4ANRA

Crystal structure of soluble lytic transglycosylase sltb1 from pseudomonas aeruginosa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
300
structure length
297
Chain Sequence
PQVAEFVSEMTRDYGFAGEQLMGLFRDVNRKQSILDAISRPAERVKQWKEYRPIFISDARISRGVDFWNKHAEDLARAEKEYGVPAEIIVSIIGVETFFGRNTGSYRVMDALSTLGFDYPPRADFFRKELREFLLLAREQQVDPLSLTGSYAGAMGLPQFMPSSFRAYAVDFDGDGHINIWSDPTDAIGSVASYFKQHGWVTGEPVVSVAEINDESAESAVTRGVDPTMSLGELRARGWRTLRDDQKVTAMRFVGDKGIEYWVGLPNFYVITRYNRSAMYAMAVYQLAGEIARARGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE LYTIC TRANSGLYCOSYLASE B
publication title Calcium-Dependent Complex Formation between Pbp2 and Lytic Transglycosylase Sltb1 of Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 101
structure length 297
sequence length 300
ec nomenclature
pdb deposition date 2012-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 4anrA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4anrA02
1ZVHL 5I53A 4DDCA 2D6BA 4ML7A 1W08A 2MEBA 2H9KA 3QY4A 1QIOA 2HEFA 4RW2A 5E4PA 4HTNA 4WLYA 1G7HC 5IHGA 1GFUA 1LZSA 1B5ZA 1RCMA 3EBAB 4HPEA 4PPOA 4YEOA 5FDJA 1GEZA 3P4ZA 2Z2FA 4LYCA 3W6AA 5LVGA 1JKDA 1XGRC 1IC4Y 1LMAA 4KL7A 4LT1A 1B7PA 5B1GA 6LYZA 1GDWA 1ZV5L 3QNGA 1B7OA 5C6JA 4H93A 4XJHA 2H5ZA 1DPXA 1FN5A 4DT3A 1GE4A 4OWBA 3EO5A 4DDAA 3AGIA 3D9AC 1LSBA 4NGKA 5HNCA 3FI7A 5FCPA 3P66A 4YF2A 2FBDA 1HEWA 1IC5Y 1RI8B 1IP6A 1LSYA 5LAFA 1BB7A 3WULA 2HEBA 1LZDA 135LA 1GF6A 4H1PA 4IATA 5A3ZA 5KKIA 5HMVA 1XEIA 5F14A 1GFGA 4J0LA 4RDSA 3ZVQA 1IOCA 3RZ4A 2F2NA 1Z55A 1D0KA 3MGWA 4D9ZA 1GEVA 5DL9A 3TXGA 134LA 3A93A 2BQMA 1E8LA 4ET9A 1IWXA 1NQIA 4DDBA 1IP7A 3LN2A 1LZ1A 3RNXA 1IOTA 2BQLA 1UIEA 4B4EA 4NEBA 1IO5A 4XJBA 5KJ9A 2HEEA 4LT3A 1H87A 4RLMA 2XBSA 3B6LA 5KXRA 1XSFA 4H9IA 4NG1A 4GCBA 1LHLA 4ETBA 4O34A 2Q0MX 4N8ZA 5B06A 5LIOA 4LT2A 4H9AA 3W6BA 5KXMA 1UACY 4KPMA 1XGPC 4DD7A 5I4WA 3N9CA 1LKRA 1VDTA 3OK0A 1UBZA 2LYZA 6LYTA 2YBHA 3WU8A 4N1EI 1VDPA 2C8OA 2MEGA 3TXHA 1UICA 1LMPA 4Z98A 3TMVA 3W6EA 1LHHA 1LSNA 193LA 1UA6Y 5F9XA 5HNLA 4WO9A 5I5QA 2YSSC 1BVKC 1HELA 1LSGA 2HTXA 1QTKA 4GN4A 3KAMA 4NHQA 1QTEA 4Z46A 1LJ3A 4MSTA 2Z38A 4PHIA 1LZEA 1UC0A 1LMNA 4DD3A 1LYSA 4XJDA 1UIHA 3GXKA 4L41A 4KT3A 2EKSC 1LSPA 1XEJA 4TSCA 1VAUA 1QUSA 4HTKA 5B05A 1AT6A 4H8ZA 1OUFA 4WG1A 4CHXA 1CKFA 2ZQ4A 1B7RA 2BQIA 4WM2A 4AXTA 1JTOL 1RE2A 2W1XA 3N9EA 2I6ZA 5KXXA 1I1ZA 5ILCA 1JHLA 3AJNA 3P64A 2LZ2A 1RJCB 1XGTC 2YBIA 3G3AB 4A7DA 3J4GA 4DD2A 1QSAA 1YKXX 4LT0A 4TSBA 4NGJA 4GLAA 5LVHA 4WM1A 1LZAA 3TXFA 3ATNA 1F0WA 4WG7A 4QEQA 4ET8A 5B07A 2I26L 1YANA 2DQGY 1LZGA 1LMCA 2NWDX 1B7SA 2XBRA 4CJ2A 3ULRA 4FJRA 4TWSA 1JUGA 1YAQA 1HEQA 2W1MA 1UIGA 4MR1A 1O23A 3B0KA 4WLXA 4B4JA 2G4QA 1IVMA 1LKSA 5F81A 1BWIA 3T36A 5KXKA 1VFBC 2A7FA 1JISA 3WU9A 1YL0X 4U3XB 4YEMA 1IWVA 2D4JA 1GB3A 4GN5C 1TBYA 4Z3MA 2BQBA 1MLCE 1NHEA 4N5RA 1NBZC 5LAGA 4QY9A 4ETDA 5LYMA 1IEEA 4OOTA 3A94A 4NGYA 3ZVQB 1C45A 4OWCA 1DZBX 1OUAA 2ZILA 2HEAA 3CSZA 1LJ4A 4H9CA 1KIPC 1FBIX 2A7DA 3WW6A 1LZ6A 5LYTA 1I56A 1EQEA 1G7LC 1HEMA 4YOPA 5DLAA 1GB6A 3AGHA 1REYA 3K3TA 4ANRA 3BKVA 1LYOA 1FKVA 1LZ9A 4H9FA 1HEPA 3TXIA 1V7TA 1J1XY 1N4FA 4HP0A 3EMSA 1HC0A 1UIAA 2DQIY 1QUTA 2CDSA 2LYOA 3A3RX 3LYTA 1WTNA 4HTQA 4II8A 5D5CA 4DWXA 5AMYA 1REXA 1IC7Y 3WUNA 1CJ6A 1GF3A 4N9RA 4Z41A 2W1LA 5KXPA 2DKVA 3WUAA 5KKJA 1OUEA 1B7LA 1TDYA 3RU5A 5C6LA 1IY4A 4I0CA 1LSFA 1YIKA 1KIRC 1PS5A 1CJ9A 3A96A 3TXBA 1KXWA 1LSCA 4N0JA 4BS7A 4NSIA 1D9UA 1WQMA 3TXDA 207LA 3A92A 4XENA 4PGJB 5FHWA 1FLUA 2BQFA 5DN4A 2BAAA 5KXZA 1LSEA 1G7JC 2AUBA 1B5XA 1JSEA 1BWJA 5KXNA 1NKHA 1HFXA 2BQNA 1LSAA 1GB2A 2MEEA 4G9SA 3WH1A 1T3PA 4HV2A 4WM3A 2YVBA 3G3BB 1GE2A 5KXSA 1CKHA 1BB3A 3AB6A 4OWEA 4LYOA 2ZQ3A 4H9BA 3ATOA 5M1YA 1PZYA 2N5ZA 1GHLA 1YQVY 1LYYA 1AM7A 1LHJA 1JEFA 1IR7A 4HJVA 2VB1A 4AGAA 1NMMA 4H9EA 1GF4A 2DQEY 4W96A 5LA8A 4LYBA 4ZIXA 2BQHA 1DKKA 1LJFA 2HU3A 1LSZA 2Z19A 4XJGA 3WVXA 4IASA 2YBNA 3TXKA 1REMA 133LA 2BLYA 4QGZA 2HECA 1JTTL 7LYZA 4QDNA 1AZFA 1ZMYL 2X0AA 5KXOA 5F9UA 1IR8A 1BHZA 5JENB 4PRQA 4ZEEA 1GE1A 2MECA 4OWAA 1AT5A 3WW5A 1OUIA 4B1AA 1IR9A 1OUHA 5FEKA 1D6QA 3IJVA 8LYZA 1GB5A 1UCOA 2FYCA 2LYMA 2DQFC 3WU7A 1GF8A 1HMLA 2DQJY 2D4KA 1OQMA 5DN5A 5LYZA 5APFA 3M18B 2BQOA 1D6PA 4R6CA 1C46A 1YAMA 3HFMY 5LXWA 1YL1X 1B7MA 1JIYA 1JKCA 1GBXA 3CSRA 4ZFPA 1UIBA 4H90A 5DM9A 1IP3A 1C43A 2YDGA 5LVIA 1NWGA 1NBYC 3A34A 5I54A 1B9OA 3B0IA 2MEAA 2BQJA 4ETEA 1LZTA 4J7VA 1H6MA 4H8XA 2Z18A 2BQDA 4NSHA 5II3A 4XYYA 1BB5A 4P2EA 1VATA 1IOQA 1UIFA 1FDLY 3AW7A 1GB8A 1GBWA 1D0MA 5APDA 5C6IA 1SLYA 2EQLA 2YBJA 4R0FA 1GBYA 1OUGA 4GCCA 5LVKA 4ETAA 4G49A 4LYTA 1IP4A 3A8ZA 2XJWA 4OWHA 1BVXA 1GPQC 1YILA 1LJEA 1V7SA 1IWTA 1C10A 1HFYA 2PC2A 1RFPA 4LYMA 1YROA 3WPLA 5D5FA 1EL1A 5KY1A 5KXLA 2BQKA 2F4GA 1WTMA 132LA 1GF7A 4XJIA 5KXWA 4TX7A 3A3QA 1YAOA 3A6BY 4XN6A 1LOZA 4NSJA 5HMJA 1KXXA 1REZA 2XTHA 1WQPA 1LZBA 4YENA 2ZNXY 1JJ3A 1GDXA 1GFHA 4ETCA 3GXRA 4LYZA 4EMNA 1GAYA 2BQCA 3SP3A 4NHSA 3HBEX 153LA 4H8YA 2I25L 2MEIA 4BAFA 3F6ZA 3W6CA 1HHLA 1HFZA 1CKCA 3N9AA 5FSTA 4NGVA 1LYZA 1OUBA 1VEDA 5L3IA 4NHPA 1LZCA 4GCFA 1GBOA 2ZNWY 5APEA 2DQHY 4B0DA 2MEDA 2RSCA 3AZ6A 4PJ2C 2DBTA 4PRUA 3WYHA 1YAPA 2F30A 3IJUA 2G4NA 4XJFA 1QQYA 5J7CA 1FLQA 3TXEA 3WPJA 1CKGA 1WQRA 1OUDA 3CB7A 3A67Y 5ILFA 1HF4A 1FKQA 2BQGA 2Z39A 2D4IA 4DC4A 4G4CA 2EIZC 2YBMA 3LYMA 5IDDA 1SQ2L 2BQAA 4NY5A 2DQDY 1B5YA 3CT5A 3P68A 4IJ4A 1IORA 1LHMA 1GBZA 1GXV2 2LZTA 3BKHA 1BGIA 4UWNA 2Z12A 1BWHA 4HJZA 4OW1A 4E3UA 1LJNA 4NFVA 5B59A 4DD9A 4LGKA 2ZIJA 2F4AA 1GWDA 4G4BA 4J1AA 2YBLA 1TEWA 4MCKA 1A2YC 3AZ5A 1IIZA 4X3BA 5L3HA 2BLXA 1DI3A 1WQQA 3LHMA 1LZYA 5IELA 1OUCA 1MELL 1GAZA 1ZVYB 5T3FA 3HBHA 5HLLA 9LYZA 4B4IA 1BB6A 2DQCY 4HJYA 1CNSA 1OP9B 1EQ5A 5E9RA 1INUA 1IP5A 1QDTA 4DYGA 1HEOA 1LJKA 2IFFY 2FBBA 1IP2A 1GFVA 1C7PA 1GBSA 1WVVA 4HSFA 3ZEKA 4NWHA 5L9JA 1GFTA 1B2KA 1LJIA 4WLTA 1IY3A 1AKIA 5LA5A 4NHTA 4NG8A 2BPUA 5LVJA 1WVUA 4NHIA 4CFPA 1JPOA 3LYZA 1LCNA 1NDGC 3J6KA 5I4XA 1LPIA 4WM4A 5FELA 3LZ2A 3WXTA 3W6FA 4WM6A 1GF5A 5I4YA 4EOFA 1VDQA 3B0OA 4GCDA 2C8PA 1LSMA 1LMOA 3WL2A 4WLDA 2HU1A 3CT1A 4OOOA 3WVYA 3AYQA 1LJHA 3WUMA 1IP1A 4DD0A 3B72A 3TXJA 1JKBA 1XFPL 2D91A 3EXDA 3VWOA 3E3DA 1JKAA 1IOSA 2CGIA 1OUJA 1JTPL 4KXIA 4FDYA 1HSWA 1KIQC 3FE0A 1I20A 1LAAA 1HMKA 1DI4A 3OJPA 4I8SA 1B7NA 4NSGA 3P65A 2MEHA 5APCA 3A91A 4B49A 2Z37A 4C3WA 208LA 2FYDA 1XGQC 5K7OA 1BB4A 4NGZA 4WO6A 1CJ8A 1LZ4A 1LZ5A 1CKDA 1GXXA 1LZ8A 1G7IC 4H91A 2MEFA 3RT5X 3IWRA 1IWYA 4TTDA 2B5ZA 4H9HA 4GLVA 3M3UA 4BAPA 4TUNA 1IWWA 3AW6A 2BQEA 194LA 4RW1A 3AZ7A 5A3EA 2H9JA 1YKZX 2WARA 2W1YA 5HQ1A 1GB0A 1UUZC 1EQ4A 4UWVA 4H94A 1NF5A 1LZNA 1D0LA 1GFKA 3W3EA 1DQJC 1B5WA 1JITA 4NGWA 1DXJA 1LSDA 1LHKA 3HBDA 4LZTA 4WM5A 1GB7A 1JWRA 2GV0A 5F16A 3RW8A 4YM8A 4NGOA 4H92A 1JJ0A 5KXYA 1A4VA 1J1PY 1HNLA 154LA 1TAYA 4WL6A 4DD1A 1DI5A 2ZYPA 4BADA 3LYOA 1VDSA 3WMKA 2CWIA 1WQNA 4J1BA 1HENA 1TCYA 4LFXA 1BQLY 3TMWA 3A90A 3TMXA 2ZIKA 1C08C 1B7QA 1DKJA 4GN3A 3D3DA 2IHLA 3AZ4A 1KXYA 2LHMA 4HV1A 4N1CC 5LINA 3CSQA 2HUBA 1GFRA 1QDRA 1GFEA 4WL7A 2ZYCA 4NGIA 4WMGA 5EBHA 4CFOA 4CGEA 1QSWA 4XADA 4WOAA 1CJ7A 1J1OY 3WPKA 1GF9A 1WQOA 3CT0A 1F6RA 1JJ1A 1HERA 1HSXA 3T6UA 1NDMC 4HPIA 4W94A 4NGLA 3TMUA 1FLWA 1UIDA 1LZRA 1P2CC 2EPEA 4G4HA 1LHIA 4M6DA 3LZTA 1F10A 4RLNA 1JSFA 1G7MC 1GD6A 1LMQA 1LJGA 1GFAA 3QE8A 1LMTA 4LFPA 5KXTA 1GF0A 1IWZA 1DPWA 1LTMA 4NIJA 1GB9A 1B5UA 2CJLA 1YKYX 2HEDA 1ALCA 2G4PA 2Z2EA 2ZWBA 4C5FA 1F6SA 2Y8PA 1B0DA 1GE3A 1T6VL 4UWUA 5B1FA 1W6ZA 1GE0A 3A95A 1LJJA 4GCEA 3WXUA 2DQAA 3AGGG 3W6DA 1XEKA 4M4OA 1FLYA 1XGUC 1GFJA 3CQLA 1B5VA 1IWUA 3A6CY 1IX0A 4NWEA
chains in the Genus database with same CATH superfamily
2CUZA 1MU5A 3HWSA 1NHGC 1SXJA 1QT8A 1W08A 2H9KA 3QY4A 1HT2E 212LA 4L4UA 5KQ8A 3A46A 1L98A 3GLFA 4RW2A 4HTNA 4WLYA 1G7HC 4LRTA 1C6MA 1LZSA 3EBAB 1B5ZA 1RCMA 231LA 233LA 2L7HA 3GUOA 1IC4Y 2XEPA 3U5ZA 1ZV5L 5C6JA 1L44A 1FN5A 3B89A 3SB9A 5I14A 1GE4A 2MGWA 232LA 3AGIA 1LSBA 4NGKA 4LGYA 1GLNA 5EXXA 4YF2A 2FBDA 1LZDA 1SXJE 3SB6A 3ZCBB 3GPPA 1XEIA 1L17A 1CVKA 1IOCA 3GLFE 2F2NA 1Z55A 4PDIA 5DL9A 134LA 3A93A 4ET9A 1IP7A 2O25A 4XJBA 1Z6TA 4OU7A 2HEEA 1H87A 1ZYTA 262LA 4RLMA 2XBSA 143LA 242LA 1C6BA 1J7KA 1LHLA 4O34A 5LIOA 1IBLM 3HT7A 3ODUA 4H9AA 4LT2A 7LZMA 5KXMA 5FTLA 4LFBM 1N34M 1LKRA 2EKFA 3SHGB 2YBHA 2C8OA 2MEGA 1G07A 108LA 1UICA 3U60B 1LMPA 1LHHA 193LA 2YSSC 1HELA 1QTKA 4GN4A 3KAMA 3UJNA 1L76A 2ANVA 1UC0A 2FE8A 1ORYB 2BJWA 3GXKA 3TWKA 1QUSA 2KNVA 5B05A 5E6JA 3HTBA 1OUFA 4CHXA 1OIPA 2ZQ4A 4HL4A 3VLFB 4R3DA 1I1ZA 165LA 4ZPXA 1RJCB 4A7DA 1SXJB 1TH3A 220LA 2Q9EA 1L67A 4LT0A 4JYAM 4GLAA 3GLFB 4GRVA 4WM1A 2A5YB 4G3OA 1LZAA 2NQ8C 1L10A 1YANA 2XBRA 5EP3A 4TWSA 3U5ZB 1JUGA 1L13A 1KNIA 2W1MA 3RGSA 1UIGA 4B4JA 186LA 2G4QA 5F81A 1BWIA 3F92A 1L09A 4GBRB 1JISA 1YL0X 4U3XB 4L16A 1DV0A 1IWVA 1GB3A 4GN5C 1NJFA 5JI2E 3C3EA 4N5RA 4QY9A 4ETDA 5LYMA 2OU9A 5EP1A 2HEAA 3CSZA 2O4WA 5LYTA 3FUXA 1I56A 5KPZA 2DZOB 1GB6A 1YSYA 1LGXA 1REYA 1QANA 2AHMA 150LA 3U6PA 3CDTA 2Y21A 1HEPA 1CTWA 4MGHA 1L73A 2LYOA 4DWXA 3C58A 4HTQA 4LFCM 4FWDA 4I7TA 2LVOC 1GJTA 1L0KA 1L08A 4Q7JA 2RB1X 5KKJA 1T3TA 1B7LA 1TDYA 4KT0F 3RU5A 1IY4A 5C6LA 1PS5A 1CJ9A 4BS7A 1L40A 207LA 4XENA 2BQFA 5DN4A 177LA 1BWJA 1D2YA 4LJ4A 4HLQA 3WH1A 1C64A 4HV2A 3DNAA 3G3BB 3VK8A 3VK7A 218LA 3AB6A 4LYOA 2ZQ3A 4H9BA 3ATOA 5M1YA 2N5ZA 3HU3A 3HHWA 4OW0A 1G0MA 4W54A 1NMMA 5LA8A 4ZIXA 2BQHA 2HU3A 2W82A 240LA 3EIEA 4IASA 1L52A 2YBNA 3HTGA 4QGZA 236LA 4QOSA 3JAMS 2G3QA 5F9UA 4LF7M 4PRQA 2ZAMA 1IY1A 4ZEEA 3SBBC 4B7FA 5FEKA 4I7NA 5ITRA 1G1VA 3FYCA 2CV0A 1WHCA 2RAZX 1Z5CA 4KODA 3WU7A 1HMLA 1QTHA 120LA 2DQJY 2OQ4A 245LA 1BVSA 3VFDA 1TLAA 1C46A 2OE4X 4XK8F 3E21A 1CX6A 200LA 1UIBA 4H90A 5DM9A 1IP3A 1C43A 2YDGA 5LVIA 4EPIA 254LA 4AKIA 1B9OA 1GJSA 4H8XA 4XYYA 2D7HA 5APDA 1GB8A 1SLYA 4R0FA 1GBYA 4ETAA 2C96A 4LYTA 2HL7A 5F3WA 3FTDA 3GPXA 1YILA 1HFYA 4IJEA 1L12A 3IECA 1CUQA 1XJUA 2RGOA 4I7KA 5KXLA 3IG5A 1TDHA 4JV5M 4ZPUA 3C9PA 1VEKA 4OX9M 1OWYA 4TX7A 3L2AA 1YAOA 3A3QA 1N75A 4NSJA 3L64A 1KXXA 1REZA 137LA 1WQPA 1LZBA 3EIHA 196LA 1L14A 4I7MA 4EMNA 2KHHA 3B9PA 5FTJA 4DV3M 3F6ZA 3M0EA 110LA 187LA 1P37A 1KW7A 1G71A 185LA 2ZNWY 3AZ6A 4PRUA 4PJ2C 3OE8A 1YUBA 4JN6A 1YAPA 3IJUA 4XJFA 3ZH9B 1OUDA 5ITYA 1HF4A 142LA 2BQGA 5ILFA 5GKNA 4DC4A 4JI4M 2KNZA 1T43A 4GHAA 1IORA 1LHMA 1G8PA 1GBZA 1QTZA 3HH3A 1BGIA 1AUAA 4OW1A 1PQKA 2CUUA 4DD9A 1PQMA 4E97A 1L2CA 1QSBA 2VDBB 3HTFA 4LY6A 1EFUB 4LGMA 1CV4A 1Q39A 3AZ5A 1IIZA 1NHBA 1WQQA 3I4YA 5IELA 2HHHM 4I5SA 2L78A 5T3FA 2CV1A 2KXEA 4IJFA 3PFIA 1VG5A 152LA 2RKOA 1OV5A 1CNSA 1EQ5A 2QENA 2ZBKB 169LA 1IP5A 1L42A 148LE 1L74A 4QHSA 2JP7A 1C7PA 1GBSA 3MJ5A 1B2KA 4AW4A 1IY3A 3U6DA 1KY1A 1N36M 4NG8A 5LVJA 4CFPA 147LA 5ITTA 2LVQD 1L15A 3V2WA 1OVHA 1GF5A 2DVWB 3I51A 4EOFA 1XEPA 4WLDA 3LVWA 5ITQA 3WVYA 1LJHA 1IP1A 2ANXA 3L28A 4RKUF 1JKBA 2B7XA 2RBNA 4W52A 3GUIA 1OUJA 1JTPL 1C6KA 1HMKA 3Q8GA 3P65A 5A2QS 5K7OA 2FYDA 4NL4H 1BB4A 4NGZA 3J81S 1T6HA 1LZ5A 1GXXA 2KNAA 1L58A 2V1CA 4FW9A 4XBOA 2HUMA 1QAQA 3M3UA 1L38A 1IWWA 230LA 252LA 3AZ7A 2BWBA 3GRYA 1YKZX 2WARA 4ARLA 1GO5A 4QNMA 130LA 1NF5A 2NTHA 2VQFM 4IBEA 1L27A 4II7A 1B5WA 4W51A 1DXJA 1OVJA 4S12A 4LF6M 3RW8A 4YM8A 4HEOA 1S3SA 5JI3E 1PGYA 4NGOA 1B6IA 1JJ0A 1J1PY 154LA 4WL6A 2O7AA 3KOYE 1IN4A 3W0LB 3GQ5A 3DFZA 1LGWA 3LYOA 2XGNA 3DN1A 4J1BA 1G41A 4LJ8A 1BQLY 1L33A 1L91A 3TMXA 3NBIA 2OE9X 2HKJA 3GLHA 4P16A 1PQIA 160LA 1CU5A 3D3DA 2IHLA 2YNMD 2LHMA 5LINA 210LA 2UXBM 253LA 1QSWA 3HUQA 3WPKA 3CT0A 1FLWA 1TGUA 2EPEA 1XNQM 3QWLA 2JY6B 1LHIA 3F8VA 4M6DA 3J80S 2CFOA 4JI7M 1G7MC 1LMQA 1L62A 4DR1M 4I7RA 1R7RA 2D7GA 2QARC 1LTMA 3GLHE 4LZZA 2HEDA 5DNYA 5LMNM 1HR0M 3K2RA 5KQDA 2OPFA 1IN5A 4IBKA 2QP9X 2DXIA 2QQ8A 3HKPA 1L1ZA 3A95A 2DENA 4REZA 2DQAA 3W6DA 2CP8A 1YLAA 2L2DA 228LA 1L54A 3A6CY 1IX0A 4NWEA 5LVKA 1ZVHL 5DFLA 2LXEA 5KPTA 4I7PA 156LA 3HT9A 4YEOA 1L31A 4PPOA 1L21A 5KPRA 127LA 1LMAA 5B1GA 3SBAA 1P6YA 3QNGA 4H93A 1PJQA 5EXPA 4FWHA 2H5ZA 2X4AA 1YE9A 1DPXA 1L60A 4DT3A 1L92A 3A42A 3AL0C 4GHLA 4IBBA 5HNCA 4OO9A 5KO3A 1HEWA 1IC5Y 1IP6A 1RI8B 213LA 1LSYA 1BB7A 1ZV1A 2BWEA 4IATA 3HX3A 5KKIA 4J0LA 1OVKA 1PJSA 4AZFA 3MGWA 1D0KA 1MN3A 4RF1A 3TXGA 2EKKA 2QB0B 2R44A 1QTBA 3W0FA 1IWXA 2YFQA 4W55A 4DDBA 3LN2A 1VEJA 1LZ1A 2BQLA 1UIEA 4G4NA 4B4EA 5E26A 1IO5A 4NEBA 103LA 4X62M 155LA 3GLHB 4DV4M 4AKHA 2QCUA 1XSFA 3HDEA 4GCBA 2R6FA 2Q0MX 3QAUA 4I7QA 5B06A 3FTEA 2A4TA 4GRIA 4X65M 3B7ZA 4DD7A 5I4WA 3N9CA 3OK0A 3MHVC 3PXGA 1T6OA 1LLHA 219LA 4MB7A 4JI0M 4Z98A 4L15A 1UA6Y 5I5QA 199LA 4WO9A 2B6XA 1BVKC 3L27A 1QUHA 197LA 4IIWA 1QTEA 4Z46A 2Z38A 2FH0A 4BB9A 1P46A 4OVZA 1L63A 1E32A 1LMNA 1L51A 1LYHA 1PJIA 4KT3A 1LSPA 1XEJA 4G4RA 1VAUA 4KLNA 4TSCA 1XHBA 176LA 3UK6A 2R4JA 4EJ4A 1L49A 2BQIA 4WM2A 3FI5A 1CU6A 1V33A 1JTOL 243LA 3N9EA 2L6OA 2I6ZA 5KXXA 1WGLA 3CF2A 4AG6A 1JHLA 1PQJA 1L84A 3P64A 3G3AB 1VQ1A 1C6EA 4PD2A 3NYAA 4DR3M 1L53A 2QPAA 4TSBA 1QT4A 255LA 1FNNA 4QEQA 4ET8A 5B07A 114LA 2NWDX 1B7SA 1XMOM 3VW7A 4FJRA 1YAQA 173LA 4MR1A 1IVMA 4DV6M 3WU9A 2VIIA 3K2LA 1QZMA 3T15A 2EA0A 2BQBA 1MLCE 4YXAC 2Q2EB 4PCZA 1IEEA 145LA 2MR9A 1K82A 1DZBX 1OUAA 4FCVA 4DV1M 4H9CA 180LA 3C8RA 2A7DA 1L25A 1G1WA 2VF7A 4GMQA 1W5SA 4NSOB 1OYUA 3GLGA 3K3TA 4ANRA 2LC9A 2V6ZM 1LYOA 249LA 3TXIA 1J1XY 4HP0A 3OTOM 2M60A 3LYTA 1QUTA 5ITXA 1XXHA 4LG2A 5D5CA 5AMYA 1WR1B 1IC7Y 3SBJA 1PJTA 3WUNA 1CJ6A 1GF3A 4Z41A 1DYFA 5KXPA 2DKVA 5LZMA 2KDLA 4I0CA 3A96A 4I7LA 1C61A 1LSCA 4N0JA 3UZUA 1I94M 3GLGE 1D9UA 1WQMA 3WHLA 1QUGA 1FLUA 2UU9M 1QSQA 2AUBA 3PNVA 1B5XA 1JSEA 1NKHA 1HFXA 1T3PA 4OVZB 3HDFA 1FJGM 5ITXE 1DGHA 1XXHE 5KXSA 3C7ZA 1DYEA 4ARJA 1CKHA 4OWEA 3D8LA 1EIJA 1N78A 1GHLA 1L56A 3FTFA 2ERCA 1Y8GA 1LYYA 4M0DA 126LA 1PQOA 1JEFA 1JTNA 4AGAA 4H9EA 3UGJA 1LSZA 3TXKA 1L70A 3C8QA 125LA 119LA 184LA 1QTDA 5EP2A 4QDNA 4DQ5A 5KXOA 1IR8A 5JENB 1C6HA 2RRUA 1L29A 2CWBA 1IR9A 4I8OA 3IJVA 3Q8XA 2FYCA 2LYMA 1GF8A 3SFZA 4DR4M 5LYZA 5APFA 2BQOA 4R6CA 5LXWA 3C7WA 1YL1X 1JKCA 4ZFPA 3SAVA 3HU9A 1NWGA 4ARPA 1NV9A 4W5WA 3U6QA 1L83A 1C6NA 4RNAA 1VATA 1L46A 1UIFA 1FDLY 3GLGB 3AW7A 2HULA 2WSFF 1F4IA 3I01M 2XJWA 1V92A 1WTHA 1CV3A 1GPQC 5FHWA 5I4YA 188LA 2PC2A 2DWMA 4LYMA 1YROA 5D5FA 2F5PA 1XXHB 1GF7A 146LA 2O79A 5KXWA 1P2RA 3VDPA 2C98A 4DR7M 4EKQA 1G0JA 2CHGA 2ZNXY 2B74A 2KZSA 4DBGB 3AOGA 2RBPA 4LYZA 1GAYA 3B7QA 3SP3A 2K6BA 2WSCF 1L28A 1L05A 3W6CA 163LA 1CKCA 3RZEA 5FSTA 4NGVA 2KRUA 1L30A 1LYZA 1VEDA 224LA 4NHPA 1DGHB 2B6WA 4DV2M 2RSCA 3GUPA 2XZFA 2DAEA 1FLQA 3A67Y 2D4IA 181LA 4G4CA 1IY0A 1K28A 1KS3A 3A98B 2UXDM 3HUAA 1L32A 4NY5A 2DQDY 2GNOA 3ILKA 1B5YA 2Z6BA 2G8LA 3LQRA 4UWNA 2Z12A 1L02A 4HJZA 3IG8A 4E3UA 1JR3D 4NFVA 259LA 1GWDA 4J1AA 237LA 4LJ5A 1TEWA 3JR4A 1C1KA 1NJGA 2BLXA 1DGFA 1LZYA 1OUCA 1C6QA 1ZVYB 5ITUA 1QTCA 3R9XB 1BB6A 4HJYA 3PVSA 1QYRA 2OEAX 5E9RA 3GULA 4ARQA 4DYGA 4D80A 2IFFY 1HNXM 1ZWNA 2FBBA 3HT6A 3ZEKA 4HSFA 1LJIA 166LA 1AKIA 2BPUA 4NHIA 2QHOB 1L71A 3LYZA 2LCBA 3M6AA 1VEGA 4JI6M 1L66A 4WM6A 2Z4SA 1L48A 1VDQA 4I7SA 4CIZA 1OAIA 4GCDA 1GL7A 3WL2A 2HU1A 3L29A 2Q9DA 3GUMA 4MM3B 3TXJA 201LA 2CEAA 1JQUA 1XFPL 2D91A 111LA 3E3DA 1C62A 1C7YA 4PT5A 4KXIA 1KIQC 1GVNA 1DI4A 1L93A 1XWIA 170LA 4B3MM 1CJ8A 4DUYM 1LZ4A 139LA 1HJPA 4CISA 1C6GA 229LA 1G0GA 1KW5A 1IY2A 4H9HA 4GLVA 4LCBA 3J7AS 1L82A 4TUNA 4EKPA 2APLA 2OTYX 3SN6R 194LA 2XSZA 5A3EA 1C6LA 1CUKA 1EQ4A 4UWVA 1HNZM 1LZNA 1D0LA 3FUVA 5DYGA 1GFKA 195LA 2JZ0A 4F1IA 1JITA 1L61A 2Y0QA 223LA 4NGWA 2G5GX 2OOBA 3HBDA 4AI6A 4LZTA 1JWRA 4Y28F 2ZTDA 2FFJA 1QZEA 4H92A 5KXYA 6LZMA 1TF0B 5BR8M 216LA 2Y20A 2ZYPA 4LF4M 4M9XA 4NXNM 4GITA 2L4EA 1DYBA 1SXJD 3TMWA 5FTMA 3A90A 1IN8A 4GN3A 3W67A 1L23A 1L26A 4B08A 1G0PA 2OE7X 4N1CC 1G0KA 1L11A 1C60A 1ZMVA 4NGIA 4WMGA 2ZTCA 5H37D 4CGEA 2Z3XA 3KDSE 3DN8A 2I7NA 1OAOC 1NNUC 1GF9A 1TDZA 3TMUA 4ARQB 4CHTB 4W94A 4IBGA 1L36A 1P2CC 2OTZX 1MJGM 2CHVA 4G6ZA 4G4HA 3UONA 3LZTA 4RLNA 3DN6A 4LFPA 2DAKA 2N35A 1LJGA 1LMTA 2F4VM 1T97A 1CV6A 2JNHA 1WGNA 4M9SA 4X66M 1ALCA 2G4PA 2VF8A 1X37A 2ZWBA 175LA 4C5FA 4AQYM 1T6VL 5B1FA 2HCBA 2L7IA 1LJJA 4GCEA 1KYIA 1L1TA 3GUNA 1J5EM 3FTCA 1GL6A 3U6EA 3OE6A 3DN4A 1V7SA 3RGPA 3ZC7B 5FLXS 5I53A 2D6BA 256LA 2I7PA 2MEBA 4W53A 2HEFA 4FCTA 1DO0A 3NWLA 5IHGA 102LA 1QT6A 4HPEA 5FDJA 1GEZA 2K0BX 1QT5A 1XGRC 4KL7A 4LT1A 1B7PA 6LYZA 3F9LA 1LYGA 3MMPA 1C66A 2HUKA 3EO5A 4DDAA 3D9AC 2DWLA 4LDOA 3FA0A 4LJ7A 1DGBA 3FI7A 3P66A 206LA 1QUOA 225LA 5LAFA 4H1PA 135LA 1GF6A 4G4OA 5A3ZA 3FKEA 5HMVA 2Z4RA 4R7GA 1K3WA 4RDSA 2RH1A 118LA 1OWZA 1D3JA 2BQMA 1E8LA 4MGZE 226LA 1IOTA 2XZUA 3FRIA 4LT3A 1IBKM 4LZJA 1L39A 3J27B 3B6LA 1L69A 4H9IA 4NG1A 4P17A 3C82A 3HHYA 1CV5A 1HNWM 3W6BA 214LA 1SWYA 3V2YA 3T1HM 2DNAA 1VDTA 3K8ZA 2LYZA 4N1EI 3TXHA 3SAUA 4ARMA 122LA 2DAMA 3W6EA 3TMVA 3VKHA 5HNLA 1C65A 3KP0E 1OV7A 192LA 4MSTA 4PHIA 3CF6E 1LZEA 1P3QQ 3MK6A 1CUPA 1ZMUA 4DD3A 4AQNA 4XJDA 7CATA 2EKSC 1L85A 1VDLA 4WG1A 3LQQA 1B7RA 1D2NA 2W1XA 5ILCA 3CDOA 3AJNA 2LZ2A 1D9WA 3GPUA 3J4GA 2B75A 1L94A 2EUCA 4IBIA 4LF8M 3TXFA 3ATNA 1F0WA 4WG7A 3JR6A 4DUZM 2I26L 2DQGY 190LA 1LZGA 1C6PA 1W5TA 3G3VA 3AKZA 2X8AA 4LFAM 3CDRA 4MGYE 4KO8A 4LJ9A 1L07A 1T8FA 4WLXA 3B0KA 1LKSA 3HH5A 3T36A 1L00A 1VFBC 2A7FA 3QAKA 1MX0A 1HQCA 3FUTA 3K1JA 1G06A 1TBYA 3SMPA 5EP4A 4EIWA 5LAGA 261LA 4OWCA 140LA 1L75A 4WW0A 1FBIX 3M7GA 1LZ6A 1G7LC 2BNKA 2XQOA 2L09A 3AGHA 3GRUA 1T8AA 191LA 1IXRC 1LYJA 5EXSA 1LZ9A 1LYDA 1V7TA 1N4FA 1KSFX 1HC0A 3HY5A 1L64A 2CDSA 4II8A 1DYCA 1N33M 3FD9A 4YHHM 1L19A 1REXA 2LBCA 2W1LA 5C18A 1N32M 3WUAA 2CV2A 1OUEA 5KJ9A 1CU2A 1LSFA 1YIKA 3PDSA 2C99A 4ARMB 1L80A 1LWKA 2CHQA 251LA 4NSIA 4NRWA 4PGJB 3LCVB 113LA 1PQDA 2BAAA 1LSEA 1G7JC 239LA 3DMVA 2F5SA 2BQNA 4G9SA 4I7JA 4WM3A 1E94E 3DMXA 2FS1A 2YVBA 1GE2A 1CU3A 2B6ZA 1BB3A 4LZMA 2P5TA 1L04A 3NBXX 4QNRA 1AIPC 3AOEC 1LHJA 1IR7A 4HJVA 2VB1A 1G0LA 4I4LA 4LYBA 1L65A 1LJFA 4DR2M 1L97A 2Z19A 1L35A 2L4FA 4L8RC 4CGYB 4LDLA 112LA 1EPYA 4D81A 2HECA 7LYZA 2X0AA 3GLIA 2MECA 3DN0A 3WW5A 1OUIA 2HWJA 4B1AA 4NC6A 1NV8A 1D6QA 2Z8YM 8LYZA 2DQFC 1L87A 1OQMA 174LA 4PDGA 1CX7A 2B3TA 1D6PA 3HFMY 1I6SA 1QQWA 1SSWA 4Z8XA 129LA 1B7MA 1JIYA 1QS5A 1GBXA 3KSXA 4GC5A 1NBYC 5I54A 1L43A 2F5OA 2BQJA 1LZTA 1NHWC 3D4SA 4LRSA 1C68A 5II3A 4GIPA 2C9CA 3GLIE 3U61A 1L72A 1LYFA 1BB5A 4GH9A 3SB8A 2UUCM 5C6IA 1D0MA 2EQLA 3D8BA 4AG5A 4QOZC 2GQFA 4OWHA 3SHFA 1LJEA 2DAIA 3PNYA 1L0JA 1RFPA 1EL1A 5EJCA 5KY1A 1DYDA 2XH9A 2BQKA 2F4GA 132LA 3LW5F 2B73A 4YXCA 3TL4X 3A6BY 2F2QA 3DMZA 1C6JA 1L22A 2XTHA 1Q3CA 1ZMWA 1ZAEA 3KOXE 1L45A 1JJ3A 3GO8A 1GDXA 1GFHA 2O5RA 3GXRA 4EKSA 1NSFA 2BQCA 4QHTA 3WHKA 104LA 4NHSA 2FOIC 3RUNA 153LA 141LA 2ZANA 3KOZE 2I25L 1C67A 3DZDA 1D2WA 1NNJA 3N9AA 4IBDA 1C6FA 5L3IA 4BBAA 1LZCA 1DYGA 1GBOA 5APEA 4B49A 2R65A 4YX7C 2F30A 1Q02A 1QQYA 3LVVA 241LA 3C7YA 1LPYA 3FUWA 1QVRA 1WQRA 3CB7A 2OOAA 2Z39A 2VQEM 1FKQA 1VDDA 1P2LA 1L34A 1SSYA 2V1UA 1SQ2L 4EPFA 2BQAA 2LVPC 1QAOA 3P68A 2BJVA 3GP1A 4GEWA 1UM8A 3GLIB 3SB7A 1J09A 3DN2A 4LGKA 2ZIJA 2F4AA 2OU0X 4D82A 158LA 4G4BA 1A2YC 2C5RA 3TQSA 3LZMA 5L3HA 4FWGA 3TPZA 1DI3A 3LHMA 3KW6A 3GUKA 1GAZA 4WP2A 2R62A 4B4IA 2DQCY 1XMQM 109LA 4IBCA 164LA 1INUA 1QDTA 1IP2A 3KP1E 1GFVA 1WVVA 3W68A 3U61B 4NWHA 1GFTA 1OQYA 1TH2A 4NHTA 2DZLA 1L90A 1WVUA 2LVAA 3B74A 1JPOA 3J6KA 1SXJC 2QBYA 5I4XA 4WM4A 3WXTA 4GKJM 3W6FA 3CF0A 1OJLA 3B0OA 3HGIA 1NY6A 4OOOA 217LA 3CT1A 3FADA 3AYQA 3WUMA 4DD0A 3B72A 4MGIE 3EXDA 3VWOA 1IOSA 4FDYA 1HSWA 3OJPA 1LAAA 4I8SA 1B7NA 1JTMA 4NSGA 2Z37A 2R45A 1XGQC 4WO6A 1SG9A 1Q3BA 3QYEA 3RT5X 1ZURA 2R4EA 1LV7A 123LA 1L50A 4BAPA 3T1YM 1WIVA 3AW6A 3H4JA 4RW1A 4NRVA 3C83A 2H9JA 2F32A 2W1YA 1L77A 4H94A 2RBOA 3OE9A 2M5ZA 3W3EA 1L18A 3HWLA 4G4QA 4B7GA 1LSDA 5F16A 4WM5A 4UN2B 2GV0A 3GQ4A 3DKEX 3FRHA 3IHPA 3KOWE 1HNLA 1TAYA 2UUBM 4DD1A 4JI3M 3A45A 3HH6A 1VDSA 1L8QA 2CWIA 1WQNA 2DAGA 1TCYA 1N77A 4S0WA 4LFXA 2ZM6M 3J7BA 3H4MA 1DKJA 1P7SA 4K5YA 1CU0A 2LZMA 1SX2A 4GKKM 2HUBA 1QDRA 1GFEA 1L57A 4WL7A 4CFOA 144LA 159LA 4XADA 1CJ7A 1J1OY 1L01A 1LWGA 1F6RA 4HPIA 2CE7A 1UIDA 250LA 1LZRA 3QYBA 1IM2A 2KW0A 182LA 2DZNB 1F10A 149LA 2EJSA 2KZUA 1GD6A 3E46A 161LA 5KXTA 2WSEF 1IWZA 1DPWA 2QBYB 4NIJA 3SC3A 1YKYX 3SMSA 2Z2EA 1QT7A 1OIZA 1L20A 1OKSA 4UWUA 1GE3A 1LI6A 3WXUA 3LCUA 3AGGG 1XEKA 2B6YA 1FLYA 1XGUC 3FYDA 4LJAA 3RE8A 4DDCA 1T8GA 4ML7A 3B7NA 1QIOA 2OO9A 2F5NA 5E4PA 8CATA 2EO2A 1GFUA 2DHRA 3I4VA 5LVGA 3P4ZA 2Z2FA 4LYCA 1DYAA 3W6AA 4A3VB 1JKDA 2K47A 1GDWA 3C80A 1LW9A 1B7OA 4XJHA 2HAKA 4OWBA 3U6MA 1L86A 5FCPA 3WULA 2HEBA 3L25A 1L99A 247LA 5F14A 1GFGA 1ZQ9A 3ZVQA 4LDEA 3RZ4A 3AJIB 4D9ZA 2R18A 1GEVA 2Z7JA 1NQIA 1IBMM 3RNXA 3SB5A 3BBZA 4FVMA 3KFUG 3PBLA 4M0WA 107LA 5KXRA 1P5CA 2XFSA 3HHZA 1L96A 4ETBA 4N8ZA 4CJ6A 1L2DA 3E9SA 4B3SM 1UACY 4KPMA 1NO1A 1XGPC 1PJJA 1E9SA 2LVNC 171LA 3BXWA 1UBZA 1C69A 3WU8A 6LYTA 234LA 4M9ZA 1VDPA 2LHCA 1RU3A 2RGHA 1LSNA 5F9XA 3HJ8A 4DV7M 1LSGA 2F47A 2HTXA 4NHQA 2QNJA 3TWMA 1Z5AA 2XF3A 1L16A 1LJ3A 4FCWA 1D3FA 4IAPA 1LYSA 1UIHA 1WJ7A 1P64A 4L41A 3K9PA 2RAYX 1XB2B 4HTKA 3U6SA 2UUAM 1AT6A 4H8ZA 1L41A 1CKFA 4AXTA 1RE2A 3U6CA 4IBFA 1R2YA 1XGTC 2YBIA 4DD2A 1QSAA 2RB0X 1YKXX 1L47A 5LVHA 4NGJA 3OE0A 1G3IA 3JR5A 1QAMA 1QS9A 3DN3A 1L37A 1LMCA 2KRKA 5FTNA 3ULRA 4CJ2A 2R46A 4BLCA 1HEQA 5C1BA 1L68A 2JZ1A 1L06A 1O23A 1P3NA 5KXKA 1EE8A 4KHPM 4YEMA 2D4JA 4Z3MA 4YY3M 1QT3A 2FNAA 1NHEA 1NBZC 3BOSA 4OOTA 3ZVQB 3A94A 2JA2A 3SASA 4B3TM 1C45A 4NGYA 2ZILA 1LJ4A 3HH4A 1KIPC 3WW6A 2LNHC 1EQEA 1R4GA 1HEMA 4YOPA 5DLAA 4Z6YA 3BKVA 4WURA 183LA 1FKVA 3G3WA 4H9FA 4X64M 1DGGA 4JI1M 3EMSA 3VKGA 1UIAA 3C8SA 2DQIY 3A3RX 1WTNA 2JY8A 211LA 1R6BX 4N9RA 3SYLA 1IN7A 3SYKA 4NSRA 3KS4A 5IZ7D 157LA 1LYEA 1QTVA 3TXBA 1KIRC 1I4WA 1TR8A 2LWXA 1KXWA 2Y0TA 2D7EA 1L95A 3TXDA 2RB2X 3A92A 1CV0A 5KXZA 4DR6M 260LA 3KS8A 1L88A 5KXNA 2MEEA 1LSAA 1GB2A 1P36A 1LYIA 215LA 1D3NA 3TE6A 222LA 168LA 4GC9A 4B3RM 1PZYA 1L24A 1YQVY 4DQJA 3GUJA 2DKLA 1AM7A 3L26A 1C63A 221LA 1G4AE 3CGWA 1GF4A 2DQEY 4W96A 1DKKA 2WZJA 4XJGA 3WVXA 5EQTA 4DKLA 1K3XA 1REMA 133LA 2BLYA 1JTTL 2X49A 3CTWB 3HJQA 1AZFA 1ZMYL 1BHZA 1HT1E 2XFTA 1GE1A 2F5QA 4OWAA 1AT5A 1OUHA 1PM5A 2DI0A 1DO2A 1HQYE 1GB5A 1UCOA 3KXEC 3R8FA 2D4KA 5DN5A 2JWSA 3SAWA 2MROB 2LTUA 3C3DA 4IBJA 3M18B 4DR5M 1YAMA 1IXSA 3ZQJA 3K9OA 1KFVA 3CSRA 1SX7A 2O01F 3T38A 3A34A 3U6LA 3B0IA 2MEAA 4ETEA 1V34A 4J7VA 1H6MA 4EXMA 3DOAA 2Z18A 2BQDA 3DA1A 4NSHA 1NY5A 4PJZA 4P2EA 1IOQA 1GBWA 2R0IA 1XC8A 2YBJA 1L59A 1OUGA 4GCCA 2H1RA 4DV5M 4G49A 4I81A 3SARA 1IP4A 3A8ZA 1BVXA 1C6DA 3G3XA 1IWTA 1C10A 3WPLA 2KA6B 4MGKE 3L2XA 1WTMA 4W58A 4XJIA 1QUDA 2KEBA 5FTKA 4LF9M 1LGUA 4XN6A 2QSFX 1LOZA 5HMJA 2LHGA 4JI2M 4YENA 2DHYA 4ETCA 4W57A 1L55A 3UMMA 2E5LM 1LI3A 4AKGA 3HBEX 4H8YA 3T6PA 2MEIA 4BAFA 1HHLA 1HFZA 3THGA 3HU8A 3VDUA 1OUBA 4NXMM 4GCFA 1C6CA 3SATA 4B0DA 2DQHY 2MEDA 2DBTA 3WYHA 1L81A 2JXNA 5J7CA 2G4NA 3HUKA 3TXEA 3WPJA 1CKGA 1C6IA 2JY7A 2EIZC 2YBMA 3LYMA 3I04M 4DV0M 4FD2A 5IDDA 5IWAM 4EKRA 4JI8M 1LI2A 3CT5A 4IJ4A 162LA 258LA 238LA 1GXV2 2LZTA 3BKHA 5L8RF 189LA 2H5XA 1BWHA 1C6AA 1JQJC 1LJNA 5B59A 4XGIA 1IQPA 3AOEA 3EMLA 3HU1A 3GPYA 1GKIA 2YBLA 3NY9A 4MCKA 4RF0A 3HTDA 4X3BA 248LA 4DQ7A 1MELL 1IXSB 1G59A 3HZJA 3TWLA 2XSZD 3HBHA 2LH0A 5HLLA 9LYZA 5FSWA 2MJ5B 3CDVA 2MH8A 2B6TA 4L6V6 1OP9B 4MH0E 1HEOA 3HJSA 1LJKA 1TTEA 5L9JA 1R2ZA 4WLTA 3LMMA 5LA5A 2B70A 1LCNA 1NDGC 2YR0A 1LPIA 1A5TA 5EXTA 5FELA 3LZ2A 2J5YA 1PRBA 2C8PA 1LSMA 5BPVA 1LMOA 3RFWA 4PK0A 2YQZA 1CV1A 115LA 2CRUA 4JI5M 1L79A 3V76A 1L89A 1JKAA 3U6OA 2B72A 128LA 2CGIA 167LA 3FE0A 2JY5A 3AFHA 5DYIA 1I20A 3A91A 5APCA 4C3WA 2MEHA 1JR3A 208LA 1OFHA 1CKDA 4H91A 1LZ8A 1R5LA 1G7IC 2MEFA 3IWRA 1IWYA 4TTDA 4ITQA 257LA 4K0KM 2B5ZA 5IREB 4L78A 4F2LA 2BQEA 244LA 227LA 4R71A 3GRVA 2RBQA 5HQ1A 1GB0A 1UUZC 1C6TA 3FUUA 172LA 2UXCM 4LF5M 1DQJC 1P56A 1LHKA 1JR3E 1GB7A 2RBRA 1KY0A 4W56A 1JB0F 1Z5BA 2IGCA 1NVMA 1A4VA 1WXQA 3NY8A 2XLJA 1E9RA 4DAJA 3CDQA 5LMUM 1DI5A 4W59A 2NTGA 4BADA 3WMKA 3KVWA 2OU8A 2JUJA 1HENA 2J7NA 3GQ3A 3KSJA 209LA 1SWZA 205LA 1IFYA 2ZIKA 1C08C 1B7QA 246LA 2C9OA 3FE3A 3K92A 3AZ4A 1KXYA 4HV1A 3CSQA 1GFRA 3HHXA 2ZYCA 5EBHA 2J7OA 1OTRA 3J2PB 1UFZA 2K9DA 4LJ6A 4WOAA 1OFIA 2QZ4A 1IXZA 3AV0A 1WQOA 4I7OA 4NOOB 1JJ1A 1HERA 1HSXA 1L2BA 1NDMC 3C81A 4NGLA 2DWZB 3T6UA 3U60A 4DJHA 3E4RA 131LA 5IT9S 2DWNA 178LA 1GABA 3HT8A 1JSFA 3QE8A 1GFAA 2RBSA 1L03A 1GF0A 2ZAOA 1XNRM 1GB9A 1B5UA 1G0QA 2CJLA 3GRRA 1Z59A 1TH4A 3HU2A 1F6SA 2Y8PA 138LA 1B0DA 198LA 1IN6A 1D3MA 235LA 4B7HA 1W6ZA 1GE0A 1H6UA 4JXJA 4M4OA 4TUWA 151LA 1GFJA 3CQLA 1B5VA 1IWUA 1XJTA
chains in the Genus database with same CATH topology
1W08A 1QT8A 2H9KA 3QY4A 212LA 1L98A 4RW2A 4HTNA 4WLYA 1G7HC 1C6MA 1LZSA 3EBAB 1B5ZA 1RCMA 231LA 233LA 3GUOA 1IC4Y 1ZV5L 5C6JA 1L44A 1FN5A 3SB9A 5I14A 1GE4A 232LA 3AGIA 1LSBA 4NGKA 4YF2A 2FBDA 1LZDA 3SB6A 1XEIA 1L17A 1CVKA 1IOCA 2F2NA 1Z55A 5DL9A 134LA 3A93A 4ET9A 1IP7A 4XJBA 2HEEA 1H87A 1ZYTA 262LA 4RLMA 2XBSA 143LA 242LA 1C6BA 1LHLA 4O34A 5LIOA 3HT7A 4LT2A 3ODUA 4H9AA 7LZMA 5KXMA 1LKRA 2YBHA 2C8OA 2MEGA 1G07A 108LA 1UICA 1LMPA 1LHHA 193LA 2YSSC 1HELA 1QTKA 4GN4A 3KAMA 1L76A 2ANVA 1UC0A 3GXKA 1QUSA 5B05A 3HTBA 1OUFA 4CHXA 2ZQ4A 1I1ZA 165LA 1RJCB 4A7DA 220LA 2Q9EA 1L67A 4LT0A 4GLAA 4GRVA 4WM1A 1LZAA 1L10A 1YANA 2XBRA 4TWSA 1JUGA 1L13A 1KNIA 2W1MA 1UIGA 4B4JA 186LA 2G4QA 5F81A 1BWIA 1L09A 4GBRB 1JISA 1YL0X 4U3XB 1IWVA 4GN5C 1GB3A 4N5RA 4QY9A 4ETDA 5LYMA 2OU9A 2HEAA 3CSZA 2O4WA 5LYTA 1I56A 1GB6A 1LGXA 1REYA 150LA 3CDTA 1HEPA 1CTWA 1L73A 2LYOA 4DWXA 4HTQA 4I7TA 1L0KA 1L08A 2RB1X 5KKJA 1B7LA 1TDYA 3RU5A 5C6LA 1IY4A 1PS5A 1CJ9A 4BS7A 1L40A 207LA 4XENA 2BQFA 5DN4A 177LA 1BWJA 1D2YA 3WH1A 1C64A 4HV2A 3DNAA 3G3BB 218LA 3AB6A 4LYOA 2ZQ3A 4H9BA 3ATOA 5M1YA 2N5ZA 1G0MA 4W54A 1NMMA 5LA8A 4ZIXA 2BQHA 2HU3A 240LA 4IASA 1L52A 2YBNA 3HTGA 4QGZA 236LA 5F9UA 4PRQA 4ZEEA 3SBBC 5FEKA 4I7NA 1G1VA 2RAZX 3WU7A 1HMLA 1QTHA 120LA 2DQJY 245LA 1TLAA 1C46A 2OE4X 1CX6A 200LA 1UIBA 4H90A 5DM9A 1C43A 1IP3A 2YDGA 5LVIA 4EPIA 254LA 1B9OA 4H8XA 4XYYA 5APDA 1GB8A 1SLYA 4R0FA 1GBYA 4ETAA 4LYTA 1YILA 1HFYA 1L12A 1CUQA 1XJUA 4I7KA 5KXLA 4ZPUA 1OWYA 4TX7A 3A3QA 1YAOA 4NSJA 3L64A 1KXXA 1REZA 137LA 1WQPA 1LZBA 196LA 1L14A 4I7MA 4EMNA 3F6ZA 110LA 187LA 1P37A 1KW7A 185LA 2ZNWY 3AZ6A 4PRUA 4PJ2C 3OE8A 1YAPA 3IJUA 4XJFA 1OUDA 5ILFA 1HF4A 142LA 2BQGA 4DC4A 1IORA 1LHMA 1GBZA 1QTZA 3HH3A 1BGIA 4OW1A 1PQKA 2CUUA 4DD9A 1PQMA 4E97A 1QSBA 3HTFA 3AZ5A 1CV4A 1IIZA 1NHBA 1WQQA 5IELA 2L78A 5T3FA 152LA 1OV5A 1CNSA 1EQ5A 169LA 1L42A 1IP5A 148LE 1L74A 1C7PA 1GBSA 1B2KA 1IY3A 1KY1A 4NG8A 5LVJA 4CFPA 147LA 1L15A 3V2WA 1OVHA 1GF5A 4EOFA 1XEPA 4WLDA 3WVYA 1LJHA 1IP1A 2ANXA 2RBNA 1JKBA 2B7XA 4W52A 3GUIA 1OUJA 1JTPL 1C6KA 1HMKA 3P65A 5K7OA 2FYDA 1BB4A 4NGZA 1T6HA 1LZ5A 1GXXA 1L58A 2HUMA 3M3UA 1L38A 1IWWA 230LA 252LA 3AZ7A 1YKZX 2WARA 4ARLA 130LA 1NF5A 2NTHA 1L27A 1B5WA 4W51A 1DXJA 1OVJA 3RW8A 4YM8A 4NGOA 1B6IA 1JJ0A 1J1PY 154LA 4WL6A 2O7AA 1LGWA 3LYOA 3DN1A 4J1BA 1BQLY 1L33A 1L91A 3TMXA 2OE9X 1PQIA 160LA 1CU5A 3D3DA 2IHLA 2LHMA 5LINA 210LA 253LA 1QSWA 3HUQA 3WPKA 3CT0A 1FLWA 2EPEA 1LHIA 4M6DA 3F8VA 1G7MC 1LMQA 1L62A 4I7RA 2QARC 1LTMA 2HEDA 3K2RA 3A95A 2DQAA 3W6DA 228LA 1L54A 3A6CY 1IX0A 4NWEA 5LVKA 1ZVHL 4I7PA 156LA 3HT9A 4YEOA 1L31A 4PPOA 1L21A 1LMAA 127LA 5B1GA 3SBAA 1P6YA 3QNGA 4H93A 2H5ZA 1DPXA 1L60A 4DT3A 1L92A 5HNCA 4OO9A 1HEWA 1IC5Y 1RI8B 1IP6A 213LA 1LSYA 1BB7A 4IATA 5KKIA 4J0LA 1OVKA 3MGWA 1D0KA 3TXGA 2QB0B 1QTBA 1IWXA 4DDBA 4W55A 3LN2A 1LZ1A 2BQLA 1UIEA 4B4EA 4NEBA 1IO5A 103LA 155LA 1XSFA 3HDEA 4GCBA 2Q0MX 4I7QA 5B06A 2A4TA 4DD7A 5I4WA 3N9CA 3OK0A 1LLHA 219LA 4Z98A 1UA6Y 5I5QA 199LA 4WO9A 2B6XA 1BVKC 1QUHA 197LA 1QTEA 4Z46A 2Z38A 1P46A 1L63A 1LMNA 1L51A 1LYHA 4KT3A 1LSPA 1XEJA 4TSCA 1VAUA 176LA 4EJ4A 1L49A 2BQIA 4WM2A 3FI5A 1CU6A 1JTOL 243LA 3N9EA 2I6ZA 5KXXA 1JHLA 1PQJA 1L84A 3P64A 3G3AB 1C6EA 3NYAA 1L53A 4TSBA 1QT4A 255LA 4QEQA 4ET8A 5B07A 114LA 2NWDX 1B7SA 3VW7A 4FJRA 1YAQA 173LA 4MR1A 1IVMA 3WU9A 2BQBA 1MLCE 4YXAC 1IEEA 145LA 1DZBX 1OUAA 4H9CA 180LA 3C8RA 2A7DA 1L25A 1G1WA 1OYUA 3K3TA 4ANRA 2LC9A 1LYOA 249LA 3TXIA 1J1XY 4HP0A 3LYTA 1QUTA 5D5CA 5AMYA 1IC7Y 3WUNA 1CJ6A 1GF3A 4Z41A 1DYFA 5KXPA 2DKVA 5LZMA 4I0CA 3A96A 4I7LA 1C61A 1LSCA 4N0JA 1D9UA 1WQMA 1QUGA 1FLUA 1QSQA 2AUBA 1B5XA 1JSEA 1NKHA 1HFXA 1T3PA 3HDFA 5KXSA 3C7ZA 1DYEA 4ARJA 1CKHA 4OWEA 1GHLA 1L56A 1LYYA 126LA 1PQOA 1JEFA 1JTNA 4AGAA 4H9EA 1LSZA 3TXKA 1L70A 3C8QA 125LA 119LA 184LA 1QTDA 4QDNA 4DQ5A 5KXOA 1IR8A 5JENB 1C6HA 1L29A 1IR9A 3IJVA 2FYCA 2LYMA 1GF8A 5LYZA 5APFA 2BQOA 4R6CA 5LXWA 3C7WA 1YL1X 1JKCA 4ZFPA 3HU9A 1NWGA 4ARPA 1L83A 1C6NA 1VATA 1L46A 1UIFA 1FDLY 3AW7A 2HULA 2XJWA 1WTHA 1CV3A 1GPQC 5FHWA 5I4YA 188LA 2PC2A 4LYMA 1YROA 5D5FA 1GF7A 146LA 2O79A 5KXWA 1P2RA 4EKQA 1G0JA 2ZNXY 2B74A 2RBPA 4LYZA 1GAYA 3SP3A 1L28A 1L05A 3W6CA 163LA 1CKCA 3RZEA 5FSTA 4NGVA 1LYZA 1L30A 1VEDA 224LA 4NHPA 2B6WA 2RSCA 3GUPA 1FLQA 3A67Y 2D4IA 181LA 4G4CA 1K28A 1KS3A 3HUAA 1L32A 4NY5A 2DQDY 1B5YA 2Z6BA 4UWNA 2Z12A 1L02A 4HJZA 4E3UA 4NFVA 259LA 1GWDA 4J1AA 237LA 1TEWA 2BLXA 1LZYA 1OUCA 1C6QA 1ZVYB 1QTCA 1BB6A 4HJYA 2OEAX 5E9RA 3GULA 4ARQA 4DYGA 2IFFY 1ZWNA 2FBBA 3HT6A 3ZEKA 4HSFA 1LJIA 166LA 1AKIA 2BPUA 4NHIA 1L71A 3LYZA 2LCBA 1L66A 4WM6A 1L48A 1VDQA 4I7SA 4GCDA 3WL2A 2HU1A 2Q9DA 3GUMA 3TXJA 201LA 1JQUA 1XFPL 2D91A 3E3DA 111LA 1C62A 4KXIA 1KIQC 1DI4A 1L93A 170LA 1CJ8A 1LZ4A 139LA 1C6GA 229LA 1G0GA 1KW5A 4H9HA 4GLVA 1L82A 4TUNA 4EKPA 2OTYX 3SN6R 194LA 5A3EA 1C6LA 1EQ4A 4UWVA 1LZNA 1D0LA 1GFKA 195LA 1JITA 1L61A 223LA 4NGWA 3HBDA 4LZTA 1JWRA 4H92A 5KXYA 6LZMA 216LA 2ZYPA 1DYBA 3TMWA 3A90A 4GN3A 1L23A 1L26A 2OE7X 1G0PA 4N1CC 1G0KA 1L11A 1C60A 4NGIA 4WMGA 4CGEA 3DN8A 1GF9A 3TMUA 4ARQB 4W94A 1L36A 1P2CC 2OTZX 4G4HA 3UONA 3LZTA 4RLNA 3DN6A 4LFPA 1LJGA 1LMTA 1T97A 1CV6A 1ALCA 2G4PA 2ZWBA 175LA 4C5FA 1T6VL 5B1FA 1LJJA 4GCEA 3GUNA 3OE6A 3DN4A 1V7SA 5I53A 2D6BA 256LA 2MEBA 4W53A 2HEFA 5IHGA 102LA 1QT6A 4HPEA 5FDJA 1GEZA 1QT5A 1XGRC 4KL7A 4LT1A 1B7PA 6LYZA 3F9LA 1LYGA 1C66A 2HUKA 3EO5A 4DDAA 3D9AC 4LDOA 3FA0A 3FI7A 3P66A 206LA 1QUOA 225LA 5LAFA 4H1PA 135LA 1GF6A 5A3ZA 5HMVA 4RDSA 2RH1A 118LA 1OWZA 1D3JA 2BQMA 1E8LA 226LA 1IOTA 4LT3A 1L39A 3B6LA 1L69A 4H9IA 4NG1A 3C82A 1CV5A 3W6BA 214LA 1SWYA 3V2YA 1VDTA 2LYZA 4N1EI 3TXHA 4ARMA 122LA 3W6EA 3TMVA 5HNLA 1C65A 1OV7A 192LA 4MSTA 4PHIA 1LZEA 1CUPA 4DD3A 4AQNA 4XJDA 2EKSC 1L85A 4WG1A 1B7RA 2W1XA 5ILCA 3CDOA 3AJNA 2LZ2A 1D9WA 3J4GA 2B75A 1L94A 3TXFA 3ATNA 1F0WA 4WG7A 3JR6A 2I26L 2DQGY 190LA 1LZGA 1C6PA 3G3VA 3CDRA 1T8FA 1L07A 4WLXA 3B0KA 1LKSA 3HH5A 3T36A 1L00A 1VFBC 2A7FA 3QAKA 1G06A 1TBYA 5LAGA 261LA 4OWCA 140LA 1L75A 1FBIX 1LZ6A 1G7LC 2XQOA 3AGHA 1T8AA 191LA 1LYJA 1LZ9A 1LYDA 1V7TA 1N4FA 1HC0A 1L64A 2CDSA 4II8A 1DYCA 1L19A 1REXA 2W1LA 3WUAA 1OUEA 5KJ9A 1CU2A 1LSFA 1YIKA 3PDSA 4ARMB 1L80A 1LWKA 251LA 4NSIA 4PGJB 1PQDA 113LA 2BAAA 1LSEA 1G7JC 239LA 3DMVA 2BQNA 4G9SA 4I7JA 4WM3A 3DMXA 2YVBA 1GE2A 1CU3A 2B6ZA 1BB3A 4LZMA 1L04A 1LHJA 1IR7A 4HJVA 2VB1A 1G0LA 4LYBA 1L65A 1LJFA 1L97A 2Z19A 1L35A 4LDLA 112LA 1EPYA 2HECA 7LYZA 2X0AA 3DN0A 2MECA 3WW5A 1OUIA 4B1AA 1D6QA 8LYZA 2DQFC 1L87A 1OQMA 174LA 1CX7A 1D6PA 3HFMY 1I6SA 1SSWA 129LA 1B7MA 1JIYA 1QS5A 1GBXA 1NBYC 5I54A 1L43A 2BQJA 1LZTA 3D4SA 1C68A 5II3A 1L72A 1LYFA 1BB5A 3SB8A 5C6IA 1D0MA 2EQLA 4OWHA 1LJEA 1L0JA 1RFPA 1EL1A 5KY1A 1DYDA 2BQKA 2F4GA 132LA 2B73A 4YXCA 3A6BY 2F2QA 3DMZA 1C6JA 1L22A 2XTHA 1L45A 1JJ3A 1GDXA 1GFHA 3GXRA 4EKSA 2BQCA 104LA 4NHSA 3RUNA 153LA 141LA 2I25L 1C67A 1D2WA 3N9AA 1C6FA 5L3IA 1LZCA 1DYGA 1GBOA 5APEA 4B49A 4YX7C 2F30A 1QQYA 241LA 3C7YA 1LPYA 1WQRA 3CB7A 2Z39A 1FKQA 1P2LA 1L34A 1SSYA 1SQ2L 4EPFA 2BQAA 3P68A 3SB7A 3DN2A 4LGKA 2ZIJA 2F4AA 2OU0X 158LA 4G4BA 1A2YC 3LZMA 5L3HA 1DI3A 3LHMA 3GUKA 1GAZA 4B4IA 2DQCY 109LA 164LA 1INUA 1QDTA 1IP2A 1GFVA 1WVVA 4NWHA 1GFTA 4NHTA 1L90A 1WVUA 1JPOA 3J6KA 5I4XA 4WM4A 3WXTA 3W6FA 3B0OA 4OOOA 217LA 3CT1A 3FADA 3AYQA 3WUMA 4DD0A 3B72A 3EXDA 3VWOA 1IOSA 4FDYA 1HSWA 3OJPA 1LAAA 4I8SA 1B7NA 1JTMA 4NSGA 2Z37A 1XGQC 4WO6A 3RT5X 1ZURA 123LA 1L50A 4BAPA 3AW6A 4RW1A 3C83A 2H9JA 2F32A 2W1YA 1L77A 4H94A 2RBOA 3OE9A 3W3EA 1L18A 3HWLA 1LSDA 5F16A 4WM5A 2GV0A 3DKEX 1HNLA 1TAYA 4DD1A 3HH6A 1VDSA 2CWIA 1WQNA 1TCYA 4S0WA 4LFXA 1DKJA 1P7SA 4K5YA 1CU0A 2LZMA 1SX2A 2HUBA 1QDRA 1GFEA 1L57A 4WL7A 4CFOA 144LA 159LA 4XADA 1CJ7A 1J1OY 1L01A 1LWGA 1F6RA 4HPIA 1UIDA 250LA 1LZRA 182LA 1F10A 149LA 1GD6A 161LA 5KXTA 1IWZA 1DPWA 4NIJA 1YKYX 2Z2EA 1QT7A 1L20A 4UWUA 1GE3A 1LI6A 3WXUA 3AGGG 1XEKA 2B6YA 1FLYA 1XGUC 4DDCA 1T8GA 4ML7A 1QIOA 5E4PA 1GFUA 5LVGA 3P4ZA 2Z2FA 4LYCA 1DYAA 3W6AA 1JKDA 1GDWA 3C80A 1LW9A 1B7OA 4XJHA 4OWBA 1L86A 5FCPA 3WULA 2HEBA 1L99A 247LA 5F14A 1GFGA 3ZVQA 4LDEA 3RZ4A 4D9ZA 1GEVA 1NQIA 3RNXA 3SB5A 3PBLA 107LA 5KXRA 1P5CA 1L96A 4ETBA 4N8ZA 1UACY 4KPMA 1XGPC 1UBZA 171LA 6LYTA 1C69A 3WU8A 234LA 1VDPA 1LSNA 5F9XA 1LSGA 2F47A 2HTXA 4NHQA 1L16A 1LJ3A 1D3FA 4IAPA 1LYSA 1UIHA 1P64A 4L41A 2RAYX 4HTKA 1AT6A 4H8ZA 1L41A 1CKFA 4AXTA 1RE2A 1XGTC 2YBIA 4DD2A 1QSAA 2RB0X 1YKXX 1L47A 5LVHA 4NGJA 3OE0A 1QS9A 3DN3A 1L37A 1LMCA 4CJ2A 3ULRA 1HEQA 1L68A 1L06A 1O23A 1P3NA 5KXKA 4YEMA 2D4JA 4Z3MA 1QT3A 1NHEA 1NBZC 4OOTA 3ZVQB 3A94A 4NGYA 1C45A 2ZILA 1LJ4A 3HH4A 1KIPC 3WW6A 1EQEA 1HEMA 4YOPA 5DLAA 3BKVA 183LA 1FKVA 3G3WA 4H9FA 3EMSA 3C8SA 1UIAA 2DQIY 3A3RX 1WTNA 211LA 4N9RA 157LA 1LYEA 1QTVA 3TXBA 1KIRC 1KXWA 1L95A 3TXDA 2RB2X 3A92A 1CV0A 5KXZA 260LA 1L88A 5KXNA 2MEEA 1LSAA 1GB2A 1P36A 1LYIA 215LA 1D3NA 222LA 168LA 1PZYA 1L24A 1YQVY 4DQJA 3GUJA 1AM7A 1C63A 221LA 1GF4A 2DQEY 4W96A 1DKKA 4XJGA 3WVXA 4DKLA 1REMA 133LA 2BLYA 1JTTL 1AZFA 1ZMYL 1BHZA 1GE1A 4OWAA 1AT5A 1OUHA 1GB5A 1UCOA 2D4KA 5DN5A 3M18B 1YAMA 3CSRA 1SX7A 3A34A 3B0IA 2MEAA 4ETEA 4J7VA 1H6MA 4EXMA 2Z18A 2BQDA 4NSHA 4PJZA 4P2EA 1IOQA 1GBWA 2YBJA 1L59A 1OUGA 4GCCA 4G49A 1IP4A 3A8ZA 1BVXA 1C6DA 3G3XA 1IWTA 1C10A 3WPLA 3L2XA 1WTMA 4W58A 4XJIA 1QUDA 1LGUA 4XN6A 1LOZA 5HMJA 4YENA 4ETCA 4W57A 1L55A 1LI3A 3HBEX 4H8YA 2MEIA 4BAFA 1HHLA 1HFZA 3HU8A 1OUBA 4GCFA 1C6CA 4B0DA 2DQHY 2MEDA 2DBTA 3WYHA 1L81A 5J7CA 2G4NA 3HUKA 3TXEA 3WPJA 1CKGA 1C6IA 2EIZC 2YBMA 3LYMA 5IDDA 4EKRA 1LI2A 3CT5A 4IJ4A 162LA 258LA 238LA 1GXV2 2LZTA 3BKHA 189LA 1BWHA 1C6AA 1LJNA 5B59A 3EMLA 2YBLA 3NY9A 4MCKA 3HTDA 4X3BA 248LA 4DQ7A 1MELL 3HBHA 5HLLA 9LYZA 3CDVA 2B6TA 1OP9B 1HEOA 1LJKA 5L9JA 4WLTA 5LA5A 2B70A 1LCNA 1NDGC 1LPIA 5FELA 3LZ2A 2C8PA 1LSMA 1LMOA 4PK0A 1CV1A 115LA 1L79A 1L89A 1JKAA 2B72A 2CGIA 128LA 167LA 3FE0A 3A91A 1I20A 5APCA 4C3WA 2MEHA 208LA 1CKDA 4H91A 1LZ8A 1G7IC 2MEFA 3IWRA 1IWYA 4TTDA 257LA 2B5ZA 2BQEA 244LA 227LA 2RBQA 5HQ1A 1GB0A 1UUZC 1C6TA 172LA 1DQJC 1P56A 1LHKA 2RBRA 1GB7A 1KY0A 4W56A 2IGCA 1A4VA 3NY8A 4DAJA 3CDQA 1DI5A 4W59A 2NTGA 4BADA 3WMKA 2OU8A 1HENA 209LA 1SWZA 205LA 2ZIKA 1C08C 1B7QA 246LA 3AZ4A 1KXYA 4HV1A 3CSQA 1GFRA 2ZYCA 5EBHA 4WOAA 1WQOA 4I7OA 1JJ1A 1HERA 1HSXA 3C81A 1NDMC 3T6UA 4NGLA 4DJHA 131LA 178LA 3HT8A 1JSFA 3QE8A 2RBSA 1GFAA 1L03A 1GF0A 1GB9A 1B5UA 1G0QA 2CJLA 1F6SA 2Y8PA 138LA 1B0DA 198LA 1D3MA 235LA 1W6ZA 1GE0A 4M4OA 151LA 1GFJA 3CQLA 1B5VA 1IWUA 1XJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVH L;  5I53 A;  4DDC A;  2D6B A;  4ML7 A;  1W08 A;  2MEB A;  2H9K A;  3QY4 A;  1QIO A;  2HEF A;  4RW2 A;  5E4P A;  4HTN A;  4WLY A;  1G7H C;  5IHG A;  1GFU A;  1LZS A;  1B5Z A;  1RCM A;  3EBA B;  4HPE A;  4PPO A;  4YEO A;  5FDJ A;  1GEZ A;  3P4Z A;  2Z2F A;  4LYC A;  3W6A A;  5LVG A;  1JKD A;  1XGR C;  1IC4 Y;  1LMA A;  4KL7 A;  4LT1 A;  1B7P A;  5B1G A;  6LYZ A;  1GDW A;  1ZV5 L;  3QNG A;  1B7O A;  5C6J A;  4H93 A;  4XJH A;  2H5Z A;  1DPX A;  1FN5 A;  4DT3 A;  1GE4 A;  4OWB A;  3EO5 A;  4DDA A;  3AGI A;  3D9A C;  1LSB A;  4NGK A;  5HNC A;  3FI7 A;  5FCP A;  3P66 A;  4YF2 A;  2FBD A;  1HEW A;  1IC5 Y;  1RI8 B;  1IP6 A;  1LSY A;  5LAF A;  1BB7 A;  3WUL A;  2HEB A;  1LZD A;  135L A;  1GF6 A;  4H1P A;  4IAT A;  5A3Z A;  5KKI A;  5HMV A;  1XEI A;  5F14 A;  1GFG A;  4J0L A;  4RDS A;  3ZVQ A;  1IOC A;  3RZ4 A;  2F2N A;  1Z55 A;  1D0K A;  3MGW A;  4D9Z A;  1GEV A;  5DL9 A;  3TXG A;  134L A;  3A93 A;  2BQM A;  1E8L A;  4ET9 A;  1IWX A;  1NQI A;  4DDB A;  1IP7 A;  3LN2 A;  1LZ1 A;  3RNX A;  1IOT A;  2BQL A;  1UIE A;  4B4E A;  4NEB A;  1IO5 A;  4XJB A;  5KJ9 A;  2HEE A;  4LT3 A;  1H87 A;  4RLM A;  2XBS A;  3B6L A;  5KXR A;  1XSF A;  4H9I A;  4NG1 A;  4GCB A;  1LHL A;  4ETB A;  4O34 A;  2Q0M X;  4N8Z A;  5B06 A;  5LIO A;  4LT2 A;  4H9A A;  3W6B A;  5KXM A;  1UAC Y;  4KPM A;  1XGP C;  4DD7 A;  5I4W A;  3N9C A;  1LKR A;  1VDT A;  3OK0 A;  1UBZ A;  2LYZ A;  6LYT A;  2YBH A;  3WU8 A;  4N1E I;  1VDP A;  2C8O A;  2MEG A;  3TXH A;  1UIC A;  1LMP A;  4Z98 A;  3TMV A;  3W6E A;  1LHH A;  1LSN A;  193L A;  1UA6 Y;  5F9X A;  5HNL A;  4WO9 A;  5I5Q A;  2YSS C;  1BVK C;  1HEL A;  1LSG A;  2HTX A;  1QTK A;  4GN4 A;  3KAM A;  4NHQ A;  1QTE A;  4Z46 A;  1LJ3 A;  4MST A;  2Z38 A;  4PHI A;  1LZE A;  1UC0 A;  1LMN A;  4DD3 A;  1LYS A;  4XJD A;  1UIH A;  3GXK A;  4L41 A;  4KT3 A;  2EKS C;  1LSP A;  1XEJ A;  4TSC A;  1VAU A;  1QUS A;  4HTK A;  5B05 A;  1AT6 A;  4H8Z A;  1OUF A;  4WG1 A;  4CHX A;  1CKF A;  2ZQ4 A;  1B7R A;  2BQI A;  4WM2 A;  4AXT A;  1JTO L;  1RE2 A;  2W1X A;  3N9E A;  2I6Z A;  5KXX A;  1I1Z A;  5ILC A;  1JHL A;  3AJN A;  3P64 A;  2LZ2 A;  1RJC B;  1XGT C;  2YBI A;  3G3A B;  4A7D A;  3J4G A;  4DD2 A;  1QSA A;  1YKX X;  4LT0 A;  4TSB A;  4NGJ A;  4GLA A;  5LVH A;  4WM1 A;  1LZA A;  3TXF A;  3ATN A;  1F0W A;  4WG7 A;  4QEQ A;  4ET8 A;  5B07 A;  2I26 L;  1YAN A;  2DQG Y;  1LZG A;  1LMC A;  2NWD X;  1B7S A;  2XBR A;  4CJ2 A;  3ULR A;  4FJR A;  4TWS A;  1JUG A;  1YAQ A;  1HEQ A;  2W1M A;  1UIG A;  4MR1 A;  1O23 A;  3B0K A;  4WLX A;  4B4J A;  2G4Q A;  1IVM A;  1LKS A;  5F81 A;  1BWI A;  3T36 A;  5KXK A;  1VFB C;  2A7F A;  1JIS A;  3WU9 A;  1YL0 X;  4U3X B;  4YEM A;  1IWV A;  2D4J A;  1GB3 A;  4GN5 C;  1TBY A;  4Z3M A;  2BQB A;  1MLC E;  1NHE A;  4N5R A;  1NBZ C;  5LAG A;  4QY9 A;  4ETD A;  5LYM A;  1IEE A;  4OOT A;  3A94 A;  4NGY A;  3ZVQ B;  1C45 A;  4OWC A;  1DZB X;  1OUA A;  2ZIL A;  2HEA A;  3CSZ A;  1LJ4 A;  4H9C A;  1KIP C;  1FBI X;  2A7D A;  3WW6 A;  1LZ6 A;  5LYT A;  1I56 A;  1EQE A;  1G7L C;  1HEM A;  4YOP A;  5DLA A;  1GB6 A;  3AGH A;  1REY A;  3K3T A;  4ANR A;  3BKV A;  1LYO A;  1FKV A;  1LZ9 A;  4H9F A;  1HEP A;  3TXI A;  1V7T A;  1J1X Y;  1N4F A;  4HP0 A;  3EMS A;  1HC0 A;  1UIA A;  2DQI Y;  1QUT A;  2CDS A;  2LYO A;  3A3R X;  3LYT A;  1WTN A;  4HTQ A;  4II8 A;  5D5C A;  4DWX A;  5AMY A;  1REX A;  1IC7 Y;  3WUN A;  1CJ6 A;  1GF3 A;  4N9R A;  4Z41 A;  2W1L A;  5KXP A;  2DKV A;  3WUA A;  5KKJ A;  1OUE A;  1B7L A;  1TDY A;  3RU5 A;  5C6L A;  1IY4 A;  4I0C A;  1LSF A;  1YIK A;  1KIR C;  1PS5 A;  1CJ9 A;  3A96 A;  3TXB A;  1KXW A;  1LSC A;  4N0J A;  4BS7 A;  4NSI A;  1D9U A;  1WQM A;  3TXD A;  207L A;  3A92 A;  4XEN A;  4PGJ B;  5FHW A;  1FLU A;  2BQF A;  5DN4 A;  2BAA A;  5KXZ A;  1LSE A;  1G7J C;  2AUB A;  1B5X A;  1JSE A;  1BWJ A;  5KXN A;  1NKH A;  1HFX A;  2BQN A;  1LSA A;  1GB2 A;  2MEE A;  4G9S A;  3WH1 A;  1T3P A;  4HV2 A;  4WM3 A;  2YVB A;  3G3B B;  1GE2 A;  5KXS A;  1CKH A;  1BB3 A;  3AB6 A;  4OWE A;  4LYO A;  2ZQ3 A;  4H9B A;  3ATO A;  5M1Y A;  1PZY A;  2N5Z A;  1GHL A;  1YQV Y;  1LYY A;  1AM7 A;  1LHJ A;  1JEF A;  1IR7 A;  4HJV A;  2VB1 A;  4AGA A;  1NMM A;  4H9E A;  1GF4 A;  2DQE Y;  4W96 A;  5LA8 A;  4LYB A;  4ZIX A;  2BQH A;  1DKK A;  1LJF A;  2HU3 A;  1LSZ A;  2Z19 A;  4XJG A;  3WVX A;  4IAS A;  2YBN A;  3TXK A;  1REM A;  133L A;  2BLY A;  4QGZ A;  2HEC A;  1JTT L;  7LYZ A;  4QDN A;  1AZF A;  1ZMY L;  2X0A A;  5KXO A;  5F9U A;  1IR8 A;  1BHZ A;  5JEN B;  4PRQ A;  4ZEE A;  1GE1 A;  2MEC A;  4OWA A;  1AT5 A;  3WW5 A;  1OUI A;  4B1A A;  1IR9 A;  1OUH A;  5FEK A;  1D6Q A;  3IJV A;  8LYZ A;  1GB5 A;  1UCO A;  2FYC A;  2LYM A;  2DQF C;  3WU7 A;  1GF8 A;  1HML A;  2DQJ Y;  2D4K A;  1OQM A;  5DN5 A;  5LYZ A;  5APF A;  3M18 B;  2BQO A;  1D6P A;  4R6C A;  1C46 A;  1YAM A;  3HFM Y;  5LXW A;  1YL1 X;  1B7M A;  1JIY A;  1JKC A;  1GBX A;  3CSR A;  4ZFP A;  1UIB A;  4H90 A;  5DM9 A;  1IP3 A;  1C43 A;  2YDG A;  5LVI A;  1NWG A;  1NBY C;  3A34 A;  5I54 A;  1B9O A;  3B0I A;  2MEA A;  2BQJ A;  4ETE A;  1LZT A;  4J7V A;  1H6M A;  4H8X A;  2Z18 A;  2BQD A;  4NSH A;  5II3 A;  4XYY A;  1BB5 A;  4P2E A;  1VAT A;  1IOQ A;  1UIF A;  1FDL Y;  3AW7 A;  1GB8 A;  1GBW A;  1D0M A;  5APD A;  5C6I A;  1SLY A;  2EQL A;  2YBJ A;  4R0F A;  1GBY A;  1OUG A;  4GCC A;  5LVK A;  4ETA A;  4G49 A;  4LYT A;  1IP4 A;  3A8Z A;  2XJW A;  4OWH A;  1BVX A;  1GPQ C;  1YIL A;  1LJE A;  1V7S A;  1IWT A;  1C10 A;  1HFY A;  2PC2 A;  1RFP A;  4LYM A;  1YRO A;  3WPL A;  5D5F A;  1EL1 A;  5KY1 A;  5KXL A;  2BQK A;  2F4G A;  1WTM A;  132L A;  1GF7 A;  4XJI A;  5KXW A;  4TX7 A;  3A3Q A;  1YAO A;  3A6B Y;  4XN6 A;  1LOZ A;  4NSJ A;  5HMJ A;  1KXX A;  1REZ A;  2XTH A;  1WQP A;  1LZB A;  4YEN A;  2ZNX Y;  1JJ3 A;  1GDX A;  1GFH A;  4ETC A;  3GXR A;  4LYZ A;  4EMN A;  1GAY A;  2BQC A;  3SP3 A;  4NHS A;  3HBE X;  153L A;  4H8Y A;  2I25 L;  2MEI A;  4BAF A;  3F6Z A;  3W6C A;  1HHL A;  1HFZ A;  1CKC A;  3N9A A;  5FST A;  4NGV A;  1LYZ A;  1OUB A;  1VED A;  5L3I A;  4NHP A;  1LZC A;  4GCF A;  1GBO A;  2ZNW Y;  5APE A;  2DQH Y;  4B0D A;  2MED A;  2RSC A;  3AZ6 A;  4PJ2 C;  2DBT A;  4PRU A;  3WYH A;  1YAP A;  2F30 A;  3IJU A;  2G4N A;  4XJF A;  1QQY A;  5J7C A;  1FLQ A;  3TXE A;  3WPJ A;  1CKG A;  1WQR A;  1OUD A;  3CB7 A;  3A67 Y;  5ILF A;  1HF4 A;  1FKQ A;  2BQG A;  2Z39 A;  2D4I A;  4DC4 A;  4G4C A;  2EIZ C;  2YBM A;  3LYM A;  5IDD A;  1SQ2 L;  2BQA A;  4NY5 A;  2DQD Y;  1B5Y A;  3CT5 A;  3P68 A;  4IJ4 A;  1IOR A;  1LHM A;  1GBZ A;  1GXV 2;  2LZT A;  3BKH A;  1BGI A;  4UWN A;  2Z12 A;  1BWH A;  4HJZ A;  4OW1 A;  4E3U A;  1LJN A;  4NFV A;  5B59 A;  4DD9 A;  4LGK A;  2ZIJ A;  2F4A A;  1GWD A;  4G4B A;  4J1A A;  2YBL A;  1TEW A;  4MCK A;  1A2Y C;  3AZ5 A;  1IIZ A;  4X3B A;  5L3H A;  2BLX A;  1DI3 A;  1WQQ A;  3LHM A;  1LZY A;  5IEL A;  1OUC A;  1MEL L;  1GAZ A;  1ZVY B;  5T3F A;  3HBH A;  5HLL A;  9LYZ A;  4B4I A;  1BB6 A;  2DQC Y;  4HJY A;  1CNS A;  1OP9 B;  1EQ5 A;  5E9R A;  1INU A;  1IP5 A;  1QDT A;  4DYG A;  1HEO A;  1LJK A;  2IFF Y;  2FBB A;  1IP2 A;  1GFV A;  1C7P A;  1GBS A;  1WVV A;  4HSF A;  3ZEK A;  4NWH A;  5L9J A;  1GFT A;  1B2K A;  1LJI A;  4WLT A;  1IY3 A;  1AKI A;  5LA5 A;  4NHT A;  4NG8 A;  2BPU A;  5LVJ A;  1WVU A;  4NHI A;  4CFP A;  1JPO A;  3LYZ A;  1LCN A;  1NDG C;  3J6K A;  5I4X A;  1LPI A;  4WM4 A;  5FEL A;  3LZ2 A;  3WXT A;  3W6F A;  4WM6 A;  1GF5 A;  5I4Y A;  4EOF A;  1VDQ A;  3B0O A;  4GCD A;  2C8P A;  1LSM A;  1LMO A;  3WL2 A;  4WLD A;  2HU1 A;  3CT1 A;  4OOO A;  3WVY A;  3AYQ A;  1LJH A;  3WUM A;  1IP1 A;  4DD0 A;  3B72 A;  3TXJ A;  1JKB A;  1XFP L;  2D91 A;  3EXD A;  3VWO A;  3E3D A;  1JKA A;  1IOS A;  2CGI A;  1OUJ A;  1JTP L;  4KXI A;  4FDY A;  1HSW A;  1KIQ C;  3FE0 A;  1I20 A;  1LAA A;  1HMK A;  1DI4 A;  3OJP A;  4I8S A;  1B7N A;  4NSG A;  3P65 A;  2MEH A;  5APC A;  3A91 A;  4B49 A;  2Z37 A;  4C3W A;  208L A;  2FYD A;  1XGQ C;  5K7O A;  1BB4 A;  4NGZ A;  4WO6 A;  1CJ8 A;  1LZ4 A;  1LZ5 A;  1CKD A;  1GXX A;  1LZ8 A;  1G7I C;  4H91 A;  2MEF A;  3RT5 X;  3IWR A;  1IWY A;  4TTD A;  2B5Z A;  4H9H A;  4GLV A;  3M3U A;  4BAP A;  4TUN A;  1IWW A;  3AW6 A;  2BQE A;  194L A;  4RW1 A;  3AZ7 A;  5A3E A;  2H9J A;  1YKZ X;  2WAR A;  2W1Y A;  5HQ1 A;  1GB0 A;  1UUZ C;  1EQ4 A;  4UWV A;  4H94 A;  1NF5 A;  1LZN A;  1D0L A;  1GFK A;  3W3E A;  1DQJ C;  1B5W A;  1JIT A;  4NGW A;  1DXJ A;  1LSD A;  1LHK A;  3HBD A;  4LZT A;  4WM5 A;  1GB7 A;  1JWR A;  2GV0 A;  5F16 A;  3RW8 A;  4YM8 A;  4NGO A;  4H92 A;  1JJ0 A;  5KXY A;  1A4V A;  1J1P Y;  1HNL A;  154L A;  1TAY A;  4WL6 A;  4DD1 A;  1DI5 A;  2ZYP A;  4BAD A;  3LYO A;  1VDS A;  3WMK A;  2CWI A;  1WQN A;  4J1B A;  1HEN A;  1TCY A;  4LFX A;  1BQL Y;  3TMW A;  3A90 A;  3TMX A;  2ZIK A;  1C08 C;  1B7Q A;  1DKJ A;  4GN3 A;  3D3D A;  2IHL A;  3AZ4 A;  1KXY A;  2LHM A;  4HV1 A;  4N1C C;  5LIN A;  3CSQ A;  2HUB A;  1GFR A;  1QDR A;  1GFE A;  4WL7 A;  2ZYC A;  4NGI A;  4WMG A;  5EBH A;  4CFO A;  4CGE A;  1QSW A;  4XAD A;  4WOA A;  1CJ7 A;  1J1O Y;  3WPK A;  1GF9 A;  1WQO A;  3CT0 A;  1F6R A;  1JJ1 A;  1HER A;  1HSX A;  3T6U A;  1NDM C;  4HPI A;  4W94 A;  4NGL A;  3TMU A;  1FLW A;  1UID A;  1LZR A;  1P2C C;  2EPE A;  4G4H A;  1LHI A;  4M6D A;  3LZT A;  1F10 A;  4RLN A;  1JSF A;  1G7M C;  1GD6 A;  1LMQ A;  1LJG A;  1GFA A;  3QE8 A;  1LMT A;  4LFP A;  5KXT A;  1GF0 A;  1IWZ A;  1DPW A;  1LTM A;  4NIJ A;  1GB9 A;  1B5U A;  2CJL A;  1YKY X;  2HED A;  1ALC A;  2G4P A;  2Z2E A;  2ZWB A;  4C5F A;  1F6S A;  2Y8P A;  1B0D A;  1GE3 A;  1T6V L;  4UWU A;  5B1F A;  1W6Z A;  1GE0 A;  3A95 A;  1LJJ A;  4GCE A;  3WXU A;  2DQA A;  3AGG G;  3W6D A;  1XEK A;  4M4O A;  1FLY A;  1XGU C;  1GFJ A;  3CQL A;  1B5V A;  1IWU A;  3A6C Y;  1IX0 A;  4NWE A; 
#chains in the Genus database with same CATH topology
 2CUZ A;  1MU5 A;  3HWS A;  1NHG C;  1SXJ A;  1QT8 A;  1W08 A;  2H9K A;  3QY4 A;  1HT2 E;  212L A;  4L4U A;  5KQ8 A;  3A46 A;  1L98 A;  3GLF A;  4RW2 A;  4HTN A;  4WLY A;  1G7H C;  4LRT A;  1C6M A;  1LZS A;  3EBA B;  1B5Z A;  1RCM A;  231L A;  233L A;  2L7H A;  3GUO A;  1IC4 Y;  2XEP A;  3U5Z A;  1ZV5 L;  5C6J A;  1L44 A;  1FN5 A;  3B89 A;  3SB9 A;  5I14 A;  1GE4 A;  2MGW A;  232L A;  3AGI A;  1LSB A;  4NGK A;  4LGY A;  1GLN A;  5EXX A;  4YF2 A;  2FBD A;  1LZD A;  1SXJ E;  3SB6 A;  3ZCB B;  3GPP A;  1XEI A;  1L17 A;  1CVK A;  1IOC A;  3GLF E;  2F2N A;  1Z55 A;  4PDI A;  5DL9 A;  134L A;  3A93 A;  4ET9 A;  1IP7 A;  2O25 A;  4XJB A;  1Z6T A;  4OU7 A;  2HEE A;  1H87 A;  1ZYT A;  262L A;  4RLM A;  2XBS A;  143L A;  242L A;  1C6B A;  1J7K A;  1LHL A;  4O34 A;  5LIO A;  1IBL M;  3HT7 A;  3ODU A;  4H9A A;  4LT2 A;  7LZM A;  5KXM A;  5FTL A;  4LFB M;  1N34 M;  1LKR A;  2EKF A;  3SHG B;  2YBH A;  2C8O A;  2MEG A;  1G07 A;  108L A;  1UIC A;  3U60 B;  1LMP A;  1LHH A;  193L A;  2YSS C;  1HEL A;  1QTK A;  4GN4 A;  3KAM A;  3UJN A;  1L76 A;  2ANV A;  1UC0 A;  2FE8 A;  1ORY B;  2BJW A;  3GXK A;  3TWK A;  1QUS A;  2KNV A;  5B05 A;  5E6J A;  3HTB A;  1OUF A;  4CHX A;  1OIP A;  2ZQ4 A;  4HL4 A;  3VLF B;  4R3D A;  1I1Z A;  165L A;  4ZPX A;  1RJC B;  4A7D A;  1SXJ B;  1TH3 A;  220L A;  2Q9E A;  1L67 A;  4LT0 A;  4JYA M;  4GLA A;  3GLF B;  4GRV A;  4WM1 A;  2A5Y B;  4G3O A;  1LZA A;  2NQ8 C;  1L10 A;  1YAN A;  2XBR A;  5EP3 A;  4TWS A;  3U5Z B;  1JUG A;  1L13 A;  1KNI A;  2W1M A;  3RGS A;  1UIG A;  4B4J A;  186L A;  2G4Q A;  5F81 A;  1BWI A;  3F92 A;  1L09 A;  4GBR B;  1JIS A;  1YL0 X;  4U3X B;  4L16 A;  1DV0 A;  1IWV A;  1GB3 A;  4GN5 C;  1NJF A;  5JI2 E;  3C3E A;  4N5R A;  4QY9 A;  4ETD A;  5LYM A;  2OU9 A;  5EP1 A;  2HEA A;  3CSZ A;  2O4W A;  5LYT A;  3FUX A;  1I56 A;  5KPZ A;  2DZO B;  1GB6 A;  1YSY A;  1LGX A;  1REY A;  1QAN A;  2AHM A;  150L A;  3U6P A;  3CDT A;  2Y21 A;  1HEP A;  1CTW A;  4MGH A;  1L73 A;  2LYO A;  4DWX A;  3C58 A;  4HTQ A;  4LFC M;  4FWD A;  4I7T A;  2LVO C;  1GJT A;  1L0K A;  1L08 A;  4Q7J A;  2RB1 X;  5KKJ A;  1T3T A;  1B7L A;  1TDY A;  4KT0 F;  3RU5 A;  1IY4 A;  5C6L A;  1PS5 A;  1CJ9 A;  4BS7 A;  1L40 A;  207L A;  4XEN A;  2BQF A;  5DN4 A;  177L A;  1BWJ A;  1D2Y A;  4LJ4 A;  4HLQ A;  3WH1 A;  1C64 A;  4HV2 A;  3DNA A;  3G3B B;  3VK8 A;  3VK7 A;  218L A;  3AB6 A;  4LYO A;  2ZQ3 A;  4H9B A;  3ATO A;  5M1Y A;  2N5Z A;  3HU3 A;  3HHW A;  4OW0 A;  1G0M A;  4W54 A;  1NMM A;  5LA8 A;  4ZIX A;  2BQH A;  2HU3 A;  2W82 A;  240L A;  3EIE A;  4IAS A;  1L52 A;  2YBN A;  3HTG A;  4QGZ A;  236L A;  4QOS A;  3JAM S;  2G3Q A;  5F9U A;  4LF7 M;  4PRQ A;  2ZAM A;  1IY1 A;  4ZEE A;  3SBB C;  4B7F A;  5FEK A;  4I7N A;  5ITR A;  1G1V A;  3FYC A;  2CV0 A;  1WHC A;  2RAZ X;  1Z5C A;  4KOD A;  3WU7 A;  1HML A;  1QTH A;  120L A;  2DQJ Y;  2OQ4 A;  245L A;  1BVS A;  3VFD A;  1TLA A;  1C46 A;  2OE4 X;  4XK8 F;  3E21 A;  1CX6 A;  200L A;  1UIB A;  4H90 A;  5DM9 A;  1IP3 A;  1C43 A;  2YDG A;  5LVI A;  4EPI A;  254L A;  4AKI A;  1B9O A;  1GJS A;  4H8X A;  4XYY A;  2D7H A;  5APD A;  1GB8 A;  1SLY A;  4R0F A;  1GBY A;  4ETA A;  2C96 A;  4LYT A;  2HL7 A;  5F3W A;  3FTD A;  3GPX A;  1YIL A;  1HFY A;  4IJE A;  1L12 A;  3IEC A;  1CUQ A;  1XJU A;  2RGO A;  4I7K A;  5KXL A;  3IG5 A;  1TDH A;  4JV5 M;  4ZPU A;  3C9P A;  1VEK A;  4OX9 M;  1OWY A;  4TX7 A;  3L2A A;  1YAO A;  3A3Q A;  1N75 A;  4NSJ A;  3L64 A;  1KXX A;  1REZ A;  137L A;  1WQP A;  1LZB A;  3EIH A;  196L A;  1L14 A;  4I7M A;  4EMN A;  2KHH A;  3B9P A;  5FTJ A;  4DV3 M;  3F6Z A;  3M0E A;  110L A;  187L A;  1P37 A;  1KW7 A;  1G71 A;  185L A;  2ZNW Y;  3AZ6 A;  4PRU A;  4PJ2 C;  3OE8 A;  1YUB A;  4JN6 A;  1YAP A;  3IJU A;  4XJF A;  3ZH9 B;  1OUD A;  5ITY A;  1HF4 A;  142L A;  2BQG A;  5ILF A;  5GKN A;  4DC4 A;  4JI4 M;  2KNZ A;  1T43 A;  4GHA A;  1IOR A;  1LHM A;  1G8P A;  1GBZ A;  1QTZ A;  3HH3 A;  1BGI A;  1AUA A;  4OW1 A;  1PQK A;  2CUU A;  4DD9 A;  1PQM A;  4E97 A;  1L2C A;  1QSB A;  2VDB B;  3HTF A;  4LY6 A;  1EFU B;  4LGM A;  1CV4 A;  1Q39 A;  3AZ5 A;  1IIZ A;  1NHB A;  1WQQ A;  3I4Y A;  5IEL A;  2HHH M;  4I5S A;  2L78 A;  5T3F A;  2CV1 A;  2KXE A;  4IJF A;  3PFI A;  1VG5 A;  152L A;  2RKO A;  1OV5 A;  1CNS A;  1EQ5 A;  2QEN A;  2ZBK B;  169L A;  1IP5 A;  1L42 A;  148L E;  1L74 A;  4QHS A;  2JP7 A;  1C7P A;  1GBS A;  3MJ5 A;  1B2K A;  4AW4 A;  1IY3 A;  3U6D A;  1KY1 A;  1N36 M;  4NG8 A;  5LVJ A;  4CFP A;  147L A;  5ITT A;  2LVQ D;  1L15 A;  3V2W A;  1OVH A;  1GF5 A;  2DVW B;  3I51 A;  4EOF A;  1XEP A;  4WLD A;  3LVW A;  5ITQ A;  3WVY A;  1LJH A;  1IP1 A;  2ANX A;  3L28 A;  4RKU F;  1JKB A;  2B7X A;  2RBN A;  4W52 A;  3GUI A;  1OUJ A;  1JTP L;  1C6K A;  1HMK A;  3Q8G A;  3P65 A;  5A2Q S;  5K7O A;  2FYD A;  4NL4 H;  1BB4 A;  4NGZ A;  3J81 S;  1T6H A;  1LZ5 A;  1GXX A;  2KNA A;  1L58 A;  2V1C A;  4FW9 A;  4XBO A;  2HUM A;  1QAQ A;  3M3U A;  1L38 A;  1IWW A;  230L A;  252L A;  3AZ7 A;  2BWB A;  3GRY A;  1YKZ X;  2WAR A;  4ARL A;  1GO5 A;  4QNM A;  130L A;  1NF5 A;  2NTH A;  2VQF M;  4IBE A;  1L27 A;  4II7 A;  1B5W A;  4W51 A;  1DXJ A;  1OVJ A;  4S12 A;  4LF6 M;  3RW8 A;  4YM8 A;  4HEO A;  1S3S A;  5JI3 E;  1PGY A;  4NGO A;  1B6I A;  1JJ0 A;  1J1P Y;  154L A;  4WL6 A;  2O7A A;  3KOY E;  1IN4 A;  3W0L B;  3GQ5 A;  3DFZ A;  1LGW A;  3LYO A;  2XGN A;  3DN1 A;  4J1B A;  1G41 A;  4LJ8 A;  1BQL Y;  1L33 A;  1L91 A;  3TMX A;  3NBI A;  2OE9 X;  2HKJ A;  3GLH A;  4P16 A;  1PQI A;  160L A;  1CU5 A;  3D3D A;  2IHL A;  2YNM D;  2LHM A;  5LIN A;  210L A;  2UXB M;  253L A;  1QSW A;  3HUQ A;  3WPK A;  3CT0 A;  1FLW A;  1TGU A;  2EPE A;  1XNQ M;  3QWL A;  2JY6 B;  1LHI A;  3F8V A;  4M6D A;  3J80 S;  2CFO A;  4JI7 M;  1G7M C;  1LMQ A;  1L62 A;  4DR1 M;  4I7R A;  1R7R A;  2D7G A;  2QAR C;  1LTM A;  3GLH E;  4LZZ A;  2HED A;  5DNY A;  5LMN M;  1HR0 M;  3K2R A;  5KQD A;  2OPF A;  1IN5 A;  4IBK A;  2QP9 X;  2DXI A;  2QQ8 A;  3HKP A;  1L1Z A;  3A95 A;  2DEN A;  4REZ A;  2DQA A;  3W6D A;  2CP8 A;  1YLA A;  2L2D A;  228L A;  1L54 A;  3A6C Y;  1IX0 A;  4NWE A;  5LVK A;  1ZVH L;  5DFL A;  2LXE A;  5KPT A;  4I7P A;  156L A;  3HT9 A;  4YEO A;  1L31 A;  4PPO A;  1L21 A;  5KPR A;  127L A;  1LMA A;  5B1G A;  3SBA A;  1P6Y A;  3QNG A;  4H93 A;  1PJQ A;  5EXP A;  4FWH A;  2H5Z A;  2X4A A;  1YE9 A;  1DPX A;  1L60 A;  4DT3 A;  1L92 A;  3A42 A;  3AL0 C;  4GHL A;  4IBB A;  5HNC A;  4OO9 A;  5KO3 A;  1HEW A;  1IC5 Y;  1IP6 A;  1RI8 B;  213L A;  1LSY A;  1BB7 A;  1ZV1 A;  2BWE A;  4IAT A;  3HX3 A;  5KKI A;  4J0L A;  1OVK A;  1PJS A;  4AZF A;  3MGW A;  1D0K A;  1MN3 A;  4RF1 A;  3TXG A;  2EKK A;  2QB0 B;  2R44 A;  1QTB A;  3W0F A;  1IWX A;  2YFQ A;  4W55 A;  4DDB A;  3LN2 A;  1VEJ A;  1LZ1 A;  2BQL A;  1UIE A;  4G4N A;  4B4E A;  5E26 A;  1IO5 A;  4NEB A;  103L A;  4X62 M;  155L A;  3GLH B;  4DV4 M;  4AKH A;  2QCU A;  1XSF A;  3HDE A;  4GCB A;  2R6F A;  2Q0M X;  3QAU A;  4I7Q A;  5B06 A;  3FTE A;  2A4T A;  4GRI A;  4X65 M;  3B7Z A;  4DD7 A;  5I4W A;  3N9C A;  3OK0 A;  3MHV C;  3PXG A;  1T6O A;  1LLH A;  219L A;  4MB7 A;  4JI0 M;  4Z98 A;  4L15 A;  1UA6 Y;  5I5Q A;  199L A;  4WO9 A;  2B6X A;  1BVK C;  3L27 A;  1QUH A;  197L A;  4IIW A;  1QTE A;  4Z46 A;  2Z38 A;  2FH0 A;  4BB9 A;  1P46 A;  4OVZ A;  1L63 A;  1E32 A;  1LMN A;  1L51 A;  1LYH A;  1PJI A;  4KT3 A;  1LSP A;  1XEJ A;  4G4R A;  1VAU A;  4KLN A;  4TSC A;  1XHB A;  176L A;  3UK6 A;  2R4J A;  4EJ4 A;  1L49 A;  2BQI A;  4WM2 A;  3FI5 A;  1CU6 A;  1V33 A;  1JTO L;  243L A;  3N9E A;  2L6O A;  2I6Z A;  5KXX A;  1WGL A;  3CF2 A;  4AG6 A;  1JHL A;  1PQJ A;  1L84 A;  3P64 A;  3G3A B;  1VQ1 A;  1C6E A;  4PD2 A;  3NYA A;  4DR3 M;  1L53 A;  2QPA A;  4TSB A;  1QT4 A;  255L A;  1FNN A;  4QEQ A;  4ET8 A;  5B07 A;  114L A;  2NWD X;  1B7S A;  1XMO M;  3VW7 A;  4FJR A;  1YAQ A;  173L A;  4MR1 A;  1IVM A;  4DV6 M;  3WU9 A;  2VII A;  3K2L A;  1QZM A;  3T15 A;  2EA0 A;  2BQB A;  1MLC E;  4YXA C;  2Q2E B;  4PCZ A;  1IEE A;  145L A;  2MR9 A;  1K82 A;  1DZB X;  1OUA A;  4FCV A;  4DV1 M;  4H9C A;  180L A;  3C8R A;  2A7D A;  1L25 A;  1G1W A;  2VF7 A;  4GMQ A;  1W5S A;  4NSO B;  1OYU A;  3GLG A;  3K3T A;  4ANR A;  2LC9 A;  2V6Z M;  1LYO A;  249L A;  3TXI A;  1J1X Y;  4HP0 A;  3OTO M;  2M60 A;  3LYT A;  1QUT A;  5ITX A;  1XXH A;  4LG2 A;  5D5C A;  5AMY A;  1WR1 B;  1IC7 Y;  3SBJ A;  1PJT A;  3WUN A;  1CJ6 A;  1GF3 A;  4Z41 A;  1DYF A;  5KXP A;  2DKV A;  5LZM A;  2KDL A;  4I0C A;  3A96 A;  4I7L A;  1C61 A;  1LSC A;  4N0J A;  3UZU A;  1I94 M;  3GLG E;  1D9U A;  1WQM A;  3WHL A;  1QUG A;  1FLU A;  2UU9 M;  1QSQ A;  2AUB A;  3PNV A;  1B5X A;  1JSE A;  1NKH A;  1HFX A;  1T3P A;  4OVZ B;  3HDF A;  1FJG M;  5ITX E;  1DGH A;  1XXH E;  5KXS A;  3C7Z A;  1DYE A;  4ARJ A;  1CKH A;  4OWE A;  3D8L A;  1EIJ A;  1N78 A;  1GHL A;  1L56 A;  3FTF A;  2ERC A;  1Y8G A;  1LYY A;  4M0D A;  126L A;  1PQO A;  1JEF A;  1JTN A;  4AGA A;  4H9E A;  3UGJ A;  1LSZ A;  3TXK A;  1L70 A;  3C8Q A;  125L A;  119L A;  184L A;  1QTD A;  5EP2 A;  4QDN A;  4DQ5 A;  5KXO A;  1IR8 A;  5JEN B;  1C6H A;  2RRU A;  1L29 A;  2CWB A;  1IR9 A;  4I8O A;  3IJV A;  3Q8X A;  2FYC A;  2LYM A;  1GF8 A;  3SFZ A;  4DR4 M;  5LYZ A;  5APF A;  2BQO A;  4R6C A;  5LXW A;  3C7W A;  1YL1 X;  1JKC A;  4ZFP A;  3SAV A;  3HU9 A;  1NWG A;  4ARP A;  1NV9 A;  4W5W A;  3U6Q A;  1L83 A;  1C6N A;  4RNA A;  1VAT A;  1L46 A;  1UIF A;  1FDL Y;  3GLG B;  3AW7 A;  2HUL A;  2WSF F;  1F4I A;  3I01 M;  2XJW A;  1V92 A;  1WTH A;  1CV3 A;  1GPQ C;  5FHW A;  5I4Y A;  188L A;  2PC2 A;  2DWM A;  4LYM A;  1YRO A;  5D5F A;  2F5P A;  1XXH B;  1GF7 A;  146L A;  2O79 A;  5KXW A;  1P2R A;  3VDP A;  2C98 A;  4DR7 M;  4EKQ A;  1G0J A;  2CHG A;  2ZNX Y;  2B74 A;  2KZS A;  4DBG B;  3AOG A;  2RBP A;  4LYZ A;  1GAY A;  3B7Q A;  3SP3 A;  2K6B A;  2WSC F;  1L28 A;  1L05 A;  3W6C A;  163L A;  1CKC A;  3RZE A;  5FST A;  4NGV A;  2KRU A;  1L30 A;  1LYZ A;  1VED A;  224L A;  4NHP A;  1DGH B;  2B6W A;  4DV2 M;  2RSC A;  3GUP A;  2XZF A;  2DAE A;  1FLQ A;  3A67 Y;  2D4I A;  181L A;  4G4C A;  1IY0 A;  1K28 A;  1KS3 A;  3A98 B;  2UXD M;  3HUA A;  1L32 A;  4NY5 A;  2DQD Y;  2GNO A;  3ILK A;  1B5Y A;  2Z6B A;  2G8L A;  3LQR A;  4UWN A;  2Z12 A;  1L02 A;  4HJZ A;  3IG8 A;  4E3U A;  1JR3 D;  4NFV A;  259L A;  1GWD A;  4J1A A;  237L A;  4LJ5 A;  1TEW A;  3JR4 A;  1C1K A;  1NJG A;  2BLX A;  1DGF A;  1LZY A;  1OUC A;  1C6Q A;  1ZVY B;  5ITU A;  1QTC A;  3R9X B;  1BB6 A;  4HJY A;  3PVS A;  1QYR A;  2OEA X;  5E9R A;  3GUL A;  4ARQ A;  4DYG A;  4D80 A;  2IFF Y;  1HNX M;  1ZWN A;  2FBB A;  3HT6 A;  3ZEK A;  4HSF A;  1LJI A;  166L A;  1AKI A;  2BPU A;  4NHI A;  2QHO B;  1L71 A;  3LYZ A;  2LCB A;  3M6A A;  1VEG A;  4JI6 M;  1L66 A;  4WM6 A;  2Z4S A;  1L48 A;  1VDQ A;  4I7S A;  4CIZ A;  1OAI A;  4GCD A;  1GL7 A;  3WL2 A;  2HU1 A;  3L29 A;  2Q9D A;  3GUM A;  4MM3 B;  3TXJ A;  201L A;  2CEA A;  1JQU A;  1XFP L;  2D91 A;  111L A;  3E3D A;  1C62 A;  1C7Y A;  4PT5 A;  4KXI A;  1KIQ C;  1GVN A;  1DI4 A;  1L93 A;  1XWI A;  170L A;  4B3M M;  1CJ8 A;  4DUY M;  1LZ4 A;  139L A;  1HJP A;  4CIS A;  1C6G A;  229L A;  1G0G A;  1KW5 A;  1IY2 A;  4H9H A;  4GLV A;  4LCB A;  3J7A S;  1L82 A;  4TUN A;  4EKP A;  2APL A;  2OTY X;  3SN6 R;  194L A;  2XSZ A;  5A3E A;  1C6L A;  1CUK A;  1EQ4 A;  4UWV A;  1HNZ M;  1LZN A;  1D0L A;  3FUV A;  5DYG A;  1GFK A;  195L A;  2JZ0 A;  4F1I A;  1JIT A;  1L61 A;  2Y0Q A;  223L A;  4NGW A;  2G5G X;  2OOB A;  3HBD A;  4AI6 A;  4LZT A;  1JWR A;  4Y28 F;  2ZTD A;  2FFJ A;  1QZE A;  4H92 A;  5KXY A;  6LZM A;  1TF0 B;  5BR8 M;  216L A;  2Y20 A;  2ZYP A;  4LF4 M;  4M9X A;  4NXN M;  4GIT A;  2L4E A;  1DYB A;  1SXJ D;  3TMW A;  5FTM A;  3A90 A;  1IN8 A;  4GN3 A;  3W67 A;  1L23 A;  1L26 A;  4B08 A;  1G0P A;  2OE7 X;  4N1C C;  1G0K A;  1L11 A;  1C60 A;  1ZMV A;  4NGI A;  4WMG A;  2ZTC A;  5H37 D;  4CGE A;  2Z3X A;  3KDS E;  3DN8 A;  2I7N A;  1OAO C;  1NNU C;  1GF9 A;  1TDZ A;  3TMU A;  4ARQ B;  4CHT B;  4W94 A;  4IBG A;  1L36 A;  1P2C C;  2OTZ X;  1MJG M;  2CHV A;  4G6Z A;  4G4H A;  3UON A;  3LZT A;  4RLN A;  3DN6 A;  4LFP A;  2DAK A;  2N35 A;  1LJG A;  1LMT A;  2F4V M;  1T97 A;  1CV6 A;  2JNH A;  1WGN A;  4M9S A;  4X66 M;  1ALC A;  2G4P A;  2VF8 A;  1X37 A;  2ZWB A;  175L A;  4C5F A;  4AQY M;  1T6V L;  5B1F A;  2HCB A;  2L7I A;  1LJJ A;  4GCE A;  1KYI A;  1L1T A;  3GUN A;  1J5E M;  3FTC A;  1GL6 A;  3U6E A;  3OE6 A;  3DN4 A;  1V7S A;  3RGP A;  3ZC7 B;  5FLX S;  5I53 A;  2D6B A;  256L A;  2I7P A;  2MEB A;  4W53 A;  2HEF A;  4FCT A;  1DO0 A;  3NWL A;  5IHG A;  102L A;  1QT6 A;  4HPE A;  5FDJ A;  1GEZ A;  2K0B X;  1QT5 A;  1XGR C;  4KL7 A;  4LT1 A;  1B7P A;  6LYZ A;  3F9L A;  1LYG A;  3MMP A;  1C66 A;  2HUK A;  3EO5 A;  4DDA A;  3D9A C;  2DWL A;  4LDO A;  3FA0 A;  4LJ7 A;  1DGB A;  3FI7 A;  3P66 A;  206L A;  1QUO A;  225L A;  5LAF A;  4H1P A;  135L A;  1GF6 A;  4G4O A;  5A3Z A;  3FKE A;  5HMV A;  2Z4R A;  4R7G A;  1K3W A;  4RDS A;  2RH1 A;  118L A;  1OWZ A;  1D3J A;  2BQM A;  1E8L A;  4MGZ E;  226L A;  1IOT A;  2XZU A;  3FRI A;  4LT3 A;  1IBK M;  4LZJ A;  1L39 A;  3J27 B;  3B6L A;  1L69 A;  4H9I A;  4NG1 A;  4P17 A;  3C82 A;  3HHY A;  1CV5 A;  1HNW M;  3W6B A;  214L A;  1SWY A;  3V2Y A;  3T1H M;  2DNA A;  1VDT A;  3K8Z A;  2LYZ A;  4N1E I;  3TXH A;  3SAU A;  4ARM A;  122L A;  2DAM A;  3W6E A;  3TMV A;  3VKH A;  5HNL A;  1C65 A;  3KP0 E;  1OV7 A;  192L A;  4MST A;  4PHI A;  3CF6 E;  1LZE A;  1P3Q Q;  3MK6 A;  1CUP A;  1ZMU A;  4DD3 A;  4AQN A;  4XJD A;  7CAT A;  2EKS C;  1L85 A;  1VDL A;  4WG1 A;  3LQQ A;  1B7R A;  1D2N A;  2W1X A;  5ILC A;  3CDO A;  3AJN A;  2LZ2 A;  1D9W A;  3GPU A;  3J4G A;  2B75 A;  1L94 A;  2EUC A;  4IBI A;  4LF8 M;  3TXF A;  3ATN A;  1F0W A;  4WG7 A;  3JR6 A;  4DUZ M;  2I26 L;  2DQG Y;  190L A;  1LZG A;  1C6P A;  1W5T A;  3G3V A;  3AKZ A;  2X8A A;  4LFA M;  3CDR A;  4MGY E;  4KO8 A;  4LJ9 A;  1L07 A;  1T8F A;  4WLX A;  3B0K A;  1LKS A;  3HH5 A;  3T36 A;  1L00 A;  1VFB C;  2A7F A;  3QAK A;  1MX0 A;  1HQC A;  3FUT A;  3K1J A;  1G06 A;  1TBY A;  3SMP A;  5EP4 A;  4EIW A;  5LAG A;  261L A;  4OWC A;  140L A;  1L75 A;  4WW0 A;  1FBI X;  3M7G A;  1LZ6 A;  1G7L C;  2BNK A;  2XQO A;  2L09 A;  3AGH A;  3GRU A;  1T8A A;  191L A;  1IXR C;  1LYJ A;  5EXS A;  1LZ9 A;  1LYD A;  1V7T A;  1N4F A;  1KSF X;  1HC0 A;  3HY5 A;  1L64 A;  2CDS A;  4II8 A;  1DYC A;  1N33 M;  3FD9 A;  4YHH M;  1L19 A;  1REX A;  2LBC A;  2W1L A;  5C18 A;  1N32 M;  3WUA A;  2CV2 A;  1OUE A;  5KJ9 A;  1CU2 A;  1LSF A;  1YIK A;  3PDS A;  2C99 A;  4ARM B;  1L80 A;  1LWK A;  2CHQ A;  251L A;  4NSI A;  4NRW A;  4PGJ B;  3LCV B;  113L A;  1PQD A;  2BAA A;  1LSE A;  1G7J C;  239L A;  3DMV A;  2F5S A;  2BQN A;  4G9S A;  4I7J A;  4WM3 A;  1E94 E;  3DMX A;  2FS1 A;  2YVB A;  1GE2 A;  1CU3 A;  2B6Z A;  1BB3 A;  4LZM A;  2P5T A;  1L04 A;  3NBX X;  4QNR A;  1AIP C;  3AOE C;  1LHJ A;  1IR7 A;  4HJV A;  2VB1 A;  1G0L A;  4I4L A;  4LYB A;  1L65 A;  1LJF A;  4DR2 M;  1L97 A;  2Z19 A;  1L35 A;  2L4F A;  4L8R C;  4CGY B;  4LDL A;  112L A;  1EPY A;  4D81 A;  2HEC A;  7LYZ A;  2X0A A;  3GLI A;  2MEC A;  3DN0 A;  3WW5 A;  1OUI A;  2HWJ A;  4B1A A;  4NC6 A;  1NV8 A;  1D6Q A;  2Z8Y M;  8LYZ A;  2DQF C;  1L87 A;  1OQM A;  174L A;  4PDG A;  1CX7 A;  2B3T A;  1D6P A;  3HFM Y;  1I6S A;  1QQW A;  1SSW A;  4Z8X A;  129L A;  1B7M A;  1JIY A;  1QS5 A;  1GBX A;  3KSX A;  4GC5 A;  1NBY C;  5I54 A;  1L43 A;  2F5O A;  2BQJ A;  1LZT A;  1NHW C;  3D4S A;  4LRS A;  1C68 A;  5II3 A;  4GIP A;  2C9C A;  3GLI E;  3U61 A;  1L72 A;  1LYF A;  1BB5 A;  4GH9 A;  3SB8 A;  2UUC M;  5C6I A;  1D0M A;  2EQL A;  3D8B A;  4AG5 A;  4QOZ C;  2GQF A;  4OWH A;  3SHF A;  1LJE A;  2DAI A;  3PNY A;  1L0J A;  1RFP A;  1EL1 A;  5EJC A;  5KY1 A;  1DYD A;  2XH9 A;  2BQK A;  2F4G A;  132L A;  3LW5 F;  2B73 A;  4YXC A;  3TL4 X;  3A6B Y;  2F2Q A;  3DMZ A;  1C6J A;  1L22 A;  2XTH A;  1Q3C A;  1ZMW A;  1ZAE A;  3KOX E;  1L45 A;  1JJ3 A;  3GO8 A;  1GDX A;  1GFH A;  2O5R A;  3GXR A;  4EKS A;  1NSF A;  2BQC A;  4QHT A;  3WHK A;  104L A;  4NHS A;  2FOI C;  3RUN A;  153L A;  141L A;  2ZAN A;  3KOZ E;  2I25 L;  1C67 A;  3DZD A;  1D2W A;  1NNJ A;  3N9A A;  4IBD A;  1C6F A;  5L3I A;  4BBA A;  1LZC A;  1DYG A;  1GBO A;  5APE A;  4B49 A;  2R65 A;  4YX7 C;  2F30 A;  1Q02 A;  1QQY A;  3LVV A;  241L A;  3C7Y A;  1LPY A;  3FUW A;  1QVR A;  1WQR A;  3CB7 A;  2OOA A;  2Z39 A;  2VQE M;  1FKQ A;  1VDD A;  1P2L A;  1L34 A;  1SSY A;  2V1U A;  1SQ2 L;  4EPF A;  2BQA A;  2LVP C;  1QAO A;  3P68 A;  2BJV A;  3GP1 A;  4GEW A;  1UM8 A;  3GLI B;  3SB7 A;  1J09 A;  3DN2 A;  4LGK A;  2ZIJ A;  2F4A A;  2OU0 X;  4D82 A;  158L A;  4G4B A;  1A2Y C;  2C5R A;  3TQS A;  3LZM A;  5L3H A;  4FWG A;  3TPZ A;  1DI3 A;  3LHM A;  3KW6 A;  3GUK A;  1GAZ A;  4WP2 A;  2R62 A;  4B4I A;  2DQC Y;  1XMQ M;  109L A;  4IBC A;  164L A;  1INU A;  1QDT A;  1IP2 A;  3KP1 E;  1GFV A;  1WVV A;  3W68 A;  3U61 B;  4NWH A;  1GFT A;  1OQY A;  1TH2 A;  4NHT A;  2DZL A;  1L90 A;  1WVU A;  2LVA A;  3B74 A;  1JPO A;  3J6K A;  1SXJ C;  2QBY A;  5I4X A;  4WM4 A;  3WXT A;  4GKJ M;  3W6F A;  3CF0 A;  1OJL A;  3B0O A;  3HGI A;  1NY6 A;  4OOO A;  217L A;  3CT1 A;  3FAD A;  3AYQ A;  3WUM A;  4DD0 A;  3B72 A;  4MGI E;  3EXD A;  3VWO A;  1IOS A;  4FDY A;  1HSW A;  3OJP A;  1LAA A;  4I8S A;  1B7N A;  1JTM A;  4NSG A;  2Z37 A;  2R45 A;  1XGQ C;  4WO6 A;  1SG9 A;  1Q3B A;  3QYE A;  3RT5 X;  1ZUR A;  2R4E A;  1LV7 A;  123L A;  1L50 A;  4BAP A;  3T1Y M;  1WIV A;  3AW6 A;  3H4J A;  4RW1 A;  4NRV A;  3C83 A;  2H9J A;  2F32 A;  2W1Y A;  1L77 A;  4H94 A;  2RBO A;  3OE9 A;  2M5Z A;  3W3E A;  1L18 A;  3HWL A;  4G4Q A;  4B7G A;  1LSD A;  5F16 A;  4WM5 A;  4UN2 B;  2GV0 A;  3GQ4 A;  3DKE X;  3FRH A;  3IHP A;  3KOW E;  1HNL A;  1TAY A;  2UUB M;  4DD1 A;  4JI3 M;  3A45 A;  3HH6 A;  1VDS A;  1L8Q A;  2CWI A;  1WQN A;  2DAG A;  1TCY A;  1N77 A;  4S0W A;  4LFX A;  2ZM6 M;  3J7B A;  3H4M A;  1DKJ A;  1P7S A;  4K5Y A;  1CU0 A;  2LZM A;  1SX2 A;  4GKK M;  2HUB A;  1QDR A;  1GFE A;  1L57 A;  4WL7 A;  4CFO A;  144L A;  159L A;  4XAD A;  1CJ7 A;  1J1O Y;  1L01 A;  1LWG A;  1F6R A;  4HPI A;  2CE7 A;  1UID A;  250L A;  1LZR A;  3QYB A;  1IM2 A;  2KW0 A;  182L A;  2DZN B;  1F10 A;  149L A;  2EJS A;  2KZU A;  1GD6 A;  3E46 A;  161L A;  5KXT A;  2WSE F;  1IWZ A;  1DPW A;  2QBY B;  4NIJ A;  3SC3 A;  1YKY X;  3SMS A;  2Z2E A;  1QT7 A;  1OIZ A;  1L20 A;  1OKS A;  4UWU A;  1GE3 A;  1LI6 A;  3WXU A;  3LCU A;  3AGG G;  1XEK A;  2B6Y A;  1FLY A;  1XGU C;  3FYD A;  4LJA A;  3RE8 A;  4DDC A;  1T8G A;  4ML7 A;  3B7N A;  1QIO A;  2OO9 A;  2F5N A;  5E4P A;  8CAT A;  2EO2 A;  1GFU A;  2DHR A;  3I4V A;  5LVG A;  3P4Z A;  2Z2F A;  4LYC A;  1DYA A;  3W6A A;  4A3V B;  1JKD A;  2K47 A;  1GDW A;  3C80 A;  1LW9 A;  1B7O A;  4XJH A;  2HAK A;  4OWB A;  3U6M A;  1L86 A;  5FCP A;  3WUL A;  2HEB A;  3L25 A;  1L99 A;  247L A;  5F14 A;  1GFG A;  1ZQ9 A;  3ZVQ A;  4LDE A;  3RZ4 A;  3AJI B;  4D9Z A;  2R18 A;  1GEV A;  2Z7J A;  1NQI A;  1IBM M;  3RNX A;  3SB5 A;  3BBZ A;  4FVM A;  3KFU G;  3PBL A;  4M0W A;  107L A;  5KXR A;  1P5C A;  2XFS A;  3HHZ A;  1L96 A;  4ETB A;  4N8Z A;  4CJ6 A;  1L2D A;  3E9S A;  4B3S M;  1UAC Y;  4KPM A;  1NO1 A;  1XGP C;  1PJJ A;  1E9S A;  2LVN C;  171L A;  3BXW A;  1UBZ A;  1C69 A;  3WU8 A;  6LYT A;  234L A;  4M9Z A;  1VDP A;  2LHC A;  1RU3 A;  2RGH A;  1LSN A;  5F9X A;  3HJ8 A;  4DV7 M;  1LSG A;  2F47 A;  2HTX A;  4NHQ A;  2QNJ A;  3TWM A;  1Z5A A;  2XF3 A;  1L16 A;  1LJ3 A;  4FCW A;  1D3F A;  4IAP A;  1LYS A;  1UIH A;  1WJ7 A;  1P64 A;  4L41 A;  3K9P A;  2RAY X;  1XB2 B;  4HTK A;  3U6S A;  2UUA M;  1AT6 A;  4H8Z A;  1L41 A;  1CKF A;  4AXT A;  1RE2 A;  3U6C A;  4IBF A;  1R2Y A;  1XGT C;  2YBI A;  4DD2 A;  1QSA A;  2RB0 X;  1YKX X;  1L47 A;  5LVH A;  4NGJ A;  3OE0 A;  1G3I A;  3JR5 A;  1QAM A;  1QS9 A;  3DN3 A;  1L37 A;  1LMC A;  2KRK A;  5FTN A;  3ULR A;  4CJ2 A;  2R46 A;  4BLC A;  1HEQ A;  5C1B A;  1L68 A;  2JZ1 A;  1L06 A;  1O23 A;  1P3N A;  5KXK A;  1EE8 A;  4KHP M;  4YEM A;  2D4J A;  4Z3M A;  4YY3 M;  1QT3 A;  2FNA A;  1NHE A;  1NBZ C;  3BOS A;  4OOT A;  3ZVQ B;  3A94 A;  2JA2 A;  3SAS A;  4B3T M;  1C45 A;  4NGY A;  2ZIL A;  1LJ4 A;  3HH4 A;  1KIP C;  3WW6 A;  2LNH C;  1EQE A;  1R4G A;  1HEM A;  4YOP A;  5DLA A;  4Z6Y A;  3BKV A;  4WUR A;  183L A;  1FKV A;  3G3W A;  4H9F A;  4X64 M;  1DGG A;  4JI1 M;  3EMS A;  3VKG A;  1UIA A;  3C8S A;  2DQI Y;  3A3R X;  1WTN A;  2JY8 A;  211L A;  1R6B X;  4N9R A;  3SYL A;  1IN7 A;  3SYK A;  4NSR A;  3KS4 A;  5IZ7 D;  157L A;  1LYE A;  1QTV A;  3TXB A;  1KIR C;  1I4W A;  1TR8 A;  2LWX A;  1KXW A;  2Y0T A;  2D7E A;  1L95 A;  3TXD A;  2RB2 X;  3A92 A;  1CV0 A;  5KXZ A;  4DR6 M;  260L A;  3KS8 A;  1L88 A;  5KXN A;  2MEE A;  1LSA A;  1GB2 A;  1P36 A;  1LYI A;  215L A;  1D3N A;  3TE6 A;  222L A;  168L A;  4GC9 A;  4B3R M;  1PZY A;  1L24 A;  1YQV Y;  4DQJ A;  3GUJ A;  2DKL A;  1AM7 A;  3L26 A;  1C63 A;  221L A;  1G4A E;  3CGW A;  1GF4 A;  2DQE Y;  4W96 A;  1DKK A;  2WZJ A;  4XJG A;  3WVX A;  5EQT A;  4DKL A;  1K3X A;  1REM A;  133L A;  2BLY A;  1JTT L;  2X49 A;  3CTW B;  3HJQ A;  1AZF A;  1ZMY L;  1BHZ A;  1HT1 E;  2XFT A;  1GE1 A;  2F5Q A;  4OWA A;  1AT5 A;  1OUH A;  1PM5 A;  2DI0 A;  1DO2 A;  1HQY E;  1GB5 A;  1UCO A;  3KXE C;  3R8F A;  2D4K A;  5DN5 A;  2JWS A;  3SAW A;  2MRO B;  2LTU A;  3C3D A;  4IBJ A;  3M18 B;  4DR5 M;  1YAM A;  1IXS A;  3ZQJ A;  3K9O A;  1KFV A;  3CSR A;  1SX7 A;  2O01 F;  3T38 A;  3A34 A;  3U6L A;  3B0I A;  2MEA A;  4ETE A;  1V34 A;  4J7V A;  1H6M A;  4EXM A;  3DOA A;  2Z18 A;  2BQD A;  3DA1 A;  4NSH A;  1NY5 A;  4PJZ A;  4P2E A;  1IOQ A;  1GBW A;  2R0I A;  1XC8 A;  2YBJ A;  1L59 A;  1OUG A;  4GCC A;  2H1R A;  4DV5 M;  4G49 A;  4I81 A;  3SAR A;  1IP4 A;  3A8Z A;  1BVX A;  1C6D A;  3G3X A;  1IWT A;  1C10 A;  3WPL A;  2KA6 B;  4MGK E;  3L2X A;  1WTM A;  4W58 A;  4XJI A;  1QUD A;  2KEB A;  5FTK A;  4LF9 M;  1LGU A;  4XN6 A;  2QSF X;  1LOZ A;  5HMJ A;  2LHG A;  4JI2 M;  4YEN A;  2DHY A;  4ETC A;  4W57 A;  1L55 A;  3UMM A;  2E5L M;  1LI3 A;  4AKG A;  3HBE X;  4H8Y A;  3T6P A;  2MEI A;  4BAF A;  1HHL A;  1HFZ A;  3THG A;  3HU8 A;  3VDU A;  1OUB A;  4NXM M;  4GCF A;  1C6C A;  3SAT A;  4B0D A;  2DQH Y;  2MED A;  2DBT A;  3WYH A;  1L81 A;  2JXN A;  5J7C A;  2G4N A;  3HUK A;  3TXE A;  3WPJ A;  1CKG A;  1C6I A;  2JY7 A;  2EIZ C;  2YBM A;  3LYM A;  3I04 M;  4DV0 M;  4FD2 A;  5IDD A;  5IWA M;  4EKR A;  4JI8 M;  1LI2 A;  3CT5 A;  4IJ4 A;  162L A;  258L A;  238L A;  1GXV 2;  2LZT A;  3BKH A;  5L8R F;  189L A;  2H5X A;  1BWH A;  1C6A A;  1JQJ C;  1LJN A;  5B59 A;  4XGI A;  1IQP A;  3AOE A;  3EML A;  3HU1 A;  3GPY A;  1GKI A;  2YBL A;  3NY9 A;  4MCK A;  4RF0 A;  3HTD A;  4X3B A;  248L A;  4DQ7 A;  1MEL L;  1IXS B;  1G59 A;  3HZJ A;  3TWL A;  2XSZ D;  3HBH A;  2LH0 A;  5HLL A;  9LYZ A;  5FSW A;  2MJ5 B;  3CDV A;  2MH8 A;  2B6T A;  4L6V 6;  1OP9 B;  4MH0 E;  1HEO A;  3HJS A;  1LJK A;  1TTE A;  5L9J A;  1R2Z A;  4WLT A;  3LMM A;  5LA5 A;  2B70 A;  1LCN A;  1NDG C;  2YR0 A;  1LPI A;  1A5T A;  5EXT A;  5FEL A;  3LZ2 A;  2J5Y A;  1PRB A;  2C8P A;  1LSM A;  5BPV A;  1LMO A;  3RFW A;  4PK0 A;  2YQZ A;  1CV1 A;  115L A;  2CRU A;  4JI5 M;  1L79 A;  3V76 A;  1L89 A;  1JKA A;  3U6O A;  2B72 A;  128L A;  2CGI A;  167L A;  3FE0 A;  2JY5 A;  3AFH A;  5DYI A;  1I20 A;  3A91 A;  5APC A;  4C3W A;  2MEH A;  1JR3 A;  208L A;  1OFH A;  1CKD A;  4H91 A;  1LZ8 A;  1R5L A;  1G7I C;  2MEF A;  3IWR A;  1IWY A;  4TTD A;  4ITQ A;  257L A;  4K0K M;  2B5Z A;  5IRE B;  4L78 A;  4F2L A;  2BQE A;  244L A;  227L A;  4R71 A;  3GRV A;  2RBQ A;  5HQ1 A;  1GB0 A;  1UUZ C;  1C6T A;  3FUU A;  172L A;  2UXC M;  4LF5 M;  1DQJ C;  1P56 A;  1LHK A;  1JR3 E;  1GB7 A;  2RBR A;  1KY0 A;  4W56 A;  1JB0 F;  1Z5B A;  2IGC A;  1NVM A;  1A4V A;  1WXQ A;  3NY8 A;  2XLJ A;  1E9R A;  4DAJ A;  3CDQ A;  5LMU M;  1DI5 A;  4W59 A;  2NTG A;  4BAD A;  3WMK A;  3KVW A;  2OU8 A;  2JUJ A;  1HEN A;  2J7N A;  3GQ3 A;  3KSJ A;  209L A;  1SWZ A;  205L A;  1IFY A;  2ZIK A;  1C08 C;  1B7Q A;  246L A;  2C9O A;  3FE3 A;  3K92 A;  3AZ4 A;  1KXY A;  4HV1 A;  3CSQ A;  1GFR A;  3HHX A;  2ZYC A;  5EBH A;  2J7O A;  1OTR A;  3J2P B;  1UFZ A;  2K9D A;  4LJ6 A;  4WOA A;  1OFI A;  2QZ4 A;  1IXZ A;  3AV0 A;  1WQO A;  4I7O A;  4NOO B;  1JJ1 A;  1HER A;  1HSX A;  1L2B A;  1NDM C;  3C81 A;  4NGL A;  2DWZ B;  3T6U A;  3U60 A;  4DJH A;  3E4R A;  131L A;  5IT9 S;  2DWN A;  178L A;  1GAB A;  3HT8 A;  1JSF A;  3QE8 A;  1GFA A;  2RBS A;  1L03 A;  1GF0 A;  2ZAO A;  1XNR M;  1GB9 A;  1B5U A;  1G0Q A;  2CJL A;  3GRR A;  1Z59 A;  1TH4 A;  3HU2 A;  1F6S A;  2Y8P A;  138L A;  1B0D A;  198L A;  1IN6 A;  1D3M A;  235L A;  4B7H A;  1W6Z A;  1GE0 A;  1H6U A;  4JXJ A;  4M4O A;  4TUW A;  151L A;  1GFJ A;  3CQL A;  1B5V A;  1IWU A;  1XJT A; 
#chains in the Genus database with same CATH homology
 1W08 A;  1QT8 A;  2H9K A;  3QY4 A;  212L A;  1L98 A;  4RW2 A;  4HTN A;  4WLY A;  1G7H C;  1C6M A;  1LZS A;  3EBA B;  1B5Z A;  1RCM A;  231L A;  233L A;  3GUO A;  1IC4 Y;  1ZV5 L;  5C6J A;  1L44 A;  1FN5 A;  3SB9 A;  5I14 A;  1GE4 A;  232L A;  3AGI A;  1LSB A;  4NGK A;  4YF2 A;  2FBD A;  1LZD A;  3SB6 A;  1XEI A;  1L17 A;  1CVK A;  1IOC A;  2F2N A;  1Z55 A;  5DL9 A;  134L A;  3A93 A;  4ET9 A;  1IP7 A;  4XJB A;  2HEE A;  1H87 A;  1ZYT A;  262L A;  4RLM A;  2XBS A;  143L A;  242L A;  1C6B A;  1LHL A;  4O34 A;  5LIO A;  3HT7 A;  4LT2 A;  3ODU A;  4H9A A;  7LZM A;  5KXM A;  1LKR A;  2YBH A;  2C8O A;  2MEG A;  1G07 A;  108L A;  1UIC A;  1LMP A;  1LHH A;  193L A;  2YSS C;  1HEL A;  1QTK A;  4GN4 A;  3KAM A;  1L76 A;  2ANV A;  1UC0 A;  3GXK A;  1QUS A;  5B05 A;  3HTB A;  1OUF A;  4CHX A;  2ZQ4 A;  1I1Z A;  165L A;  1RJC B;  4A7D A;  220L A;  2Q9E A;  1L67 A;  4LT0 A;  4GLA A;  4GRV A;  4WM1 A;  1LZA A;  1L10 A;  1YAN A;  2XBR A;  4TWS A;  1JUG A;  1L13 A;  1KNI A;  2W1M A;  1UIG A;  4B4J A;  186L A;  2G4Q A;  5F81 A;  1BWI A;  1L09 A;  4GBR B;  1JIS A;  1YL0 X;  4U3X B;  1IWV A;  4GN5 C;  1GB3 A;  4N5R A;  4QY9 A;  4ETD A;  5LYM A;  2OU9 A;  2HEA A;  3CSZ A;  2O4W A;  5LYT A;  1I56 A;  1GB6 A;  1LGX A;  1REY A;  150L A;  3CDT A;  1HEP A;  1CTW A;  1L73 A;  2LYO A;  4DWX A;  4HTQ A;  4I7T A;  1L0K A;  1L08 A;  2RB1 X;  5KKJ A;  1B7L A;  1TDY A;  3RU5 A;  5C6L A;  1IY4 A;  1PS5 A;  1CJ9 A;  4BS7 A;  1L40 A;  207L A;  4XEN A;  2BQF A;  5DN4 A;  177L A;  1BWJ A;  1D2Y A;  3WH1 A;  1C64 A;  4HV2 A;  3DNA A;  3G3B B;  218L A;  3AB6 A;  4LYO A;  2ZQ3 A;  4H9B A;  3ATO A;  5M1Y A;  2N5Z A;  1G0M A;  4W54 A;  1NMM A;  5LA8 A;  4ZIX A;  2BQH A;  2HU3 A;  240L A;  4IAS A;  1L52 A;  2YBN A;  3HTG A;  4QGZ A;  236L A;  5F9U A;  4PRQ A;  4ZEE A;  3SBB C;  5FEK A;  4I7N A;  1G1V A;  2RAZ X;  3WU7 A;  1HML A;  1QTH A;  120L A;  2DQJ Y;  245L A;  1TLA A;  1C46 A;  2OE4 X;  1CX6 A;  200L A;  1UIB A;  4H90 A;  5DM9 A;  1C43 A;  1IP3 A;  2YDG A;  5LVI A;  4EPI A;  254L A;  1B9O A;  4H8X A;  4XYY A;  5APD A;  1GB8 A;  1SLY A;  4R0F A;  1GBY A;  4ETA A;  4LYT A;  1YIL A;  1HFY A;  1L12 A;  1CUQ A;  1XJU A;  4I7K A;  5KXL A;  4ZPU A;  1OWY A;  4TX7 A;  3A3Q A;  1YAO A;  4NSJ A;  3L64 A;  1KXX A;  1REZ A;  137L A;  1WQP A;  1LZB A;  196L A;  1L14 A;  4I7M A;  4EMN A;  3F6Z A;  110L A;  187L A;  1P37 A;  1KW7 A;  185L A;  2ZNW Y;  3AZ6 A;  4PRU A;  4PJ2 C;  3OE8 A;  1YAP A;  3IJU A;  4XJF A;  1OUD A;  5ILF A;  1HF4 A;  142L A;  2BQG A;  4DC4 A;  1IOR A;  1LHM A;  1GBZ A;  1QTZ A;  3HH3 A;  1BGI A;  4OW1 A;  1PQK A;  2CUU A;  4DD9 A;  1PQM A;  4E97 A;  1QSB A;  3HTF A;  3AZ5 A;  1CV4 A;  1IIZ A;  1NHB A;  1WQQ A;  5IEL A;  2L78 A;  5T3F A;  152L A;  1OV5 A;  1CNS A;  1EQ5 A;  169L A;  1L42 A;  1IP5 A;  148L E;  1L74 A;  1C7P A;  1GBS A;  1B2K A;  1IY3 A;  1KY1 A;  4NG8 A;  5LVJ A;  4CFP A;  147L A;  1L15 A;  3V2W A;  1OVH A;  1GF5 A;  4EOF A;  1XEP A;  4WLD A;  3WVY A;  1LJH A;  1IP1 A;  2ANX A;  2RBN A;  1JKB A;  2B7X A;  4W52 A;  3GUI A;  1OUJ A;  1JTP L;  1C6K A;  1HMK A;  3P65 A;  5K7O A;  2FYD A;  1BB4 A;  4NGZ A;  1T6H A;  1LZ5 A;  1GXX A;  1L58 A;  2HUM A;  3M3U A;  1L38 A;  1IWW A;  230L A;  252L A;  3AZ7 A;  1YKZ X;  2WAR A;  4ARL A;  130L A;  1NF5 A;  2NTH A;  1L27 A;  1B5W A;  4W51 A;  1DXJ A;  1OVJ A;  3RW8 A;  4YM8 A;  4NGO A;  1B6I A;  1JJ0 A;  1J1P Y;  154L A;  4WL6 A;  2O7A A;  1LGW A;  3LYO A;  3DN1 A;  4J1B A;  1BQL Y;  1L33 A;  1L91 A;  3TMX A;  2OE9 X;  1PQI A;  160L A;  1CU5 A;  3D3D A;  2IHL A;  2LHM A;  5LIN A;  210L A;  253L A;  1QSW A;  3HUQ A;  3WPK A;  3CT0 A;  1FLW A;  2EPE A;  1LHI A;  4M6D A;  3F8V A;  1G7M C;  1LMQ A;  1L62 A;  4I7R A;  2QAR C;  1LTM A;  2HED A;  3K2R A;  3A95 A;  2DQA A;  3W6D A;  228L A;  1L54 A;  3A6C Y;  1IX0 A;  4NWE A;  5LVK A;  1ZVH L;  4I7P A;  156L A;  3HT9 A;  4YEO A;  1L31 A;  4PPO A;  1L21 A;  1LMA A;  127L A;  5B1G A;  3SBA A;  1P6Y A;  3QNG A;  4H93 A;  2H5Z A;  1DPX A;  1L60 A;  4DT3 A;  1L92 A;  5HNC A;  4OO9 A;  1HEW A;  1IC5 Y;  1RI8 B;  1IP6 A;  213L A;  1LSY A;  1BB7 A;  4IAT A;  5KKI A;  4J0L A;  1OVK A;  3MGW A;  1D0K A;  3TXG A;  2QB0 B;  1QTB A;  1IWX A;  4DDB A;  4W55 A;  3LN2 A;  1LZ1 A;  2BQL A;  1UIE A;  4B4E A;  4NEB A;  1IO5 A;  103L A;  155L A;  1XSF A;  3HDE A;  4GCB A;  2Q0M X;  4I7Q A;  5B06 A;  2A4T A;  4DD7 A;  5I4W A;  3N9C A;  3OK0 A;  1LLH A;  219L A;  4Z98 A;  1UA6 Y;  5I5Q A;  199L A;  4WO9 A;  2B6X A;  1BVK C;  1QUH A;  197L A;  1QTE A;  4Z46 A;  2Z38 A;  1P46 A;  1L63 A;  1LMN A;  1L51 A;  1LYH A;  4KT3 A;  1LSP A;  1XEJ A;  4TSC A;  1VAU A;  176L A;  4EJ4 A;  1L49 A;  2BQI A;  4WM2 A;  3FI5 A;  1CU6 A;  1JTO L;  243L A;  3N9E A;  2I6Z A;  5KXX A;  1JHL A;  1PQJ A;  1L84 A;  3P64 A;  3G3A B;  1C6E A;  3NYA A;  1L53 A;  4TSB A;  1QT4 A;  255L A;  4QEQ A;  4ET8 A;  5B07 A;  114L A;  2NWD X;  1B7S A;  3VW7 A;  4FJR A;  1YAQ A;  173L A;  4MR1 A;  1IVM A;  3WU9 A;  2BQB A;  1MLC E;  4YXA C;  1IEE A;  145L A;  1DZB X;  1OUA A;  4H9C A;  180L A;  3C8R A;  2A7D A;  1L25 A;  1G1W A;  1OYU A;  3K3T A;  4ANR A;  2LC9 A;  1LYO A;  249L A;  3TXI A;  1J1X Y;  4HP0 A;  3LYT A;  1QUT A;  5D5C A;  5AMY A;  1IC7 Y;  3WUN A;  1CJ6 A;  1GF3 A;  4Z41 A;  1DYF A;  5KXP A;  2DKV A;  5LZM A;  4I0C A;  3A96 A;  4I7L A;  1C61 A;  1LSC A;  4N0J A;  1D9U A;  1WQM A;  1QUG A;  1FLU A;  1QSQ A;  2AUB A;  1B5X A;  1JSE A;  1NKH A;  1HFX A;  1T3P A;  3HDF A;  5KXS A;  3C7Z A;  1DYE A;  4ARJ A;  1CKH A;  4OWE A;  1GHL A;  1L56 A;  1LYY A;  126L A;  1PQO A;  1JEF A;  1JTN A;  4AGA A;  4H9E A;  1LSZ A;  3TXK A;  1L70 A;  3C8Q A;  125L A;  119L A;  184L A;  1QTD A;  4QDN A;  4DQ5 A;  5KXO A;  1IR8 A;  5JEN B;  1C6H A;  1L29 A;  1IR9 A;  3IJV A;  2FYC A;  2LYM A;  1GF8 A;  5LYZ A;  5APF A;  2BQO A;  4R6C A;  5LXW A;  3C7W A;  1YL1 X;  1JKC A;  4ZFP A;  3HU9 A;  1NWG A;  4ARP A;  1L83 A;  1C6N A;  1VAT A;  1L46 A;  1UIF A;  1FDL Y;  3AW7 A;  2HUL A;  2XJW A;  1WTH A;  1CV3 A;  1GPQ C;  5FHW A;  5I4Y A;  188L A;  2PC2 A;  4LYM A;  1YRO A;  5D5F A;  1GF7 A;  146L A;  2O79 A;  5KXW A;  1P2R A;  4EKQ A;  1G0J A;  2ZNX Y;  2B74 A;  2RBP A;  4LYZ A;  1GAY A;  3SP3 A;  1L28 A;  1L05 A;  3W6C A;  163L A;  1CKC A;  3RZE A;  5FST A;  4NGV A;  1LYZ A;  1L30 A;  1VED A;  224L A;  4NHP A;  2B6W A;  2RSC A;  3GUP A;  1FLQ A;  3A67 Y;  2D4I A;  181L A;  4G4C A;  1K28 A;  1KS3 A;  3HUA A;  1L32 A;  4NY5 A;  2DQD Y;  1B5Y A;  2Z6B A;  4UWN A;  2Z12 A;  1L02 A;  4HJZ A;  4E3U A;  4NFV A;  259L A;  1GWD A;  4J1A A;  237L A;  1TEW A;  2BLX A;  1LZY A;  1OUC A;  1C6Q A;  1ZVY B;  1QTC A;  1BB6 A;  4HJY A;  2OEA X;  5E9R A;  3GUL A;  4ARQ A;  4DYG A;  2IFF Y;  1ZWN A;  2FBB A;  3HT6 A;  3ZEK A;  4HSF A;  1LJI A;  166L A;  1AKI A;  2BPU A;  4NHI A;  1L71 A;  3LYZ A;  2LCB A;  1L66 A;  4WM6 A;  1L48 A;  1VDQ A;  4I7S A;  4GCD A;  3WL2 A;  2HU1 A;  2Q9D A;  3GUM A;  3TXJ A;  201L A;  1JQU A;  1XFP L;  2D91 A;  3E3D A;  111L A;  1C62 A;  4KXI A;  1KIQ C;  1DI4 A;  1L93 A;  170L A;  1CJ8 A;  1LZ4 A;  139L A;  1C6G A;  229L A;  1G0G A;  1KW5 A;  4H9H A;  4GLV A;  1L82 A;  4TUN A;  4EKP A;  2OTY X;  3SN6 R;  194L A;  5A3E A;  1C6L A;  1EQ4 A;  4UWV A;  1LZN A;  1D0L A;  1GFK A;  195L A;  1JIT A;  1L61 A;  223L A;  4NGW A;  3HBD A;  4LZT A;  1JWR A;  4H92 A;  5KXY A;  6LZM A;  216L A;  2ZYP A;  1DYB A;  3TMW A;  3A90 A;  4GN3 A;  1L23 A;  1L26 A;  2OE7 X;  1G0P A;  4N1C C;  1G0K A;  1L11 A;  1C60 A;  4NGI A;  4WMG A;  4CGE A;  3DN8 A;  1GF9 A;  3TMU A;  4ARQ B;  4W94 A;  1L36 A;  1P2C C;  2OTZ X;  4G4H A;  3UON A;  3LZT A;  4RLN A;  3DN6 A;  4LFP A;  1LJG A;  1LMT A;  1T97 A;  1CV6 A;  1ALC A;  2G4P A;  2ZWB A;  175L A;  4C5F A;  1T6V L;  5B1F A;  1LJJ A;  4GCE A;  3GUN A;  3OE6 A;  3DN4 A;  1V7S A;  5I53 A;  2D6B A;  256L A;  2MEB A;  4W53 A;  2HEF A;  5IHG A;  102L A;  1QT6 A;  4HPE A;  5FDJ A;  1GEZ A;  1QT5 A;  1XGR C;  4KL7 A;  4LT1 A;  1B7P A;  6LYZ A;  3F9L A;  1LYG A;  1C66 A;  2HUK A;  3EO5 A;  4DDA A;  3D9A C;  4LDO A;  3FA0 A;  3FI7 A;  3P66 A;  206L A;  1QUO A;  225L A;  5LAF A;  4H1P A;  135L A;  1GF6 A;  5A3Z A;  5HMV A;  4RDS A;  2RH1 A;  118L A;  1OWZ A;  1D3J A;  2BQM A;  1E8L A;  226L A;  1IOT A;  4LT3 A;  1L39 A;  3B6L A;  1L69 A;  4H9I A;  4NG1 A;  3C82 A;  1CV5 A;  3W6B A;  214L A;  1SWY A;  3V2Y A;  1VDT A;  2LYZ A;  4N1E I;  3TXH A;  4ARM A;  122L A;  3W6E A;  3TMV A;  5HNL A;  1C65 A;  1OV7 A;  192L A;  4MST A;  4PHI A;  1LZE A;  1CUP A;  4DD3 A;  4AQN A;  4XJD A;  2EKS C;  1L85 A;  4WG1 A;  1B7R A;  2W1X A;  5ILC A;  3CDO A;  3AJN A;  2LZ2 A;  1D9W A;  3J4G A;  2B75 A;  1L94 A;  3TXF A;  3ATN A;  1F0W A;  4WG7 A;  3JR6 A;  2I26 L;  2DQG Y;  190L A;  1LZG A;  1C6P A;  3G3V A;  3CDR A;  1T8F A;  1L07 A;  4WLX A;  3B0K A;  1LKS A;  3HH5 A;  3T36 A;  1L00 A;  1VFB C;  2A7F A;  3QAK A;  1G06 A;  1TBY A;  5LAG A;  261L A;  4OWC A;  140L A;  1L75 A;  1FBI X;  1LZ6 A;  1G7L C;  2XQO A;  3AGH A;  1T8A A;  191L A;  1LYJ A;  1LZ9 A;  1LYD A;  1V7T A;  1N4F A;  1HC0 A;  1L64 A;  2CDS A;  4II8 A;  1DYC A;  1L19 A;  1REX A;  2W1L A;  3WUA A;  1OUE A;  5KJ9 A;  1CU2 A;  1LSF A;  1YIK A;  3PDS A;  4ARM B;  1L80 A;  1LWK A;  251L A;  4NSI A;  4PGJ B;  1PQD A;  113L A;  2BAA A;  1LSE A;  1G7J C;  239L A;  3DMV A;  2BQN A;  4G9S A;  4I7J A;  4WM3 A;  3DMX A;  2YVB A;  1GE2 A;  1CU3 A;  2B6Z A;  1BB3 A;  4LZM A;  1L04 A;  1LHJ A;  1IR7 A;  4HJV A;  2VB1 A;  1G0L A;  4LYB A;  1L65 A;  1LJF A;  1L97 A;  2Z19 A;  1L35 A;  4LDL A;  112L A;  1EPY A;  2HEC A;  7LYZ A;  2X0A A;  3DN0 A;  2MEC A;  3WW5 A;  1OUI A;  4B1A A;  1D6Q A;  8LYZ A;  2DQF C;  1L87 A;  1OQM A;  174L A;  1CX7 A;  1D6P A;  3HFM Y;  1I6S A;  1SSW A;  129L A;  1B7M A;  1JIY A;  1QS5 A;  1GBX A;  1NBY C;  5I54 A;  1L43 A;  2BQJ A;  1LZT A;  3D4S A;  1C68 A;  5II3 A;  1L72 A;  1LYF A;  1BB5 A;  3SB8 A;  5C6I A;  1D0M A;  2EQL A;  4OWH A;  1LJE A;  1L0J A;  1RFP A;  1EL1 A;  5KY1 A;  1DYD A;  2BQK A;  2F4G A;  132L A;  2B73 A;  4YXC A;  3A6B Y;  2F2Q A;  3DMZ A;  1C6J A;  1L22 A;  2XTH A;  1L45 A;  1JJ3 A;  1GDX A;  1GFH A;  3GXR A;  4EKS A;  2BQC A;  104L A;  4NHS A;  3RUN A;  153L A;  141L A;  2I25 L;  1C67 A;  1D2W A;  3N9A A;  1C6F A;  5L3I A;  1LZC A;  1DYG A;  1GBO A;  5APE A;  4B49 A;  4YX7 C;  2F30 A;  1QQY A;  241L A;  3C7Y A;  1LPY A;  1WQR A;  3CB7 A;  2Z39 A;  1FKQ A;  1P2L A;  1L34 A;  1SSY A;  1SQ2 L;  4EPF A;  2BQA A;  3P68 A;  3SB7 A;  3DN2 A;  4LGK A;  2ZIJ A;  2F4A A;  2OU0 X;  158L A;  4G4B A;  1A2Y C;  3LZM A;  5L3H A;  1DI3 A;  3LHM A;  3GUK A;  1GAZ A;  4B4I A;  2DQC Y;  109L A;  164L A;  1INU A;  1QDT A;  1IP2 A;  1GFV A;  1WVV A;  4NWH A;  1GFT A;  4NHT A;  1L90 A;  1WVU A;  1JPO A;  3J6K A;  5I4X A;  4WM4 A;  3WXT A;  3W6F A;  3B0O A;  4OOO A;  217L A;  3CT1 A;  3FAD A;  3AYQ A;  3WUM A;  4DD0 A;  3B72 A;  3EXD A;  3VWO A;  1IOS A;  4FDY A;  1HSW A;  3OJP A;  1LAA A;  4I8S A;  1B7N A;  1JTM A;  4NSG A;  2Z37 A;  1XGQ C;  4WO6 A;  3RT5 X;  1ZUR A;  123L A;  1L50 A;  4BAP A;  3AW6 A;  4RW1 A;  3C83 A;  2H9J A;  2F32 A;  2W1Y A;  1L77 A;  4H94 A;  2RBO A;  3OE9 A;  3W3E A;  1L18 A;  3HWL A;  1LSD A;  5F16 A;  4WM5 A;  2GV0 A;  3DKE X;  1HNL A;  1TAY A;  4DD1 A;  3HH6 A;  1VDS A;  2CWI A;  1WQN A;  1TCY A;  4S0W A;  4LFX A;  1DKJ A;  1P7S A;  4K5Y A;  1CU0 A;  2LZM A;  1SX2 A;  2HUB A;  1QDR A;  1GFE A;  1L57 A;  4WL7 A;  4CFO A;  144L A;  159L A;  4XAD A;  1CJ7 A;  1J1O Y;  1L01 A;  1LWG A;  1F6R A;  4HPI A;  1UID A;  250L A;  1LZR A;  182L A;  1F10 A;  149L A;  1GD6 A;  161L A;  5KXT A;  1IWZ A;  1DPW A;  4NIJ A;  1YKY X;  2Z2E A;  1QT7 A;  1L20 A;  4UWU A;  1GE3 A;  1LI6 A;  3WXU A;  3AGG G;  1XEK A;  2B6Y A;  1FLY A;  1XGU C;  4DDC A;  1T8G A;  4ML7 A;  1QIO A;  5E4P A;  1GFU A;  5LVG A;  3P4Z A;  2Z2F A;  4LYC A;  1DYA A;  3W6A A;  1JKD A;  1GDW A;  3C80 A;  1LW9 A;  1B7O A;  4XJH A;  4OWB A;  1L86 A;  5FCP A;  3WUL A;  2HEB A;  1L99 A;  247L A;  5F14 A;  1GFG A;  3ZVQ A;  4LDE A;  3RZ4 A;  4D9Z A;  1GEV A;  1NQI A;  3RNX A;  3SB5 A;  3PBL A;  107L A;  5KXR A;  1P5C A;  1L96 A;  4ETB A;  4N8Z A;  1UAC Y;  4KPM A;  1XGP C;  1UBZ A;  171L A;  6LYT A;  1C69 A;  3WU8 A;  234L A;  1VDP A;  1LSN A;  5F9X A;  1LSG A;  2F47 A;  2HTX A;  4NHQ A;  1L16 A;  1LJ3 A;  1D3F A;  4IAP A;  1LYS A;  1UIH A;  1P64 A;  4L41 A;  2RAY X;  4HTK A;  1AT6 A;  4H8Z A;  1L41 A;  1CKF A;  4AXT A;  1RE2 A;  1XGT C;  2YBI A;  4DD2 A;  1QSA A;  2RB0 X;  1YKX X;  1L47 A;  5LVH A;  4NGJ A;  3OE0 A;  1QS9 A;  3DN3 A;  1L37 A;  1LMC A;  4CJ2 A;  3ULR A;  1HEQ A;  1L68 A;  1L06 A;  1O23 A;  1P3N A;  5KXK A;  4YEM A;  2D4J A;  4Z3M A;  1QT3 A;  1NHE A;  1NBZ C;  4OOT A;  3ZVQ B;  3A94 A;  4NGY A;  1C45 A;  2ZIL A;  1LJ4 A;  3HH4 A;  1KIP C;  3WW6 A;  1EQE A;  1HEM A;  4YOP A;  5DLA A;  3BKV A;  183L A;  1FKV A;  3G3W A;  4H9F A;  3EMS A;  3C8S A;  1UIA A;  2DQI Y;  3A3R X;  1WTN A;  211L A;  4N9R A;  157L A;  1LYE A;  1QTV A;  3TXB A;  1KIR C;  1KXW A;  1L95 A;  3TXD A;  2RB2 X;  3A92 A;  1CV0 A;  5KXZ A;  260L A;  1L88 A;  5KXN A;  2MEE A;  1LSA A;  1GB2 A;  1P36 A;  1LYI A;  215L A;  1D3N A;  222L A;  168L A;  1PZY A;  1L24 A;  1YQV Y;  4DQJ A;  3GUJ A;  1AM7 A;  1C63 A;  221L A;  1GF4 A;  2DQE Y;  4W96 A;  1DKK A;  4XJG A;  3WVX A;  4DKL A;  1REM A;  133L A;  2BLY A;  1JTT L;  1AZF A;  1ZMY L;  1BHZ A;  1GE1 A;  4OWA A;  1AT5 A;  1OUH A;  1GB5 A;  1UCO A;  2D4K A;  5DN5 A;  3M18 B;  1YAM A;  3CSR A;  1SX7 A;  3A34 A;  3B0I A;  2MEA A;  4ETE A;  4J7V A;  1H6M A;  4EXM A;  2Z18 A;  2BQD A;  4NSH A;  4PJZ A;  4P2E A;  1IOQ A;  1GBW A;  2YBJ A;  1L59 A;  1OUG A;  4GCC A;  4G49 A;  1IP4 A;  3A8Z A;  1BVX A;  1C6D A;  3G3X A;  1IWT A;  1C10 A;  3WPL A;  3L2X A;  1WTM A;  4W58 A;  4XJI A;  1QUD A;  1LGU A;  4XN6 A;  1LOZ A;  5HMJ A;  4YEN A;  4ETC A;  4W57 A;  1L55 A;  1LI3 A;  3HBE X;  4H8Y A;  2MEI A;  4BAF A;  1HHL A;  1HFZ A;  3HU8 A;  1OUB A;  4GCF A;  1C6C A;  4B0D A;  2DQH Y;  2MED A;  2DBT A;  3WYH A;  1L81 A;  5J7C A;  2G4N A;  3HUK A;  3TXE A;  3WPJ A;  1CKG A;  1C6I A;  2EIZ C;  2YBM A;  3LYM A;  5IDD A;  4EKR A;  1LI2 A;  3CT5 A;  4IJ4 A;  162L A;  258L A;  238L A;  1GXV 2;  2LZT A;  3BKH A;  189L A;  1BWH A;  1C6A A;  1LJN A;  5B59 A;  3EML A;  2YBL A;  3NY9 A;  4MCK A;  3HTD A;  4X3B A;  248L A;  4DQ7 A;  1MEL L;  3HBH A;  5HLL A;  9LYZ A;  3CDV A;  2B6T A;  1OP9 B;  1HEO A;  1LJK A;  5L9J A;  4WLT A;  5LA5 A;  2B70 A;  1LCN A;  1NDG C;  1LPI A;  5FEL A;  3LZ2 A;  2C8P A;  1LSM A;  1LMO A;  4PK0 A;  1CV1 A;  115L A;  1L79 A;  1L89 A;  1JKA A;  2B72 A;  2CGI A;  128L A;  167L A;  3FE0 A;  3A91 A;  1I20 A;  5APC A;  4C3W A;  2MEH A;  208L A;  1CKD A;  4H91 A;  1LZ8 A;  1G7I C;  2MEF A;  3IWR A;  1IWY A;  4TTD A;  257L A;  2B5Z A;  2BQE A;  244L A;  227L A;  2RBQ A;  5HQ1 A;  1GB0 A;  1UUZ C;  1C6T A;  172L A;  1DQJ C;  1P56 A;  1LHK A;  2RBR A;  1GB7 A;  1KY0 A;  4W56 A;  2IGC A;  1A4V A;  3NY8 A;  4DAJ A;  3CDQ A;  1DI5 A;  4W59 A;  2NTG A;  4BAD A;  3WMK A;  2OU8 A;  1HEN A;  209L A;  1SWZ A;  205L A;  2ZIK A;  1C08 C;  1B7Q A;  246L A;  3AZ4 A;  1KXY A;  4HV1 A;  3CSQ A;  1GFR A;  2ZYC A;  5EBH A;  4WOA A;  1WQO A;  4I7O A;  1JJ1 A;  1HER A;  1HSX A;  3C81 A;  1NDM C;  3T6U A;  4NGL A;  4DJH A;  131L A;  178L A;  3HT8 A;  1JSF A;  3QE8 A;  2RBS A;  1GFA A;  1L03 A;  1GF0 A;  1GB9 A;  1B5U A;  1G0Q A;  2CJL A;  1F6S A;  2Y8P A;  138L A;  1B0D A;  198L A;  1D3M A;  235L A;  1W6Z A;  1GE0 A;  4M4O A;  151L A;  1GFJ A;  3CQL A;  1B5V A;  1IWU A;  1XJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...