 4HTFA 2JH9A 2Q1UA 3MB8A 3BQMB 5EERA 4EPWA 2O8EB 3QHQA 3CGGA 4WESB 4XTCS 4YMLA 2HQSA 3SFVA 3OCCA 3X0DA 3C3JA 3LQKA 1V47A 2QD1A 3K4PA 4X44A 3KUUA 3TQOA 4ZYXA 2YR0A 3GLHB 4DLVA 5FA5A 1VYTA 2CMFA 2VP6A 2F4VB 2A92A 1T25A 3VBEA 2PGLA 5C3UA 4AZVA 1NYTA 4QPPA 1QDUA 2D4AA 2R96A 2ZJ6A 4OU4A 1E3TA 4GUAA 4PZ9A 4ZVPA 3V1UA 1WMAA 3GAFA 3RUEA 4Y6RA 2CNBA 2GPAA 2PUDA 2WJ3A 2GEKA 4IQFA 4Y2SA 2X8BA 5EWLA 4ZYUA 4M0FA 2PKQP 5HWSA 1J25A 4V0ME 1IZYA 3AUSA 1IM2A 4CTMA 3WP0A 4LCEA 3MM4A 4CLDA 4GRDA 3KELA 1SXGA 3OPYA 4GZ5A 1UOOA 4A9AA 4IJKA 4KREA 5FIUA 3PJEA 4UDOA 1KQOA 2P9FA 3GRZA 2LR0A 3L8GA 3OOSA 3DZFA 4FFMA 2BEVB 2G09A 3E8SA 1IBSA 4A8HA 3PQ8A 3ASZA 2ZJ3A 4LX0A 4WXPA 3T3PB 4OA5A 4JUDX 4S0ZA 2VATA 3UUFA 3P2JA 5EWLB 1SRRA 3KDSE 2J7PA 3C98A 1ECPA 2EYUA 2FSVC 2I6UA 3C3XA 3ZHVA 3C5VA 4BLSA 4MW0A 3PFFA 3V8RA 3O5AA 1VMDA 2ZUSA 1CUSA 1VM6A 4A2QA 5JMWA 1B43A 1QCYA 3ZCVA 1O5OA 5FOTA 2VP0A 4II3A 5GWXA 3TRJA 2Q6OA 3RS3A 4LAFA 1T36B 2BIFA 2FZGA 2HK6A 2LCFA 1WBJB 3R3JA 3WAGA 1JTVA 3HXQA 2G1KA 3GZ4A 1DQRA 4QICA 1XELA 3KUDA 3GGOA 5LXTF 5KOJA 2VJBA 3GH3A 2HA0A 4JQYA 4PSVA 3TS1A 3QMPA 4FONA 4JNKA 4RZQA 1G8HA 1YFZA 3D6TB 1RXIA 1CC1S 1SIUA 2YWBA 4ZEWA 4DCPA 4EG6A 1I9CA 2COUA 5AJWA 5H4GA 4B3GA 3MTGA 4TQGA 5C35A 2O2GA 3SQXA 2AJDA 3X1JA 2CSUA 2PL1A 4ZEXA 4JQCA 1I01A 2GAFA 1KEVA 3BGDA 1YKSA 5HGXA 1GEEA 1PKEA 5DWDA 3DC2A 4RKFA 1RADA 3FNBA 1EFUA 2ZQZA 3DTYA 5D1NA 3IKTA 3QGMA 1D8AA 1N2ZA 4QAQA 1JG7A 1KFCB 2ZKLA 4F1WA 9MHTA 4DG9A 1QMGA 4RY2A 1U99A 2I7CA 1OVMA 3WJAA 3JSXA 5CURA 1IWOA 4DC1A 2I2AA 2QAJA 3AM4A 2OQ2A 3CZPA 1MW8X 3WYBA 4CFYA 4LYJA 1U7ZA 2QTZA 3JRWA 1SVIA 2QM7A 4NYJR 3FLBA 5TEVA 1QHEA 3I9JA 1R8SA 4WFQA 3PKZA 3GLGE 5FWDA 5CDSA 4C0JA 2VDQB 4AK9A 2P77A 2KMLA 2B1IA 2QTTA 3CJRA 3ZJYA 5CNMA 4NEHB 4KITB 5ITVA 1OASA 1FFHA 2P40A 3IAHA 4QL3A 1YHNA 3FCYA 3ZXXA 2V7UA 5A02A 3SYTA 1WPXA 4RS3A 1XU4A 4UUBA 2D62A 3AM3A 3A9TA 1J56A 4GX1A 4V0RA 4E2YA 5LA6B 5LP6A 4JENA 5JQGA 1DIBA 4B44A 3K2IA 1L5NA 3J7TA 1HL3A 5BSTA 3EIUA 1EGAA 2JS7A 5EPUA 4R83A 4UHBA 3RIGA 3WGZA 3MW8A 1QDLB 1NG1A 4DZZA 1J5EB 1N78A 1FMFA 4RV4A 3DE1X 2GDJA 5K4HA 1VPTA 1APBA 2WTNA 1LZLA 1AKTA 1XEWX 2JA2A 1SK9A 1F8XA 2IE8A 4CKBA 5H3HA 4B9EA 2BMDA 3O2QB 1HYHA 2W6JA 4QEDA 4QJ5A 4TTVA 5G1PA 5C8YF 3K71B 2EATA 3AUKA 4O2AB 4WQMA 4ZAYA 3BL8A 1ZUD1 4OJNA 1FTGA 2CMHA 5LUAA 1UFKA 4B71A 5JDIC 1C7FA 2Y27A 1KF0A 3QU5A 4FB4A 1F9EA 4BECA 3D43A 5J40A 2HAEA 1GTZA 2Z5VA 1OIXA 4WLVA 1AHPA 5IW8A 1X9IA 2W6PA 4UTVA 1D0VA 3VPAA 4JMPA 5EFZA 4CLOA 4RL6A 3VNBA 1WNFA 2CFSA 1VPLA 2CUNA 3LUHA 4G5SA 4WAUA 2ZIGA 3RK0A 3EZNA 4KH1A 4F6RB 2XY4A 1M8FA 3U4DA 5IRCD 1XWIA 3BH7A 3JQ9A 2YIJA 3VTFA 2WU1A 4AP9A 2Y2VA 3LWNA 1P2SA 1TEHA 1Z5PA 2WDZA 2X0IA 1H42A 2ZATA 4YDSA 3UWDA 2R8RA 2Y77A 1W5SA 1MJ5A 2X7HA 4XR9A 1WXDA 2P9EA 3F4BA 2D2FA 3MRSA 4G8DA 4F45A 4N0QA 3Q6NA 3D4LA 2HDNB 5JJCA 3BL5A 3I6QA 3RANA 1TAQA 1GRNA 1HDIA 3QUQA 3EPPA 3WP1B 1G4AE 2HXGA 5AKLA 3OTOB 1LDYA 2HHCA 4WXRA 1E5VA 2RGNC 1Y8QB 1NT2A 1PZNA 3AB3A 3DZHA 3PWZA 4KN5A 4RTSA 4RK6A 1U4SA 5TC4A 3AOGA 5ES3A 3M4ZA 7YASA 2EG5A 2HM7A 6NULA 3N8HA 1QYIA 2FWJA 4UU1A 4E2ZA 3R5XA 1OREA 2ZT6A 4AMYA 4LCBA 3CN9A 4D80A 5CA0F 1MEJA 4MMYB 3X43A 3BBLA 4QUKA 4NBLA 2PD6A 3CUTA 3LTNC 1P5FA 4NZPA 4P3OA 4UHEA 5AIBA 2W2LD 3JZAA 5B6IA 4EY6A 2H29A 2OSBA 2QM3A 2XPCA 3PX2A 4JL8A 5HMLA 3W34A 2R84A 2X2FA 1ECFA 1TT7A 2B4KA 4DR6B 4CGYA 2PUTA 2AOXA 1C1XA 1ZXXA 2MJLA 1KA9H 4ENRA 2BHNA 4RANA 1QO9A 1S0UA 4RJKA 1R6BX 3V4LA 3ITEA 1UBEA 4NYJQ 4XA8A 1P19A 4PAGA 1WJGA 4M1EA 4ZZ0A 2YVAA 2H7YA 4IPTA 2CKMA 4XEUA 2C4WA 2QP3A 4EX7A 1EUYA 3WNCA 3EVTA 3U5ZB 1B6TA 4F2GA 1UP7A 2Q1WA 2VI5A 2XYGA 3AKDA 1KP3A 5KWVA 1Z7EA 1VMKA 2ZJ5A 4PLWA 3V4VB 4HZIA 4B4VA 4NX2A 2HCJB 3ZVLA 3Q1LA 5B7PA 3MUEA 4N40A 5E0OA 1GUDA 3P26A 5A0VA 4LE0A 3V1TC 3H9CA 4HXFB 4QNRA 4OUDB 4U9UA 4EY7A 2G0TA 1KMMA 4KK4A 4X6UA 3NB0A 1BKSB 4H7KA 1FBNA 3LX6A 1YE5A 2W4QA 3DO6A 4RD6A 1O96A 5JAPA 3F97A 1BVHA 2ZDQA 3F1KA 3UW1A 4Q3BA 4NMLA 4TLMB 1VB5A 3UCXA 2X8AA 3U3MA 5GONF 1SUDA 1SXPA 4AKGA 1H4TA 1KL7A 3CC8A 2BFPA 3OQIA 1YNOA 1Z2EA 2BFFB 2CF5A 5TSDA 1NPYA 1D03A 3EC1A 3RT9A 4Z1MA 2PGJA 3PTZA 1V8ZA 2O2JA 1KDZA 3T38A 3U2QA 3LIPA 4LJKA 3NNDA 4R8MA 2BFEA 1S8OA 3RSHA 2X76A 1YIAA 5DM4A 4AIRA 2OWEA 1RDFA 4AO8A 4DLUA 4AG6A 1M7HA 2EJBA 3TOSA 4PN7A 5I9IA 3DBVO 5BNZA 3NBKA 3E4CA 1Z0UA 4NU8X 4HNQA 1SG0A 2B5WA 4I55F 4LZPA 3W2EA 2FA9A 1O6GA 3REQB 1M9NA 3AWDA 1KI3A 3BXEA 4ZVOA 4D9JA 5C37A 1LW7A 2BFMA 2ZVJA 4W9RA 3G3EA 4EIWA 1AF7A 1BRTA 3HNOA 1X1QA 2IP1A 4FFDA 1T29A 1QUEA 4H4EA 4IXMA 3VPFA 4BKQA 2OK7A 2VZEA 4FGZA 4MRNA 2LKCA 2ZDHA 1FMCA 4L5YA 3WXMA 3KXDA 1I3CA 4TTRA 1UXJA 3DC7A 2Y0PA 2IEBA 1HG1A 1WF3A 1CUEA 1J0DA 3LVFO 2ZSFA 1QAMA 2ZPAA 4G4SP 5D5QA 4YRJA 3N59A 4CLHA 3DNMA 2QMEA 3IA2A 3N5CA 1RM3A 3V8PA 4B7ZA 4DY4A 3AH8A 2BJHA 4QQ8A 2ZRNA 4G3XA 2V8OA 1GQ2A 2Y4OA 3TZHA 4BQSA 3L77A 2J9FA 1PP4A 1Y6JA 2OLKA 4PZZA 3NNNA 5TJHA 3E1GA 2WHPB 1E5XA 2TMKA 1JA0A 4FMCB 2QM8A 3IAAA 3PS9A 1UOPA 1CFZA 3HHPA 3SC4A 1JDJA 3OLYA 3COYA 3KQMA 2C9YA 1RBZA 4XYLA 5C1IA 4B2IA 1OIWA 4OBEA 2R68A 2NU7A 5D85A 3FXAA 2GZ3A 3GH1A 1EBUA 4FYVA 1YS9A 4LWQA 4MW4A 1WQ4A 3UPDA 3VAYA 1NVTA 1WE2A 1USKA 1ZAKA 2RGNA 3QEAZ 3OY7A 4Z4CA 2G06A 2VHZA 4JT4A 1UZLA 4YWHA 2YRXA 4IHJA 1OZFA 1UJCA 3G2IA 3N75A 3BGVA 1X13A 5LB2A 3VH4A 1F7VA 1E7QA 3NGMA 1YTLA 1DKOA 1XROA 1I0LA 1KXZA 2PX3A 2CLCX 2I80A 1CJKC 2ISCA 2V6FA 3NONA 5EYPA 5IF9A 2R6FA 4CMEC 4YRZA 1RQ2A 3WGNA 4RGBA 2NO5A 2GS9A 3FPJA 3G9QA 4N1AA 1V4VA 3O4RA 2DPLA 3SI7A 5IXSA 2G76A 3UXYA 3FKSA 2HRCA 3ZQ4A 4FJ0A 1M6VB 3MD9A 3MERA 4LJSA 5LNK6 2IP4A 2PRKA 4B6EA 2D5AA 1AA9A 3W3AH 1ZVVA 5JAZA 1X7ZB 2YVKA 4URUR 1ISJA 3KZOA 1LLDA 3FZEA 1OCEA 5CDHA 1NV9A 2W7TA 2QY9A 2JB9A 2Y6UA 1DJLA 3D4BA 2JLBA 3GUCA 1L4LA 3MGKA 2VOEA 2XRFA 4Z99A 4C4XA 4D8TA 1E0DA 4UAVA 5I7HA 3IT2A 3SY8A 3JWGA 2PBFA 4HQRA 4FDVA 5HKKA 4DAOA 1XRQA 4K3UA 3R7SA 1POWA 1Z17A 1T9HA 2IUFA 2WMDA 4LRUA 4NZOA 5LQMA 1E2BA 3FOFC 3U6BA 3EWIA 3KYBA 4F7DA 1JJVA 4P22A 4NEGA 4N3CA 1QOQB 3FJ1A 3QU9A 2Q28A 1THGA 1SHKA 1ULBA 2FRDC 3M49A 1FLAA 1JLRA 2AJBA 2WYUA 4C4RA 3VSCA 3LP5A 1SJ9A 1RAGA 4UZEA 4B4KA 1PQYA 1KJJA 3IIIA 1E79A 3QTBA 5CDGA 1BE8A 3ISJA 3GCXA 1W4LA 4NYIQ 2VWGA 4Y2YA 1BJKA 1P5RA 2QR2A 3BUSA 3LA6A 3LPCA 4KWHA 2MSNA 4JP2A 5AJYA 1YS1X 4DCUA 1LRKA 1T26A 5IJ9B 4B3XA 3DV9A 4ZO9A 1OLUA 3CEMA 2HJSA 4INPA 3SQWA 1NV8A 2B69A 5C5EA 1VL1A 4MA4A 1QIKA 3WGQA 4MO9A 2QYTA 1VYUA 3ESZA 1AG9A 4EZIA 5B2FA 1J0XO 1W75A 5IKPA 3HRHA 5FQNA 1GLNA 3W3AA 1NXQA 3B48A 4HZUA 3TO5A 4DEYA 2X9VA 1UINA 2B1JA 2E7ZA 2IIQA 3T1OA 3OWXA 5D86A 1KAGA 4R1PA 3WZMA 3ZW8A 3FDFA 2G8LA 4LDNA 2A3RA 5DHFA 5FNVF 2DYKA 4BLRA 3JYHA 2GF9A 3GDGA 5JVDB 2H57A 5BPHA 5AOAA 1M5UA 4MUKA 2BMWA 1U7OA 1OD6A 1T6XA 1MX9A 2IXFA 2Z1DA 5GONA 1IZ8A 5KDLA 2BELA 2P2DA 1JQEA 1ODTC 3GEBA 1UT8A 4YHHB 1UMBA 2WWYA 4ZTUB 4Y1FA 3EGDB 4DPLA 2QS9A 4IBOA 2CB0A 4URZR 3K9QO 4MHSA 1PFKA 2HK9A 3SJAA 4ZAXA 1CJUC 2R6DA 1R50A 1TA4A 2HKIA 1XP5A 2NYAA 2XZTA 3QI7A 1G20B 1PSDA 2VNIA 1NM5C 4UEOA 5WRFA 2QB5A 4MZDA 2GYVA 4N6OA 2ESRA 2C1EA 3NBZC 3SJCA 3IO5A 4MI6A 1IK4A 3ADCA 1NVGA 5EUMA 3TEMA 1DG1G 1P77A 3B1FA 4CMKA 5KQSA 4M1QA 4HYYA 1M83A 2OCAA 3MWYW 3I1IA 2RK3A 5IUKC 3DLAA 2IH2A 1H6BA 4ZQHA 2DBZA 3TXYA 3IKVA 1S1MA 2YY6A 1SQ0A 4JZKA 5JQGF 1KARA 3RS4A 3GPBA 4HV4A 3OLZA 2CVFA 3KEGA 1MX1A 1XEAA 5I7RA 3HVRA 1FU7A 3ANSA 5A03A 5EJ7A 1NMQA 1WEKA 1FC0A 1YZGA 3C1UA 3GNLA 3IP9A 1XQXA 3ETGA 3R5FA 4TLBA 1CFJA 3OCJA 3OZUA 5JCZA 2W6NA 5LYJA 3UFXB 2PJRA 1G0OA 2VHWA 3JVEA 2X5NA 4M1TA 4WDQA 3RHZA 3PFWO 4NPHA 2CLHB 1NJ2A 2GJ9A 2ZI6A 3OFKA 3OQ1A 4GC5A 3TJRA 5ABPA 5FOQA 5MGNA 2XWJI 1KPIA 5DI9A 1K97A 4MPPA 5DSTA 4YGYA 1M6VA 2PRSA 1W0CA 2NU7B 3I9FA 4GYKA 4P1ZA 1P4SA 4A03A 2HHHB 3SC2A 4YMGA 4JLAA 3HKBA 5L6MB 3ZKWA 1Z0AA 3PE6A 1U8EA 5EHZA 1DAHA 4GOKA 3AR5A 1N25A 2TMDA 2HWUA 3EAGA 3H9EO 1EIZA 1CQJA 2WF5A 2OD7A 4RL4A 3N7UA 1EJBA 3QXXA 5B7GA 1QFMA 2RHRA 2FH5B 3M1LA 4ERXA 2AB0A 5AVKA 2AZ4A 3F8SA 4FZJA 3C70A 2A30A 3NDRA 5FFNA 3VPGA 3LNTA 3PJDA 4B76A 4RDHA 1PZEA 5IJ0A 3T0GA 3TG8A 4FNGA 4JBXA 4LTMA 3U49A 2GASA 1TGVA 3HDHA 3DQZA 2JAOA 5ALSA 1FXWA 2AFRA 3U7GA 4OYLA 2B3TA 2HIHA 3EQ9A 3QYPA 4UUOA 3T34A 1T5HX 3LLVA 3FCUB 3KQKA 3OFVA 1VE5A 1PT5A 2GCOB 2NZWA 4BNIA 1L1RA 3KVNA 5JSFA 4J94A 3RC8A 4ER5A 2XMSA 2YRWA 1XLTA 4ZARA 4KEAA 1NF8A 4FOTA 5A1JA 2M9MA 5JQWA 2C00A 3PQ6A 2TS1A 3QVOA 3RFCA 2PQMA 2RCNA 2VQ6A 1JAZA 1GDDA 2GCNA 3EZYA 3K0HA 3SFZA 3ZDRA 4QJ3A 4M9SA 5KBYA 5AHRA 4CM9D 1N5RA 1ZI9A 3CX3A 3EX7C 1G21E 1R4AA 1LX7A 2F1RA 3W9BA 3I53A 4A1FA 2DPXA 1BVRA 1YMVA 1Q5PA 2QTVA 3EFBA 4P82A 1GUYA 4RHEA 1USIA 3TZEA 1H0RA 4IKEA 1E1NA 1EUDA 1NLFA 1RJWA 3CURA 3UMFA 2VAMA 3H04A 3MWEA 3Q10A 4DUZB 4FBGA 2P8SA 1BXRA 3VVBA 4L6CA 3SKVA 5JV5A 2CXHA 1YACA 3V4PB 3LPAA 1ZWLA 5TMEA 2W2MA 3VR6H 3HVKA 3KBOA 4BCCA 4ES6A 2IXGA 4AJIA 3U26A 5BV8A 4BVAA 3HTXA 3GB9A 5HHTA 4EAQA 2XDWA 2W43A 1W85A 2UV8A 1HH4A 4FM9A 5HFAA 1XKTA 4GOXA 4UU7A 4A6PA 4IJVA 4ZVRA 1UMDA 3OFJA 3OPMA 4IX9A 4JJKA 1FFGA 3I4LA 3LAWA 1XTIA 2WHYA 3SOZA 5DBEX 4CEIA 4ZT5A 3UAGA 1XD8A 4C9BA 3SWWA 3LO8A 4EFKA 5IG2A 1AE1A 1SQGA 3VR4H 4GLJA 4EEZA 4EFLA 3OECA 1VLVA 4MQEB 3T5MA 4M87A 1XZEA 4HWGA 1OPXA 2A1IA 1SBZA 3C0KA 2PS3A 1K6JA 4K05A 3SMQA 2W42A 1U2GC 2OCKA 5JECA 3RAEC 1ZYUA 1ZJYA 2NTVA 1UPAA 2GN8A 1KOFA 3KZXA 3PQ3A 4Q3KA 3RB8A 1KIMA 1IPHA 1E4EB 1OXUA 2EWMA 3EDCA 2ADFA 3M70A 5GAJA 4AF7A 5BR8B 1N6LA 4ZYLA 1NBMA 4Y7DA 4JR0A 5LB4A 1QJ4A 2H5EA 2V7BA 4PC6A 2ARKA 3HRIA 1J0BA 2BDUA 4LA4A 4I66A 2VUUA 4F5EA 4A15A 2CSXA 4NBKA 4QBTA 4W6QA 4JASB 3TUIC 1IJEA 3R7DA 1GNLA 2H2WA 2KLBA 1YF3A 3GO4A 2XD9A 1Z4MA 2WP8J 3EAFA 1U31A 1VBFA 2IODA 3RU3A 5C7OO 2XNDA 1D4ZA 1R6DA 3UICA 5KKNB 4OX9Y 3OJXA 5IKXA 1CJVC 5JLAA 2OXTA 2CVZA 4G5OA 5LQDA 1KTIA 2OFWA 1O97D 1KPHA 3BYZA 4MUNA 3MMPA 4P84A 1I4WA 3TBKA 1XMPA 3QG1A 1RXCA 4OOFA 4ZCQA 2OPHA 2GQ0A 4TVSA 3TYXA 2CXQA 3J7AC 4YUZA 1T0JB 3ILSA 4YUWA 1LFDB 2B9EA 4ZK2A 3O8CA 4ZYZA 4MI1A 1N6RA 3QQ5A 5KSZA 3LKBA 3ZS9A 3U7EB 3PDIA 1U28C 3LLSA 3B7PA 4W9NC 4TTJA 5DYWA 4RDCA 2WOJA 4EW3A 5BQXA 5BUZA 1NYRA 2X3YA 1SKYE 2H2DA 3F5DA 5E6RA 3UT5B 5CDYA 3OT5A 1YB2A 4UBLA 4ZD6A 3S8MA 4J16A 3UA3A 1E3QA 4AN0A 4UEWA 1QGED 2VHTA 3Q3JB 4DCJA 4RTRA 1K3TA 3V7NA 4Z5XA 4IJMA 4CIYA 2DHRA 3N2GA 4TN1A 5BURA 1V9LA 1DJPA 3S8YA 3SR0A 2X5JO 2LRHA 4X94A 5B7QA 1OBFO 2QU8A 2AQKA 3B6IA 3DA8A 3IGFA 4Y6OA 1JUDA 3CLTC 4K9LA 1HNWB 1KJYA 1YZNA 5FLEX 1NRXA 1RYNA 1VHDA 1JWLA 2O8EA 1M5TA 2WJJA 3FR8A 2C7VA 2ZU6A 2VL7A 3UUWA 5BW8A 3NUZA 2EZTA 5AK5A 1A82A 3I37X 4MUAA 4K86A 4B33A 4CKBB 1F38A 1Y8RB 2FXIA 2JI7A 4YJDA 4RSHA 2AG5A 3LYUA 4PNZA 4B32A 4NMMA 2KM1A 4NENA 1KMHA 1WU7A 3UW3A 3F4KA 1WWKA 3NIFB 1A5BB 1CERA 3M5CA 3GFSA 3QWBA 4FOOA 2UZIR 5FTJA 4BASA 2HMYB 1JTFA 3NCHA 3BIOA 3C39A 5DN6A 5AMXA 4C7OA 1VIDA 1B93A 5F3DA 1KI2A 4QYMA 1RAEA 3VMMA 3OQ6A 3FGNA 4DMUB 4JLVA 1OWMA 1UXGA 1XN4A 2PPLA 3EVGA 5L7YA 1NXWA 3P4UA 4MKZA 4LF5B 4H4CA 2QY6A 1YZUA 3AI2A 1FTWA 4HGYA 4M46A 5IT5A 3AHCA 4UVHA 4KXWA 4WOKA 1T4GA 1VL8A 2NTEA 3M6UA 1T2AA 5GV8A 4IFBA 3WRWA 2HYDA 5AOCA 3QPAA 1XVIA 2DLDA 3VNUA 1N0UA 4FFBB 2GO1A 3GFFA 4R7ZA 2HSEA 3IP7A 2J48A 3RYTC 4DQKA 5AW4A 2O23A 3KB1A 4FT4A 1XHFA 4QGBA 4YCBA 2J6BA 3TOZA 3MAGA 3U3XA 4CF4A 3ZUPA 5K8CA 2VYND 2XQKA 3GQBB 4P5EA 3L07A 3KKKA 1TW3A 4YAOA 4FGUA 4ZI7F 3FCXA 1YMQA 2Q29A 3EEYA 2BL4A 3QKRB 3ZHRA 4PC1A 2O19A 4JYPA 1PAUA 1NE7A 1F1JA 2FX5A 3NM4A 3FVVA 4LJ5A 4PSCA 3SQLA 4QM6A 4LISA 1YR3A 4KQWA 5CPFA 2ZZMA 3HJAA 3MOSA 1NULA 1U2GA 4DMGA 3K8ZA 1EFLA 2H07A 5DNEA 2GBFA 3HNPA 1MORA 3NDIA 5BSEA 1CQWA 2G83A 1ZW6A 2QVYX 4EI7A 4MWCA 2I2FA 3EA4A 4U3JB 4JT8A 3WYAA 2O3QA 3DNPA 3DWFA 1TB4A 1ULUA 2J9FB 5T4BA 3HM2A 4W7SA 5SZJA 4UATA 5A3RA 2FN3A 4LFCB 1VA5A 3Q9UA 3TFQA 2VSFA 3OZDA 3LRTA 3LT4A 1RXSA 4XEHA 1JKIA 1QZTA 1V2HE 2ZREA 3THSA 5AM2A 2ZZNA 2OUIA 3AV0B 1G7CA 4ZFNA 2V74B 2WIAA 1Z0ZA 4DRXB 5LD2B 4NBSA 3QEMB 2VQDA 3ZNNA 4F9GA 5JWRA 1N3BA 1XKXA 5DASA 3SHOA 2XADA 5DI3B 1K5PA 2VK1A 1SPBS 3EA5A 3FPKA 3I39X 3WK8A 2F59A 2VZ8A 1V5EA 4BZZA 5JANA 4CM9A 1G20A 4CF6A 3RG8A 1YB4A 2XF2A 4INJA 3VHRA 4CG2A 3WBBA 3GARA 1CNEA 4TUYF 5DMHA 2D1TA 4HXEB 1NBME 5FPHA 2VJQA 3WRVA 4DVGA 3WJ1A 2BCGY 3IDZA 1NBHA 4A8JB 1JECA 2GM9A 2AD5A 5HTKA 1PWHA 5HQJA 1RQLA 4LHWA 4OL9A 2XV1A 4KPGA 3GF4A 3F6BX 10MHA 3I5MA 3ZZ0A 4WVLA 2I78A 3KU4A 2WWIA 2XMRA 4FFWA 4GBJA 4Q4LA 2IGTA 2I55A 1XI2A 2QGZA 4MROA 3OFNA 2VKTA 4GYWA 4KXLA 1SG9A 2JEOA 4LV6A 4RACA 1PX0A 2B8WA 4DB4A 3JD4A 3Q9NA 3K1TA 3LL4A 1JS1X 1RZVA 3FWYA 1L4UA 4B40A 1JF8A 2C4TA 4JEIA 1K2WA 4M7OA 3CNNA 4PPQA 3ZC3A 1JTEA 4F4UA 4B3IA 5DHRA 4ML3A 3RPEA 4KKVA 4UBMA 3OEHA 3PEUA 5JARA 2XKKA 3U4QB 1VLZA 5TPZA 4DLWA 3ELWA 2QN8A 3RQIA 1F5SA 3NUQA 5IK2A 4A0GA 1JHDA 3I72A 1YDEA 2WA2A 4TKLA 5TV2A 2PLFA 1OI4A 1OXBB 3AETB 4CFSA 2GT1A 2J3IA 3F4LA 1VFPA 1ZBDA 3E61A 4N5DA 4F84A 2O7QA 3TLAA 3RTGA 5AQ1A 1JR2A 3TW8A 5HIKA 3IP5A 1B0AA 1IEXA 4H6PA 1FDTA 3GHHA 4WCDA 2QM0A 4HB4A 4F4JA 2P62A 1J4AA 2A88A 2O05A 5FEMA 3WK5A 4NWIA 4E7PA 1K88A 3S1LA 4GMGA 2WIGA 1I13A 5EHXA 3ROEA 2XJ4A 1LTHR 2PLWA 4IIEA 1I1NA 4X45A 1HC7A 5REQA 1QYVA 1YZ3A 1RMTA 3V8QA 2EP8A 3FOZA 1K66A 3FSJX 3K35A 4IV8A 1JEYA 5JRDS 5FQOA 3CUSA 4GLOA 1JALA 3TQFA 3UM9A 1KFEB 4FGSA 4Z2YA 1WD5A 4H18A 1BGXT 1VHLA 2Y9PB 3REQA 3WL7A 4JA2A 4LDZA 4A36A 1ISRA 4E21A 4HVLA 5CFZA 1GFIA 1TM2A 1Z7GA 3FETA 1GGMA 3TBFA 4ESOA 4XQ0A 3BJEA 4JQSA 4FD2A 4W63A 3SLKA 1PYGA 1SGWA 4B73A 4DABA 4D8WA 3EXFB 1W44A 2PKEA 1MDBA 3PR2B 3EXG2 3PVSA 4JBLA 3ZG6A 3RU2A 4YV2A 2CV2A 2PD3A 4QQRA 4L8FA 1MLDA 2CJFA 3OC6A 5F12A 2CYCA 3OF3A 5CA0B 1PZGA 4RABA 2FP4A 1QQ7A 1NLMA 3KKPA 5I7WA 4F3TA 4O5OA 1LDGA 1UIRA 2B5VA 2NN3C 2VNSA 4KPUA 4B09A 1IQUA 1UXOA 3K2EA 2DFPA 3X1DA 4Z3KA 2AV6A 4X62B 4D9BA 1FYXA 3B12A 3E3MA 1GRCA 3TKYA 1HY3A 2C8LA 4YJFB 5HX7A 5TX7A 3TX2A 3MHPA 3IBCA 4IG9A 3D64A 3CH7A 4YCSA 5HF8A 1T91A 3D4NA 2JFVA 4CM6A 2H4ZA 2OXCA 1KYIA 2ZRFA 2XOKA 3EE6A 3P9XA 2WHQA 4JBNA 2JHAA 3EWSA 5DTQA 3DAYA 5A4MS 2VQFB 3UB2A 1WNTA 2XIJA 3T3NA 1XF1A 5FWXA 5KTRA 3NV9A 3R5TA 5LLTA 2AFHB 1UEJA 4LCJA 2QPOA 3V3TA 2EIHA 1C3JA 1U8TA 3LUFA 1ODLA 3KOMA 4LZLA 2WSLA 3S2GA 1DEKA 1ADCA 4YYEA 3ZHYA 5B1EA 4EJ6A 4AZSA 3TFOA 3OTGA 2P2GA 4L5AA 4QNNA 3RF7A 3E53A 4KQ2A 1WOMA 5AI9A 3MRVA 3D2LA 1HDGO 3GIDA 4O4IA 3VPXA 4BO0A 3Q8KA 1TK3A 4MK4A 1IB0A 1G8YA 1K2VN 2HGZA 5KREA 1ZXBA 1ZFNA 1DAGA 1DWPA 2I65A 3CG0A 1YR6A 1ZITA 3BMCA 3DO8A 4WASA 4X3OA 2PEYA 3KB2A 4OK3A 2C0PA 1PX2A 1JHOA 3UQZA 3PNBA 4OQEA 7REQA 1PFYA 2P9HA 4UM8B 3FNFA 1PZMA 2AK3A 1ISGA 5LM3A 3TGWA 4CUKA 4PEVA 1OWLA 2FUG6 3GGGA 3JRXA 4BPBA 1E4YA 4ZAZA 1UBNA 3IDQA 1MA0A 4N9WA 5CBKA 2AWNA 3EXFA 2E4AA 5DHAA 4A8TA 3DZCA 1MQ8B 3BIWA 4P2GA 1NTOA 1GP2A 4FE4A 4LW8A 2JJMA 1KEWA 3TJZA 5AVUA 2FUNB 2O8BA 4JNCA 2DPYA 2FQQA 3DS8A 1B0ZA 4ZMRA 2CV0A 1WCIA 3TDKA 3A25A 4JOCA 1NBWB 2X3FA 4YMWA 3K32A 3IMCA 1KE2A 4HMQA 1Z16A 3EIXA 2NYRA 1W85B 1FF9A 3OZRA 1U9CA 3AF3A 4E2XA 2P69A 1N2BA 4E09A 4WW0A 1JP7A 1X6VA 1Z2CA 1ESZA 2C2BA 2CNKA 3G17A 4KLRA 4LMRA 3O8OA 5JRJA 5KJCA 4O25A 4B79A 3S28A 1MB3A 2X0EA 4QOEA 4PO3X 2MR6A 4C7VA 3PDIB 1N3LA 2FPPA 2CFOA 2W8BA 2EERA 2C94A 2O3SA 2X9LA 3O8OB 5I7EA 1ZUHA 3N70A 4BKRA 1IZ7A 3BIFA 4DMCA 4JVOA 1RU3A 3V1YA 3R9XA 4E5DA 4XJVA 2P0AA 3AIKA 3LBIA 3VYUB 2WF9A 2Z57A 4Y2VA 1RQGA 2C07A 1SCJA 3NV7A 4NK5A 4BBJA 1ZM2A 2QD4A 4S0XA 1EP9A 3PNMA 1L3CA 1LBTA 1YL7A 4O1HA 1N1EA 4JJIA 1BCRB 2FWAA 2GDZA 4D6PA 5J2UA 4IICA 2NUBA 3DZKA 4I5GA 4I46A 3A14A 3ZDCA 2PH7A 2ZRHA 4CCYB 4HLCA 3GLTA 1P1FA 4X71A 2OHOA 5ALDA 1CUBA 3EXHA 1NVUQ 1BXRB 1GA6A 3I01M 4KIWA 2A5YB 3G7SA 5L4SA 1GQOA 1WB4A 3K6KA 5L3QA 3BWVA 3WWOA 4XM2A 1DCKA 1P0CA 3EXHB 2GO7A 3OU2A 3IYLW 1M54A 2X4IA 3OE4A 1TFRA 4OQ4A 2AFIE 1E2MA 1FUYB 3ILXA 4W1SA 3O3NB 1W0KA 3G2MA 3PCXA 4LX8A 5CH8A 4ZANA 4AYWA 3EZXA 3D4PA 3DV0A 4Z3DA 2MWMA 2V5AA 1MGPA 3PHLA 4L02A 3DOUA 2HQOA 1AGYA 5BSHA 5JVDA 1EB9A 3ZBTA 5AYVA 1W4ZA 3GG2A 5KPDA 2P0EA 1HE5A 2DH6A 2V55B 3BH6A 3I45A 5GGXA 5CDFA 4QLOA 2VWHA 3RI3A 3G2NA 3CPEA 4C7MA 1MO5A 1A69A 3CEPB 3CNOA 4XOUA 4ZQCB 4I4TA 1KEKA 4KR7A 4H17A 4HFMA 5EUCA 2ZSIA 5EQDA 1KE1A 3WWZA 4BRUA 1WCWA 1ZS9A 3A04A 3R6WA 3D81A 4KXYA 1LBHA 1ZVQA 3GJYA 1NFFA 4CM8A 4KVZA 3PQEA 4UUMA 4MKIA 5G3YA 2WY2D 2P79A 3RVPA 3QVUA 2WYVA 3EVFA 3GRYA 4EY3A 4PV7A 4EEKA 3E27A 1AQNA 3T7RA 4MEBA 1MC4A 4ODIA 4UOQA 5F73A 2GAIA 4Z51A 5B57C 5EE5B 5JRZA 2Z9CA 4MVJD 3HR8A 2WYIA 3VO9A 4BLWA 1K0FA 4CCSA 2EGGA 2FW6A 4P4NA 4WXHA 3GLQA 4YR7A 2XNKA 1SKBA 3F6CA 4NFSA 2R1VB 3OCWA 4H4DA 2QLTA 1LU9A 1X7YB 4AS2A 1EK6A 4BNNA 5JNVA 4EYSA 3UTCA 1XVTA 4P33A 2C4HA 4WZAE 2XTJA 4XFKA 5BV0A 6GPBA 2P4EA 3R5KA 4L72A 1OFIA 3QE0A 4MWTA 2OENG 4X91A 3UFXA 4AM8A 5LYJB 3F2IA 4CKZA 3X2SA 2H6EA 4MV6A 1G42A 1Q14A 4TOIA 4MULA 4FSDA 3I05A 5THXA 5JEEA 3NO4A 5JALA 4WXYB 3K0CC 4EMUA 4LV5B 1U3VA 2IZ7A 3SK0A 1ZBQA 2BOVA 1NLYA 3DG9A 3I8OA 3KT3A 4O0LA 3ZWKA 5KMGA 2ZLBA 5BSRA 3M3DA 5D1HA 3VH3A 3THXA 2B1RA 3PPXA 4D46A 2IPAB 1HDRA 2JH3A 3QELA 4HYEA 3P20A 5CLJA 3ZD7A 3EOBI 1QLHA 4US1R 1EFVA 3DWIA 1TU3A 1LSUA 1E58A 2EP5A 5ECWA 4ZGBA 2PLRA 3OZFA 3ZOKA 5BVHA 2AS0A 3NXKA 3GUHA 1GHTA 4I4TB 3AERA 4OATA 5FPTA 1MAUA 4H7EA 1VI2A 2GA9A 3ZYCA 5AKYA 5DU2A 3P32A 5CHYA 4CEHA 4ND1A 2W2OA 1FVFA 1LRLA 5JQGB 2DBRA 4B4DA 1KZ7B 3RYCB 4HK4A 2WU0A 4ZI7A 4R71A 2QX6A 2WTXA 2V96A 3WNZA 2G4LA 2PANA 1V5GA 4L76A 3AFIA 2NWQA 1H8EA 2W5UA 2B94A 2JASA 4IV0A 4LE1A 5AO9A 3W5HA 4NI5A 5AW1A 4MYDA 3HKEA 4HDKA 1BIFA 1BA3A 3MINB 2QQ5A 4RGYA 2HXSA 2UZ3A 3KEFA 3U3RA 4P3XA 1H3NA 3V97A 1HFKA 3M34A 4DR1B 2FETA 5MDHA 3QX9A 2COKA 4FYMA 5FJIA 4K28A 1QZXA 3GJ7A 3KZKA 2QE7A 2QN2A 5AKZA 3BJIC 3U4AA 1ZCJA 1FSPA 3OQOA 1GZHB 3INGA 3A2KA 4EJ2A 1DQNA 3CZCA 3H5NA 1QLJA 3FCEA 1BN6A 1ADJA 1P9WA 5AJTA 4DLTA 5L6LB 2L0XA 1NUUA 3RSSA 3KOWA 3UKDA 4TROA 2VP3A 3Q5DA 3NHLA 4ZWNA 3HCDA 5C3MA 4QREA 4LI3X 4JBYA 1YQUA 1BS2A 1ZOPA 2Q5FA 2PY6A 3IJEB 2QAGA 1DKPA 2B61A 4DLNA 4DR5B 3FMGA 4CMHA 3AEKB 3IUNA 1Z2DA 2OVBA 5FFFA 5E4JA 5H5JA 2IHBA 1M2GA 5HJ5A 1Y6ZA 2RHLA 2IEGA 2OHXA 1KOJA 4TYNA 1H2ZA 1NSFA 2CZCA 3D0QA 4QG3A 2PXHA 3ZE8A 4TQ9A 2QBYB 2N46A 3GUYA 2I6TA 3MFQA 5CVVA 4D4MA 4EGQA 2VBGA 1ORTA 1BWPA 2B2NA 3HDJA 3IHTA 4JT9A 4D92A 2I6QA 2B0JA 1NIJA 1XNRB 5D7NA 3TD9A 4KE6A 5DGHA 1X1CA 2I7TA 2B4YA 3BWBA 1ZCZA 4N6NA 3AJAA 4QHSA 1VKOA 4LN1A 1SUPA 3NYIA 4ZEVA 1OHHA 1Q0RA 4EENA 3NIBA 2CHQA 1R8JA 1A96A 3PLRA 4D4KA 4YV7A 1GVNB 3HGTA 1GZ4A 1Q1AA 2BDEA 2QVGA 1E2KA 5EGNA 2PMDA 4E7OA 2YASA 4EELA 3CM0A 4AJ9A 3SS9X 4WLOA 1RVDA 2B8NA 1VP3A 3TTWA 1ZK3A 1GSIA 4KZPA 2ERYA 2XRZA 5HILA 3ND8A 4MTCA 1DKNA 1JE0A 5FCDA 3FCSB 3EPRA 4M0EA 3LY7A 3K8OE 2XUAA 4UTXA 3HXLA 5FNVA 1RC0A 1QGDA 3NH9A 2BI4A 3OBBA 3HFSA 1C1DB 5B6PA 4ARVA 3UPTA 1KPGA 4FS3A 1SBYA 1YK0A 2QZ9A 2W6ZA 2P9TA 2WK1A 3ROMA 4DJFC 3Q40A 2WTAA 1XLTC 3U4GA 5KINB 1HEIA 3DBLA 5EXPA 1SK8A 1FDWA 3T06B 3TSZA 4B8ZA 1ZC4A 4S35A 2ADMA 2BKEA 3CVJA 3CCCA 4DQ0A 1L6RA 1WW8A 5ICEA 1J06A 4ZZIA 4FU0A 1TVMA 3MTBA 4RE5A 4CLEA 4EP1A 1ODFA 2AD1A 3LUPA 3MEQA 3K70C 1ENOA 4Q05A 1K7CA 4IS3A 4EECA 5FPQA 3SICE 3UJ3X 4L8WB 1GNVA 1Y8QA 2JJ2D 2H7XA 4F4IA 1NDQA 3WMWA 1Q83A 4LNHA 4RD0A 2IHKA 2ZZKA 2OG2A 4FR0A 2PZJA 2BVNA 2BMFA 3ABIA 3VPSA 1UBMS 1XGKA 4GX0A 3C3PA 3WL5A 3W5DA 4GWLA 3QRWA 4D5EA 3K72B 3I9NA 1O6BA 1Z34A 3B2QA 3O95A 4WKPA 2ZRBA 3ZHBA 2OO7A 2QGFA 5BRNA 2QVXX 3R6GA 3D5EA 2ZWMA 1KZ4A 1RJ9A 2CHFA 3QKUA 1YBAA 1QNLA 3LOUA 1H05A 3JVUA 3T7TA 4QRHA 3AI1A 3L02A 4FN4A 3WB0A 5JC8A 4JMLA 2UYCA 2QSZA 1T35A 4KJZA 2GN6A 1QIGA 1T13A 5T64A 2I67A 1NI3A 4TV9A 4WINA 2B82A 3KWJA 4OJQA 1U0LA 5KYNA 4MWSA 4LF6B 1Y3FE 2ZT8A 1E8DA 4KMSA 5CB8A 4HL6A 1O89A 2HX1A 3SX2A 1FUIA 4R1LA 5FBQB 4BO3A 1QF6A 4D5GA 1ABFA 4ZZ3A 2G9NA 4YRFA 2R79A 4JX9A 2OAGA 2D3TA 4UTOA 3A1NA 1JSXA 3LXRA 1J5PA 4JP5A 1HWYA 1XTVA 2DCUA 3MMXA 1VJTA 4R0MA 1A95A 5CFNA 5IT4A 5B58C 3B9QA 4G07A 4HDNA 4HG2A 1H85A 3UJHA 3QMMA 3VPDA 3NHPA 3IBYA 4W9NA 5EMNA 4DBLE 4YRNA 1IBMB 5CGZA 2NP6A 4M54A 3CIOA 4E31A 2XXBA 4HQ6A 5GGYA 4EG0A 1FNMA 1WXFA 3TKAA 5AW8A 5LDDC 3TIGA 1CULC 2GKOA 1DAEA 1B1CA 3IOEA 3NEPX 1TLLA 1X7DA 1PD0A 3NKLA 2DHDA 4P32A 3V6MA 3MT9A 4ND6A 3RARA 4G1EB 2VJCA 1HKHA 1QH8B 3D59A 1GZ3A 4Y6QA 4JY7A 4OMUA 2IHJA 5EKUA 4K9OA 1II8B 3A1UA 2QN3A 4G5QA 1GCOA 2FFAA 4O6VA 4JU9A 1PT8A 3R7FA 4XPZA 1B00A 4Q4JA 4J4BA 4WY2A 1J2EA 2CVQA 5FV4A 1L5HB 1OTHA 3COPA 1GGEA 3PIIA 3DR5A 2Y1LA 1R6AA 3MWFA 4NDNE 4NH4A 2WM9B 3W6OA 2IITA 2ZJ0A 4HPJB 4HJXA 2H06A 3AIOA 2CFTA 1NUAA 3QW4B 3JQAB 2A9KA 4MS3A 4O2LA 4PWZA 4GM4A 2IXTA 5J5VA 1OGIA 2I1WA 1ECBA 1B3RA 1FQKA 1PR4A 3JQFC 3M6LA 2I1VB 3T5AA 4X65B 2Q9BA 1P4RA 3C3DA 4AL4A 1QE5A 5BSWA 3U4CA 4UM7A 4DT1B 4DZTA 1VE9A 4CIWA 1CJTC 3SBOA 3P71T 4GM0A 4HAUA 1MQSA 4MCIA 3OZAA 2YZ7A 3FA2A 3QXSA 2IV2X 4RGVA 3OPNA 4GUDA 2FEKA 2PS1A 2ZB7A 3AJRA 4LPSA 4DSAA 1X9HA 4FJ1A 2NXNA 3A2MA 3H2JA 1TKRA 3D3QA 4RXMA 3R8XA 3U09A 3TR6A 2W90A 5KOHB 2O3UA 2XE6A 2XODA 4U7HA 4FR5A 2PX4A 2BDTA 5CEFA 5H1YA 1G9XA 3NOXA 4E12A 2WJHA 3JATA 1DBRA 5SYMA 1UR5A 1PTKA 5M3BA 4ANFA 4BFTA 3IQDB 4I8IA 4XZ3A 4F8EA 3GDWA 3EG9B 3RSZA 2PAAA 2HU8A 1IC6A 5HF9A 1AB5A 5T67A 4NXNB 2EYQA 1JDZA 2B2CA 3R5JA 3QLVC 4DUYB 1J6UA 2FWNA 2ZRPA 4GBGA 1B42A 1KIFA 4HLUC 1WCIB 2GTHA 2Z5GA 1A7UA 4Q9NA 2VN8A 3LH5A 4MPTA 2BTOA 3CHYA 4RVGA 4WK4B 4CKEB 2H59A 3GLIB 2FI1A 3KFVA 4MR9A 4D74A 3E23A 2HMAA 4A0HA 1LI5A 3QF4A 4X3CA 1IB6A 1RAHA 1XC7A 2DX7A 4R1UA 2W2QA 4NJMB 2QE6A 3TVYA 2P7HA 2XITA 1CX9B 1RCUA 2Z2YA 4ZOLF 4BBAA 1I6KA 5J4HA 4C2AA 2FZ4A 2J4CA 5CT8A 4X84A 1L5HA 4R1TA 3ZHOA 4BMZA 3C85A 3RGWS 4FOPA 4IO0A 4FSHA 3UIEA 1ZGBA 3REGA 2ETVA 2VDRB 1V1JA 2B0CA 2QA5A 3BIXA 3PJGA 3A7EA 4YRLA 4LYHA 1QORA 1T2EA 2BGJA 4TM7A 4WRRA 3DKVA 4BX8A 4EHNA 4ZI7B 2JLWA 4GPAA 3I34X 4WEOA 2AUTA 5LMNB 1XDBA 2K5UA 3WLSA 1YZLA 5BT9A 3V55A 3H4IA 3HBMA 4QBIA 2QMQA 1X14A 3QVGA 3U40A 1KRHA 2R0QC 1RHMA 4QUDA 1JAXA 1M6HA 1RAIA 4D8VA 3L4BA 3OZGA 3PJFA 2C95A 2PGNA 2D1YA 2OD2A 3FZYA 3K16A 1BCSA 1UANA 3U3OA 4R5HA 5AVZA 5GOTA 4P0QB 5TLSA 1F2VA 4OVKA 2JJ2A 3N2YA 3VUEA 3WBJA 1QYDA 3RHTA 5AVXA 3ZLBA 2RGAA 3UAYA 1VPEA 3AI3A 4QTZA 1JYSA 4R2XA 4E1VA 2G63A 1LJLA 5H70A 4YUXA 4ZVQA 1O95A 3RYCA 4HHEA 1AURA 3DDOA 1WP9A 3ZLJA 1DWOA 1ZVKA 3MRXA 2BTEA 3EAQA 1CZHA 1AKUA 4BGVA 4D3ZA 1I3MA 2VDMB 1Y3HA 2PZEA 1NMSA 4PPYA 2BUAA 2Q5EA 4NU0A 3DYIA 3MNFA 4FDTA 5ALTA 4N47A 1U2ZA 3ASYA 3ULKA 3WFJA 3P5BA 3R6TA 1XLUA 5IBCA 3F5SA 4IOLA 1EXDA 3LQQA 2CC2A 1T1JA 1PLKA 4KFUA 1RD4A 3GDHA 1I2CA 3MRTA 1UJMA 1AN0A 2YV3A 3CPJB 1RRMA 3GC6A 3NWJA 3VH1A 3S1SA 2X2OA 3K9FC 2WB2A 2B20A 1NVKA 4Z9XA 5KYYA 5BMVB 1WXHA 2Z3VA 3P9IA 4NZZA 2R6JA 4Q9IA 4QSHA 2YQ4A 4R68A 4GAEA 4M9XA 3QQPA 3BCSA 3N0VA 4XD2A 1OTYA 4OEHA 3MLEA 1M7GA 5E7JA 5AI4A 3IAS1 3GLIE 1SKAA 2VHXA 3MWGA 2OFFA 4U0JA 4AF8A 1DX6A 3K7EA 5C5DA 4C88A 2QI9F 3FTNA 4H27A 2POQX 2R8YA 4DA8A 1ZA2A 3E4DA 1ISHA 4FYYA 3ZJVA 4RDIA 1X7YA 4JLWA 1T0PA 3MILA 1XCGB 2X0NA 2V0GA 2AEMA 1J39A 2Q2NA 4I19A 2FUEA 1BC5A 2UVQA 4AUEA 1TJ4A 2XI4A 2Z2IA 3DM5A 1A5TA 1PNVA 3W3AD 1V3TA 4OYHA 2A1TR 2FF5A 4W1QA 1ACLA 4I4IA 2M6KA 3T7AA 3KLOA 4FR2A 1DV2A 5JAMA 3M4XA 3QVVA 4QFMA 5DYIA 3IPLA 1Q0ZA 3T99A 1GPNA 2SHKA 4TSFA 1YOVB 4I50F 3SVZA 3MD0A 3OCXA 2B4QA 1FQWA 1LRJA 4TTPA 3VC7A 1LWOA 1TGYA 4S3MA 1LK5A 4G01B 3SHFA 2ZUFA 4GWKA 1E8NA 4YRBA 4LVOA 4CI0B 3Q1KA 4EY5A 3EGXA 5EQJB 2WZDA 4XRRA 3LM8A 2P3LA 4MMXB 2UYHA 3IUQA 4U2EA 5K99A 4AMUA 5TIIA 5LU9A 3CZMA 5IDWA 5T7BA 3H87A 1F8YA 1HETA 4MWGA 4G5YA 4C7BA 4EQZA 4WSOA 3IQHX 3DYBA 4U6NA 1GFSA 1YXMA 1RT9A 2YY5A 4EHHA 2EEZA 1BWSA 1YRAA 4WOJA 5BMVA 1MT3A 1EH5A 1VG9B 3IRVA 3PEVA 3ASUA 1T1GA 1KDVA 2YMPA 1A9YA 4K9MA 3K96A 2Q8NA 2ZAYA 4CV3A 1Z4KA 2NPIA 5K3SA 1NAHA 5JSQA 1K5DA 1F0KA 3KJQA 2MDTA 4V0LA 4DJTA 3M83A 1LTQA 4TYQA 1NRIA 2IYNA 5B2ZA 3A3KA 4OY3A 4MS1B 1S9DA 1L4YA 4X8LA 3ZBUA 1KK0A 2AQ8A 2BEJA 2O8VA 3IXMA 4RKEA 4RPGA 4YAJA 2Z04A 2BTQA 3ACDA 1GUFA 2EWVA 1WVMA 1IN8A 1W0KD 2BSAA 3F6EX 1Y5MA 1P0QA 4EB6B 3JV7A 3GNTA 5LLSA 4CLRA 2EFGA 5THQA 2IHZA 1GUZA 3EY9A 2VJYA 1YMUA 1YA6A 4ZTBA 1JSRA 1QS0B 2WIBA 5IWAB 5COQA 2GXUA 3UXMA 2BFWA 5DX8A 3E5HA 1CUUA 6REQA 1OXKB 3LGXA 2RARA 5HJ2A 4M9QA 3JALB 6YASA 4FGJA 3TLJA 1G98A 3U7QB 3F1LA 3GLSA 2DOKA 3Q2KA 3QUCA 1BNCA 1AXGA 1JVBA 2ODEA 2RBEA 3HADA 3BB1A 4M8SA 1KYQA 4E4YA 1WVIA 2JK1A 4PRKA 1R6VA 1JLMA 4EPRA 2Q41A 3NAQA 2FNAA 2IKQA 2D2EA 3EH1A 3F90A 5DBGA 4KPFC 4ALNA 1KVRA 1WZEA 2HF8A 2MR5A 4DUPA 2XUIA 1YUBA 3G02A 1YT5A 2V54A 3BMCB 3OY2A 3PWTA 5ICCA 1KU6A 3NRCA 4CF5A 1V26A 3RDPA 4GNRA 5F78A 4F5YA 2LIVA 1C7JA 4B2PA 4WJLA 3G2QA 4KDRA 2ORWA 1G8GA 2E1RA 3L7IA 3RKUA 3CCBA 3OX2A 3Q9LA 1Z8FA 3G9UA 1W73A 2WSBA 1SVMA 2JI6A 3VR1A 3L8HA 2O2ZA 2J3JA 3Q12A 5KVVA 2H3HA 3DVAB 1U0HC 3IELA 4DDTA 1E3WA 1F14A 3E2MA 4EYGA 3Q7TA 5MN6A 1XXLA 4Z3OA 1XCJA 1H0HA 3V48A 3KLPX 4LI0A 2BV3A 3UHPA 1FUKA 5JT1A 4NBVA 1Y6RA 5JFTA 4IDOA 5EAIA 3FOWA 5F52A 1SO8A 2ZYGA 5KTTA 1I1QB 1SOWA 2Q2WA 2Q5LA 5DVZA 1D07A 2QD2A 4AJKA 3RH0A 5BQFA 1QRTA 2FEXA 3LGAA 2GZ1A 3EEQA 4DY6A 2ZRJA 1G2PA 1P39A 1W6RA 3M8KA 1YJBA 3EZ6A 3LW8A 3PZBA 3PDUA 4TKUB 2FRDA 1GPMA 1P2VA 1PD1A 4NE7A 3CPHA 1Z15A 1Y4AE 5U4QA 3U31A 2E6UX 3HACA 4W5WA 3IMFA 4PSUA 4ZEMA 1YS6A 1YI0A 4M88A 1PWYE 3IB3A 4ETMA 2O54A 7MDHA 1KEZA 1ES9A 5F1OA 3SFTA 3IR7A 1NUQA 4YASA 2GETA 5AJHA 1GL9B 1OLSA 2AC7A 2O57A 3PXCX 2LIPA 2HJGA 4M76B 3WLAA 4W5RA 5E8RA 1PG2A 4UBIA 3DP7A 4NIMA 3ZDFA 1TE2A 3K0BA 3O26A 3D9QX 2VBCA 1KP9A 2MYPA 2CNWD 3D3KA 3H2ZA 1Y1SA 3TTVA 3K09A 1CF4A 1M2VB 1NP7A 4TKZA 1YRLA 1AQLA 4QASA 3ZEIA 3NVKI 3PL1A 1RKQA 4EABA 4M1OA 1SCKA 1QGYA 4TL7A 1M8KA 2GTPA 1ZI6A 4Y0VA 4E70A 3QLJA 1NUPA 1R5NA 2QR5A 4A10A 1WUHS 1U3UA 4H1VA 3IKJA 4ZU6X 4EF4A 3GFRA 4LZWA 4G85A 3OX3A 2ZJ4A 4YNBA 4EG8A 4EX6A 4F8YA 2IBSA 1FLDA 2SCUA 1VHWA 2PX0A 2V4UA 4ZA2A 3HCEA 3LRPA 1MG0A 2XMBA 4B3SB 2GLTA 1L4KA 4NJMA 5JO9A 4OLAA 3VQTA 4RLFA 3WHPA 2SKEA 2O2CA 4ISCA 2PUGA 4JS0A 1Q91A 4RJLA 4ZQGA 2R6AA 1JEQA 1M1XB 5D3QA 1C30B 3OSUA 3EQ8A 3KQVA 3TRKA 5LPNA 1UBFA 1LKZA 5DXFA 4RK5A 4NMXB 1VXRA 2FZLA 2VNJA 3ND6A 5IF3A 5J1SB 1WV1A 2V7WA 3BDAA 5KNDA 1WXWA 1XFAA 2V5UA 1GU7A 1NX9A 2HPAA 2W6JD 1V5IA 4MJ3A 1KDPA 1YBVA 4RIHA 3D31A 5ALYA 1L5LA 1ZH2A 2Z2ZA 4OPMA 3T1VA 3LPMA 4BNDA 3PPYA 4IMPA 4TMWA 1QQ6A 1RWNA 1U8UA 3ESDA 2ECOA 5FUQA 3AETA 3X2EA 4P38A 4RA6B 2HA2A 2BKUA 2ZSBA 5A5FA 4LF4B 2YN4A 4RPJA 1MJFA 5A7HA 2OAQ1 2JJ1D 4GP7A 5EZYA 4OGGA 1QK3A 1U2QA 3SZLA 5G4KB 5AUNB 4FXOA 2WUGA 3BK7A 4EB0A 4TXLA 2ADOA 3EARA 4E07A 2CWWA 4BV3A 4AN1A 3VOAA 3SN6A 2HO4A 4ETIA 4KNWA 4U1RA 3EIQA 2GBGA 1HZZC 1LFAA 3UMBA 2H4FA 4EL0A 4C5CA 1QFZA 2GEJA 5IKMA 1NDUA 4OD0A 5G0WA 1ORIA 3GFTA 1YUMA 2NU6A 3IUEA 2VDPB 2HL6A 2V6BA 2ZIXB 1YQEA 3DCNA 4BUZA 5BVGA 4CEJA 1XZGA 2B34A 1YU6A 3HA7A 2TMYA 5KOHA 1ZGGA 1WG8A 1VGRA 2NVBA 1X80A 4NU6A 5T8KC 3GAAA 3WA6A 1NNLA 4GRAA 3ZE2B 4O0MA 4WLEA 4BVFA 4JI0B 4Q66C 5L7TA 1R8YA 3RVSA 1GA1A 5CGQB 2FEOA 3KZMA 2NVOA 3NBUA 1G8AA 4R9UC 5FWYB 1S96A 4J91A 3E15A 1ZZGA 3N3AC 3QP9A 5KNDH 4G0NA 4O2BF 4FHDA 4E4RA 5KQLA 5AJVB 2I2CA 5LWQA 4PYKA 1XYVA 2VYVA 3FM9A 1S1CA 5FPSA 2P2CA 2AG0A 4HNTA 4JT2A 1Z13A 1DADA 2J3DA 1K6IA 1PL7A 4Q12A 4P86A 4JJ6A 1WF6A 3W5BA 1EHYA 2A5LA 2WHRA 3K9GA 2ACVA 3TLXA 2PDAA 1W52X 3CY6A 4QDTA 1ZD1A 1JFFA 5JU6A 4AXXA 5ALIA 2ZEJA 4C04A 4EA9A 4NYIR 3ML1A 1XTJA 2MIIA 3PRYA 3W5JA 3PSHA 3ZXSA 3AYZB 5BYAA 5FWNA 4OGWA 3H1PA 3JASB 2PUJA 2HTFA 3FGOA 3LX8A 1GRQA 3ONDA 4CXMA 4RF4A 1BHJA 2XMQA 5FAKA 4KH0A 4LHEA 1CE8A 1XMVA 2QQGA 5A4JA 2GD2A 2HO5A 1J99A 2B4RO 1D5WA 1DDGA 4PZYA 1B6GA 1MAHA 4UXHA 2VEDA 2UUAB 1N6HA 1YDGA 3C7CB 3R7BA 4Z4HA 3VZBA 1G2OA 4EMBA 2H51A 2D5BA 2YXBA 3BD6A 4A8PA 2VRBA 4DLPA 5JS6A 2CYBA 1ZEMA 2ZR0A 5F3WB 3F5QA 1I0ZA 1UP4A 2DPGA 3CXRA 3IQXA 1LTKA 3SJZA 5I7VA 1ARZA 2GILA 4O63O 4EUHA 5FLXA 5BV1A 3H2GA 1GAJA 3K0KA 2PS9A 1QKKA 1V71A 2HUPA 1A8SA 1OXSC 2R47A 2QLBA 2WWFA 1C8BA 4INAA 4FQ7A 1ZC3A 4NZ9A 4CUZA 4RPLA 4EBFA 1H22A 4YIKA 4UPDA 5K4GA 4XWGA 2YIMA 3KJHA 3QPUA 2FR0A 5BNWA 1PJ2A 1E2JA 3FROA 1BHSA 1VP9A 1Z4PX 5D84A 3RE1A 4L16A 1L5SA 2DPMA 2QUZA 4R7GA 4JLBA 4ZPXA 1WABA 4J0EA 2NSDA 4FE3A 2OT3B 1FP2A 5E9QA 3N3BC 3L0ZA 6REQB 3FOAA 4F86A 1ZAYA 4KYUA 1W88B 5HIMA 1MA3A 1ZK4A 3VISA 1MZPA 3C1TA 1VL0A 3P96A 4U5QA 1O94C 3DTTA 3IODA 1QG0A 2PAFA 4J9UE 4IMRA 5TT0A 4N49A 1QHHB 1UM9B 2Y0DA 4KZKA 4ZQIA 3UK7A 4AKSA 3PL5A 3M5WA 4R1NA 5SYNA 3EY4A 2Q5HA 1IN7A 3VHXB 1ZD8A 1XZDA 2C98A 2KW5A 1K1EA 2OZVA 2DLNA 3KOXA 1KGDA 3U4IA 3T52A 3KQHA 3CVUA 4IW3B 3KVVA 4JR2A 1R9NA 4OQFA 3NRBA 3JZFA 1M33A 4WOBA 3WK9A 1TI7A 1WZCA 3L7LA 2OBLA 4Y6PA 1H4SA 4LOLA 1AKWA 3QFFA 1JVSA 2JZNA 3JAWA 2EFCB 4XCQA 4B81A 2QDKA 1KERA 1CJCA 4HS9A 5DBIA 2KB0A 4X00A 5ILGA 4UEJA 3H4TA 3JYNA 4QA9A 5TVKA 4EUSA 4DLYA 4LC0A 4XWKA 5CU7A 3A0RB 1HYQA 2I29A 2EEPA 4MW6A 5K1ZA 2WKWA 3D5QA 1BHQ1 3N0TA 4LY9A 1EE2A 4QOHA 4QYXA 4IJ6A 2C7OA 3CU5A 5B5SA 2PYZA 2YFQA 1ZNQO 3RSCA 1DQPA 3BX1A 1HDOA 3O8QA 3SJUA 3U17A 3GY0A 3R1IA 2VS1A 1JR3D 1ONPA 3GVXA 4EHBA 3KQUA 2ZWVA 2O1EA 1RHQA 2ZAOA 1OFUA 2FJ0A 1AKYA 3LP8A 2IYLD 2ZBUA 5HVNA 4WFIA 1V7QA 2Q5JA 4IZHA 4LJYA 3II6X 2C0CA 2GK3A 3FVWA 1CQPA 4EG3A 2Z9BA 3FFAA 3OMWA 4BMYA 4JBHA 2P5UA 2PUWA 4F60A 3HMQA 1DFGA 1Z83A 3OESA 1QIEA 3HBNA 4DLXA 4C0WA 3HXMA 3FLEA 1DC6A 2QL9A 3H9UA 3TR0A 3FUUA 4ZDWA 4MUMA 4FYPA 2XGGA 3OOHA 2H4YA 2LTAA 3FB1A 4D25A 2JCBA 3CKLA 4A8JA 5DCUA 4OHZA 1U4NA 1VRCA 4B45A 4RPCA 3DDUA 4BKUA 3M7IA 1KMIY 2OZLB 5A1TA 1WPRA 3I9V6 4RQAA 4E5VA 3NHRA 4JLKA 5CB4A 3ONEA 4RJTA 1E7WA 3D2AA 2AZXA 5MGBA 3A4YA 2YWDA 2H0QA 1SHUX 4M7PA 3RC3A 4ZKEA 2GZ2A 2EARA 3CZ5A 3N2KB 2CL7X 4GOOD 4GMDA 3RF6A 3FPEA 3YASA 2C92A 3DEKA 4U7PB 3I1FA 4J07A 3T7JA 5TMDA 1P4HA 3JYQA 3Q8LA 2HPVA 4KMRA 4A6XA 2Z4SA 3MCTA 4S05A 3IPAA 5H3LA 3J80A 3Q85A 3AESA 1JMKC 2V5VA 1SXJB 1ZD2P 2YYSA 5SYAA 4EL5A 4ND4A 5AM0A 1O4VA 1VBKA 1B7GO 1E5DA 1NW5A 1PT6A 2NO1A 3R09A 2HLHA 1PCXA 1XTQA 4RH1A 4WCVA 3ZY4A 3LZDA 2W8BB 1F4PA 3S0JA 4TSKA 3PUIA 3G0HA 2J7KA 1JRLA 3C8DA 3AJ8A 4M36A 1QHXA 4WECA 2ZS9A 2YL2A 3L1VA 3O6VA 3R77A 1R0LA 5IFLA 1XN1A 2C03A 4TZTA 1SU7A 1DNPA 1BJRE 1NI5A 2Q3FA 5BQ3A 3OEEA 5EINA 4OXKA 1X7XA 4EA7A 4OMFG 3BE4A 1YR2A 2ERCA 4NOKA 5E3HA 4P5PA 2NO4A 3UAOA 1K4KA 1ODCA 3WI7A 4DLAA 2Y67A 1C0LA 1UBCA 3FHOA 3QI2A 3RC2A 4Y9TA 1MJNA 2B4TO 2WWGA 3GP3A 1C3LA 3V7WA 2HJRA 3X3HA 3UK2A 4M99A 3G89A 1XYYA 2RJ3A 4NS4A 4OMDA 1P8JA 2QRKA 3LW7A 3OU7A 4PYOA 4TZ6A 2QSYA 3GPLA 2WTUA 1FFBA 2YWXA 3IBSA 1TNDA 2E2WA 2PWBA 1PHRA 2QVZX 4ZHQA 1E2NA 5B1YA 5BW4A 1QP8A 3RUFA 2QYOA 3EFEA 4FMBB 3BHJA 5A2QA 1VTKA 3UV7A 1CRWG 3BE6A 3HCRA 3WDKA 1YR7A 3G5TA 4EF5A 4R5MA 1A88A 4FNMA 4HRAA 5A62A 5ALWA 5B3AA 4Z53A 1DAFA 3A0UA 1ISMA 3C43A 1QNFA 3DE0X 1F06A 4XB1A 5B37A 3W9SA 4GE3A 2PD4A 1IN6A 2YYAA 4XYBA 3VR5H 4L0MA 4D3DA 4AKEA 2BT4A 4R1MA 1QFSA 1LPSA 3PGXA 5NULA 1C30A 2D5IA 1T3ZA 4M0PA 1O08A 4KSCA 2GCOA 3G0GA 1IXKA 2H4JA 3KKNA 4O59O 3VYVA 5BV7A 3B7GA 2AC2A 4WNIA 1H9CA 4X20B 1XZMA 2BM1A 4L08A 3CWCA 4N5NA 2JFNA 2QYSA 1PQ4A 3ELYA 3FFXA 3S1AB 1G17A 3KUXA 3WB1A 1KZ9A 1TTTA 4TYMA 3QK7A 3IKMB 4QXRA 2RI1A 5AW0A 1PR5A 2QKYA 4YX9A 3GA0A 4DLSA 1O94A 1QK5A 3R76A 5LJLA 3AHFA 2P2SA 1ZK0A 4EZEA 1IXZA 3H0EA 1UBOS 1Z5OA 5I8PA 4OHKA 4DKJA 5FP0A 1E1MA 4NJEB 2P1RA 1RCFA 1T9CA 2H1SA 1YBFA 3AQIA 3CEAA 4GZMA 5F77A 5BWBA 4OBWA 1DEAA 3T9BA 2ET6A 1YVRA 3I0ZA 4LC9A 3AILA 2ZJ8A 2LGJA 4PN3A 1R0XA 4YAEA 1WHTA 3DVRX 4MW5A 1BAPA 3R0VA 4QHYA 4RVDA 3S29A 3VKVA 4YQFA 2BH2A 4CFZA 1PQUA 2J5XA 8LDHA 1MGOA 5K0GA 4D79A 1F12A 3L92A 2WHEA 3W5UA 3KT6A 2XWBF 4KUEA 4Y9SA 2Q4DA 1U98A 1RI5A 3KDAA 3GJSA 3SVLA 5IBRA 4WKGA 5BVGB 5JZBA 1G5FA 4MQLA 3ZQKA 1DRVA 2I66A 2OFXA 4MTLA 5C1DA 2BRUC 1QVRA 2Y76A 1K98A 3WGKA 5LVAA 4RHYA 2RC5A 4BX9A 4DA6A 5ARCA 3FHTA 2FJPA 4Q3DA 2JRCA 4D96A 2YUTA 4MVXA 4QKQA 1I0IA 2G28A 4DMKA 3DYVA 1BMFA 1HO3A 3DZJA 4Y18A 4D0SA 2ZIAA 2WSSA 4MA0A 3OJWA 1SWVA 2FSFA 1Z9BA 1GYQA 3H1EA 1UC9A 2NZ2A 3N6XA 3OLCX 1TMOA 4X60A 1F4LA 3E0XA 3KYCA 4KIFA 4K9QA 3UHJA 3GFBA 5JD4A 4RTOA 2VPWA 1WTCA 3VDNB 2C3PA 3HJBA 2HHAA 2CNLA 2PA3A 1LSJA 3FPHA 3NKFA 3RVOA 3NAMA 2R9VA 4WA8A 5AHKA 3O9MA 5JBNA 1LC0A 4QUIA 4R1QA 1PLJA 5IHPA 2CNNA 2ZROA 3HWX1 2BZ1A 4M22A 1WUTA 3O7WA 1PGQA 1ZCBA 1MUUA 1LLQA 5CYGA 1NMZA 2C29D 3EVNA 4DTCA 1KWKA 1OU0A 1Q3KA 1RABA 3GG9A 2WM3A 5SICE 1O5IA 1ZNYA 4YCAA 5HKBA 1GDHA 1X1BA 2NLOA 3VNQA 1SRQA 4MR7A 1IOZA 5J2TF 3HN7A 1PT7A 3E84A 4YXFA 5K0SA 1HF3A 2ZYVX 3HL4A 4GYJA 4JJ7A 3TLGA 1YFJA 3D3JA 2P6MA 4ZMSA 1S3IA 1IZZA 1HUQA 1FDOA 2A9PA 1EEHA 3V8EA 4A16A 4A0QA 1F3LA 3IO3A 1BFDA 3WYCA 1ZOOA 3AV3A 2V3WA 1UZMA 3T5GA 4COKA 4BU1A 1CKEA 5KO2A 1G1MA 2B8EA 3F49S 1RHRA 2WDPA 1IRXA 1XA0A 1E5TA 4KVFA 4X6YA 4CU2A 3PRKE 5BW5A 4RPIA 4CTOA 3WVNA 2O4CA 2RGBA 2XYRA 3ZCQA 1KH2A 1W4RA 1S2DA 2C2OA 1M73E 2J7PD 3KKOA 4L0CA 2Z4RA 2OK8A 2GYYA 2XVMA 3HYLA 1Q7EA 2AYYA 2OWDA 3R0IA 4U5XA 3G2PA 2ATVA 2C4KA 1F2DA 4ETNA 4AS3A 2OQRA 4ITRC 4R3NA 1UKAA 4EMTA 2OV8A 1VJGA 4Q9HA 4B46A 3W78A 4RHXA 2BSXA 1FX0A 3FNEA 4WMLA 4RADA 2FMUA 1YZTA 1MU0A 3U9SA 3TCXB 1XZPA 1WXIA 3CNEA 2H18A 3VKUA 1UKBA 3LUDA 4JVSB 5G02A 3CE6A 1R10A 2H92A 1Y9JA 3CRVA 4PLHA 1EFRD 2JGAA 3PEEA 4XYMA 1VLHA 3O2NA 3ZHXA 3TI7A 3H86A 3VV2A 1C1HA 2QIOA 1P9OA 3A11A 3C5EA 4J03A 4FCVA 3LVQE 4WUTA 1NJSA 2DFLA 3PIDA 4QJBA 2V0NA 2BCEA 1QC5A 4JXXA 2PG3A 2L19A 2J0SA 1NPTO 1QIMA 4MV9A 5KTOA 1E4OA 2WPNA 3AFHA 1XZHA 5LU8A 3R2JA 5C52B 3ZJTA 3EQ2A 1TLFA 4B4UA 2VPTA 4V2IA 3EGXB 2FV8A 5INTA 1KRXA 3U7IA 4F72A 2W6OA 5CK5A 4PLPA 1A2KC 2QP9X 1QZ3A 4P3KA 4BEJA 5I7AA 3N53A