4ANRA

Crystal structure of soluble lytic transglycosylase sltb1 from pseudomonas aeruginosa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
300
structure length
297
Chain Sequence
b'PQVAEFVSEMTRDYGFAGEQLMGLFRDVNRKQSILDAISRPAERVKQWKEYRPIFISDARISRGVDFWNKHAEDLARAEKEYGVPAEIIVSIIGVETFFGRNTGSYRVMDALSTLGFDYPPRADFFRKELREFLLLAREQQVDPLSLTGSYAGAMGLPQFMPSSFRAYAVDFDGDGHINIWSDPTDAIGSVASYFKQHGWVTGEPVVSVAEINDESAESAVTRGVDPTMSLGELRARGWRTLRDDQKVTAMRFVGDKGIEYWVGLPNFYVITRYNRSAMYAMAVYQLAGEIARARGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE LYTIC TRANSGLYCOSYLASE B
publication title Calcium-Dependent Complex Formation between Pbp2 and Lytic Transglycosylase Sltb1 of Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 101
structure length 297
sequence length 300
ec nomenclature
pdb deposition date 2012-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 4anrA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4anrA02
1LZ1A 1YILA 4H9IA 4OWAA 4B4EA 2EIZC 4C3WA 7LYZA 1LYOA 4XADA 1HF4A 5LXWA 4CJ2A 5FSTA 2H9JA 5DN4A 1CJ7A 5L3HA 2I6ZA 3LZ2A 1YQVY 1LPIA 1EL1A 1EQ5A 6LYTA 1EQ4A 5T3FA 134LA 4H8XA 1LZ6A 4KT3A 1LSAA 1NDMC 2BQMA 4QDNA 2Z2FA 4AXTA 1KIRC 3M3UA 1UUZC 5HQ1A 4J1BA 1JITA 1REYA 1IR7A 5LA5A 3QE8A 3W6AA 1XGRC 4H9FA 4KL7A 5L9JA 3W6DA 133LA 2G4NA 4RDSA 4HTNA 5IDDA 5KKIA 2BQAA 2EPEA 1B7NA 5KXSA 3A67Y 1WQNA 3P68A 1F6SA 1IOSA 4NGWA 1E8LA 1LJ3A 1NHEA 4BS7A 4XJFA 1G7IC 1OUJA 4DD1A 1JISA 1FBIX 1HEOA 3LYZA 3A8ZA 2MEAA 4NWEA 3AB6A 1G7JC 1JJ3A 1GD6A 4NGVA 1NBZC 4XJHA 3CSQA 1D0MA 4XN6A 1DI5A 1QTKA 1REMA 1IP2A 2Z18A 5LYMA 2DQEY 4GLVA 1VATA 1VEDA 3CSZA 5IHGA 2G4PA 4LYZA 1J1XY 4G4BA 5EBHA 2AUBA 3WPKA 1HFZA 2F4AA 4WM2A 4ZIXA 2I25L 1IWWA 1CJ6A 3HBHA 1AT5A 2MEIA 1AM7A 4N5RA 3VWOA 1GBZA 1GPQC 5C6JA 1DPWA 3AZ7A 1YL1X 2WARA 1B7OA 1IWVA 2H9KA 1LSGA 3P64A 4NEBA 5KKJA 3KAMA 2DQDY 1CJ8A 1QDTA 2ZILA 1CKCA 1LCNA 4PJ2C 1OUDA 1WQQA 1CKHA 2BQLA 3P4ZA 1JTPL 1LMOA 4WO9A 1QUTA 4QY9A 4FJRA 1FKQA 1MELL 4CFPA 1GAZA 1ZMYL 2XJWA 1C43A 3P65A 4G9SA 1JKBA 1LZEA 1GB0A 1C46A 1B5ZA 208LA 4U3XB 3BKHA 3EBAB 2MEGA 3WL2A 4ZFPA 1G7HC 4DD9A 1ALCA 3RT5X 1IP1A 1A4VA 1KIPC 1B9OA 4NHIA 1NWGA 5FHWA 1UA6Y 2BQEA 3ZVQA 4OOOA 3FE0A 4R6CA 3WPJA 2CDSA 2HUBA 5KXYA 1GE1A 1LZAA 1UICA 1DI4A 1SQ2L 4OW1A 2LYMA 1IOTA 1GB8A 1HEPA 2F4GA 1LHKA 3A91A 5LVHA 1FLWA 2FYDA 1KXWA 3LYOA 1B7SA 4C5FA 4NSIA 1LHJA 1LMCA 5KXWA 1OUEA 2EKSC 2N5ZA 3TMWA 4WO6A 2YBNA 1LJIA 1HFYA 1GFEA 2BQIA 2HECA 1GF7A 4KXIA 1BB5A 1IY4A 1JHLA 1V7TA 5B06A 2BQKA 3ZEKA 4WG1A 1BB3A 2YDGA 1IORA 1YKXX 2C8OA 1LZ5A 2GV0A 1GB2A 1C7PA 1OUGA 1LKSA 1LZSA 3CSRA 5F16A 1GFKA 1GF6A 1PS5A 6LYZA 4LT0A 1IIZA 5I54A 1H87A 9LYZA 1T6VL 4J7VA 2ZYPA 1NBYC 1LJKA 1VDSA 3A3RX 4HPEA 4OWCA 1HENA 4NSHA 2H5ZA 4LT3A 4XJDA 1REXA 1ZVHL 3ATNA 3AZ4A 3HFMY 3TXFA 1HNLA 1LSCA 5FCPA 3B0IA 4J0LA 5J7CA 1LYSA 1JIYA 4D9ZA 4LGKA 1JKDA 4LYBA 4QEQA 153LA 1HEWA 1JSFA 4DWXA 2Z38A 1IP6A 1YAOA 2D4JA 1B5UA 3AGIA 3AZ6A 4NG1A 1CKDA 2LYOA 4H9BA 3N9EA 5F9UA 2BQGA 2I26L 1IC7Y 1MLCE 2DQGY 5F14A 2Q0MX 1D0LA 1IWZA 1QTEA 3RZ4A 2MEBA 1GFRA 2BQBA 1GXV2 4N8ZA 1LZ8A 3WU8A 1WVVA 4WM5A 5HLLA 2DQHY 1LSFA 1OP9B 4WG7A 4WM4A 1D6PA 1LMPA 5LVGA 5AMYA 3W6CA 4OWHA 1LJ4A 4E3UA 4LT2A 1JUGA 1IR9A 4PRQA 4WM6A 194LA 1LYYA 1B0DA 1H6MA 2ZWBA 4J1AA 3A90A 1QSWA 1TEWA 1YROA 3AGGG 5DM9A 5JENB 1ZVYB 4ETCA 1LZNA 4H9HA 1IWYA 3QY4A 2BQFA 1IR8A 4XJBA 5I4WA 135LA 1GE2A 1I1ZA 2BQJA 3FI7A 1WVUA 5C6LA 2FYCA 4ET9A 5KXMA 1HMLA 1LKRA 1XEKA 1YAQA 1D9UA 5KXRA 2ZIKA 1YAMA 5KXNA 4ML7A 4ETAA 1UIAA 5APDA 5E4PA 2ZQ4A 2FBBA 1J1OY 4H90A 4YEOA 4HSFA 4TX7A 1DKJA 2BQCA 4GN5C 1GAYA 1HMKA 4BAFA 1G7MC 3GXRA 5K7OA 2D4IA 1HC0A 3LZTA 1HEQA 1W08A 4YOPA 2HEBA 1LJGA 4WOAA 1VAUA 4YM8A 1NQIA 4CHXA 2Z19A 1I20A 2G4QA 3RW8A 3B72A 3CT0A 3TXJA 5DN5A 1J1PY 1LJHA 1VDTA 1REZA 2LZ2A 4PRUA 4WLXA 1LTMA 1N4FA 1GB7A 4BADA 5A3EA 2ZIJA 1BVKC 1D6QA 1LSDA 4GN4A 1WQMA 4CGEA 2ZYCA 4DDBA 5HNCA 4BAPA 4W96A 1YKZX 1HHLA 4Z46A 4NGOA 2DQCY 3D9AC 1UACY 4NHQA 4IATA 2XTHA 1B7MA 2Y8PA 2DBTA 5FEKA 3W6FA 4G4CA 4B0DA 2W1XA 1GE3A 1UIFA 4X3BA 3T6UA 2ZQ3A 4WLYA 2DQAA 1B7RA 4FDYA 2YBMA 1UIBA 1UIHA 1IY3A 1GE4A 193LA 1FN5A 3AJNA 4N0JA 3WUMA 5L3IA 1LMQA 1UBZA 5D5CA 5I4XA 1WQPA 2ZNXY 4WMGA 1IP5A 2MECA 3TXHA 1JJ0A 3M18B 3AW7A 5F81A 2B5ZA 4UWVA 4PPOA 1YANA 4RLNA 5LAGA 3A92A 1GDXA 2CGIA 2W1LA 4KPMA 1JPOA 1GB9A 1AKIA 4NGLA 4WLTA 3TMUA 4ETBA 2DKVA 5KJ9A 3GXKA 4TUNA 1GBXA 4B4JA 4WLDA 1GF9A 4WL6A 3TMVA 1F6RA 3A94A 4MR1A 1LMNA 1IOQA 1GBSA 1GDWA 1IC4Y 1B5XA 3A34A 4H91A 4NG8A 4DYGA 2HTXA 5D5FA 4DD2A 1C45A 1GFTA 4NHPA 4M4OA 3ZVQB 4CFOA 1LSNA 5DLAA 1LHLA 4ET8A 1C08C 1HFXA 4HV2A 4NSGA 1B7QA 2BLXA 4DC4A 2MEEA 2D91A 2MEDA 1LZ4A 4A7DA 4ETEA 1RJCB 2F30A 1OQMA 4DT3A 3WPLA 1LSPA 1SLYA 4H9AA 4GN3A 3TXKA 1GEVA 2XBSA 1WTMA 3AW6A 1JEFA 2ZNWY 4TWSA 2MEHA 2HU3A 4QGZA 3OK0A 1GFGA 3WMKA 4Z41A 1GBOA 4NFVA 1OUCA 1FDLY 3TXBA 1JKAA 1LZDA 4OWBA 1PZYA 1LHMA 4LYCA 1GBYA 1C10A 4MSTA 4ZEEA 1YAPA 4HTQA 5LVKA 4NGYA 4N1EI 1GFUA 3HBDA 4LYOA 5FDJA 1O23A 1UIDA 4NWHA 4H9CA 3K3TA 3WYHA 2D6BA 4GCEA 5B59A 5KXKA 1XGQC 5A3ZA 5LAFA 1OUAA 1DXJA 1FLUA 1LSZA 2LZTA 1AZFA 4GCBA 1D0KA 4LT1A 2D4KA 1HERA 1B5YA 5I4YA 1GF0A 1FLQA 1DI3A 1BHZA 2CJLA 3A6CY 4XJGA 2YBHA 3SP3A 3AGHA 5HNLA 1BQLY 1JTTL 2VB1A 1OUIA 1LJNA 1F10A 3CT5A 5HMJA 4N1CC 5II3A 2RSCA 4DDCA 3CT1A 2W1MA 4NGZA 4L41A 4NGIA 1GB5A 1QUSA 1LSBA 3TXIA 1F0WA 1VDQA 1XGPC 3LYMA 5HMVA 2Z12A 5APFA 4NHSA 2HEAA 5FELA 1LSMA 4AGAA 1QSAA 1GXXA 1YIKA 2Z37A 3A3QA 1B7PA 1OUBA 4YENA 5I5QA 3WU9A 5IELA 1LZTA 2YBLA 4XJIA 1LZBA 1ZV5L 1DPXA 2HEDA 4LZTA 2BQDA 4M6DA 5LVJA 1V7SA 1TAYA 5KXZA 3WXUA 4HV1A 5KXXA 5KXLA 4RW1A 1IO5A 1GFVA 1LZYA 3EXDA 1IOCA 4H8ZA 4PGJB 1B5VA 1BWHA 3BKVA 1KXXA 3A96A 1XGTC 3CB7A 3CQLA 1DQJC 4I0CA 4IASA 1CKFA 2YBJA 4B4IA 1LHIA 3WULA 1IP3A 4G49A 1IWTA 1LAAA 5KXTA 1IC5Y 3WXTA 2IHLA 1QIOA 4TSCA 4HJYA 1WQRA 3OJPA 2BAAA 4EOFA 1LSYA 2BPUA 1IX0A 1B7LA 3J4GA 3N9AA 4LYTA 4RLMA 4GLAA 1W6ZA 3TXGA 1XSFA 1XEIA 5LIOA 2MEFA 4HPIA 3W6EA 1A2YC 3W3EA 4DDAA 1FLYA 3IJVA 2A7DA 207LA 5M1YA 3AYQA 4H92A 1GFJA 1WTNA 1JJ1A 1LJFA 2F2NA 3WVXA 1INUA 1BB6A 154LA 5C6IA 1YKYX 2A7FA 2HEEA 1BGIA 1LZGA 1QQYA 132LA 2BQHA 1KXYA 2YBIA 3EMSA 1TCYA 1B2KA 2X0AA 3D3DA 1GB3A 5APCA 5KY1A 4UWNA 3ATOA 1LMTA 4DD0A 2HU1A 1JWRA 1HELA 4EMNA 1IP7A 1GFHA 1RFPA 3AZ5A 3WH1A 1HEMA 1LMAA 4O34A 1QDRA 1GWDA 2NWDX 3N9CA 5F9XA 2IFFY 1BB7A 4GCFA 3QNGA 3IJUA 3WUAA 5KXPA 1IP4A 1GF4A 5I53A 3WUNA 4NGJA 3P66A 3TXEA 4W94A 1IWXA 2PC2A 1XFPL 2BQNA 3MGWA 1UC0A 1GFAA 4GCDA 1I56A 5LVIA 1XEJA 5B05A 4NY5A 1RCMA 4NSJA 4OOTA 4WL7A 2YSSC 4B49A 5LYTA 4P2EA 1RE2A 1BWJA 4H93A 3WVYA 1UCOA 3E3DA 5B07A 1HSXA 3RNXA 3EO5A 3G3BB 4TTDA 3RU5A 4WM3A 1LSEA 4YF2A 3HBEX 2YVBA 1GEZA 1JKCA 1NDGC 2HEFA 4NIJA 4RW2A 1LJJA 4HP0A 2LYZA 4YEMA 3J6KA 2BLYA 4H1PA 4H8YA 4IJ4A 3TMXA 1P2CC 1IWUA 2XBRA 4Z3MA 1JTOL 1LZRA 1GF8A 5LA8A 4LFPA 3G3AB 1BVXA 1KIQC 1VFBC 1T3PA 2DQJY 3A93A 4XENA 5LYZA 3TXDA 1CJ9A 3LYTA 1GBWA 3B6LA 4I8SA 3T36A 3WU7A 3A95A 1GF5A 1DZBX 1FKVA 5APEA 1LJEA 3W6BA 3WW5A 5KXOA 1NKHA 2DQIY 2Z2EA 3IWRA 4N9RA 3ULRA 4HTKA 4DD7A 4II8A 5ILCA 4LFXA 4H9EA 1CNSA 1B5WA 1LZCA 4NGKA 4B1AA 4HJZA 1IEEA 1Z55A 4HJVA 1JSEA 4TSBA 3LN2A 4XYYA 3A6BY 2BQOA 4OWEA 2LHMA 4WM1A 5B1FA 1RI8B 1XGUC 1NMMA 2FBDA 1GB6A 4R0FA 1UIGA 2Z39A 5DL9A 2EQLA 2CWIA 3WW6A 4ETDA 1GE0A 5B1GA 4ANRA 1OUHA 1TBYA 1WQOA 4H94A 5LINA 1DKKA 1OUFA 3F6ZA 2DQFC 4MCKA 4NHTA 4GCCA 1BB4A 4G4HA 4UWUA 1VDPA 2W1YA 1LHHA 1NF5A 1IVMA 1YL0X 1HSWA 1LOZA 2C8PA 5ILFA 1LZ9A 1LYZA 1EQEA 1UIEA 3B0OA 3LHMA 1TDYA 4Z98A 8LYZA 4LYMA 4DD3A 1GF3A 1CKGA 1G7LC 3B0KA 1GHLA 5E9RA 4PHIA 1AT6A 1BWIA
chains in the Genus database with same CATH superfamily
4OWAA 4B4EA 1WTHA 1LYOA 2KNZA 1HF4A 1KW5A 228LA 5LXWA 3ZCBB 2H9JA 1CJ7A 1L47A 5FTJA 4GH9A 2QARC 1EQ4A 2LCBA 134LA 4DV1M 1LZ6A 4DQ7A 4QDNA 3C81A 1CV3A 2ANXA 205LA 1CX6A 1L90A 4X64M 5LA5A 1FJGM 1SXJE 1XGRC 218LA 4JI7M 2RGOA 1K28A 4JI8M 4BB9A 3GPXA 1L20A 1QZMA 1LJ3A 3GLFA 1QUDA 4IAPA 1GKIA 1NHEA 4BS7A 1L8QA 1G7IC 1L60A 4OU7A 3DN3A 3LYZA 3A8ZA 3HTDA 4DD2A 3AB6A 1G7JC 1WXQA 4XJHA 1QTKA 1PQMA 1QAQA 1L50A 4AQNA 1XNRM 3CSZA 3AL0C 2HL7A 1C64A 5IHGA 1OWZA 249LA 4A3VB 1J1XY 1LW9A 4G4BA 3GUIA 4ZIXA 4M0WA 1L56A 4AG6A 5C1BA 3VWOA 3F92A 1AM7A 1DPWA 3VW7A 2H9KA 1OIZA 2KZSA 3KAMA 3KS8A 1G0MA 2GNOA 3U60B 1L92A 1LCNA 2KRUA 3P4ZA 1OFHA 4R3DA 1LMOA 4DUZM 4WO9A 1FKQA 3GP1A 2DWNA 5EXXA 4DQ5A 4G9SA 1CU5A 201LA 3CDTA 3HUAA 4NSRA 208LA 2R4EA 1I94M 1A4VA 1Z5CA 4P16A 3A98B 2JUJA 2NTHA 1GJTA 2O25A 2HKJA 4DV7M 4LG2A 1TH2A 1GE1A 2VDBB 1C65A 252LA 4OW1A 2LYMA 1HEPA 3A91A 1IN4A 1G59A 2F32A 1B7SA 2UXBM 4IBKA 113LA 2N5ZA 3TMWA 1P46A 2IGCA 2CUUA 1GFEA 4G4OA 4I81A 2BQIA 4KXIA 1JHLA 1IY4A 3ZEKA 1V7TA 3SAUA 5BR8M 2YDGA 1G0JA 3HTGA 1ZWNA 3HY5A 1OVKA 1S3SA 3CF2A 3U6SA 1GF6A 3SYKA 3U6QA 4JI5M 3U6CA 1E32A 1IIZA 3J80S 4JI4M 4IIWA 4HPEA 4OWCA 3TXFA 1REXA 3AZ4A 1I4WA 1C60A 1L33A 2HUMA 3HH6A 3E4RA 1LSCA 4J0LA 232LA 3EMLA 1EFUB 1LV7A 153LA 4NXMM 3LZMA 4DWXA 2Z38A 1IP6A 3C8RA 4DD7A 2DAMA 4H9BA 2WZJA 1IC7Y 5KQ8A 3SBJA 182LA 3RZ4A 2MEBA 2G5GX 1GFRA 2BQBA 1QT5A 1WVVA 4WM5A 2CP8A 1Z5BA 1LSFA 4WG7A 4WM4A 1JUGA 3L2XA 4PK0A 3NYAA 1T3TA 1P7SA 4GRVA 1B0DA 2ZWBA 4J1AA 157LA 3B7QA 5DM9A 1LZNA 4H9HA 1IR8A 1I1ZA 1WVUA 4CIZA 4LF5M 5C6LA 3G3WA 147LA 5KXRA 1XEKA 4GKKM 4HEOA 2L2DA 4NOOB 4ML7A 2ZAMA 1AIPC 3SATA 1ZMVA 3IECA 2WSCF 5K7OA 130LA 221LA 2D4IA 3LVWA 4ARPA 1DYGA 1MN3A 2HEBA 1QAOA 1LJGA 4WOAA 109LA 2Z19A 5A2QS 8CATA 4PRUA 1LTMA 4GN4A 1D6QA 1LSDA 2OE4X 4CGEA 4W96A 4Z46A 5EXPA 2JXNA 3C3DA 4NGOA 3GLHE 3D9AC 4P17A 3W6FA 3HZJA 4G4CA 4B0DA 5DFLA 2W1XA 1UIFA 4X3BA 5LZMA 2EKKA 2DQAA 3U60A 2EA0A 4FDYA 1UIHA 1GE4A 193LA 2G3QA 3AJNA 5L3IA 3GLGB 5D5CA 2R62A 2ZNXY 4WMGA 2BWEA 2MGWA 2VF8A 2K9DA 4WW0A 4NXNM 1YANA 2QB0B 4RLNA 4KPMA 3HTBA 2DAEA 1GB9A 4DJHA 1GVNA 3TMUA 2DKVA 3J27B 3GO8A 1JQJC 2QCUA 3A94A 1LMNA 4NG8A 2B72A 2KW0A 1L2BA 4NC6A 108LA 4CFOA 1DYCA 1LSNA 3FRHA 1QVRA 1C08C 1QTBA 2B74A 4Y28F 1L2CA 2D91A 1NSFA 1P6YA 237LA 1RJCB 2F30A 1OKSA 1N34M 4H9AA 3TXKA 2XBSA 1WTMA 1QTHA 2BJVA 3WMKA 1L31A 3CTWB 4W52A 1IQPA 4DKLA 5BPVA 3GULA 1YAPA 2JNHA 1CV6A 2QBYB 1LYGA 242LA 4H9CA 4LRTA 1N75A 1YLAA 3VLFB 4IBFA 2QP9X 1C68A 4EKRA 1LSZA 4GCBA 2D4KA 4M9XA 4CGYB 1KY1A 1R7RA 2CJLA 4XJGA 4IBIA 2RGHA 3L25A 1L30A 199LA 2YBHA 1BQLY 1WGNA 2MJ5B 4MH0E 2W1MA 4NGIA 1G71A 1QUSA 2QENA 1XGPC 5APFA 4NHSA 4S12A 1LWGA 2HEAA 5FTNA 4AGAA 4MGHA 1JR3A 3WU9A 5IELA 3HU9A 1QT8A 1L12A 4LZTA 2APLA 2BQDA 5LVJA 1H6UA 2KDLA 1L29A 1V7SA 3SN6R 1L58A 1IOCA 3CB7A 1TLAA 4I0CA 4IASA 4B4IA 1TTEA 5EP3A 1QANA 3GLIA 1LHIA 248LA 3VK8A 190LA 1T6HA 4AI6A 1IFYA 1L1ZA 1IC5Y 3WXTA 4TSCA 4DV3M 2WSFF 3AJIB 1LSYA 1G0QA 1LYIA 3N9AA 3ZQJA 4GLAA 1XEIA 1VQ1A 149LA 4D81A 1L52A 251LA 230LA 4H92A 4LDEA 1INUA 154LA 5C6IA 2A7FA 4B7FA 1B2KA 2KNVA 1Z6TA 4JV5M 1Z5AA 3HX3A 3C7WA 3U6EA 2OO9A 2R4JA 2YFQA 3B7ZA 1F4IA 4MB7A 2XGNA 1IP7A 1UFZA 2EUCA 3GUJA 1GFHA 3GRYA 3AZ5A 3FKEA 1HEMA 2IFFY 1BB7A 223LA 3WUNA 1L59A 5I53A 1QQWA 2Z4RA 1IXZA 4B3MM 155LA 4OVZA 1P37A 1HQYE 4NY5A 4OOTA 4P2EA 1RE2A 4ARMB 1UCOA 4G3OA 137LA 2YVBA 1V34A 3L2AA 225LA 1IM2A 3Q8GA 4RW2A 3B7NA 250LA 4YEMA 2DHYA 2BLYA 2L7IA 234LA 2Q9DA 1GF8A 3G3AB 1KIQC 1CJ9A 1LYJA 3LYTA 1IXSB 5FTKA 2A5YB 1GF5A 1FKVA 1XXHA 5KXOA 1NKHA 2Z2EA 3IWRA 4N9RA 2LVAA 1N78A 4H9EA 1L09A 2L6OA 4L15A 1PQKA 4NGKA 1DGFA 4TUWA 4HJVA 3LN2A 3GLFE 3FUUA 4K0KM 114LA 4WM1A 2CV1A 1QS5A 2RBQA 1HJPA 2JY5A 3FUXA 1GE0A 4I7JA 1N33M 3HU3A 3PXGA 1NHGC 1OUFA 2B75A 4G4HA 2ZANA 4LDLA 1DGHB 5L8RF 3T38A 1YL0X 1HSWA 2C8PA 1DYEA 1LZ9A 3KSXA 4Z98A 2XQOA 1TDYA 4YXCA 2LVOC 1ZQ9A 177LA 168LA 1IN8A 1G7LC 3W0LB 2CE7A 2VQFM 7LYZA 1L25A 1CU2A 1YQVY 4EPFA 2LHCA 1L54A 2XEPA 1NDMC 3DN2A 1KIRC 1L35A 1JITA 1L65A 1CUQA 1IR7A 1L86A 1NV8A 5L9JA 4KL7A 1ZURA 2XLJA 3ZH9B 4JI2M 4HTNA 4RDSA 5IDDA 4ITQA 4LDOA 2EPEA 1B7NA 2FS1A 3P68A 103LA 1IOSA 1E8LA 3UMMA 3WHLA 4XJFA 1OUJA 4W56A 2UU9M 1JISA 1C6AA 3KXEC 5FTLA 2CV0A 4NGVA 2F5QA 2C9CA 3J7AS 3HJQA 4Z6YA 1IP2A 110LA 4EKSA 5LYMA 2KEBA 1L82A 2RKOA 4DR4M 2F5PA 2DQEY 1VEDA 1ZAEA 2UUBM 1IY2A 2G4PA 3FI5A 1L40A 1QTCA 1G8PA 4DBGB 1SSYA 1T43A 198LA 4FWDA 2AUBA 3WPKA 2F4AA 2I25L 1C6KA 1AT5A 4N5RA 1GBZA 2YQZA 3AZ7A 3T6PA 3LCUA 1B7OA 3P64A 1LSGA 4NEBA 1CJ8A 2RRUA 1P5CA 3KP1E 1CKCA 4M9ZA 3HHZA 1L18A 1OUDA 1TDHA 1WQQA 1CKHA 2W82A 1QUTA 3VK7A 3HHYA 4PDGA 2JP7A 1JKBA 2JZ0A 1GB0A 1L15A 1ALCA 3OE9A 2FOIC 5FHWA 1P2LA 4B08A 4AKGA 3FE0A 3WPJA 2J7OA 5KXYA 2Z4SA 1MJGM 4DV6M 1UICA 1DI4A 1L04A 1OV5A 1SQ2L 2ANVA 4NRVA 2XSZA 138LA 1IOTA 5FTMA 5KPRA 1FLWA 5LVHA 1KXWA 2DZOB 5KXWA 2YNMD 1OUEA 2RBNA 1HFYA 2LBCA 2HECA 1NY6A 3VKGA 1BB5A 2Y0TA 1IXSA 1J7KA 1R5LA 1L75A 2BQKA 2QZ4A 1BB3A 3DNAA 1PJJA 260LA 2KXEA 126LA 2VQEM 2DNAA 262LA 1GB2A 1LZSA 2G8LA 1GFKA 1L57A 5I54A 1H87A 2CHGA 4J7VA 2ZYPA 1LJKA 4PCZA 5GKNA 1L63A 2H5ZA 1NVMA 1ZMUA 1ZVHL 3HFMY 3HU8A 4LT3A 4XJDA 1HNLA 4EKQA 5FCPA 3NBIA 2O01F 1LYEA 3UZUA 1L01A 4LYBA 1HEWA 1N32M 1CU0A 3AZ6A 2D4JA 2LZMA 1LLHA 4NG1A 1CKDA 4I7QA 4LF9M 1C6FA 3N9EA 3R8FA 2BQGA 2I26L 1L43A 1MLCE 1NNUC 1QTEA 2LNHC 4N8ZA 2D7HA 1OP9B 200LA 1D6PA 1LMPA 5JI2E 192LA 5AMYA 4OWHA 1LJ4A 189LA 3KOWE 1TH4A 1L07A 194LA 1IBMM 1BVSA 1W5TA 1TEWA 4GITA 5JENB 1KY0A 4E97A 2BQFA 5FLXS 1SXJC 196LA 2BQJA 2XF3A 3K9OA 3SYLA 4W55A 1L21A 5KXMA 1HMLA 1SXJD 1D9UA 1TGUA 2ZIKA 4ETAA 1UIAA 4HSFA 1DKJA 4GN5C 2FFJA 1GAYA 4BAFA 4JYAM 2Y0QA 3KS4A 4AKHA 3U6OA 4YOPA 1L42A 3DKEX 1ZYTA 146LA 1I20A 5DN5A 1J1PY 1LJHA 4W53A 3BXWA 1BVKC 3E9SA 3HUKA 2DAGA 2M5ZA 127LA 3AOEC 4DDBA 5HNCA 222LA 2JA2A 1DYBA 1UACY 2DQCY 212LA 2XTHA 2Y8PA 4LFAM 2H1RA 115LA 1GE3A 1L66A 5C18A 1C69A 2KZUA 2YBMA 2DKLA 5IREB 1TH3A 161LA 1HQCA 1CUKA 2GQFA 1IP5A 2MECA 4DV2M 256LA 3AW7A 3M18B 2CUZA 5F81A 3V2WA 1L17A 1DYAA 1L27A 2B5ZA 4PPOA 5LAGA 2DWMA 3A92A 4IBCA 158LA 1JPOA 4WLTA 4KT0F 4DQJA 4AW4A 4BBAA 1G4AE 1L00A 4WLDA 3FA0A 1W5SA 186LA 1SXJB 3SMPA 1F6RA 3HH3A 1IOQA 5D5FA 1C45A 4JI1M 4NHPA 2MROB 4M4OA 2B73A 3ZVQB 5DLAA 139LA 1LHLA 3GPYA 4IBDA 1L44A 1HFXA 4ET8A 4DC4A 2MEEA 4A7DA 2C96A 2UUAM 1LI2A 3B74A 1OQMA 3DN1A 1JR3E 1GEVA 2ZNWY 2MEHA 2KA6B 3KOZE 2HU3A 4M0DA 4QGZA 3T1YM 3OK0A 1GFGA 1L02A 2B6XA 4FCWA 1FDLY 4L16A 4QHSA 4LJ4A 3TXBA 1NO1A 1JKAA 3GLIE 1PZYA 3HWSA 4MSTA 151LA 4HTQA 2OOAA 4NGYA 1GFUA 2V1UA 5FDJA 3SB6A 1LGXA 3WYHA 2D6BA 5B59A 5KXKA 1L46A 5ITXA 2DENA 5LAFA 1OVJA 3FRIA 1FLUA 4GBRB 3JR4A 4LF8M 2LZTA 1D0KA 1KSFX 3HHWA 1HERA 2XFSA 1PRBA 5ITQA 3FTCA 3TQSA 3AGHA 3SP3A 1C6DA 1JTTL 1OUIA 1F10A 5HMJA 4N1CC 3TPZA 2HUKA 5II3A 1C6TA 4DDCA 156LA 1LSBA 1VDQA 3U6PA 5HMVA 2Z12A 5DYGA 1L11A 1VEKA 3B89A 4JI0M 1QT4A 4G4NA 2LTUA 2M60A 1R6BX 1HNZM 4L6V6 227LA 3IG5A 1IN6A 1HT2E 1OUBA 1L91A 1LZTA 4XJIA 2HEDA 4FWHA 1C6LA 4M6DA 1OFIA 4HV1A 5KXXA 2RB2X 3FUVA 1GFVA 2H5XA 1VEGA 5LMUM 1CKFA 2YBJA 3R9XB 4G49A 5KO3A 5EXTA 1NNJA 1L39A 1WQRA 1EE8A 2BPUA 1WIVA 2YR0A 3HTFA 1QTDA 4RLMA 1XSFA 4ZPXA 3L64A 4L4UA 1L89A 1A2YC 1L05A 1R2ZA 1K3XA 1FLYA 140LA 207LA 3AYQA 3EIHA 123LA 1IY1A 4UN2B 1JJ1A 2L4FA 1QSQA 1OQYA 4MGZE 1XXHE 3M0EA 2YBIA 3CF0A 2JWSA 4IJEA 4LJ5A 132LA 4KODA 1KXYA 1TCYA 3RUNA 2X0AA 2Z3XA 5KY1A 3KP0E 4LF6M 1R4GA 1LMTA 4LZJA 2HU1A 2FE8A 1JWRA 4PDIA 2R18A 4ARQB 2O7AA 3SASA 1LMAA 4O34A 1GWDA 2NWDX 2R45A 3VDPA 4GCFA 3QNGA 3FUWA 3IJUA 5KXPA 3P66A 3KW6A 2PC2A 2BQNA 1UC0A 1GFAA 4GCDA 3SMSA 1XEJA 4NSJA 1L85A 3FUTA 3HDFA 1BWJA 4H93A 1L87A 3UONA 4LGMA 4JI6M 2DI0A 1QUGA 259LA 4YF2A 3HBEX 2Z7JA 1JKCA 3CDVA 3CDRA 5LMNM 3J6KA 4IJ4A 150LA 2JY8A 1KS3A 4DV4M 5LA8A 1YSYA 4GC9A 3H4MA 215LA 4GC5A 1T3PA 2DQJY 3A93A 3DZDA 3DMVA 4XENA 3TXDA 1GBWA 2OE9X 173LA 3A95A 4LJ8A 165LA 3RZEA 3ULRA 4II8A 3SARA 1B5WA 1LZCA 4QOSA 1IBLM 2HULA 4B3TM 1L36A 4OWEA 3GLHB 3Q8XA 3AOEA 3MMPA 1RI8B 4I7PA 1XGUC 2R0IA 3GUKA 2LH0A 1GB6A 1UIGA 3UJNA 4ETDA 1LI6A 5B1GA 4ANRA 1OUHA 3HU1A 3F8VA 2DQFC 3A45A 4MCKA 3AV0A 2F2QA 1LHHA 1IVMA 4I7LA 1R2YA 4I7RA 1JTNA 1Q39A 183LA 5ILFA 3J7BA 1UM8A 1LYZA 1UIEA 8LYZA 3UK6A 2LVQD 3L26A 4LYMA 216LA 4YHHM 3B0KA 1G06A 2LWXA 3MHVC 5E9RA 2NQ8C 3QYEA 4PHIA 128LA 1BWIA 1LZ1A 4H9IA 1HNWM 2BNKA 3K2LA 3HU2A 1QT7A 5FSTA 5L3HA 3RE8A 2EO2A 1CV1A 3LZ2A 6LYTA 5T3FA 1QYRA 3U5ZB 4PJZA 1LSAA 2UUCM 2UXDM 4AXTA 2B6WA 3M3UA 5HQ1A 1L49A 4J1BA 2DHRA 3HT8A 1C6HA 2VF7A 3QE8A 4L8RC 3W6DA 2G4NA 1QUOA 4WURA 3K9PA 1E94E 3A67Y 1WQNA 3PBLA 3LMMA 4LF7M 188LA 1FBIX 4DR7M 2MEAA 1XMOM 3OE8A 4NWEA 3DA1A 4XN6A 3C8SA 2LHGA 1DI5A 3HT9A 3CDQA 2DVWB 3ZC7B 254LA 4W5WA 1VATA 4LYZA 2XFTA 2DZNB 1L28A 4B7HA 1QTZA 2CFOA 5EBHA 3C9PA 4WM2A 1P2RA 3HBHA 1IWWA 1HR0M 1XWIA 2K47A 3ODUA 2CRUA 246LA 3QYBA 2DQDY 1QDTA 1L77A 2ZILA 1L79A 3GLGA 4PJ2C 4LGYA 184LA 1G0PA 4ARQA 3JR6A 3CF6E 1L67A 4QY9A 3DN8A 4DUYM 4FJRA 4II7A 1GAZA 1ZMYL 2XJWA 3P65A 1LYFA 3KSJA 1IY0A 2OOBA 1LZEA 1OTRA 1C46A 257LA 4U3XB 3C83A 3BKHA 4ZFPA 2MEGA 1G7HC 2OE7X 3RT5X 1L08A 1KIPC 1B9OA 1L10A 1C6BA 3U6LA 229LA 1NWGA 4NHIA 2BQEA 1CV4A 5IT9S 1G0LA 2HUBA 2B3TA 2L09A 3LQQA 1VEJA 2F4GA 3RGSA 1JB0F 2FYDA 1YUBA 3LYOA 4QHTA 4EPIA 4C5FA 4NSIA 3FYCA 1LHJA 1LMCA 2EKSC 166LA 4WO6A 1D2NA 2YBNA 1L70A 1GF7A 3D4SA 1D3JA 4X66M 2AHMA 4X65M 104LA 3HT6A 1GABA 3G3XA 1LZ5A 4R7GA 3KVWA 1T97A 1CX7A 2UXCM 1PJIA 244LA 5EJCA 5I14A 1OUGA 2QBYA 6LYZA 3DMZA 1XEPA 3DN6A 9LYZA 4MGIE 1T6VL 3GLHA 1NBYC 1VDSA 3A3RX 5KXZA 5KPZA 3LW5F 3QWLA 1KW7A 4DR2M 3C3EA 1QS9A 2HAKA 3SBAA 5J7CA 2L78A 3SAVA 1JIYA 4LGKA 2CHQA 1JKDA 4QEQA 3J81S 3HJSA 3UGJA 1L16A 1YAOA 2CHVA 1B5UA 4IBEA 2KHHA 5F14A 1IWZA 1J09A 2R6FA 2OTYX 1L14A 4DR5M 1LZ8A 3TE6A 5LVGA 243LA 4LT2A 1G41A 1L37A 5DYIA 4G6ZA 143LA 1GLNA 4WM6A 2CEAA 1H6MA 4I7OA 3A90A 4I7MA 3AGGG 4ETCA 5IZ7D 1IWYA 1L32A 3QY4A 4XJBA 1L84A 4NRWA 135LA 5I4WA 3DMXA 1OJLA 5EQTA 3L29A 3I01M 1SSWA 1C1KA 1SX2A 2FYCA 1LKRA 3C8QA 1YAQA 4LZZA 1E9RA 1ZMWA 2I7NA 5H37D 5KXNA 3SB7A 5APDA 5E4PA 2P5TA 2ZQ4A 1J1OY 4H90A 3ILKA 4TX7A 1L69A 2D7GA 1C6EA 4F2LA 4DV5M 4IBBA 3GLFB 1HC0A 4JXJA 2XZFA 1VAUA 4YM8A 1NQIA 2G4QA 3RW8A 3TXJA 2XZUA 2LZ2A 3GUNA 1LYHA 5A3EA 1N4FA 1D9WA 3SFZA 2HWJA 3LCVB 1WQMA 2ZYCA 185LA 2OU0X 4BAPA 4W54A 3A42A 4ZPUA 1HHLA 1D3FA 4NHQA 112LA 1WHCA 1L51A 5FEKA 2ZQ3A 4WLYA 164LA 4GHLA 3HH4A 3QAUA 1C67A 1UIBA 1IY3A 4N0JA 1FN5A 1FNNA 5ITXE 3G3VA 3FTDA 1L68A 1L94A 1I6SA 1C62A 1HNXM 1GDXA 2CGIA 1AKIA 4ARMA 4ETBA 4AKIA 3GXKA 4TUNA 1GBXA 1OYUA 4B4JA 4MM3B 1GF9A 2L4EA 4WL6A 2ZAOA 4MR1A 1GBSA 1GDWA 3A34A 4W51A 1CV5A 2DWZB 1LGUA 1IN5A 1JQUA 3RFWA 5F3WA 2QHOB 1B7QA 2MH8A 2BLXA 2RBRA 3RGPA 3U6MA 1NY5A 4B3SM 2ERCA 3THGA 3TL4X 4F1IA 3WPLA 1LSPA 4GN3A 4TWSA 231LA 4NFVA 3J2PB 1OUCA 2ZM6M 4OWBA 4RF1A 1LHMA 4LYCA 4FD2A 2BWBA 7LZMA 4CISA 4N1EI 3HBDA 4LYOA 2QPAA 1O23A 1UIDA 4NWHA 5IWAM 4I7SA 3K3TA 1DGHA 2RB0X 1L61A 1OUAA 4LJ6A 4YY3M 2LC9A 1DXJA 120LA 2HCBA 4LT1A 1GL7A 1L81A 4EKPA 3VKHA 1L83A 1EIJA 1BHZA 2BJWA 3A6CY 3HJ8A 3BBZA 174LA 2VB1A 3CT5A 2C98A 2V6ZM 1GB5A 3TXIA 1K3WA 1G0KA 3LYMA 4EXMA 1CV0A 2OPFA 3W68A 152LA 3GQ3A 1LSMA 1QSAA 4RNAA 148LE 2O79A 1B7PA 5I5QA 2YBLA 1ZV5L 3HDEA 261LA 4LRSA 4FVMA 3U6DA 2HHHM 1LPYA 4RW1A 1IO5A 4LF4M 1LZYA 4H8ZA 4DD9A 1B5VA 1BWHA 1C6JA 3A96A 3FD9A 2DWLA 3CGWA 3SHGB 2RH1A 3WULA 175LA 5KXTA 1L55A 1L06A 1QIOA 4HJYA 4W57A 3OJPA 2BAAA 1B7LA 4LYTA 3TWKA 1W6ZA 2Z8YM 4DV0M 2OU9A 3W3EA 4DDAA 4R71A 169LA 4CHTB 5M1YA 1P3QQ 2D7EA 1WTNA 1LJFA 4X62M 3C80A 4QNMA 1L95A 4I8OA 2HEEA 1BGIA 1LZGA 2BQHA 1G0GA 1PJSA 3D3DA 3T15A 3C58A 1GB3A 5APCA 3GPPA 2OTZX 4UWNA 3ATOA 5EP4A 238LA 4JI3M 4KO8A 4DD0A 1L19A 197LA 4I5SA 2FNAA 1RFPA 2EJSA 210LA 1N36M 2DAIA 1QDRA 1L23A 5F9XA 2ZTDA 4YXAC 4NGJA 3TXEA 4W94A 1IWXA 206LA 1XFPL 1I56A 2C9OA 3M6AA 4I4LA 2J5YA 4WL7A 1RU3A 247LA 3NY9A 5EP1A 3WVYA 3E3DA 1C6PA 5B07A 3D8LA 1GL6A 1HSXA 3RNXA 122LA 3G3BB 4TTDA 3B9PA 1QT6A 1WGLA 1G07A 1NDGC 1G1VA 4NIJA 3CDOA 1DO2A 4H1PA 4H8YA 163LA 1P2CC 4LZMA 5E26A 1QSBA 1JTOL 2XBRA 1LZRA 2B7XA 1VFBC 4BADA 4DT3A 4M9SA 241LA 3B6LA 4I8SA 3C7ZA 1QUHA 3I51A 1DZBX 213LA 5APEA 1JR3D 3TWLA 2ZBKB 1L71A 4QNRA 4LFXA 3IG8A 4FWGA 3K8ZA 1CNSA 2LVPC 1XNQM 240LA 1Z55A 1JSEA 4XYYA 4LY6A 3A6BY 2BQOA 3HH5A 2LHMA 4S0WA 1NMMA 3U61B 3LQRA 4R0FA 2Z39A 5DL9A 2EQLA 3WW6A 1TF0B 2R46A 1TBYA 1WQOA 2OEAX 5LINA 2A4TA 1NV9A 4GCCA 1BB4A 4UWUA 3BOSA 1VDPA 4LFCM 2RB1X 2W1YA 1Z59A 5ITYA 4EJ4A 1EQEA 214LA 4DD3A 160LA 1CKGA 1GHLA 159LA 5ITRA 1YILA 4C3WA 2OQ4A 2EIZC 4XADA 3GLGE 1C63A 4CJ2A 5DN4A 2I6ZA 2WSEF 3I04M 217LA 4ARLA 4W58A 1LPIA 1OWYA 1EL1A 1EQ5A 172LA 2B6TA 4H8XA 3GUOA 4LJ9A 4KT3A 220LA 2BQMA 1L26A 2Z2FA 3KDSE 4LJAA 1UUZC 1REYA 2X8AA 1TDZA 3W6AA 1KNIA 4H9FA 4B3RM 1C6NA 2Z6BA 133LA 3NWLA 2RBSA 3FTEA 3V76A 5KKIA 5DNYA 2BQAA 1NHWC 3IHPA 5KXSA 125LA 4NGWA 1F6SA 4IBGA 2DZLA 3GLIB 4ARJA 4DD1A 1HEOA 4I7KA 2JY7A 1GJSA 1GD6A 1JJ3A 1NBZC 1LWKA 1D0MA 181LA 1CVKA 1REMA 3CSQA 3OE0A 2Z18A 5ITTA 4GLVA 1SWYA 3W67A 245LA 1DGGA 4DR3M 4GIPA 1JTMA 3EIEA 1HFZA 1G3IA 3FE3A 4GEWA 1CJ6A 6LZMA 4HL4A 2MEIA 1GPQC 5C6JA 1YL1X 2Q9EA 2WARA 3V2YA 1IWVA 5KKJA 1XHBA 2Y21A 4Z8XA 3GRVA 1PQJA 258LA 2BQLA 1JTPL 1DO0A 3E46A 1YE9A 1MELL 4CFPA 1C7YA 1C43A 1L73A 4I7TA 2X4AA 1B5ZA 3EBAB 1T8AA 3WL2A 1SXJA 3HT7A 1IP1A 2R44A 4OVZB 1UA6Y 3ZVQA 4OOOA 4R6CA 2CDSA 3AOGA 1LZAA 1L53A 1TR8A 3PDSA 1K82A 5E6JA 2I7PA 2XH9A 4BLCA 1L62A 1GB8A 1L97A 1L88A 235LA 1LHKA 3K92A 3GQ5A 1E9SA 4FCVA 2J7NA 1Q02A 5KQDA 3GRUA 2QSFX 1DYFA 3F9LA 4RF0A 1LJIA 2N35A 1LI3A 1XB2B 5B06A 4EIWA 3NY8A 2NTGA 2Q2EB 4WG1A 1PJQA 170LA 1C6CA 1IORA 1YKXX 2C8OA 3MJ5A 2GV0A 1XXHB 4AZFA 1C7PA 4GRIA 1LKSA 3CSRA 3DN0A 5F16A 1L74A 4YX7C 1PS5A 4LT0A 1EPYA 1VG5A 2B6YA 3QAKA 4D82A 1HENA 4NSHA 2DAKA 3ATNA 2RAZX 3B0IA 1HT1E 3U61A 129LA 3GRRA 1T8FA 1LYSA 2K0BX 1Q3BA 4D9ZA 1SX7A 3GPUA 4GKJM 178LA 1JSFA 3AGIA 5F9UA 2LVNC 2LYOA 2KNAA 1L80A 3AKZA 2F4VM 2DQGY 2Q0MX 1D0LA 4PT5A 1L2DA 1GXV2 3WU8A 5HLLA 2EKFA 1LYDA 4Q7JA 2DQHY 1WJ7A 3W6CA 211LA 167LA 1GO5A 3WHKA 4FCTA 3L28A 1IR9A 1L34A 2QQ8A 1DV0A 1G1WA 3DOAA 4PRQA 1LYYA 2CWBA 1QSWA 1YROA 4OO9A 1ZVYB 1C6GA 1L41A 1A5TA 2DXIA 1GE2A 3FI7A 2LXEA 1L48A 1Y8GA 3HWLA 3VFDA 1CUPA 1L64A 4D80A 3SB5A 1QTVA 4ET9A 2F5OA 1YAMA 224LA 2FBBA 1Q3CA 4KLNA 4YEOA 1OAIA 1PQIA 3C7YA 2BQCA 2C99A 1HMKA 1L24A 1NHBA 1G7MC 3GXRA 5JI3E 4LJ7A 4MGYE 1L72A 226LA 3LZTA 1HEQA 1W08A 2XSZD 1VDLA 1D3NA 3L27A 2JY6B 4CHXA 3SB8A 3B72A 1VDDA 3CT0A 3FTFA 4PD2A 1X37A 2VIIA 1REZA 1SWZA 1VDTA 1P3NA 4WLXA 1PQOA 2F5SA 1GB7A 1L98A 3SBBC 1SG9A 2ZIJA 1C6QA 3JR5A 1MU5A 4GMQA 1YKZX 4B7GA 4KHPM 3SC3A 1DGBA 4IATA 1B7MA 3HUQA 2DBTA 4DR1M 1L38A 2OU8A 3KOYE 3T6UA 4WP2A 5ITUA 141LA 1XJUA 3HHXA 1B7RA 3PVSA 236LA 253LA 3WUMA 1LMQA 1UBZA 2Y20A 5I4XA 239LA 4NSOB 1NJFA 1WQPA 255LA 3TXHA 1JJ0A 195LA 1C6MA 4UWVA 3GUPA 1IBKM 2W1LA 4NGLA 1LGWA 5KJ9A 118LA 3TMVA 1IC4Y 4H91A 2R65A 1B5XA 4DYGA 1L03A 2HTXA 4G4QA 1GFTA 3DFZA 4HV2A 4NSGA 4XK8F 2MEDA 1LZ4A 2B70A 4HLQA 4ETEA 3SHFA 1DYDA 1XJTA 3SB9A 1SLYA 1MX0A 3W0FA 119LA 3AW6A 1JEFA 4FW9A 4Z41A 1PGYA 1GBOA 5EXSA 1LZDA 1N77A 1C10A 1GBYA 4I7NA 5EP2A 4ZEEA 3MK6A 2O4WA 1V92A 7CATA 219LA 5LVKA 3K1JA 1L96A 3NBXX 3GUMA 1L76A 4GCEA 1XGQC 5A3ZA 1XMQM 2L7HA 4DR6M 1OAOC 1AZFA 2RBPA 1ORYB 4XBOA 1T6OA 1B5YA 5I4YA 3TWMA 1GF0A 1P36A 1FLQA 1DI3A 5HNLA 1LJNA 2K6BA 5FSWA 2RSCA 3CT1A 4NGZA 4L41A 1F0WA 4W59A 4OW0A 1PJTA 3U5ZA 1D3MA 3AFHA 5FELA 2FH0A 1L13A 233LA 1AUAA 1C61A 1GXXA 1YIKA 2Z37A 3A3QA 4AQYM 2V1CA 1B6IA 4YENA 1KYIA 1L45A 4L78A 1LZBA 1DPXA 1L1TA 4IJFA 4LFBM 1TAYA 2RBOA 1IN7A 3PFIA 3WXUA 4JN6A 1XC8A 3C82A 5KXLA 187LA 3EXDA 4PGJB 3BKVA 1KXXA 1XGTC 111LA 4GHAA 1DQJC 3CQLA 107LA 1IP3A 1IWTA 1PQDA 1LAAA 2IHLA 209LA 4EOFA 3T1HM 1IX0A 2JZ1A 3J4GA 4K5YA 3TXGA 1L93A 5LIOA 2MEFA 4HPIA 3W6EA 3D8BA 3IJVA 2A7DA 1GFJA 3KOXE 4REZA 2F2NA 3WVXA 1BB6A 1OV7A 1YKYX 3EMSA 4NL4H 1QQYA 2C5RA 1J5EM 4IBJA 1CU3A 3OE6A 1HELA 4EMNA 1D2YA 3VDUA 1NJGA 4RKUF 2CV2A 3FYDA 5KPTA 162LA 3WH1A 1L0KA 3PNYA 3HKPA 1QZEA 3N9CA 3SAWA 2F5NA 3WUAA 1IP4A 2E5LM 1GF4A 1C66A 1D2WA 5LVIA 3MGWA 5B05A 1L22A 1RCMA 4B49A 2YSSC 5LYTA 4XGIA 1P64A 2ZTCA 3M7GA 176LA 3EO5A 3I4YA 3RU5A 180LA 4WM3A 4AG5A 1LSEA 1WR1B 1CTWA 1GEZA 2HEFA 1KFVA 3H4JA 1LJJA 4HP0A 2LYZA 3DN4A 3TMXA 4Z3MA 1IWUA 171LA 4MGKE 4LFPA 2QNJA 2X49A 1BVXA 1CU6A 4E3UA 5LYZA 1P56A 3FADA 4QOZC 1C6IA 3E21A 3T36A 3WU7A 1T8GA 3WW5A 1LJEA 3W6BA 2DQIY 1QAMA 4HTKA 5ILCA 1L99A 3K2RA 4LCBA 1PM5A 3OTOM 4B1AA 4HJZA 3PNVA 1L0JA 1IEEA 2RAYX 2O5RA 145LA 2MR9A 4TSBA 5B1FA 1IXRC 191LA 1OIPA 2B6ZA 2FBDA 3KFUG 1QT3A 142LA 1OVHA 2CWIA 3GQ4A 4H94A 1DKKA 2F47A 2KRKA 131LA 3F6ZA 4NHTA 4CJ6A 102LA 3LVVA 3HGIA 4OX9M 3I4VA 1NF5A 1LOZA 3A46A 144LA 1ZV1A 3LHMA 1V33A 3B0OA 1GF3A 4DAJA 4G4RA 3JAMS 1AT6A
chains in the Genus database with same CATH topology
4OWAA 4B4EA 1WTHA 1LYOA 1HF4A 1KW5A 228LA 5LXWA 2H9JA 1CJ7A 1L47A 2QARC 1EQ4A 2LCBA 134LA 1LZ6A 4DQ7A 4QDNA 3C81A 1CV3A 2ANXA 205LA 1CX6A 1L90A 5LA5A 1XGRC 218LA 1K28A 1L20A 1LJ3A 1QUDA 4IAPA 1NHEA 4BS7A 1G7IC 1L60A 3DN3A 3LYZA 3A8ZA 3HTDA 4DD2A 3AB6A 1G7JC 4XJHA 1QTKA 1PQMA 1L50A 4AQNA 3CSZA 1C64A 5IHGA 1OWZA 249LA 1J1XY 1LW9A 4G4BA 3GUIA 4ZIXA 1L56A 3VWOA 1AM7A 1DPWA 3VW7A 2H9KA 3KAMA 1G0MA 1LCNA 1L92A 3P4ZA 1LMOA 4WO9A 1FKQA 4DQ5A 4G9SA 1CU5A 201LA 3CDTA 3HUAA 208LA 1A4VA 2NTHA 1GE1A 1C65A 252LA 4OW1A 2LYMA 1HEPA 3A91A 2F32A 1B7SA 113LA 2N5ZA 3TMWA 1P46A 2IGCA 2CUUA 1GFEA 2BQIA 4KXIA 1JHLA 1IY4A 3ZEKA 1V7TA 2YDGA 1G0JA 3HTGA 1ZWNA 1OVKA 1GF6A 1IIZA 4HPEA 4OWCA 3TXFA 1REXA 3AZ4A 2HUMA 1C60A 1L33A 3HH6A 1LSCA 4J0LA 232LA 3EMLA 153LA 3LZMA 4DWXA 2Z38A 1IP6A 3C8RA 4DD7A 4H9BA 1IC7Y 182LA 3RZ4A 2MEBA 1GFRA 2BQBA 1QT5A 1WVVA 4WM5A 1LSFA 4WG7A 4WM4A 1JUGA 3L2XA 4PK0A 3NYAA 1P7SA 4GRVA 1B0DA 2ZWBA 4J1AA 157LA 5DM9A 1LZNA 4H9HA 1IR8A 1I1ZA 1WVUA 5C6LA 3G3WA 147LA 5KXRA 1XEKA 4ML7A 5K7OA 130LA 221LA 2D4IA 4ARPA 1DYGA 2HEBA 1LJGA 4WOAA 109LA 2Z19A 4PRUA 1LTMA 4GN4A 1D6QA 1LSDA 2OE4X 4CGEA 4W96A 4Z46A 4NGOA 3D9AC 3W6FA 4G4CA 4B0DA 2W1XA 1UIFA 4X3BA 5LZMA 2DQAA 4FDYA 1UIHA 1GE4A 193LA 3AJNA 5L3IA 5D5CA 2ZNXY 4WMGA 1YANA 2QB0B 4RLNA 4KPMA 3HTBA 1GB9A 4DJHA 3TMUA 2DKVA 3A94A 1LMNA 4NG8A 2B72A 108LA 4CFOA 1DYCA 1LSNA 1C08C 1QTBA 2B74A 2D91A 1P6YA 237LA 1RJCB 2F30A 4H9AA 3TXKA 2XBSA 1WTMA 1QTHA 3WMKA 1L31A 4W52A 4DKLA 3GULA 1YAPA 1CV6A 1LYGA 242LA 4H9CA 1C68A 4EKRA 1LSZA 4GCBA 2D4KA 1KY1A 2CJLA 4XJGA 1L30A 199LA 2YBHA 1BQLY 2W1MA 4NGIA 1QUSA 1XGPC 5APFA 4NHSA 2HEAA 1LWGA 4AGAA 3WU9A 5IELA 3HU9A 1QT8A 1L12A 4LZTA 2BQDA 5LVJA 1L29A 1V7SA 3SN6R 1L58A 1IOCA 3CB7A 1TLAA 4I0CA 4IASA 4B4IA 1LHIA 248LA 190LA 1T6HA 1IC5Y 3WXTA 4TSCA 1LSYA 1G0QA 1LYIA 3N9AA 4GLAA 1XEIA 149LA 1L52A 251LA 230LA 4H92A 4LDEA 1INUA 154LA 5C6IA 2A7FA 1B2KA 3C7WA 1IP7A 3GUJA 1GFHA 3AZ5A 1HEMA 2IFFY 1BB7A 223LA 3WUNA 1L59A 5I53A 155LA 1P37A 4NY5A 4OOTA 4P2EA 1RE2A 4ARMB 1UCOA 2YVBA 137LA 225LA 4RW2A 250LA 4YEMA 2BLYA 234LA 2Q9DA 1GF8A 3G3AB 1KIQC 1CJ9A 3LYTA 1LYJA 1GF5A 1FKVA 5KXOA 1NKHA 2Z2EA 3IWRA 4N9RA 4H9EA 1L09A 1PQKA 4NGKA 4HJVA 3LN2A 114LA 4WM1A 1QS5A 2RBQA 1GE0A 4I7JA 1OUFA 2B75A 4G4HA 4LDLA 1YL0X 1HSWA 2C8PA 1DYEA 1LZ9A 4Z98A 2XQOA 1TDYA 4YXCA 177LA 1G7LC 168LA 7LYZA 1L25A 1CU2A 1YQVY 4EPFA 1L54A 1NDMC 3DN2A 1KIRC 1L35A 1JITA 1L65A 1CUQA 1IR7A 1L86A 5L9JA 4KL7A 1ZURA 4RDSA 4HTNA 5IDDA 4LDOA 2EPEA 1B7NA 3P68A 103LA 1IOSA 1E8LA 4XJFA 1OUJA 4W56A 1JISA 1C6AA 4NGVA 1IP2A 110LA 4EKSA 5LYMA 1L82A 2DQEY 1VEDA 3FI5A 2G4PA 1L40A 1QTCA 1SSYA 198LA 2AUBA 3WPKA 2F4AA 2I25L 1C6KA 1AT5A 4N5RA 1GBZA 3AZ7A 1B7OA 3P64A 1LSGA 4NEBA 1CJ8A 1P5CA 1CKCA 1L18A 1OUDA 1WQQA 1CKHA 1QUTA 1JKBA 1GB0A 1L15A 1ALCA 3OE9A 5FHWA 1P2LA 3FE0A 3WPJA 5KXYA 1UICA 1DI4A 1L04A 1OV5A 1SQ2L 2ANVA 138LA 1IOTA 5LVHA 1FLWA 1KXWA 5KXWA 1OUEA 2RBNA 1HFYA 2HECA 1BB5A 2BQKA 1L75A 1BB3A 3DNAA 260LA 126LA 262LA 1GB2A 1LZSA 1GFKA 1L57A 5I54A 1H87A 4J7VA 2ZYPA 1LJKA 1L63A 2H5ZA 4LT3A 4XJDA 1ZVHL 3HFMY 3HU8A 4EKQA 5FCPA 1HNLA 1LYEA 1L01A 4LYBA 1HEWA 1CU0A 3AZ6A 2D4JA 2LZMA 1LLHA 4NG1A 1CKDA 4I7QA 3N9EA 1C6FA 2BQGA 2I26L 1L43A 1MLCE 1QTEA 4N8ZA 1OP9B 200LA 1D6PA 1LMPA 192LA 5AMYA 4OWHA 1LJ4A 189LA 1L07A 194LA 1TEWA 5JENB 1KY0A 4E97A 2BQFA 196LA 2BQJA 4W55A 1L21A 5KXMA 1HMLA 1D9UA 2ZIKA 4ETAA 1UIAA 4HSFA 1DKJA 4GN5C 1GAYA 4BAFA 4YOPA 1L42A 3DKEX 1ZYTA 146LA 1I20A 5DN5A 1J1PY 1LJHA 4W53A 1BVKC 3HUKA 127LA 4DDBA 5HNCA 222LA 2DQCY 1DYBA 1UACY 212LA 2XTHA 2Y8PA 115LA 1GE3A 1L66A 1C69A 2YBMA 161LA 1IP5A 2MECA 256LA 3AW7A 3M18B 5F81A 3V2WA 1L17A 1DYAA 1L27A 2B5ZA 4PPOA 5LAGA 3A92A 158LA 1JPOA 4WLTA 4DQJA 1L00A 4WLDA 3FA0A 186LA 1F6RA 3HH3A 1IOQA 5D5FA 1C45A 4NHPA 4M4OA 2B73A 3ZVQB 5DLAA 139LA 1LHLA 1L44A 4ET8A 1HFXA 4DC4A 2MEEA 4A7DA 1LI2A 1OQMA 3DN1A 1GEVA 2ZNWY 2MEHA 2HU3A 4QGZA 3OK0A 1GFGA 1L02A 2B6XA 1FDLY 3TXBA 1JKAA 1PZYA 4MSTA 151LA 4HTQA 4NGYA 1GFUA 5FDJA 3SB6A 1LGXA 3WYHA 2D6BA 5B59A 5KXKA 1L46A 5LAFA 1OVJA 1FLUA 4GBRB 2LZTA 1D0KA 1HERA 3SP3A 3AGHA 1C6DA 1JTTL 1OUIA 1F10A 5HMJA 4N1CC 2HUKA 5II3A 1C6TA 4DDCA 156LA 1LSBA 1VDQA 5HMVA 2Z12A 1L11A 1QT4A 227LA 1OUBA 1L91A 1LZTA 4XJIA 2HEDA 1C6LA 4M6DA 4HV1A 5KXXA 2RB2X 1GFVA 1CKFA 2YBJA 4G49A 1L39A 1WQRA 2BPUA 3HTFA 1QTDA 4RLMA 1XSFA 3L64A 1L89A 1A2YC 1L05A 1FLYA 140LA 207LA 3AYQA 123LA 1JJ1A 1QSQA 2YBIA 132LA 1KXYA 3RUNA 1TCYA 2X0AA 5KY1A 1LMTA 2HU1A 1JWRA 4ARQB 2O7AA 1LMAA 4O34A 1GWDA 2NWDX 4GCFA 3QNGA 3IJUA 5KXPA 3P66A 2PC2A 2BQNA 1UC0A 1GFAA 4GCDA 1XEJA 4NSJA 1L85A 3HDFA 1BWJA 4H93A 1L87A 3UONA 1QUGA 259LA 4YF2A 3HBEX 1JKCA 3CDVA 3CDRA 3J6KA 4IJ4A 150LA 1KS3A 5LA8A 215LA 1T3PA 2DQJY 3A93A 3DMVA 4XENA 3TXDA 1GBWA 2OE9X 173LA 3A95A 165LA 3RZEA 3ULRA 4II8A 1B5WA 1LZCA 2HULA 1L36A 4OWEA 1RI8B 4I7PA 1XGUC 3GUKA 1GB6A 1UIGA 4ETDA 1LI6A 5B1GA 4ANRA 1OUHA 3F8VA 2DQFC 4MCKA 2F2QA 1LHHA 1IVMA 4I7LA 4I7RA 1JTNA 183LA 5ILFA 1LYZA 1UIEA 8LYZA 4LYMA 216LA 3B0KA 1G06A 5E9RA 4PHIA 128LA 1BWIA 1LZ1A 4H9IA 1QT7A 5FSTA 5L3HA 1CV1A 3LZ2A 6LYTA 5T3FA 4PJZA 1LSAA 4AXTA 2B6WA 3M3UA 5HQ1A 1L49A 4J1BA 3HT8A 1C6HA 3QE8A 3W6DA 2G4NA 1QUOA 3A67Y 1WQNA 3PBLA 188LA 1FBIX 2MEAA 4NWEA 3OE8A 4XN6A 3C8SA 1DI5A 3HT9A 3CDQA 254LA 1VATA 4LYZA 1L28A 1QTZA 5EBHA 4WM2A 1P2RA 3HBHA 1IWWA 3ODUA 246LA 2DQDY 1QDTA 1L77A 2ZILA 1L79A 4PJ2C 184LA 1G0PA 4ARQA 3JR6A 1L67A 4QY9A 3DN8A 4FJRA 1GAZA 1ZMYL 2XJWA 3P65A 1LYFA 1LZEA 1C46A 257LA 4U3XB 3C83A 3BKHA 4ZFPA 2MEGA 1G7HC 2OE7X 3RT5X 1L08A 1KIPC 1B9OA 1L10A 1C6BA 229LA 4NHIA 1NWGA 2BQEA 1CV4A 1G0LA 2HUBA 2F4GA 2FYDA 3LYOA 4EPIA 4C5FA 4NSIA 1LHJA 1LMCA 2EKSC 166LA 4WO6A 2YBNA 1L70A 1GF7A 3D4SA 1D3JA 104LA 3HT6A 3G3XA 1LZ5A 1T97A 1CX7A 244LA 5I14A 1OUGA 6LYZA 3DMZA 1XEPA 3DN6A 9LYZA 1T6VL 1NBYC 1VDSA 3A3RX 5KXZA 1KW7A 3SBAA 1QS9A 5J7CA 2L78A 1JIYA 4LGKA 1JKDA 4QEQA 1L16A 1YAOA 1B5UA 5F14A 1IWZA 2OTYX 1L14A 1LZ8A 5LVGA 243LA 4LT2A 1L37A 143LA 4WM6A 1H6MA 4I7OA 3A90A 4I7MA 3AGGG 4ETCA 1IWYA 1L32A 3QY4A 4XJBA 1L84A 135LA 5I4WA 3DMXA 1SSWA 1SX2A 2FYCA 1LKRA 3C8QA 1YAQA 5KXNA 3SB7A 5APDA 5E4PA 2ZQ4A 1J1OY 4H90A 4TX7A 1L69A 1C6EA 1HC0A 1VAUA 4YM8A 1NQIA 2G4QA 3RW8A 3TXJA 2LZ2A 3GUNA 1LYHA 5A3EA 1N4FA 1D9WA 1WQMA 2ZYCA 185LA 2OU0X 4BAPA 4W54A 4ZPUA 1HHLA 1D3FA 4NHQA 112LA 1L51A 5FEKA 2ZQ3A 4WLYA 164LA 3HH4A 1C67A 1UIBA 1IY3A 4N0JA 1FN5A 3G3VA 1L68A 1L94A 1I6SA 1C62A 1GDXA 2CGIA 1AKIA 4ARMA 4ETBA 3GXKA 4TUNA 1GBXA 1OYUA 4B4JA 1GF9A 4WL6A 4MR1A 1GBSA 1GDWA 3A34A 4W51A 1CV5A 1LGUA 1JQUA 1B7QA 2BLXA 2RBRA 3WPLA 1LSPA 4GN3A 4TWSA 231LA 4NFVA 1OUCA 4OWBA 1LHMA 4LYCA 7LZMA 4N1EI 3HBDA 4LYOA 1O23A 1UIDA 4NWHA 4I7SA 3K3TA 2RB0X 1L61A 1OUAA 2LC9A 1DXJA 120LA 4LT1A 1L81A 4EKPA 1L83A 1BHZA 3A6CY 174LA 2VB1A 3CT5A 1GB5A 3TXIA 1G0KA 3LYMA 4EXMA 1CV0A 152LA 1LSMA 1QSAA 148LE 2O79A 1B7PA 5I5QA 2YBLA 1ZV5L 3HDEA 261LA 1LPYA 4RW1A 1IO5A 1LZYA 4H8ZA 4DD9A 1B5VA 1BWHA 1C6JA 3A96A 2RH1A 3WULA 175LA 5KXTA 1L55A 1L06A 1QIOA 4HJYA 4W57A 3OJPA 2BAAA 1B7LA 4LYTA 1W6ZA 2OU9A 3W3EA 4DDAA 169LA 5M1YA 1WTNA 1LJFA 3C80A 1L95A 2HEEA 1BGIA 1LZGA 2BQHA 1G0GA 3D3DA 1GB3A 5APCA 2OTZX 4UWNA 3ATOA 238LA 4DD0A 1L19A 197LA 1RFPA 210LA 1QDRA 1L23A 5F9XA 4YXAC 4NGJA 3TXEA 4W94A 1IWXA 206LA 1XFPL 1I56A 4WL7A 247LA 3NY9A 3WVYA 3E3DA 1C6PA 5B07A 1HSXA 3RNXA 122LA 3G3BB 4TTDA 1QT6A 1G07A 1NDGC 4NIJA 1G1VA 3CDOA 4H1PA 4H8YA 163LA 1P2CC 4LZMA 1QSBA 2XBRA 1JTOL 1LZRA 2B7XA 1VFBC 4BADA 4DT3A 241LA 3B6LA 4I8SA 3C7ZA 1QUHA 1DZBX 213LA 5APEA 1L71A 4LFXA 1CNSA 240LA 1Z55A 1JSEA 4XYYA 3A6BY 2BQOA 3HH5A 2LHMA 4S0WA 1NMMA 4R0FA 2Z39A 5DL9A 2EQLA 3WW6A 1TBYA 1WQOA 2OEAX 5LINA 2A4TA 4UWUA 4GCCA 1BB4A 1VDPA 2RB1X 2W1YA 4EJ4A 1EQEA 214LA 4DD3A 160LA 1CKGA 1GHLA 159LA 1YILA 4C3WA 2EIZC 4XADA 4CJ2A 1C63A 5DN4A 2I6ZA 217LA 4ARLA 4W58A 1LPIA 1OWYA 1EL1A 1EQ5A 172LA 2B6TA 4H8XA 3GUOA 4KT3A 220LA 2BQMA 1L26A 2Z2FA 1UUZC 1REYA 3W6AA 1KNIA 4H9FA 1C6NA 2Z6BA 133LA 2RBSA 5KKIA 2BQAA 5KXSA 125LA 4NGWA 1F6SA 4ARJA 4DD1A 1HEOA 4I7KA 1GD6A 1JJ3A 1NBZC 1LWKA 1D0MA 181LA 1CVKA 1REMA 3OE0A 3CSQA 2Z18A 4GLVA 1SWYA 245LA 1JTMA 1HFZA 1CJ6A 6LZMA 2MEIA 1GPQC 5C6JA 1YL1X 2Q9EA 2WARA 3V2YA 1IWVA 5KKJA 1PQJA 258LA 2BQLA 1JTPL 1MELL 4CFPA 1C43A 1L73A 4I7TA 1B5ZA 3EBAB 1T8AA 3WL2A 3HT7A 1IP1A 1UA6Y 3ZVQA 4OOOA 4R6CA 2CDSA 1LZAA 1L53A 3PDSA 1L62A 1GB8A 1L97A 1L88A 235LA 1LHKA 1DYFA 3F9LA 1LJIA 1LI3A 5B06A 3NY8A 2NTGA 4WG1A 170LA 1C6CA 1IORA 1YKXX 2C8OA 2GV0A 1C7PA 3DN0A 1LKSA 3CSRA 5F16A 1L74A 4YX7C 1PS5A 4LT0A 1EPYA 2B6YA 3QAKA 1HENA 4NSHA 3ATNA 2RAZX 3B0IA 1T8FA 129LA 1LYSA 4D9ZA 1SX7A 178LA 1JSFA 3AGIA 5F9UA 2LYOA 1L80A 2DQGY 2Q0MX 1D0LA 1GXV2 3WU8A 5HLLA 1LYDA 2DQHY 3W6CA 211LA 167LA 1IR9A 1L34A 1G1WA 4PRQA 1LYYA 1QSWA 1YROA 4OO9A 1ZVYB 1C6GA 1L41A 1GE2A 3FI7A 1L48A 3HWLA 1CUPA 1L64A 3SB5A 1QTVA 4ET9A 1YAMA 224LA 2FBBA 4YEOA 3C7YA 1PQIA 2BQCA 1HMKA 1L24A 1NHBA 1G7MC 3GXRA 1L72A 226LA 3LZTA 1HEQA 1W08A 1D3NA 4CHXA 3SB8A 3B72A 3CT0A 1VDTA 1REZA 1SWZA 1P3NA 4WLXA 1PQOA 1GB7A 1L98A 3SBBC 2ZIJA 1C6QA 1YKZX 4IATA 1B7MA 3HUQA 2DBTA 1L38A 2OU8A 3T6UA 141LA 1XJUA 1B7RA 236LA 253LA 3WUMA 1LMQA 1UBZA 5I4XA 239LA 1WQPA 255LA 3TXHA 1JJ0A 195LA 1C6MA 4UWVA 3GUPA 2W1LA 4NGLA 1LGWA 5KJ9A 118LA 3TMVA 1IC4Y 4H91A 1B5XA 4DYGA 1L03A 2HTXA 1GFTA 4HV2A 4NSGA 2MEDA 1LZ4A 2B70A 4ETEA 1DYDA 1XJTA 3SB9A 1SLYA 119LA 3AW6A 1JEFA 4Z41A 1GBOA 1LZDA 1GBYA 1C10A 4I7NA 4ZEEA 2O4WA 219LA 5LVKA 1L96A 3GUMA 1L76A 4GCEA 1XGQC 5A3ZA 1AZFA 2RBPA 1B5YA 5I4YA 1GF0A 1P36A 1FLQA 1DI3A 5HNLA 1LJNA 2RSCA 3CT1A 4NGZA 4L41A 1F0WA 4W59A 1D3MA 5FELA 1L13A 233LA 1C61A 1GXXA 1YIKA 2Z37A 3A3QA 1B6IA 4YENA 1L45A 1LZBA 1DPXA 1TAYA 3WXUA 2RBOA 5KXLA 3C82A 187LA 3EXDA 4PGJB 3BKVA 1KXXA 1XGTC 111LA 3CQLA 1DQJC 107LA 1IP3A 1IWTA 1PQDA 1LAAA 2IHLA 209LA 4EOFA 1IX0A 4K5YA 3J4GA 3TXGA 1L93A 5LIOA 2MEFA 4HPIA 3W6EA 3IJVA 2A7DA 1GFJA 2F2NA 3WVXA 1BB6A 1OV7A 1YKYX 3EMSA 1QQYA 1CU3A 3OE6A 1HELA 4EMNA 1D2YA 162LA 3WH1A 1L0KA 3N9CA 3WUAA 1IP4A 1GF4A 1C66A 1D2WA 5LVIA 3MGWA 5B05A 1L22A 1RCMA 4B49A 2YSSC 5LYTA 1P64A 176LA 3EO5A 3RU5A 180LA 4WM3A 1LSEA 1CTWA 1GEZA 2HEFA 1LJJA 4HP0A 2LYZA 3DN4A 3TMXA 4Z3MA 1IWUA 171LA 4LFPA 1BVXA 1CU6A 4E3UA 5LYZA 1P56A 3FADA 1C6IA 3T36A 3WU7A 1T8GA 3WW5A 1LJEA 3W6BA 2DQIY 4HTKA 5ILCA 1L99A 3K2RA 4B1AA 4HJZA 1L0JA 1IEEA 2RAYX 145LA 4TSBA 5B1FA 191LA 2B6ZA 2FBDA 1QT3A 142LA 1OVHA 2CWIA 4H94A 1DKKA 2F47A 131LA 3F6ZA 4NHTA 102LA 1NF5A 1LOZA 144LA 3LHMA 3B0OA 1GF3A 4DAJA 1AT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LZ1 A;  1YIL A;  4H9I A;  4OWA A;  4B4E A;  2EIZ C;  4C3W A;  7LYZ A;  1LYO A;  4XAD A;  1HF4 A;  5LXW A;  4CJ2 A;  5FST A;  2H9J A;  5DN4 A;  1CJ7 A;  5L3H A;  2I6Z A;  3LZ2 A;  1YQV Y;  1LPI A;  1EL1 A;  1EQ5 A;  6LYT A;  1EQ4 A;  5T3F A;  134L A;  4H8X A;  1LZ6 A;  4KT3 A;  1LSA A;  1NDM C;  2BQM A;  4QDN A;  2Z2F A;  4AXT A;  1KIR C;  3M3U A;  1UUZ C;  5HQ1 A;  4J1B A;  1JIT A;  1REY A;  1IR7 A;  5LA5 A;  3QE8 A;  3W6A A;  1XGR C;  4H9F A;  4KL7 A;  5L9J A;  3W6D A;  133L A;  2G4N A;  4RDS A;  4HTN A;  5IDD A;  5KKI A;  2BQA A;  2EPE A;  1B7N A;  5KXS A;  3A67 Y;  1WQN A;  3P68 A;  1F6S A;  1IOS A;  4NGW A;  1E8L A;  1LJ3 A;  1NHE A;  4BS7 A;  4XJF A;  1G7I C;  1OUJ A;  4DD1 A;  1JIS A;  1FBI X;  1HEO A;  3LYZ A;  3A8Z A;  2MEA A;  4NWE A;  3AB6 A;  1G7J C;  1JJ3 A;  1GD6 A;  4NGV A;  1NBZ C;  4XJH A;  3CSQ A;  1D0M A;  4XN6 A;  1DI5 A;  1QTK A;  1REM A;  1IP2 A;  2Z18 A;  5LYM A;  2DQE Y;  4GLV A;  1VAT A;  1VED A;  3CSZ A;  5IHG A;  2G4P A;  4LYZ A;  1J1X Y;  4G4B A;  5EBH A;  2AUB A;  3WPK A;  1HFZ A;  2F4A A;  4WM2 A;  4ZIX A;  2I25 L;  1IWW A;  1CJ6 A;  3HBH A;  1AT5 A;  2MEI A;  1AM7 A;  4N5R A;  3VWO A;  1GBZ A;  1GPQ C;  5C6J A;  1DPW A;  3AZ7 A;  1YL1 X;  2WAR A;  1B7O A;  1IWV A;  2H9K A;  1LSG A;  3P64 A;  4NEB A;  5KKJ A;  3KAM A;  2DQD Y;  1CJ8 A;  1QDT A;  2ZIL A;  1CKC A;  1LCN A;  4PJ2 C;  1OUD A;  1WQQ A;  1CKH A;  2BQL A;  3P4Z A;  1JTP L;  1LMO A;  4WO9 A;  1QUT A;  4QY9 A;  4FJR A;  1FKQ A;  1MEL L;  4CFP A;  1GAZ A;  1ZMY L;  2XJW A;  1C43 A;  3P65 A;  4G9S A;  1JKB A;  1LZE A;  1GB0 A;  1C46 A;  1B5Z A;  208L A;  4U3X B;  3BKH A;  3EBA B;  2MEG A;  3WL2 A;  4ZFP A;  1G7H C;  4DD9 A;  1ALC A;  3RT5 X;  1IP1 A;  1A4V A;  1KIP C;  1B9O A;  4NHI A;  1NWG A;  5FHW A;  1UA6 Y;  2BQE A;  3ZVQ A;  4OOO A;  3FE0 A;  4R6C A;  3WPJ A;  2CDS A;  2HUB A;  5KXY A;  1GE1 A;  1LZA A;  1UIC A;  1DI4 A;  1SQ2 L;  4OW1 A;  2LYM A;  1IOT A;  1GB8 A;  1HEP A;  2F4G A;  1LHK A;  3A91 A;  5LVH A;  1FLW A;  2FYD A;  1KXW A;  3LYO A;  1B7S A;  4C5F A;  4NSI A;  1LHJ A;  1LMC A;  5KXW A;  1OUE A;  2EKS C;  2N5Z A;  3TMW A;  4WO6 A;  2YBN A;  1LJI A;  1HFY A;  1GFE A;  2BQI A;  2HEC A;  1GF7 A;  4KXI A;  1BB5 A;  1IY4 A;  1JHL A;  1V7T A;  5B06 A;  2BQK A;  3ZEK A;  4WG1 A;  1BB3 A;  2YDG A;  1IOR A;  1YKX X;  2C8O A;  1LZ5 A;  2GV0 A;  1GB2 A;  1C7P A;  1OUG A;  1LKS A;  1LZS A;  3CSR A;  5F16 A;  1GFK A;  1GF6 A;  1PS5 A;  6LYZ A;  4LT0 A;  1IIZ A;  5I54 A;  1H87 A;  9LYZ A;  1T6V L;  4J7V A;  2ZYP A;  1NBY C;  1LJK A;  1VDS A;  3A3R X;  4HPE A;  4OWC A;  1HEN A;  4NSH A;  2H5Z A;  4LT3 A;  4XJD A;  1REX A;  1ZVH L;  3ATN A;  3AZ4 A;  3HFM Y;  3TXF A;  1HNL A;  1LSC A;  5FCP A;  3B0I A;  4J0L A;  5J7C A;  1LYS A;  1JIY A;  4D9Z A;  4LGK A;  1JKD A;  4LYB A;  4QEQ A;  153L A;  1HEW A;  1JSF A;  4DWX A;  2Z38 A;  1IP6 A;  1YAO A;  2D4J A;  1B5U A;  3AGI A;  3AZ6 A;  4NG1 A;  1CKD A;  2LYO A;  4H9B A;  3N9E A;  5F9U A;  2BQG A;  2I26 L;  1IC7 Y;  1MLC E;  2DQG Y;  5F14 A;  2Q0M X;  1D0L A;  1IWZ A;  1QTE A;  3RZ4 A;  2MEB A;  1GFR A;  2BQB A;  1GXV 2;  4N8Z A;  1LZ8 A;  3WU8 A;  1WVV A;  4WM5 A;  5HLL A;  2DQH Y;  1LSF A;  1OP9 B;  4WG7 A;  4WM4 A;  1D6P A;  1LMP A;  5LVG A;  5AMY A;  3W6C A;  4OWH A;  1LJ4 A;  4E3U A;  4LT2 A;  1JUG A;  1IR9 A;  4PRQ A;  4WM6 A;  194L A;  1LYY A;  1B0D A;  1H6M A;  2ZWB A;  4J1A A;  3A90 A;  1QSW A;  1TEW A;  1YRO A;  3AGG G;  5DM9 A;  5JEN B;  1ZVY B;  4ETC A;  1LZN A;  4H9H A;  1IWY A;  3QY4 A;  2BQF A;  1IR8 A;  4XJB A;  5I4W A;  135L A;  1GE2 A;  1I1Z A;  2BQJ A;  3FI7 A;  1WVU A;  5C6L A;  2FYC A;  4ET9 A;  5KXM A;  1HML A;  1LKR A;  1XEK A;  1YAQ A;  1D9U A;  5KXR A;  2ZIK A;  1YAM A;  5KXN A;  4ML7 A;  4ETA A;  1UIA A;  5APD A;  5E4P A;  2ZQ4 A;  2FBB A;  1J1O Y;  4H90 A;  4YEO A;  4HSF A;  4TX7 A;  1DKJ A;  2BQC A;  4GN5 C;  1GAY A;  1HMK A;  4BAF A;  1G7M C;  3GXR A;  5K7O A;  2D4I A;  1HC0 A;  3LZT A;  1HEQ A;  1W08 A;  4YOP A;  2HEB A;  1LJG A;  4WOA A;  1VAU A;  4YM8 A;  1NQI A;  4CHX A;  2Z19 A;  1I20 A;  2G4Q A;  3RW8 A;  3B72 A;  3CT0 A;  3TXJ A;  5DN5 A;  1J1P Y;  1LJH A;  1VDT A;  1REZ A;  2LZ2 A;  4PRU A;  4WLX A;  1LTM A;  1N4F A;  1GB7 A;  4BAD A;  5A3E A;  2ZIJ A;  1BVK C;  1D6Q A;  1LSD A;  4GN4 A;  1WQM A;  4CGE A;  2ZYC A;  4DDB A;  5HNC A;  4BAP A;  4W96 A;  1YKZ X;  1HHL A;  4Z46 A;  4NGO A;  2DQC Y;  3D9A C;  1UAC Y;  4NHQ A;  4IAT A;  2XTH A;  1B7M A;  2Y8P A;  2DBT A;  5FEK A;  3W6F A;  4G4C A;  4B0D A;  2W1X A;  1GE3 A;  1UIF A;  4X3B A;  3T6U A;  2ZQ3 A;  4WLY A;  2DQA A;  1B7R A;  4FDY A;  2YBM A;  1UIB A;  1UIH A;  1IY3 A;  1GE4 A;  193L A;  1FN5 A;  3AJN A;  4N0J A;  3WUM A;  5L3I A;  1LMQ A;  1UBZ A;  5D5C A;  5I4X A;  1WQP A;  2ZNX Y;  4WMG A;  1IP5 A;  2MEC A;  3TXH A;  1JJ0 A;  3M18 B;  3AW7 A;  5F81 A;  2B5Z A;  4UWV A;  4PPO A;  1YAN A;  4RLN A;  5LAG A;  3A92 A;  1GDX A;  2CGI A;  2W1L A;  4KPM A;  1JPO A;  1GB9 A;  1AKI A;  4NGL A;  4WLT A;  3TMU A;  4ETB A;  2DKV A;  5KJ9 A;  3GXK A;  4TUN A;  1GBX A;  4B4J A;  4WLD A;  1GF9 A;  4WL6 A;  3TMV A;  1F6R A;  3A94 A;  4MR1 A;  1LMN A;  1IOQ A;  1GBS A;  1GDW A;  1IC4 Y;  1B5X A;  3A34 A;  4H91 A;  4NG8 A;  4DYG A;  2HTX A;  5D5F A;  4DD2 A;  1C45 A;  1GFT A;  4NHP A;  4M4O A;  3ZVQ B;  4CFO A;  1LSN A;  5DLA A;  1LHL A;  4ET8 A;  1C08 C;  1HFX A;  4HV2 A;  4NSG A;  1B7Q A;  2BLX A;  4DC4 A;  2MEE A;  2D91 A;  2MED A;  1LZ4 A;  4A7D A;  4ETE A;  1RJC B;  2F30 A;  1OQM A;  4DT3 A;  3WPL A;  1LSP A;  1SLY A;  4H9A A;  4GN3 A;  3TXK A;  1GEV A;  2XBS A;  1WTM A;  3AW6 A;  1JEF A;  2ZNW Y;  4TWS A;  2MEH A;  2HU3 A;  4QGZ A;  3OK0 A;  1GFG A;  3WMK A;  4Z41 A;  1GBO A;  4NFV A;  1OUC A;  1FDL Y;  3TXB A;  1JKA A;  1LZD A;  4OWB A;  1PZY A;  1LHM A;  4LYC A;  1GBY A;  1C10 A;  4MST A;  4ZEE A;  1YAP A;  4HTQ A;  5LVK A;  4NGY A;  4N1E I;  1GFU A;  3HBD A;  4LYO A;  5FDJ A;  1O23 A;  1UID A;  4NWH A;  4H9C A;  3K3T A;  3WYH A;  2D6B A;  4GCE A;  5B59 A;  5KXK A;  1XGQ C;  5A3Z A;  5LAF A;  1OUA A;  1DXJ A;  1FLU A;  1LSZ A;  2LZT A;  1AZF A;  4GCB A;  1D0K A;  4LT1 A;  2D4K A;  1HER A;  1B5Y A;  5I4Y A;  1GF0 A;  1FLQ A;  1DI3 A;  1BHZ A;  2CJL A;  3A6C Y;  4XJG A;  2YBH A;  3SP3 A;  3AGH A;  5HNL A;  1BQL Y;  1JTT L;  2VB1 A;  1OUI A;  1LJN A;  1F10 A;  3CT5 A;  5HMJ A;  4N1C C;  5II3 A;  2RSC A;  4DDC A;  3CT1 A;  2W1M A;  4NGZ A;  4L41 A;  4NGI A;  1GB5 A;  1QUS A;  1LSB A;  3TXI A;  1F0W A;  1VDQ A;  1XGP C;  3LYM A;  5HMV A;  2Z12 A;  5APF A;  4NHS A;  2HEA A;  5FEL A;  1LSM A;  4AGA A;  1QSA A;  1GXX A;  1YIK A;  2Z37 A;  3A3Q A;  1B7P A;  1OUB A;  4YEN A;  5I5Q A;  3WU9 A;  5IEL A;  1LZT A;  2YBL A;  4XJI A;  1LZB A;  1ZV5 L;  1DPX A;  2HED A;  4LZT A;  2BQD A;  4M6D A;  5LVJ A;  1V7S A;  1TAY A;  5KXZ A;  3WXU A;  4HV1 A;  5KXX A;  5KXL A;  4RW1 A;  1IO5 A;  1GFV A;  1LZY A;  3EXD A;  1IOC A;  4H8Z A;  4PGJ B;  1B5V A;  1BWH A;  3BKV A;  1KXX A;  3A96 A;  1XGT C;  3CB7 A;  3CQL A;  1DQJ C;  4I0C A;  4IAS A;  1CKF A;  2YBJ A;  4B4I A;  1LHI A;  3WUL A;  1IP3 A;  4G49 A;  1IWT A;  1LAA A;  5KXT A;  1IC5 Y;  3WXT A;  2IHL A;  1QIO A;  4TSC A;  4HJY A;  1WQR A;  3OJP A;  2BAA A;  4EOF A;  1LSY A;  2BPU A;  1IX0 A;  1B7L A;  3J4G A;  3N9A A;  4LYT A;  4RLM A;  4GLA A;  1W6Z A;  3TXG A;  1XSF A;  1XEI A;  5LIO A;  2MEF A;  4HPI A;  3W6E A;  1A2Y C;  3W3E A;  4DDA A;  1FLY A;  3IJV A;  2A7D A;  207L A;  5M1Y A;  3AYQ A;  4H92 A;  1GFJ A;  1WTN A;  1JJ1 A;  1LJF A;  2F2N A;  3WVX A;  1INU A;  1BB6 A;  154L A;  5C6I A;  1YKY X;  2A7F A;  2HEE A;  1BGI A;  1LZG A;  1QQY A;  132L A;  2BQH A;  1KXY A;  2YBI A;  3EMS A;  1TCY A;  1B2K A;  2X0A A;  3D3D A;  1GB3 A;  5APC A;  5KY1 A;  4UWN A;  3ATO A;  1LMT A;  4DD0 A;  2HU1 A;  1JWR A;  1HEL A;  4EMN A;  1IP7 A;  1GFH A;  1RFP A;  3AZ5 A;  3WH1 A;  1HEM A;  1LMA A;  4O34 A;  1QDR A;  1GWD A;  2NWD X;  3N9C A;  5F9X A;  2IFF Y;  1BB7 A;  4GCF A;  3QNG A;  3IJU A;  3WUA A;  5KXP A;  1IP4 A;  1GF4 A;  5I53 A;  3WUN A;  4NGJ A;  3P66 A;  3TXE A;  4W94 A;  1IWX A;  2PC2 A;  1XFP L;  2BQN A;  3MGW A;  1UC0 A;  1GFA A;  4GCD A;  1I56 A;  5LVI A;  1XEJ A;  5B05 A;  4NY5 A;  1RCM A;  4NSJ A;  4OOT A;  4WL7 A;  2YSS C;  4B49 A;  5LYT A;  4P2E A;  1RE2 A;  1BWJ A;  4H93 A;  3WVY A;  1UCO A;  3E3D A;  5B07 A;  1HSX A;  3RNX A;  3EO5 A;  3G3B B;  4TTD A;  3RU5 A;  4WM3 A;  1LSE A;  4YF2 A;  3HBE X;  2YVB A;  1GEZ A;  1JKC A;  1NDG C;  2HEF A;  4NIJ A;  4RW2 A;  1LJJ A;  4HP0 A;  2LYZ A;  4YEM A;  3J6K A;  2BLY A;  4H1P A;  4H8Y A;  4IJ4 A;  3TMX A;  1P2C C;  1IWU A;  2XBR A;  4Z3M A;  1JTO L;  1LZR A;  1GF8 A;  5LA8 A;  4LFP A;  3G3A B;  1BVX A;  1KIQ C;  1VFB C;  1T3P A;  2DQJ Y;  3A93 A;  4XEN A;  5LYZ A;  3TXD A;  1CJ9 A;  3LYT A;  1GBW A;  3B6L A;  4I8S A;  3T36 A;  3WU7 A;  3A95 A;  1GF5 A;  1DZB X;  1FKV A;  5APE A;  1LJE A;  3W6B A;  3WW5 A;  5KXO A;  1NKH A;  2DQI Y;  2Z2E A;  3IWR A;  4N9R A;  3ULR A;  4HTK A;  4DD7 A;  4II8 A;  5ILC A;  4LFX A;  4H9E A;  1CNS A;  1B5W A;  1LZC A;  4NGK A;  4B1A A;  4HJZ A;  1IEE A;  1Z55 A;  4HJV A;  1JSE A;  4TSB A;  3LN2 A;  4XYY A;  3A6B Y;  2BQO A;  4OWE A;  2LHM A;  4WM1 A;  5B1F A;  1RI8 B;  1XGU C;  1NMM A;  2FBD A;  1GB6 A;  4R0F A;  1UIG A;  2Z39 A;  5DL9 A;  2EQL A;  2CWI A;  3WW6 A;  4ETD A;  1GE0 A;  5B1G A;  4ANR A;  1OUH A;  1TBY A;  1WQO A;  4H94 A;  5LIN A;  1DKK A;  1OUF A;  3F6Z A;  2DQF C;  4MCK A;  4NHT A;  4GCC A;  1BB4 A;  4G4H A;  4UWU A;  1VDP A;  2W1Y A;  1LHH A;  1NF5 A;  1IVM A;  1YL0 X;  1HSW A;  1LOZ A;  2C8P A;  5ILF A;  1LZ9 A;  1LYZ A;  1EQE A;  1UIE A;  3B0O A;  3LHM A;  1TDY A;  4Z98 A;  8LYZ A;  4LYM A;  4DD3 A;  1GF3 A;  1CKG A;  1G7L C;  3B0K A;  1GHL A;  5E9R A;  4PHI A;  1AT6 A;  1BWI A; 
#chains in the Genus database with same CATH topology
 4OWA A;  4B4E A;  1WTH A;  1LYO A;  2KNZ A;  1HF4 A;  1KW5 A;  228L A;  5LXW A;  3ZCB B;  2H9J A;  1CJ7 A;  1L47 A;  5FTJ A;  4GH9 A;  2QAR C;  1EQ4 A;  2LCB A;  134L A;  4DV1 M;  1LZ6 A;  4DQ7 A;  4QDN A;  3C81 A;  1CV3 A;  2ANX A;  205L A;  1CX6 A;  1L90 A;  4X64 M;  5LA5 A;  1FJG M;  1SXJ E;  1XGR C;  218L A;  4JI7 M;  2RGO A;  1K28 A;  4JI8 M;  4BB9 A;  3GPX A;  1L20 A;  1QZM A;  1LJ3 A;  3GLF A;  1QUD A;  4IAP A;  1GKI A;  1NHE A;  4BS7 A;  1L8Q A;  1G7I C;  1L60 A;  4OU7 A;  3DN3 A;  3LYZ A;  3A8Z A;  3HTD A;  4DD2 A;  3AB6 A;  1G7J C;  1WXQ A;  4XJH A;  1QTK A;  1PQM A;  1QAQ A;  1L50 A;  4AQN A;  1XNR M;  3CSZ A;  3AL0 C;  2HL7 A;  1C64 A;  5IHG A;  1OWZ A;  249L A;  4A3V B;  1J1X Y;  1LW9 A;  4G4B A;  3GUI A;  4ZIX A;  4M0W A;  1L56 A;  4AG6 A;  5C1B A;  3VWO A;  3F92 A;  1AM7 A;  1DPW A;  3VW7 A;  2H9K A;  1OIZ A;  2KZS A;  3KAM A;  3KS8 A;  1G0M A;  2GNO A;  3U60 B;  1L92 A;  1LCN A;  2KRU A;  3P4Z A;  1OFH A;  4R3D A;  1LMO A;  4DUZ M;  4WO9 A;  1FKQ A;  3GP1 A;  2DWN A;  5EXX A;  4DQ5 A;  4G9S A;  1CU5 A;  201L A;  3CDT A;  3HUA A;  4NSR A;  208L A;  2R4E A;  1I94 M;  1A4V A;  1Z5C A;  4P16 A;  3A98 B;  2JUJ A;  2NTH A;  1GJT A;  2O25 A;  2HKJ A;  4DV7 M;  4LG2 A;  1TH2 A;  1GE1 A;  2VDB B;  1C65 A;  252L A;  4OW1 A;  2LYM A;  1HEP A;  3A91 A;  1IN4 A;  1G59 A;  2F32 A;  1B7S A;  2UXB M;  4IBK A;  113L A;  2N5Z A;  3TMW A;  1P46 A;  2IGC A;  2CUU A;  1GFE A;  4G4O A;  4I81 A;  2BQI A;  4KXI A;  1JHL A;  1IY4 A;  3ZEK A;  1V7T A;  3SAU A;  5BR8 M;  2YDG A;  1G0J A;  3HTG A;  1ZWN A;  3HY5 A;  1OVK A;  1S3S A;  3CF2 A;  3U6S A;  1GF6 A;  3SYK A;  3U6Q A;  4JI5 M;  3U6C A;  1E32 A;  1IIZ A;  3J80 S;  4JI4 M;  4IIW A;  4HPE A;  4OWC A;  3TXF A;  1REX A;  3AZ4 A;  1I4W A;  1C60 A;  1L33 A;  2HUM A;  3HH6 A;  3E4R A;  1LSC A;  4J0L A;  232L A;  3EML A;  1EFU B;  1LV7 A;  153L A;  4NXM M;  3LZM A;  4DWX A;  2Z38 A;  1IP6 A;  3C8R A;  4DD7 A;  2DAM A;  4H9B A;  2WZJ A;  1IC7 Y;  5KQ8 A;  3SBJ A;  182L A;  3RZ4 A;  2MEB A;  2G5G X;  1GFR A;  2BQB A;  1QT5 A;  1WVV A;  4WM5 A;  2CP8 A;  1Z5B A;  1LSF A;  4WG7 A;  4WM4 A;  1JUG A;  3L2X A;  4PK0 A;  3NYA A;  1T3T A;  1P7S A;  4GRV A;  1B0D A;  2ZWB A;  4J1A A;  157L A;  3B7Q A;  5DM9 A;  1LZN A;  4H9H A;  1IR8 A;  1I1Z A;  1WVU A;  4CIZ A;  4LF5 M;  5C6L A;  3G3W A;  147L A;  5KXR A;  1XEK A;  4GKK M;  4HEO A;  2L2D A;  4NOO B;  4ML7 A;  2ZAM A;  1AIP C;  3SAT A;  1ZMV A;  3IEC A;  2WSC F;  5K7O A;  130L A;  221L A;  2D4I A;  3LVW A;  4ARP A;  1DYG A;  1MN3 A;  2HEB A;  1QAO A;  1LJG A;  4WOA A;  109L A;  2Z19 A;  5A2Q S;  8CAT A;  4PRU A;  1LTM A;  4GN4 A;  1D6Q A;  1LSD A;  2OE4 X;  4CGE A;  4W96 A;  4Z46 A;  5EXP A;  2JXN A;  3C3D A;  4NGO A;  3GLH E;  3D9A C;  4P17 A;  3W6F A;  3HZJ A;  4G4C A;  4B0D A;  5DFL A;  2W1X A;  1UIF A;  4X3B A;  5LZM A;  2EKK A;  2DQA A;  3U60 A;  2EA0 A;  4FDY A;  1UIH A;  1GE4 A;  193L A;  2G3Q A;  3AJN A;  5L3I A;  3GLG B;  5D5C A;  2R62 A;  2ZNX Y;  4WMG A;  2BWE A;  2MGW A;  2VF8 A;  2K9D A;  4WW0 A;  4NXN M;  1YAN A;  2QB0 B;  4RLN A;  4KPM A;  3HTB A;  2DAE A;  1GB9 A;  4DJH A;  1GVN A;  3TMU A;  2DKV A;  3J27 B;  3GO8 A;  1JQJ C;  2QCU A;  3A94 A;  1LMN A;  4NG8 A;  2B72 A;  2KW0 A;  1L2B A;  4NC6 A;  108L A;  4CFO A;  1DYC A;  1LSN A;  3FRH A;  1QVR A;  1C08 C;  1QTB A;  2B74 A;  4Y28 F;  1L2C A;  2D91 A;  1NSF A;  1P6Y A;  237L A;  1RJC B;  2F30 A;  1OKS A;  1N34 M;  4H9A A;  3TXK A;  2XBS A;  1WTM A;  1QTH A;  2BJV A;  3WMK A;  1L31 A;  3CTW B;  4W52 A;  1IQP A;  4DKL A;  5BPV A;  3GUL A;  1YAP A;  2JNH A;  1CV6 A;  2QBY B;  1LYG A;  242L A;  4H9C A;  4LRT A;  1N75 A;  1YLA A;  3VLF B;  4IBF A;  2QP9 X;  1C68 A;  4EKR A;  1LSZ A;  4GCB A;  2D4K A;  4M9X A;  4CGY B;  1KY1 A;  1R7R A;  2CJL A;  4XJG A;  4IBI A;  2RGH A;  3L25 A;  1L30 A;  199L A;  2YBH A;  1BQL Y;  1WGN A;  2MJ5 B;  4MH0 E;  2W1M A;  4NGI A;  1G71 A;  1QUS A;  2QEN A;  1XGP C;  5APF A;  4NHS A;  4S12 A;  1LWG A;  2HEA A;  5FTN A;  4AGA A;  4MGH A;  1JR3 A;  3WU9 A;  5IEL A;  3HU9 A;  1QT8 A;  1L12 A;  4LZT A;  2APL A;  2BQD A;  5LVJ A;  1H6U A;  2KDL A;  1L29 A;  1V7S A;  3SN6 R;  1L58 A;  1IOC A;  3CB7 A;  1TLA A;  4I0C A;  4IAS A;  4B4I A;  1TTE A;  5EP3 A;  1QAN A;  3GLI A;  1LHI A;  248L A;  3VK8 A;  190L A;  1T6H A;  4AI6 A;  1IFY A;  1L1Z A;  1IC5 Y;  3WXT A;  4TSC A;  4DV3 M;  2WSF F;  3AJI B;  1LSY A;  1G0Q A;  1LYI A;  3N9A A;  3ZQJ A;  4GLA A;  1XEI A;  1VQ1 A;  149L A;  4D81 A;  1L52 A;  251L A;  230L A;  4H92 A;  4LDE A;  1INU A;  154L A;  5C6I A;  2A7F A;  4B7F A;  1B2K A;  2KNV A;  1Z6T A;  4JV5 M;  1Z5A A;  3HX3 A;  3C7W A;  3U6E A;  2OO9 A;  2R4J A;  2YFQ A;  3B7Z A;  1F4I A;  4MB7 A;  2XGN A;  1IP7 A;  1UFZ A;  2EUC A;  3GUJ A;  1GFH A;  3GRY A;  3AZ5 A;  3FKE A;  1HEM A;  2IFF Y;  1BB7 A;  223L A;  3WUN A;  1L59 A;  5I53 A;  1QQW A;  2Z4R A;  1IXZ A;  4B3M M;  155L A;  4OVZ A;  1P37 A;  1HQY E;  4NY5 A;  4OOT A;  4P2E A;  1RE2 A;  4ARM B;  1UCO A;  4G3O A;  137L A;  2YVB A;  1V34 A;  3L2A A;  225L A;  1IM2 A;  3Q8G A;  4RW2 A;  3B7N A;  250L A;  4YEM A;  2DHY A;  2BLY A;  2L7I A;  234L A;  2Q9D A;  1GF8 A;  3G3A B;  1KIQ C;  1CJ9 A;  1LYJ A;  3LYT A;  1IXS B;  5FTK A;  2A5Y B;  1GF5 A;  1FKV A;  1XXH A;  5KXO A;  1NKH A;  2Z2E A;  3IWR A;  4N9R A;  2LVA A;  1N78 A;  4H9E A;  1L09 A;  2L6O A;  4L15 A;  1PQK A;  4NGK A;  1DGF A;  4TUW A;  4HJV A;  3LN2 A;  3GLF E;  3FUU A;  4K0K M;  114L A;  4WM1 A;  2CV1 A;  1QS5 A;  2RBQ A;  1HJP A;  2JY5 A;  3FUX A;  1GE0 A;  4I7J A;  1N33 M;  3HU3 A;  3PXG A;  1NHG C;  1OUF A;  2B75 A;  4G4H A;  2ZAN A;  4LDL A;  1DGH B;  5L8R F;  3T38 A;  1YL0 X;  1HSW A;  2C8P A;  1DYE A;  1LZ9 A;  3KSX A;  4Z98 A;  2XQO A;  1TDY A;  4YXC A;  2LVO C;  1ZQ9 A;  177L A;  168L A;  1IN8 A;  1G7L C;  3W0L B;  2CE7 A;  2VQF M;  7LYZ A;  1L25 A;  1CU2 A;  1YQV Y;  4EPF A;  2LHC A;  1L54 A;  2XEP A;  1NDM C;  3DN2 A;  1KIR C;  1L35 A;  1JIT A;  1L65 A;  1CUQ A;  1IR7 A;  1L86 A;  1NV8 A;  5L9J A;  4KL7 A;  1ZUR A;  2XLJ A;  3ZH9 B;  4JI2 M;  4HTN A;  4RDS A;  5IDD A;  4ITQ A;  4LDO A;  2EPE A;  1B7N A;  2FS1 A;  3P68 A;  103L A;  1IOS A;  1E8L A;  3UMM A;  3WHL A;  4XJF A;  1OUJ A;  4W56 A;  2UU9 M;  1JIS A;  1C6A A;  3KXE C;  5FTL A;  2CV0 A;  4NGV A;  2F5Q A;  2C9C A;  3J7A S;  3HJQ A;  4Z6Y A;  1IP2 A;  110L A;  4EKS A;  5LYM A;  2KEB A;  1L82 A;  2RKO A;  4DR4 M;  2F5P A;  2DQE Y;  1VED A;  1ZAE A;  2UUB M;  1IY2 A;  2G4P A;  3FI5 A;  1L40 A;  1QTC A;  1G8P A;  4DBG B;  1SSY A;  1T43 A;  198L A;  4FWD A;  2AUB A;  3WPK A;  2F4A A;  2I25 L;  1C6K A;  1AT5 A;  4N5R A;  1GBZ A;  2YQZ A;  3AZ7 A;  3T6P A;  3LCU A;  1B7O A;  3P64 A;  1LSG A;  4NEB A;  1CJ8 A;  2RRU A;  1P5C A;  3KP1 E;  1CKC A;  4M9Z A;  3HHZ A;  1L18 A;  1OUD A;  1TDH A;  1WQQ A;  1CKH A;  2W82 A;  1QUT A;  3VK7 A;  3HHY A;  4PDG A;  2JP7 A;  1JKB A;  2JZ0 A;  1GB0 A;  1L15 A;  1ALC A;  3OE9 A;  2FOI C;  5FHW A;  1P2L A;  4B08 A;  4AKG A;  3FE0 A;  3WPJ A;  2J7O A;  5KXY A;  2Z4S A;  1MJG M;  4DV6 M;  1UIC A;  1DI4 A;  1L04 A;  1OV5 A;  1SQ2 L;  2ANV A;  4NRV A;  2XSZ A;  138L A;  1IOT A;  5FTM A;  5KPR A;  1FLW A;  5LVH A;  1KXW A;  2DZO B;  5KXW A;  2YNM D;  1OUE A;  2RBN A;  1HFY A;  2LBC A;  2HEC A;  1NY6 A;  3VKG A;  1BB5 A;  2Y0T A;  1IXS A;  1J7K A;  1R5L A;  1L75 A;  2BQK A;  2QZ4 A;  1BB3 A;  3DNA A;  1PJJ A;  260L A;  2KXE A;  126L A;  2VQE M;  2DNA A;  262L A;  1GB2 A;  1LZS A;  2G8L A;  1GFK A;  1L57 A;  5I54 A;  1H87 A;  2CHG A;  4J7V A;  2ZYP A;  1LJK A;  4PCZ A;  5GKN A;  1L63 A;  2H5Z A;  1NVM A;  1ZMU A;  1ZVH L;  3HFM Y;  3HU8 A;  4LT3 A;  4XJD A;  1HNL A;  4EKQ A;  5FCP A;  3NBI A;  2O01 F;  1LYE A;  3UZU A;  1L01 A;  4LYB A;  1HEW A;  1N32 M;  1CU0 A;  3AZ6 A;  2D4J A;  2LZM A;  1LLH A;  4NG1 A;  1CKD A;  4I7Q A;  4LF9 M;  1C6F A;  3N9E A;  3R8F A;  2BQG A;  2I26 L;  1L43 A;  1MLC E;  1NNU C;  1QTE A;  2LNH C;  4N8Z A;  2D7H A;  1OP9 B;  200L A;  1D6P A;  1LMP A;  5JI2 E;  192L A;  5AMY A;  4OWH A;  1LJ4 A;  189L A;  3KOW E;  1TH4 A;  1L07 A;  194L A;  1IBM M;  1BVS A;  1W5T A;  1TEW A;  4GIT A;  5JEN B;  1KY0 A;  4E97 A;  2BQF A;  5FLX S;  1SXJ C;  196L A;  2BQJ A;  2XF3 A;  3K9O A;  3SYL A;  4W55 A;  1L21 A;  5KXM A;  1HML A;  1SXJ D;  1D9U A;  1TGU A;  2ZIK A;  4ETA A;  1UIA A;  4HSF A;  1DKJ A;  4GN5 C;  2FFJ A;  1GAY A;  4BAF A;  4JYA M;  2Y0Q A;  3KS4 A;  4AKH A;  3U6O A;  4YOP A;  1L42 A;  3DKE X;  1ZYT A;  146L A;  1I20 A;  5DN5 A;  1J1P Y;  1LJH A;  4W53 A;  3BXW A;  1BVK C;  3E9S A;  3HUK A;  2DAG A;  2M5Z A;  127L A;  3AOE C;  4DDB A;  5HNC A;  222L A;  2JA2 A;  1DYB A;  1UAC Y;  2DQC Y;  212L A;  2XTH A;  2Y8P A;  4LFA M;  2H1R A;  115L A;  1GE3 A;  1L66 A;  5C18 A;  1C69 A;  2KZU A;  2YBM A;  2DKL A;  5IRE B;  1TH3 A;  161L A;  1HQC A;  1CUK A;  2GQF A;  1IP5 A;  2MEC A;  4DV2 M;  256L A;  3AW7 A;  3M18 B;  2CUZ A;  5F81 A;  3V2W A;  1L17 A;  1DYA A;  1L27 A;  2B5Z A;  4PPO A;  5LAG A;  2DWM A;  3A92 A;  4IBC A;  158L A;  1JPO A;  4WLT A;  4KT0 F;  4DQJ A;  4AW4 A;  4BBA A;  1G4A E;  1L00 A;  4WLD A;  3FA0 A;  1W5S A;  186L A;  1SXJ B;  3SMP A;  1F6R A;  3HH3 A;  1IOQ A;  5D5F A;  1C45 A;  4JI1 M;  4NHP A;  2MRO B;  4M4O A;  2B73 A;  3ZVQ B;  5DLA A;  139L A;  1LHL A;  3GPY A;  4IBD A;  1L44 A;  1HFX A;  4ET8 A;  4DC4 A;  2MEE A;  4A7D A;  2C96 A;  2UUA M;  1LI2 A;  3B74 A;  1OQM A;  3DN1 A;  1JR3 E;  1GEV A;  2ZNW Y;  2MEH A;  2KA6 B;  3KOZ E;  2HU3 A;  4M0D A;  4QGZ A;  3T1Y M;  3OK0 A;  1GFG A;  1L02 A;  2B6X A;  4FCW A;  1FDL Y;  4L16 A;  4QHS A;  4LJ4 A;  3TXB A;  1NO1 A;  1JKA A;  3GLI E;  1PZY A;  3HWS A;  4MST A;  151L A;  4HTQ A;  2OOA A;  4NGY A;  1GFU A;  2V1U A;  5FDJ A;  3SB6 A;  1LGX A;  3WYH A;  2D6B A;  5B59 A;  5KXK A;  1L46 A;  5ITX A;  2DEN A;  5LAF A;  1OVJ A;  3FRI A;  1FLU A;  4GBR B;  3JR4 A;  4LF8 M;  2LZT A;  1D0K A;  1KSF X;  3HHW A;  1HER A;  2XFS A;  1PRB A;  5ITQ A;  3FTC A;  3TQS A;  3AGH A;  3SP3 A;  1C6D A;  1JTT L;  1OUI A;  1F10 A;  5HMJ A;  4N1C C;  3TPZ A;  2HUK A;  5II3 A;  1C6T A;  4DDC A;  156L A;  1LSB A;  1VDQ A;  3U6P A;  5HMV A;  2Z12 A;  5DYG A;  1L11 A;  1VEK A;  3B89 A;  4JI0 M;  1QT4 A;  4G4N A;  2LTU A;  2M60 A;  1R6B X;  1HNZ M;  4L6V 6;  227L A;  3IG5 A;  1IN6 A;  1HT2 E;  1OUB A;  1L91 A;  1LZT A;  4XJI A;  2HED A;  4FWH A;  1C6L A;  4M6D A;  1OFI A;  4HV1 A;  5KXX A;  2RB2 X;  3FUV A;  1GFV A;  2H5X A;  1VEG A;  5LMU M;  1CKF A;  2YBJ A;  3R9X B;  4G49 A;  5KO3 A;  5EXT A;  1NNJ A;  1L39 A;  1WQR A;  1EE8 A;  2BPU A;  1WIV A;  2YR0 A;  3HTF A;  1QTD A;  4RLM A;  1XSF A;  4ZPX A;  3L64 A;  4L4U A;  1L89 A;  1A2Y C;  1L05 A;  1R2Z A;  1K3X A;  1FLY A;  140L A;  207L A;  3AYQ A;  3EIH A;  123L A;  1IY1 A;  4UN2 B;  1JJ1 A;  2L4F A;  1QSQ A;  1OQY A;  4MGZ E;  1XXH E;  3M0E A;  2YBI A;  3CF0 A;  2JWS A;  4IJE A;  4LJ5 A;  132L A;  4KOD A;  1KXY A;  1TCY A;  3RUN A;  2X0A A;  2Z3X A;  5KY1 A;  3KP0 E;  4LF6 M;  1R4G A;  1LMT A;  4LZJ A;  2HU1 A;  2FE8 A;  1JWR A;  4PDI A;  2R18 A;  4ARQ B;  2O7A A;  3SAS A;  1LMA A;  4O34 A;  1GWD A;  2NWD X;  2R45 A;  3VDP A;  4GCF A;  3QNG A;  3FUW A;  3IJU A;  5KXP A;  3P66 A;  3KW6 A;  2PC2 A;  2BQN A;  1UC0 A;  1GFA A;  4GCD A;  3SMS A;  1XEJ A;  4NSJ A;  1L85 A;  3FUT A;  3HDF A;  1BWJ A;  4H93 A;  1L87 A;  3UON A;  4LGM A;  4JI6 M;  2DI0 A;  1QUG A;  259L A;  4YF2 A;  3HBE X;  2Z7J A;  1JKC A;  3CDV A;  3CDR A;  5LMN M;  3J6K A;  4IJ4 A;  150L A;  2JY8 A;  1KS3 A;  4DV4 M;  5LA8 A;  1YSY A;  4GC9 A;  3H4M A;  215L A;  4GC5 A;  1T3P A;  2DQJ Y;  3A93 A;  3DZD A;  3DMV A;  4XEN A;  3TXD A;  1GBW A;  2OE9 X;  173L A;  3A95 A;  4LJ8 A;  165L A;  3RZE A;  3ULR A;  4II8 A;  3SAR A;  1B5W A;  1LZC A;  4QOS A;  1IBL M;  2HUL A;  4B3T M;  1L36 A;  4OWE A;  3GLH B;  3Q8X A;  3AOE A;  3MMP A;  1RI8 B;  4I7P A;  1XGU C;  2R0I A;  3GUK A;  2LH0 A;  1GB6 A;  1UIG A;  3UJN A;  4ETD A;  1LI6 A;  5B1G A;  4ANR A;  1OUH A;  3HU1 A;  3F8V A;  2DQF C;  3A45 A;  4MCK A;  3AV0 A;  2F2Q A;  1LHH A;  1IVM A;  4I7L A;  1R2Y A;  4I7R A;  1JTN A;  1Q39 A;  183L A;  5ILF A;  3J7B A;  1UM8 A;  1LYZ A;  1UIE A;  8LYZ A;  3UK6 A;  2LVQ D;  3L26 A;  4LYM A;  216L A;  4YHH M;  3B0K A;  1G06 A;  2LWX A;  3MHV C;  5E9R A;  2NQ8 C;  3QYE A;  4PHI A;  128L A;  1BWI A;  1LZ1 A;  4H9I A;  1HNW M;  2BNK A;  3K2L A;  3HU2 A;  1QT7 A;  5FST A;  5L3H A;  3RE8 A;  2EO2 A;  1CV1 A;  3LZ2 A;  6LYT A;  5T3F A;  1QYR A;  3U5Z B;  4PJZ A;  1LSA A;  2UUC M;  2UXD M;  4AXT A;  2B6W A;  3M3U A;  5HQ1 A;  1L49 A;  4J1B A;  2DHR A;  3HT8 A;  1C6H A;  2VF7 A;  3QE8 A;  4L8R C;  3W6D A;  2G4N A;  1QUO A;  4WUR A;  3K9P A;  1E94 E;  3A67 Y;  1WQN A;  3PBL A;  3LMM A;  4LF7 M;  188L A;  1FBI X;  4DR7 M;  2MEA A;  1XMO M;  3OE8 A;  4NWE A;  3DA1 A;  4XN6 A;  3C8S A;  2LHG A;  1DI5 A;  3HT9 A;  3CDQ A;  2DVW B;  3ZC7 B;  254L A;  4W5W A;  1VAT A;  4LYZ A;  2XFT A;  2DZN B;  1L28 A;  4B7H A;  1QTZ A;  2CFO A;  5EBH A;  3C9P A;  4WM2 A;  1P2R A;  3HBH A;  1IWW A;  1HR0 M;  1XWI A;  2K47 A;  3ODU A;  2CRU A;  246L A;  3QYB A;  2DQD Y;  1QDT A;  1L77 A;  2ZIL A;  1L79 A;  3GLG A;  4PJ2 C;  4LGY A;  184L A;  1G0P A;  4ARQ A;  3JR6 A;  3CF6 E;  1L67 A;  4QY9 A;  3DN8 A;  4DUY M;  4FJR A;  4II7 A;  1GAZ A;  1ZMY L;  2XJW A;  3P65 A;  1LYF A;  3KSJ A;  1IY0 A;  2OOB A;  1LZE A;  1OTR A;  1C46 A;  257L A;  4U3X B;  3C83 A;  3BKH A;  4ZFP A;  2MEG A;  1G7H C;  2OE7 X;  3RT5 X;  1L08 A;  1KIP C;  1B9O A;  1L10 A;  1C6B A;  3U6L A;  229L A;  1NWG A;  4NHI A;  2BQE A;  1CV4 A;  5IT9 S;  1G0L A;  2HUB A;  2B3T A;  2L09 A;  3LQQ A;  1VEJ A;  2F4G A;  3RGS A;  1JB0 F;  2FYD A;  1YUB A;  3LYO A;  4QHT A;  4EPI A;  4C5F A;  4NSI A;  3FYC A;  1LHJ A;  1LMC A;  2EKS C;  166L A;  4WO6 A;  1D2N A;  2YBN A;  1L70 A;  1GF7 A;  3D4S A;  1D3J A;  4X66 M;  2AHM A;  4X65 M;  104L A;  3HT6 A;  1GAB A;  3G3X A;  1LZ5 A;  4R7G A;  3KVW A;  1T97 A;  1CX7 A;  2UXC M;  1PJI A;  244L A;  5EJC A;  5I14 A;  1OUG A;  2QBY A;  6LYZ A;  3DMZ A;  1XEP A;  3DN6 A;  9LYZ A;  4MGI E;  1T6V L;  3GLH A;  1NBY C;  1VDS A;  3A3R X;  5KXZ A;  5KPZ A;  3LW5 F;  3QWL A;  1KW7 A;  4DR2 M;  3C3E A;  1QS9 A;  2HAK A;  3SBA A;  5J7C A;  2L78 A;  3SAV A;  1JIY A;  4LGK A;  2CHQ A;  1JKD A;  4QEQ A;  3J81 S;  3HJS A;  3UGJ A;  1L16 A;  1YAO A;  2CHV A;  1B5U A;  4IBE A;  2KHH A;  5F14 A;  1IWZ A;  1J09 A;  2R6F A;  2OTY X;  1L14 A;  4DR5 M;  1LZ8 A;  3TE6 A;  5LVG A;  243L A;  4LT2 A;  1G41 A;  1L37 A;  5DYI A;  4G6Z A;  143L A;  1GLN A;  4WM6 A;  2CEA A;  1H6M A;  4I7O A;  3A90 A;  4I7M A;  3AGG G;  4ETC A;  5IZ7 D;  1IWY A;  1L32 A;  3QY4 A;  4XJB A;  1L84 A;  4NRW A;  135L A;  5I4W A;  3DMX A;  1OJL A;  5EQT A;  3L29 A;  3I01 M;  1SSW A;  1C1K A;  1SX2 A;  2FYC A;  1LKR A;  3C8Q A;  1YAQ A;  4LZZ A;  1E9R A;  1ZMW A;  2I7N A;  5H37 D;  5KXN A;  3SB7 A;  5APD A;  5E4P A;  2P5T A;  2ZQ4 A;  1J1O Y;  4H90 A;  3ILK A;  4TX7 A;  1L69 A;  2D7G A;  1C6E A;  4F2L A;  4DV5 M;  4IBB A;  3GLF B;  1HC0 A;  4JXJ A;  2XZF A;  1VAU A;  4YM8 A;  1NQI A;  2G4Q A;  3RW8 A;  3TXJ A;  2XZU A;  2LZ2 A;  3GUN A;  1LYH A;  5A3E A;  1N4F A;  1D9W A;  3SFZ A;  2HWJ A;  3LCV B;  1WQM A;  2ZYC A;  185L A;  2OU0 X;  4BAP A;  4W54 A;  3A42 A;  4ZPU A;  1HHL A;  1D3F A;  4NHQ A;  112L A;  1WHC A;  1L51 A;  5FEK A;  2ZQ3 A;  4WLY A;  164L A;  4GHL A;  3HH4 A;  3QAU A;  1C67 A;  1UIB A;  1IY3 A;  4N0J A;  1FN5 A;  1FNN A;  5ITX E;  3G3V A;  3FTD A;  1L68 A;  1L94 A;  1I6S A;  1C62 A;  1HNX M;  1GDX A;  2CGI A;  1AKI A;  4ARM A;  4ETB A;  4AKI A;  3GXK A;  4TUN A;  1GBX A;  1OYU A;  4B4J A;  4MM3 B;  1GF9 A;  2L4E A;  4WL6 A;  2ZAO A;  4MR1 A;  1GBS A;  1GDW A;  3A34 A;  4W51 A;  1CV5 A;  2DWZ B;  1LGU A;  1IN5 A;  1JQU A;  3RFW A;  5F3W A;  2QHO B;  1B7Q A;  2MH8 A;  2BLX A;  2RBR A;  3RGP A;  3U6M A;  1NY5 A;  4B3S M;  2ERC A;  3THG A;  3TL4 X;  4F1I A;  3WPL A;  1LSP A;  4GN3 A;  4TWS A;  231L A;  4NFV A;  3J2P B;  1OUC A;  2ZM6 M;  4OWB A;  4RF1 A;  1LHM A;  4LYC A;  4FD2 A;  2BWB A;  7LZM A;  4CIS A;  4N1E I;  3HBD A;  4LYO A;  2QPA A;  1O23 A;  1UID A;  4NWH A;  5IWA M;  4I7S A;  3K3T A;  1DGH A;  2RB0 X;  1L61 A;  1OUA A;  4LJ6 A;  4YY3 M;  2LC9 A;  1DXJ A;  120L A;  2HCB A;  4LT1 A;  1GL7 A;  1L81 A;  4EKP A;  3VKH A;  1L83 A;  1EIJ A;  1BHZ A;  2BJW A;  3A6C Y;  3HJ8 A;  3BBZ A;  174L A;  2VB1 A;  3CT5 A;  2C98 A;  2V6Z M;  1GB5 A;  3TXI A;  1K3W A;  1G0K A;  3LYM A;  4EXM A;  1CV0 A;  2OPF A;  3W68 A;  152L A;  3GQ3 A;  1LSM A;  1QSA A;  4RNA A;  148L E;  2O79 A;  1B7P A;  5I5Q A;  2YBL A;  1ZV5 L;  3HDE A;  261L A;  4LRS A;  4FVM A;  3U6D A;  2HHH M;  1LPY A;  4RW1 A;  1IO5 A;  4LF4 M;  1LZY A;  4H8Z A;  4DD9 A;  1B5V A;  1BWH A;  1C6J A;  3A96 A;  3FD9 A;  2DWL A;  3CGW A;  3SHG B;  2RH1 A;  3WUL A;  175L A;  5KXT A;  1L55 A;  1L06 A;  1QIO A;  4HJY A;  4W57 A;  3OJP A;  2BAA A;  1B7L A;  4LYT A;  3TWK A;  1W6Z A;  2Z8Y M;  4DV0 M;  2OU9 A;  3W3E A;  4DDA A;  4R71 A;  169L A;  4CHT B;  5M1Y A;  1P3Q Q;  2D7E A;  1WTN A;  1LJF A;  4X62 M;  3C80 A;  4QNM A;  1L95 A;  4I8O A;  2HEE A;  1BGI A;  1LZG A;  2BQH A;  1G0G A;  1PJS A;  3D3D A;  3T15 A;  3C58 A;  1GB3 A;  5APC A;  3GPP A;  2OTZ X;  4UWN A;  3ATO A;  5EP4 A;  238L A;  4JI3 M;  4KO8 A;  4DD0 A;  1L19 A;  197L A;  4I5S A;  2FNA A;  1RFP A;  2EJS A;  210L A;  1N36 M;  2DAI A;  1QDR A;  1L23 A;  5F9X A;  2ZTD A;  4YXA C;  4NGJ A;  3TXE A;  4W94 A;  1IWX A;  206L A;  1XFP L;  1I56 A;  2C9O A;  3M6A A;  4I4L A;  2J5Y A;  4WL7 A;  1RU3 A;  247L A;  3NY9 A;  5EP1 A;  3WVY A;  3E3D A;  1C6P A;  5B07 A;  3D8L A;  1GL6 A;  1HSX A;  3RNX A;  122L A;  3G3B B;  4TTD A;  3B9P A;  1QT6 A;  1WGL A;  1G07 A;  1NDG C;  1G1V A;  4NIJ A;  3CDO A;  1DO2 A;  4H1P A;  4H8Y A;  163L A;  1P2C C;  4LZM A;  5E26 A;  1QSB A;  1JTO L;  2XBR A;  1LZR A;  2B7X A;  1VFB C;  4BAD A;  4DT3 A;  4M9S A;  241L A;  3B6L A;  4I8S A;  3C7Z A;  1QUH A;  3I51 A;  1DZB X;  213L A;  5APE A;  1JR3 D;  3TWL A;  2ZBK B;  1L71 A;  4QNR A;  4LFX A;  3IG8 A;  4FWG A;  3K8Z A;  1CNS A;  2LVP C;  1XNQ M;  240L A;  1Z55 A;  1JSE A;  4XYY A;  4LY6 A;  3A6B Y;  2BQO A;  3HH5 A;  2LHM A;  4S0W A;  1NMM A;  3U61 B;  3LQR A;  4R0F A;  2Z39 A;  5DL9 A;  2EQL A;  3WW6 A;  1TF0 B;  2R46 A;  1TBY A;  1WQO A;  2OEA X;  5LIN A;  2A4T A;  1NV9 A;  4GCC A;  1BB4 A;  4UWU A;  3BOS A;  1VDP A;  4LFC M;  2RB1 X;  2W1Y A;  1Z59 A;  5ITY A;  4EJ4 A;  1EQE A;  214L A;  4DD3 A;  160L A;  1CKG A;  1GHL A;  159L A;  5ITR A;  1YIL A;  4C3W A;  2OQ4 A;  2EIZ C;  4XAD A;  3GLG E;  1C63 A;  4CJ2 A;  5DN4 A;  2I6Z A;  2WSE F;  3I04 M;  217L A;  4ARL A;  4W58 A;  1LPI A;  1OWY A;  1EL1 A;  1EQ5 A;  172L A;  2B6T A;  4H8X A;  3GUO A;  4LJ9 A;  4KT3 A;  220L A;  2BQM A;  1L26 A;  2Z2F A;  3KDS E;  4LJA A;  1UUZ C;  1REY A;  2X8A A;  1TDZ A;  3W6A A;  1KNI A;  4H9F A;  4B3R M;  1C6N A;  2Z6B A;  133L A;  3NWL A;  2RBS A;  3FTE A;  3V76 A;  5KKI A;  5DNY A;  2BQA A;  1NHW C;  3IHP A;  5KXS A;  125L A;  4NGW A;  1F6S A;  4IBG A;  2DZL A;  3GLI B;  4ARJ A;  4DD1 A;  1HEO A;  4I7K A;  2JY7 A;  1GJS A;  1GD6 A;  1JJ3 A;  1NBZ C;  1LWK A;  1D0M A;  181L A;  1CVK A;  1REM A;  3CSQ A;  3OE0 A;  2Z18 A;  5ITT A;  4GLV A;  1SWY A;  3W67 A;  245L A;  1DGG A;  4DR3 M;  4GIP A;  1JTM A;  3EIE A;  1HFZ A;  1G3I A;  3FE3 A;  4GEW A;  1CJ6 A;  6LZM A;  4HL4 A;  2MEI A;  1GPQ C;  5C6J A;  1YL1 X;  2Q9E A;  2WAR A;  3V2Y A;  1IWV A;  5KKJ A;  1XHB A;  2Y21 A;  4Z8X A;  3GRV A;  1PQJ A;  258L A;  2BQL A;  1JTP L;  1DO0 A;  3E46 A;  1YE9 A;  1MEL L;  4CFP A;  1C7Y A;  1C43 A;  1L73 A;  4I7T A;  2X4A A;  1B5Z A;  3EBA B;  1T8A A;  3WL2 A;  1SXJ A;  3HT7 A;  1IP1 A;  2R44 A;  4OVZ B;  1UA6 Y;  3ZVQ A;  4OOO A;  4R6C A;  2CDS A;  3AOG A;  1LZA A;  1L53 A;  1TR8 A;  3PDS A;  1K82 A;  5E6J A;  2I7P A;  2XH9 A;  4BLC A;  1L62 A;  1GB8 A;  1L97 A;  1L88 A;  235L A;  1LHK A;  3K92 A;  3GQ5 A;  1E9S A;  4FCV A;  2J7N A;  1Q02 A;  5KQD A;  3GRU A;  2QSF X;  1DYF A;  3F9L A;  4RF0 A;  1LJI A;  2N35 A;  1LI3 A;  1XB2 B;  5B06 A;  4EIW A;  3NY8 A;  2NTG A;  2Q2E B;  4WG1 A;  1PJQ A;  170L A;  1C6C A;  1IOR A;  1YKX X;  2C8O A;  3MJ5 A;  2GV0 A;  1XXH B;  4AZF A;  1C7P A;  4GRI A;  1LKS A;  3CSR A;  3DN0 A;  5F16 A;  1L74 A;  4YX7 C;  1PS5 A;  4LT0 A;  1EPY A;  1VG5 A;  2B6Y A;  3QAK A;  4D82 A;  1HEN A;  4NSH A;  2DAK A;  3ATN A;  2RAZ X;  3B0I A;  1HT1 E;  3U61 A;  129L A;  3GRR A;  1T8F A;  1LYS A;  2K0B X;  1Q3B A;  4D9Z A;  1SX7 A;  3GPU A;  4GKJ M;  178L A;  1JSF A;  3AGI A;  5F9U A;  2LVN C;  2LYO A;  2KNA A;  1L80 A;  3AKZ A;  2F4V M;  2DQG Y;  2Q0M X;  1D0L A;  4PT5 A;  1L2D A;  1GXV 2;  3WU8 A;  5HLL A;  2EKF A;  1LYD A;  4Q7J A;  2DQH Y;  1WJ7 A;  3W6C A;  211L A;  167L A;  1GO5 A;  3WHK A;  4FCT A;  3L28 A;  1IR9 A;  1L34 A;  2QQ8 A;  1DV0 A;  1G1W A;  3DOA A;  4PRQ A;  1LYY A;  2CWB A;  1QSW A;  1YRO A;  4OO9 A;  1ZVY B;  1C6G A;  1L41 A;  1A5T A;  2DXI A;  1GE2 A;  3FI7 A;  2LXE A;  1L48 A;  1Y8G A;  3HWL A;  3VFD A;  1CUP A;  1L64 A;  4D80 A;  3SB5 A;  1QTV A;  4ET9 A;  2F5O A;  1YAM A;  224L A;  2FBB A;  1Q3C A;  4KLN A;  4YEO A;  1OAI A;  1PQI A;  3C7Y A;  2BQC A;  2C99 A;  1HMK A;  1L24 A;  1NHB A;  1G7M C;  3GXR A;  5JI3 E;  4LJ7 A;  4MGY E;  1L72 A;  226L A;  3LZT A;  1HEQ A;  1W08 A;  2XSZ D;  1VDL A;  1D3N A;  3L27 A;  2JY6 B;  4CHX A;  3SB8 A;  3B72 A;  1VDD A;  3CT0 A;  3FTF A;  4PD2 A;  1X37 A;  2VII A;  1REZ A;  1SWZ A;  1VDT A;  1P3N A;  4WLX A;  1PQO A;  2F5S A;  1GB7 A;  1L98 A;  3SBB C;  1SG9 A;  2ZIJ A;  1C6Q A;  3JR5 A;  1MU5 A;  4GMQ A;  1YKZ X;  4B7G A;  4KHP M;  3SC3 A;  1DGB A;  4IAT A;  1B7M A;  3HUQ A;  2DBT A;  4DR1 M;  1L38 A;  2OU8 A;  3KOY E;  3T6U A;  4WP2 A;  5ITU A;  141L A;  1XJU A;  3HHX A;  1B7R A;  3PVS A;  236L A;  253L A;  3WUM A;  1LMQ A;  1UBZ A;  2Y20 A;  5I4X A;  239L A;  4NSO B;  1NJF A;  1WQP A;  255L A;  3TXH A;  1JJ0 A;  195L A;  1C6M A;  4UWV A;  3GUP A;  1IBK M;  2W1L A;  4NGL A;  1LGW A;  5KJ9 A;  118L A;  3TMV A;  1IC4 Y;  4H91 A;  2R65 A;  1B5X A;  4DYG A;  1L03 A;  2HTX A;  4G4Q A;  1GFT A;  3DFZ A;  4HV2 A;  4NSG A;  4XK8 F;  2MED A;  1LZ4 A;  2B70 A;  4HLQ A;  4ETE A;  3SHF A;  1DYD A;  1XJT A;  3SB9 A;  1SLY A;  1MX0 A;  3W0F A;  119L A;  3AW6 A;  1JEF A;  4FW9 A;  4Z41 A;  1PGY A;  1GBO A;  5EXS A;  1LZD A;  1N77 A;  1C10 A;  1GBY A;  4I7N A;  5EP2 A;  4ZEE A;  3MK6 A;  2O4W A;  1V92 A;  7CAT A;  219L A;  5LVK A;  3K1J A;  1L96 A;  3NBX X;  3GUM A;  1L76 A;  4GCE A;  1XGQ C;  5A3Z A;  1XMQ M;  2L7H A;  4DR6 M;  1OAO C;  1AZF A;  2RBP A;  1ORY B;  4XBO A;  1T6O A;  1B5Y A;  5I4Y A;  3TWM A;  1GF0 A;  1P36 A;  1FLQ A;  1DI3 A;  5HNL A;  1LJN A;  2K6B A;  5FSW A;  2RSC A;  3CT1 A;  4NGZ A;  4L41 A;  1F0W A;  4W59 A;  4OW0 A;  1PJT A;  3U5Z A;  1D3M A;  3AFH A;  5FEL A;  2FH0 A;  1L13 A;  233L A;  1AUA A;  1C61 A;  1GXX A;  1YIK A;  2Z37 A;  3A3Q A;  4AQY M;  2V1C A;  1B6I A;  4YEN A;  1KYI A;  1L45 A;  4L78 A;  1LZB A;  1DPX A;  1L1T A;  4IJF A;  4LFB M;  1TAY A;  2RBO A;  1IN7 A;  3PFI A;  3WXU A;  4JN6 A;  1XC8 A;  3C82 A;  5KXL A;  187L A;  3EXD A;  4PGJ B;  3BKV A;  1KXX A;  1XGT C;  111L A;  4GHA A;  1DQJ C;  3CQL A;  107L A;  1IP3 A;  1IWT A;  1PQD A;  1LAA A;  2IHL A;  209L A;  4EOF A;  3T1H M;  1IX0 A;  2JZ1 A;  3J4G A;  4K5Y A;  3TXG A;  1L93 A;  5LIO A;  2MEF A;  4HPI A;  3W6E A;  3D8B A;  3IJV A;  2A7D A;  1GFJ A;  3KOX E;  4REZ A;  2F2N A;  3WVX A;  1BB6 A;  1OV7 A;  1YKY X;  3EMS A;  4NL4 H;  1QQY A;  2C5R A;  1J5E M;  4IBJ A;  1CU3 A;  3OE6 A;  1HEL A;  4EMN A;  1D2Y A;  3VDU A;  1NJG A;  4RKU F;  2CV2 A;  3FYD A;  5KPT A;  162L A;  3WH1 A;  1L0K A;  3PNY A;  3HKP A;  1QZE A;  3N9C A;  3SAW A;  2F5N A;  3WUA A;  1IP4 A;  2E5L M;  1GF4 A;  1C66 A;  1D2W A;  5LVI A;  3MGW A;  5B05 A;  1L22 A;  1RCM A;  4B49 A;  2YSS C;  5LYT A;  4XGI A;  1P64 A;  2ZTC A;  3M7G A;  176L A;  3EO5 A;  3I4Y A;  3RU5 A;  180L A;  4WM3 A;  4AG5 A;  1LSE A;  1WR1 B;  1CTW A;  1GEZ A;  2HEF A;  1KFV A;  3H4J A;  1LJJ A;  4HP0 A;  2LYZ A;  3DN4 A;  3TMX A;  4Z3M A;  1IWU A;  171L A;  4MGK E;  4LFP A;  2QNJ A;  2X49 A;  1BVX A;  1CU6 A;  4E3U A;  5LYZ A;  1P56 A;  3FAD A;  4QOZ C;  1C6I A;  3E21 A;  3T36 A;  3WU7 A;  1T8G A;  3WW5 A;  1LJE A;  3W6B A;  2DQI Y;  1QAM A;  4HTK A;  5ILC A;  1L99 A;  3K2R A;  4LCB A;  1PM5 A;  3OTO M;  4B1A A;  4HJZ A;  3PNV A;  1L0J A;  1IEE A;  2RAY X;  2O5R A;  145L A;  2MR9 A;  4TSB A;  5B1F A;  1IXR C;  191L A;  1OIP A;  2B6Z A;  2FBD A;  3KFU G;  1QT3 A;  142L A;  1OVH A;  2CWI A;  3GQ4 A;  4H94 A;  1DKK A;  2F47 A;  2KRK A;  131L A;  3F6Z A;  4NHT A;  4CJ6 A;  102L A;  3LVV A;  3HGI A;  4OX9 M;  3I4V A;  1NF5 A;  1LOZ A;  3A46 A;  144L A;  1ZV1 A;  3LHM A;  1V33 A;  3B0O A;  1GF3 A;  4DAJ A;  4G4R A;  3JAM S;  1AT6 A; 
#chains in the Genus database with same CATH homology
 4OWA A;  4B4E A;  1WTH A;  1LYO A;  1HF4 A;  1KW5 A;  228L A;  5LXW A;  2H9J A;  1CJ7 A;  1L47 A;  2QAR C;  1EQ4 A;  2LCB A;  134L A;  1LZ6 A;  4DQ7 A;  4QDN A;  3C81 A;  1CV3 A;  2ANX A;  205L A;  1CX6 A;  1L90 A;  5LA5 A;  1XGR C;  218L A;  1K28 A;  1L20 A;  1LJ3 A;  1QUD A;  4IAP A;  1NHE A;  4BS7 A;  1G7I C;  1L60 A;  3DN3 A;  3LYZ A;  3A8Z A;  3HTD A;  4DD2 A;  3AB6 A;  1G7J C;  4XJH A;  1QTK A;  1PQM A;  1L50 A;  4AQN A;  3CSZ A;  1C64 A;  5IHG A;  1OWZ A;  249L A;  1J1X Y;  1LW9 A;  4G4B A;  3GUI A;  4ZIX A;  1L56 A;  3VWO A;  1AM7 A;  1DPW A;  3VW7 A;  2H9K A;  3KAM A;  1G0M A;  1LCN A;  1L92 A;  3P4Z A;  1LMO A;  4WO9 A;  1FKQ A;  4DQ5 A;  4G9S A;  1CU5 A;  201L A;  3CDT A;  3HUA A;  208L A;  1A4V A;  2NTH A;  1GE1 A;  1C65 A;  252L A;  4OW1 A;  2LYM A;  1HEP A;  3A91 A;  2F32 A;  1B7S A;  113L A;  2N5Z A;  3TMW A;  1P46 A;  2IGC A;  2CUU A;  1GFE A;  2BQI A;  4KXI A;  1JHL A;  1IY4 A;  3ZEK A;  1V7T A;  2YDG A;  1G0J A;  3HTG A;  1ZWN A;  1OVK A;  1GF6 A;  1IIZ A;  4HPE A;  4OWC A;  3TXF A;  1REX A;  3AZ4 A;  2HUM A;  1C60 A;  1L33 A;  3HH6 A;  1LSC A;  4J0L A;  232L A;  3EML A;  153L A;  3LZM A;  4DWX A;  2Z38 A;  1IP6 A;  3C8R A;  4DD7 A;  4H9B A;  1IC7 Y;  182L A;  3RZ4 A;  2MEB A;  1GFR A;  2BQB A;  1QT5 A;  1WVV A;  4WM5 A;  1LSF A;  4WG7 A;  4WM4 A;  1JUG A;  3L2X A;  4PK0 A;  3NYA A;  1P7S A;  4GRV A;  1B0D A;  2ZWB A;  4J1A A;  157L A;  5DM9 A;  1LZN A;  4H9H A;  1IR8 A;  1I1Z A;  1WVU A;  5C6L A;  3G3W A;  147L A;  5KXR A;  1XEK A;  4ML7 A;  5K7O A;  130L A;  221L A;  2D4I A;  4ARP A;  1DYG A;  2HEB A;  1LJG A;  4WOA A;  109L A;  2Z19 A;  4PRU A;  1LTM A;  4GN4 A;  1D6Q A;  1LSD A;  2OE4 X;  4CGE A;  4W96 A;  4Z46 A;  4NGO A;  3D9A C;  3W6F A;  4G4C A;  4B0D A;  2W1X A;  1UIF A;  4X3B A;  5LZM A;  2DQA A;  4FDY A;  1UIH A;  1GE4 A;  193L A;  3AJN A;  5L3I A;  5D5C A;  2ZNX Y;  4WMG A;  1YAN A;  2QB0 B;  4RLN A;  4KPM A;  3HTB A;  1GB9 A;  4DJH A;  3TMU A;  2DKV A;  3A94 A;  1LMN A;  4NG8 A;  2B72 A;  108L A;  4CFO A;  1DYC A;  1LSN A;  1C08 C;  1QTB A;  2B74 A;  2D91 A;  1P6Y A;  237L A;  1RJC B;  2F30 A;  4H9A A;  3TXK A;  2XBS A;  1WTM A;  1QTH A;  3WMK A;  1L31 A;  4W52 A;  4DKL A;  3GUL A;  1YAP A;  1CV6 A;  1LYG A;  242L A;  4H9C A;  1C68 A;  4EKR A;  1LSZ A;  4GCB A;  2D4K A;  1KY1 A;  2CJL A;  4XJG A;  1L30 A;  199L A;  2YBH A;  1BQL Y;  2W1M A;  4NGI A;  1QUS A;  1XGP C;  5APF A;  4NHS A;  2HEA A;  1LWG A;  4AGA A;  3WU9 A;  5IEL A;  3HU9 A;  1QT8 A;  1L12 A;  4LZT A;  2BQD A;  5LVJ A;  1L29 A;  1V7S A;  3SN6 R;  1L58 A;  1IOC A;  3CB7 A;  1TLA A;  4I0C A;  4IAS A;  4B4I A;  1LHI A;  248L A;  190L A;  1T6H A;  1IC5 Y;  3WXT A;  4TSC A;  1LSY A;  1G0Q A;  1LYI A;  3N9A A;  4GLA A;  1XEI A;  149L A;  1L52 A;  251L A;  230L A;  4H92 A;  4LDE A;  1INU A;  154L A;  5C6I A;  2A7F A;  1B2K A;  3C7W A;  1IP7 A;  3GUJ A;  1GFH A;  3AZ5 A;  1HEM A;  2IFF Y;  1BB7 A;  223L A;  3WUN A;  1L59 A;  5I53 A;  155L A;  1P37 A;  4NY5 A;  4OOT A;  4P2E A;  1RE2 A;  4ARM B;  1UCO A;  2YVB A;  137L A;  225L A;  4RW2 A;  250L A;  4YEM A;  2BLY A;  234L A;  2Q9D A;  1GF8 A;  3G3A B;  1KIQ C;  1CJ9 A;  3LYT A;  1LYJ A;  1GF5 A;  1FKV A;  5KXO A;  1NKH A;  2Z2E A;  3IWR A;  4N9R A;  4H9E A;  1L09 A;  1PQK A;  4NGK A;  4HJV A;  3LN2 A;  114L A;  4WM1 A;  1QS5 A;  2RBQ A;  1GE0 A;  4I7J A;  1OUF A;  2B75 A;  4G4H A;  4LDL A;  1YL0 X;  1HSW A;  2C8P A;  1DYE A;  1LZ9 A;  4Z98 A;  2XQO A;  1TDY A;  4YXC A;  177L A;  1G7L C;  168L A;  7LYZ A;  1L25 A;  1CU2 A;  1YQV Y;  4EPF A;  1L54 A;  1NDM C;  3DN2 A;  1KIR C;  1L35 A;  1JIT A;  1L65 A;  1CUQ A;  1IR7 A;  1L86 A;  5L9J A;  4KL7 A;  1ZUR A;  4RDS A;  4HTN A;  5IDD A;  4LDO A;  2EPE A;  1B7N A;  3P68 A;  103L A;  1IOS A;  1E8L A;  4XJF A;  1OUJ A;  4W56 A;  1JIS A;  1C6A A;  4NGV A;  1IP2 A;  110L A;  4EKS A;  5LYM A;  1L82 A;  2DQE Y;  1VED A;  3FI5 A;  2G4P A;  1L40 A;  1QTC A;  1SSY A;  198L A;  2AUB A;  3WPK A;  2F4A A;  2I25 L;  1C6K A;  1AT5 A;  4N5R A;  1GBZ A;  3AZ7 A;  1B7O A;  3P64 A;  1LSG A;  4NEB A;  1CJ8 A;  1P5C A;  1CKC A;  1L18 A;  1OUD A;  1WQQ A;  1CKH A;  1QUT A;  1JKB A;  1GB0 A;  1L15 A;  1ALC A;  3OE9 A;  5FHW A;  1P2L A;  3FE0 A;  3WPJ A;  5KXY A;  1UIC A;  1DI4 A;  1L04 A;  1OV5 A;  1SQ2 L;  2ANV A;  138L A;  1IOT A;  5LVH A;  1FLW A;  1KXW A;  5KXW A;  1OUE A;  2RBN A;  1HFY A;  2HEC A;  1BB5 A;  2BQK A;  1L75 A;  1BB3 A;  3DNA A;  260L A;  126L A;  262L A;  1GB2 A;  1LZS A;  1GFK A;  1L57 A;  5I54 A;  1H87 A;  4J7V A;  2ZYP A;  1LJK A;  1L63 A;  2H5Z A;  4LT3 A;  4XJD A;  1ZVH L;  3HFM Y;  3HU8 A;  4EKQ A;  5FCP A;  1HNL A;  1LYE A;  1L01 A;  4LYB A;  1HEW A;  1CU0 A;  3AZ6 A;  2D4J A;  2LZM A;  1LLH A;  4NG1 A;  1CKD A;  4I7Q A;  3N9E A;  1C6F A;  2BQG A;  2I26 L;  1L43 A;  1MLC E;  1QTE A;  4N8Z A;  1OP9 B;  200L A;  1D6P A;  1LMP A;  192L A;  5AMY A;  4OWH A;  1LJ4 A;  189L A;  1L07 A;  194L A;  1TEW A;  5JEN B;  1KY0 A;  4E97 A;  2BQF A;  196L A;  2BQJ A;  4W55 A;  1L21 A;  5KXM A;  1HML A;  1D9U A;  2ZIK A;  4ETA A;  1UIA A;  4HSF A;  1DKJ A;  4GN5 C;  1GAY A;  4BAF A;  4YOP A;  1L42 A;  3DKE X;  1ZYT A;  146L A;  1I20 A;  5DN5 A;  1J1P Y;  1LJH A;  4W53 A;  1BVK C;  3HUK A;  127L A;  4DDB A;  5HNC A;  222L A;  2DQC Y;  1DYB A;  1UAC Y;  212L A;  2XTH A;  2Y8P A;  115L A;  1GE3 A;  1L66 A;  1C69 A;  2YBM A;  161L A;  1IP5 A;  2MEC A;  256L A;  3AW7 A;  3M18 B;  5F81 A;  3V2W A;  1L17 A;  1DYA A;  1L27 A;  2B5Z A;  4PPO A;  5LAG A;  3A92 A;  158L A;  1JPO A;  4WLT A;  4DQJ A;  1L00 A;  4WLD A;  3FA0 A;  186L A;  1F6R A;  3HH3 A;  1IOQ A;  5D5F A;  1C45 A;  4NHP A;  4M4O A;  2B73 A;  3ZVQ B;  5DLA A;  139L A;  1LHL A;  1L44 A;  4ET8 A;  1HFX A;  4DC4 A;  2MEE A;  4A7D A;  1LI2 A;  1OQM A;  3DN1 A;  1GEV A;  2ZNW Y;  2MEH A;  2HU3 A;  4QGZ A;  3OK0 A;  1GFG A;  1L02 A;  2B6X A;  1FDL Y;  3TXB A;  1JKA A;  1PZY A;  4MST A;  151L A;  4HTQ A;  4NGY A;  1GFU A;  5FDJ A;  3SB6 A;  1LGX A;  3WYH A;  2D6B A;  5B59 A;  5KXK A;  1L46 A;  5LAF A;  1OVJ A;  1FLU A;  4GBR B;  2LZT A;  1D0K A;  1HER A;  3SP3 A;  3AGH A;  1C6D A;  1JTT L;  1OUI A;  1F10 A;  5HMJ A;  4N1C C;  2HUK A;  5II3 A;  1C6T A;  4DDC A;  156L A;  1LSB A;  1VDQ A;  5HMV A;  2Z12 A;  1L11 A;  1QT4 A;  227L A;  1OUB A;  1L91 A;  1LZT A;  4XJI A;  2HED A;  1C6L A;  4M6D A;  4HV1 A;  5KXX A;  2RB2 X;  1GFV A;  1CKF A;  2YBJ A;  4G49 A;  1L39 A;  1WQR A;  2BPU A;  3HTF A;  1QTD A;  4RLM A;  1XSF A;  3L64 A;  1L89 A;  1A2Y C;  1L05 A;  1FLY A;  140L A;  207L A;  3AYQ A;  123L A;  1JJ1 A;  1QSQ A;  2YBI A;  132L A;  1KXY A;  3RUN A;  1TCY A;  2X0A A;  5KY1 A;  1LMT A;  2HU1 A;  1JWR A;  4ARQ B;  2O7A A;  1LMA A;  4O34 A;  1GWD A;  2NWD X;  4GCF A;  3QNG A;  3IJU A;  5KXP A;  3P66 A;  2PC2 A;  2BQN A;  1UC0 A;  1GFA A;  4GCD A;  1XEJ A;  4NSJ A;  1L85 A;  3HDF A;  1BWJ A;  4H93 A;  1L87 A;  3UON A;  1QUG A;  259L A;  4YF2 A;  3HBE X;  1JKC A;  3CDV A;  3CDR A;  3J6K A;  4IJ4 A;  150L A;  1KS3 A;  5LA8 A;  215L A;  1T3P A;  2DQJ Y;  3A93 A;  3DMV A;  4XEN A;  3TXD A;  1GBW A;  2OE9 X;  173L A;  3A95 A;  165L A;  3RZE A;  3ULR A;  4II8 A;  1B5W A;  1LZC A;  2HUL A;  1L36 A;  4OWE A;  1RI8 B;  4I7P A;  1XGU C;  3GUK A;  1GB6 A;  1UIG A;  4ETD A;  1LI6 A;  5B1G A;  4ANR A;  1OUH A;  3F8V A;  2DQF C;  4MCK A;  2F2Q A;  1LHH A;  1IVM A;  4I7L A;  4I7R A;  1JTN A;  183L A;  5ILF A;  1LYZ A;  1UIE A;  8LYZ A;  4LYM A;  216L A;  3B0K A;  1G06 A;  5E9R A;  4PHI A;  128L A;  1BWI A;  1LZ1 A;  4H9I A;  1QT7 A;  5FST A;  5L3H A;  1CV1 A;  3LZ2 A;  6LYT A;  5T3F A;  4PJZ A;  1LSA A;  4AXT A;  2B6W A;  3M3U A;  5HQ1 A;  1L49 A;  4J1B A;  3HT8 A;  1C6H A;  3QE8 A;  3W6D A;  2G4N A;  1QUO A;  3A67 Y;  1WQN A;  3PBL A;  188L A;  1FBI X;  2MEA A;  4NWE A;  3OE8 A;  4XN6 A;  3C8S A;  1DI5 A;  3HT9 A;  3CDQ A;  254L A;  1VAT A;  4LYZ A;  1L28 A;  1QTZ A;  5EBH A;  4WM2 A;  1P2R A;  3HBH A;  1IWW A;  3ODU A;  246L A;  2DQD Y;  1QDT A;  1L77 A;  2ZIL A;  1L79 A;  4PJ2 C;  184L A;  1G0P A;  4ARQ A;  3JR6 A;  1L67 A;  4QY9 A;  3DN8 A;  4FJR A;  1GAZ A;  1ZMY L;  2XJW A;  3P65 A;  1LYF A;  1LZE A;  1C46 A;  257L A;  4U3X B;  3C83 A;  3BKH A;  4ZFP A;  2MEG A;  1G7H C;  2OE7 X;  3RT5 X;  1L08 A;  1KIP C;  1B9O A;  1L10 A;  1C6B A;  229L A;  4NHI A;  1NWG A;  2BQE A;  1CV4 A;  1G0L A;  2HUB A;  2F4G A;  2FYD A;  3LYO A;  4EPI A;  4C5F A;  4NSI A;  1LHJ A;  1LMC A;  2EKS C;  166L A;  4WO6 A;  2YBN A;  1L70 A;  1GF7 A;  3D4S A;  1D3J A;  104L A;  3HT6 A;  3G3X A;  1LZ5 A;  1T97 A;  1CX7 A;  244L A;  5I14 A;  1OUG A;  6LYZ A;  3DMZ A;  1XEP A;  3DN6 A;  9LYZ A;  1T6V L;  1NBY C;  1VDS A;  3A3R X;  5KXZ A;  1KW7 A;  3SBA A;  1QS9 A;  5J7C A;  2L78 A;  1JIY A;  4LGK A;  1JKD A;  4QEQ A;  1L16 A;  1YAO A;  1B5U A;  5F14 A;  1IWZ A;  2OTY X;  1L14 A;  1LZ8 A;  5LVG A;  243L A;  4LT2 A;  1L37 A;  143L A;  4WM6 A;  1H6M A;  4I7O A;  3A90 A;  4I7M A;  3AGG G;  4ETC A;  1IWY A;  1L32 A;  3QY4 A;  4XJB A;  1L84 A;  135L A;  5I4W A;  3DMX A;  1SSW A;  1SX2 A;  2FYC A;  1LKR A;  3C8Q A;  1YAQ A;  5KXN A;  3SB7 A;  5APD A;  5E4P A;  2ZQ4 A;  1J1O Y;  4H90 A;  4TX7 A;  1L69 A;  1C6E A;  1HC0 A;  1VAU A;  4YM8 A;  1NQI A;  2G4Q A;  3RW8 A;  3TXJ A;  2LZ2 A;  3GUN A;  1LYH A;  5A3E A;  1N4F A;  1D9W A;  1WQM A;  2ZYC A;  185L A;  2OU0 X;  4BAP A;  4W54 A;  4ZPU A;  1HHL A;  1D3F A;  4NHQ A;  112L A;  1L51 A;  5FEK A;  2ZQ3 A;  4WLY A;  164L A;  3HH4 A;  1C67 A;  1UIB A;  1IY3 A;  4N0J A;  1FN5 A;  3G3V A;  1L68 A;  1L94 A;  1I6S A;  1C62 A;  1GDX A;  2CGI A;  1AKI A;  4ARM A;  4ETB A;  3GXK A;  4TUN A;  1GBX A;  1OYU A;  4B4J A;  1GF9 A;  4WL6 A;  4MR1 A;  1GBS A;  1GDW A;  3A34 A;  4W51 A;  1CV5 A;  1LGU A;  1JQU A;  1B7Q A;  2BLX A;  2RBR A;  3WPL A;  1LSP A;  4GN3 A;  4TWS A;  231L A;  4NFV A;  1OUC A;  4OWB A;  1LHM A;  4LYC A;  7LZM A;  4N1E I;  3HBD A;  4LYO A;  1O23 A;  1UID A;  4NWH A;  4I7S A;  3K3T A;  2RB0 X;  1L61 A;  1OUA A;  2LC9 A;  1DXJ A;  120L A;  4LT1 A;  1L81 A;  4EKP A;  1L83 A;  1BHZ A;  3A6C Y;  174L A;  2VB1 A;  3CT5 A;  1GB5 A;  3TXI A;  1G0K A;  3LYM A;  4EXM A;  1CV0 A;  152L A;  1LSM A;  1QSA A;  148L E;  2O79 A;  1B7P A;  5I5Q A;  2YBL A;  1ZV5 L;  3HDE A;  261L A;  1LPY A;  4RW1 A;  1IO5 A;  1LZY A;  4H8Z A;  4DD9 A;  1B5V A;  1BWH A;  1C6J A;  3A96 A;  2RH1 A;  3WUL A;  175L A;  5KXT A;  1L55 A;  1L06 A;  1QIO A;  4HJY A;  4W57 A;  3OJP A;  2BAA A;  1B7L A;  4LYT A;  1W6Z A;  2OU9 A;  3W3E A;  4DDA A;  169L A;  5M1Y A;  1WTN A;  1LJF A;  3C80 A;  1L95 A;  2HEE A;  1BGI A;  1LZG A;  2BQH A;  1G0G A;  3D3D A;  1GB3 A;  5APC A;  2OTZ X;  4UWN A;  3ATO A;  238L A;  4DD0 A;  1L19 A;  197L A;  1RFP A;  210L A;  1QDR A;  1L23 A;  5F9X A;  4YXA C;  4NGJ A;  3TXE A;  4W94 A;  1IWX A;  206L A;  1XFP L;  1I56 A;  4WL7 A;  247L A;  3NY9 A;  3WVY A;  3E3D A;  1C6P A;  5B07 A;  1HSX A;  3RNX A;  122L A;  3G3B B;  4TTD A;  1QT6 A;  1G07 A;  1NDG C;  4NIJ A;  1G1V A;  3CDO A;  4H1P A;  4H8Y A;  163L A;  1P2C C;  4LZM A;  1QSB A;  2XBR A;  1JTO L;  1LZR A;  2B7X A;  1VFB C;  4BAD A;  4DT3 A;  241L A;  3B6L A;  4I8S A;  3C7Z A;  1QUH A;  1DZB X;  213L A;  5APE A;  1L71 A;  4LFX A;  1CNS A;  240L A;  1Z55 A;  1JSE A;  4XYY A;  3A6B Y;  2BQO A;  3HH5 A;  2LHM A;  4S0W A;  1NMM A;  4R0F A;  2Z39 A;  5DL9 A;  2EQL A;  3WW6 A;  1TBY A;  1WQO A;  2OEA X;  5LIN A;  2A4T A;  4UWU A;  4GCC A;  1BB4 A;  1VDP A;  2RB1 X;  2W1Y A;  4EJ4 A;  1EQE A;  214L A;  4DD3 A;  160L A;  1CKG A;  1GHL A;  159L A;  1YIL A;  4C3W A;  2EIZ C;  4XAD A;  4CJ2 A;  1C63 A;  5DN4 A;  2I6Z A;  217L A;  4ARL A;  4W58 A;  1LPI A;  1OWY A;  1EL1 A;  1EQ5 A;  172L A;  2B6T A;  4H8X A;  3GUO A;  4KT3 A;  220L A;  2BQM A;  1L26 A;  2Z2F A;  1UUZ C;  1REY A;  3W6A A;  1KNI A;  4H9F A;  1C6N A;  2Z6B A;  133L A;  2RBS A;  5KKI A;  2BQA A;  5KXS A;  125L A;  4NGW A;  1F6S A;  4ARJ A;  4DD1 A;  1HEO A;  4I7K A;  1GD6 A;  1JJ3 A;  1NBZ C;  1LWK A;  1D0M A;  181L A;  1CVK A;  1REM A;  3OE0 A;  3CSQ A;  2Z18 A;  4GLV A;  1SWY A;  245L A;  1JTM A;  1HFZ A;  1CJ6 A;  6LZM A;  2MEI A;  1GPQ C;  5C6J A;  1YL1 X;  2Q9E A;  2WAR A;  3V2Y A;  1IWV A;  5KKJ A;  1PQJ A;  258L A;  2BQL A;  1JTP L;  1MEL L;  4CFP A;  1C43 A;  1L73 A;  4I7T A;  1B5Z A;  3EBA B;  1T8A A;  3WL2 A;  3HT7 A;  1IP1 A;  1UA6 Y;  3ZVQ A;  4OOO A;  4R6C A;  2CDS A;  1LZA A;  1L53 A;  3PDS A;  1L62 A;  1GB8 A;  1L97 A;  1L88 A;  235L A;  1LHK A;  1DYF A;  3F9L A;  1LJI A;  1LI3 A;  5B06 A;  3NY8 A;  2NTG A;  4WG1 A;  170L A;  1C6C A;  1IOR A;  1YKX X;  2C8O A;  2GV0 A;  1C7P A;  3DN0 A;  1LKS A;  3CSR A;  5F16 A;  1L74 A;  4YX7 C;  1PS5 A;  4LT0 A;  1EPY A;  2B6Y A;  3QAK A;  1HEN A;  4NSH A;  3ATN A;  2RAZ X;  3B0I A;  1T8F A;  129L A;  1LYS A;  4D9Z A;  1SX7 A;  178L A;  1JSF A;  3AGI A;  5F9U A;  2LYO A;  1L80 A;  2DQG Y;  2Q0M X;  1D0L A;  1GXV 2;  3WU8 A;  5HLL A;  1LYD A;  2DQH Y;  3W6C A;  211L A;  167L A;  1IR9 A;  1L34 A;  1G1W A;  4PRQ A;  1LYY A;  1QSW A;  1YRO A;  4OO9 A;  1ZVY B;  1C6G A;  1L41 A;  1GE2 A;  3FI7 A;  1L48 A;  3HWL A;  1CUP A;  1L64 A;  3SB5 A;  1QTV A;  4ET9 A;  1YAM A;  224L A;  2FBB A;  4YEO A;  3C7Y A;  1PQI A;  2BQC A;  1HMK A;  1L24 A;  1NHB A;  1G7M C;  3GXR A;  1L72 A;  226L A;  3LZT A;  1HEQ A;  1W08 A;  1D3N A;  4CHX A;  3SB8 A;  3B72 A;  3CT0 A;  1VDT A;  1REZ A;  1SWZ A;  1P3N A;  4WLX A;  1PQO A;  1GB7 A;  1L98 A;  3SBB C;  2ZIJ A;  1C6Q A;  1YKZ X;  4IAT A;  1B7M A;  3HUQ A;  2DBT A;  1L38 A;  2OU8 A;  3T6U A;  141L A;  1XJU A;  1B7R A;  236L A;  253L A;  3WUM A;  1LMQ A;  1UBZ A;  5I4X A;  239L A;  1WQP A;  255L A;  3TXH A;  1JJ0 A;  195L A;  1C6M A;  4UWV A;  3GUP A;  2W1L A;  4NGL A;  1LGW A;  5KJ9 A;  118L A;  3TMV A;  1IC4 Y;  4H91 A;  1B5X A;  4DYG A;  1L03 A;  2HTX A;  1GFT A;  4HV2 A;  4NSG A;  2MED A;  1LZ4 A;  2B70 A;  4ETE A;  1DYD A;  1XJT A;  3SB9 A;  1SLY A;  119L A;  3AW6 A;  1JEF A;  4Z41 A;  1GBO A;  1LZD A;  1GBY A;  1C10 A;  4I7N A;  4ZEE A;  2O4W A;  219L A;  5LVK A;  1L96 A;  3GUM A;  1L76 A;  4GCE A;  1XGQ C;  5A3Z A;  1AZF A;  2RBP A;  1B5Y A;  5I4Y A;  1GF0 A;  1P36 A;  1FLQ A;  1DI3 A;  5HNL A;  1LJN A;  2RSC A;  3CT1 A;  4NGZ A;  4L41 A;  1F0W A;  4W59 A;  1D3M A;  5FEL A;  1L13 A;  233L A;  1C61 A;  1GXX A;  1YIK A;  2Z37 A;  3A3Q A;  1B6I A;  4YEN A;  1L45 A;  1LZB A;  1DPX A;  1TAY A;  3WXU A;  2RBO A;  5KXL A;  3C82 A;  187L A;  3EXD A;  4PGJ B;  3BKV A;  1KXX A;  1XGT C;  111L A;  3CQL A;  1DQJ C;  107L A;  1IP3 A;  1IWT A;  1PQD A;  1LAA A;  2IHL A;  209L A;  4EOF A;  1IX0 A;  4K5Y A;  3J4G A;  3TXG A;  1L93 A;  5LIO A;  2MEF A;  4HPI A;  3W6E A;  3IJV A;  2A7D A;  1GFJ A;  2F2N A;  3WVX A;  1BB6 A;  1OV7 A;  1YKY X;  3EMS A;  1QQY A;  1CU3 A;  3OE6 A;  1HEL A;  4EMN A;  1D2Y A;  162L A;  3WH1 A;  1L0K A;  3N9C A;  3WUA A;  1IP4 A;  1GF4 A;  1C66 A;  1D2W A;  5LVI A;  3MGW A;  5B05 A;  1L22 A;  1RCM A;  4B49 A;  2YSS C;  5LYT A;  1P64 A;  176L A;  3EO5 A;  3RU5 A;  180L A;  4WM3 A;  1LSE A;  1CTW A;  1GEZ A;  2HEF A;  1LJJ A;  4HP0 A;  2LYZ A;  3DN4 A;  3TMX A;  4Z3M A;  1IWU A;  171L A;  4LFP A;  1BVX A;  1CU6 A;  4E3U A;  5LYZ A;  1P56 A;  3FAD A;  1C6I A;  3T36 A;  3WU7 A;  1T8G A;  3WW5 A;  1LJE A;  3W6B A;  2DQI Y;  4HTK A;  5ILC A;  1L99 A;  3K2R A;  4B1A A;  4HJZ A;  1L0J A;  1IEE A;  2RAY X;  145L A;  4TSB A;  5B1F A;  191L A;  2B6Z A;  2FBD A;  1QT3 A;  142L A;  1OVH A;  2CWI A;  4H94 A;  1DKK A;  2F47 A;  131L A;  3F6Z A;  4NHT A;  102L A;  1NF5 A;  1LOZ A;  144L A;  3LHM A;  3B0O A;  1GF3 A;  4DAJ A;  1AT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...