4AO7A

Zinc bound structure of a novel cold-adapted esterase from an arctic intertidal metagenomic library
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
243
structure length
223
Chain Sequence
b'MSWNGKDERKLSVQERGFSLEVDGRTVPGVYWSPAEGSSDRLVLLGHGEYIEQVAKLLVGRGISAMAIDGPGTDVVGLDAFPRMWHEGGGTAAVIADWAAALDFIEAEEGPRPTGWWGLSMGTMMGLPVTASDKRIKVALLGLMGVEGVNGEDLVRLAPQVTCPVRYLLQWDDELVSLQSGLELFGKLGTKQKTLHVNPGKHSAVPTWEMFAGTVDYLDQRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
molecule tags Hydrolase
source organism Unidentified
publication title Functional and Structural Studies of a Novel Cold-Adapted Esterase from an Arctic Intertidal Metagenomic Library.
pubmed doi rcsb
total genus 78
structure length 223
sequence length 243
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ao7A00
4KAAA 3R0VA 1QJ4A 1VE6A 3PE6A 3SWWA 5AKLA 3H1BA 1QOZA 3T4UA 4H7JA 2VSQA 3M82A 2HA4A 1YB6A 1LZLA 3BDIA 4G5XA 1P0IA 1THTA 3GELA 1A8UA 5ALDA 5H3HA 1LPMA 2FJ0A 4IQ4A 1EDEA 4N8SA 5AKZA 5DTJA 1RP1A 4BC1A 1U65A 3V48A 2Z8XA 4PSUA 4HAIA 3DL7A 1LPAB 4FOLA 4U2DA 5AM5A 4G8BA 2OQIA 5HK9A 3ILSA 2GBFA 2VT7A 3WIOA 1QLWA 3R41A 2ZYSA 1EA5A 5I9IA 1EVEA 4UUQA 3V1MA 4CFSA 2XQKA 2G5TA 3LS2A 3BF7A 2QXUA 4H77A 2BCEA 2DSNA 5CBKA 3C6YA 2K2QB 1QTRA 4Y2XA 5KREA 2HA2A 1H22A 3S2ZA 2VQ6A 4C89A 2OAEA 2QM0A 1W75A 1XZLA 4U2GA 4V2IA 1W52X 3WQHA 1MNQA 2WLSA 5DNVA 1XZIA 1S8OA 4U2FA 1N8SA 4WFJA 2BUCA 3AIMA 4QDXA 3GA7A 4Y2VA 2H9YA 5AIBA 1CUEA 5AI5A 2G4LA 1QFMA 1JU4A 4M0EA 4MEAA 1LPSA 3V9AA 5ALRA 2WJ4A 1WPRA 2XUIA 1N5RA 3KWJA 5J3JA 3BF8A 4B80A 4X6XA 4NS4A 5HK8A 4UBOA 4QLOA 3FYUB 2VJAA 1MO2A 3AJAA 3VXKA 1K4YA 4L3WA 2WJ3A 2JGFA 3DLTA 3UMJA 3OG9A 4ZGBA 4OD0A 5AKKA 1B6GA 1VA5A 2BAGA 4E11A 1ZICA 4DIUA 3NUZA 1Q84A 3CCBA 4AXBA 2EDAA 5CT5A 2RHWA 1QIIA 4X71A 2PBLA 3WWDA 3ESCA 4C4YA 3R3WA 2XQJA 4BP8A 2WU3A 3H2KA 5FLKA 2OCGA 1QIDA 4ZREA 3STUA 1CUGA 4OB8A 1MAAA 1GQSA 1XRPA 4YPVA 3FYTA 4LYDA 3JW8A 5BWBA 2DHEA 1QIEA 4KE8A 4ZWNA 4F60A 4XVCA 3WJ1A 1AMNA 1CUXA 4H7FA 3EQ9A 5HF9A 1GPLA 2BGRA 2C5FA 4N5HX 4Q05A 3WK7A 4UHCA 2XT0A 2Y2UA 5AM3A 3I2IA 2HU7A 3WA6A 4GW3A 1BROA 4KYVA 3G9UA 3BL8A 4Y2YA 1DWQA 5AM0A 3AFIA 5ALMA 5K3FB 1PJAA 1K8QA 1EK1A 1SOMA 3WL5A 1MX5A 3VKFA 5T4FA 2OG1A 4UHDA 3IULA 1MX9A 2DFPA 4QDUA 3VVLA 1CUAA 2OCLA 5CT4A 3FLAA 1E89A 4FNGA 1UOQA 2ORYA 2Y1KA 1LBTA 4A5SA 1CEXA 2CBGA 5BWCA 2WIJA 1P0PA 5LLSA 2ES4A 1MTZA 2WKWA 2WM2A 3C87A 3IUQA 4BYMA 1Q0RA 1SC9A 4CG3A 1GT6A 1TCCA 1UOPA 4KEAA 1R1DA 2XMZA 3R3UA 1YA4A 1HKHA 3RK4A 1E3QA 3WKAA 5HCUA 1QIFA 5EGNA 3FVRA 4ROTA 4AO7A 4AB1A 3L1JA 2AXEA 1N1MA 5ALSA 3E0XA 2XI4A 1YASA 2B61A 2PUJA 3G02A 4YASA 4CG1A 3LP5A 5LP1A 1FSSA 4E46A 4FLMA 2HU5A 5JD4A 4JNCA 2GYVA 3CCCA 1ZGBA 4NVRA 4OB6A 1FFCA 5JASA 5JAUA 3QMMA 3C8HA 3F67A 2JF0A 2XUKA 2O7RA 5LYYA 1JT2A 4HRXA 2B4KA 3TEJA 5CT9A 1ZD4A 3KWFA 1P0MA 2C4HA 1BCSA 3WL6A 5AKEA 4DNPA 1QIKA 3G0IA 1Q83A 1SCKA 4XJVA 4MQMA 3V1KA 3BWXA 3GFFA 2JGLA 2XMBA 4D9JA 4G8CA 3H0CA 4HXGA 3C5VA 5JAOA 3WKBA 4Q3OA 1EINA 3BDVA 3FLBA 1ISPA 2GZSA 3K6KA 4QWWA 3HXKA 4IO0A 1O6FA 1XZDA 2QRUA 4L72A 4HXEB 4P08A 1DQZA 3G9TA 3A70A 4FMPA 5HF6A 4I3FA 1KU0A 5DTIA 5DWDA 4OU5A 4RGYA 1JU3A 5FP0A 3VDXA 3X3HA 2JGEA 2VA9A 3CXUA 1EB8A 3IUMA 2Y2VA 2JIDA 5CT8A 4B83A 4PO3X 4BDSA 5DYTA 2NW6A 3F9CA 5IH7A 2HADA 1KEZA 4HXFB 4UHBA 4MYSA 1IZ7A 1K63A 5EIAA 2PM8A 2DR0A 2XMCA 3E4DA 1R9MA 1EI9A 2XQGA 1EX9A 4RPCA 4DSZA 4DM7A 1R3DA 4ZV7A 5ALQA 3ICWA 3QPDA 1BU8A 1XFDA 5AOCA 2RHTA 3H2JA 2BKLA 4F5ZA 4B84A 1WHSA 2C7BA 4WFIA 1AQLA 5CURA 3R3XA 3F97A 5EIEA 4RE6A 1XLUA 4OB7A 1OXMA 3C6BA 2J3DA 3STXA 1HLGA 4AMYA 1VA4A 3STTA 4EB0A 1BRTA 5AI9A 1DU4A 5HFNA 5FRDA 2OAGA 5A7GA 1GPKA 4B9AA 3DKKA 4DMFA 3Q8WA 1XKLA 1XZGA 4ARBA 1X2EA 1AC5A 4Y2UA 5JANA 3H2GA 2EDCA 2XLBA 5ALKA 2HHAA 3EF3A 4G9EA 3IBTA 5I7UA 4MXDA 1E8MA 3AIOA 1QO9A 2ACEA 5ISMA 4UHHA 2OPHA 4AMZA 3O9MA 5K5EA 5YASA 3G0CA 2HL6A 5LIPA 3HACA 1F8UA 1QTIA 4M0MA 2WSLA 2VEOA 2C0PA 2W22A 3O4HA 3VJLA 2PSDA 1JMKC 2JEZA 3GUUA 4N5IX 2AJLI 4NMWA 4E15A 4CCYB 1WB5A 1DTEA 1DX6A 3FVTA 5ALYA 2BUAA 1PFQA 4INZA 2XUGA 1QZ3A 2D5LA 3BE8A 4UBLA 4ZXFA 1IUNA 1JMYA 5BV7A 2B9VA 2XMQA 2I78A 3M3DA 4CI9A 5E4JA 2BJHA 3B5EA 2QVBA 4BAZA 2AJBA 3DKRA 5ALHA 4W1SA 1K5PA 1TIBA 2AJDA 1TAHA 2WHPB 1XZMA 4BP9A 5JIBA 1K6EA 1J2EA 1LNSA 4K2AA 3WMRA 4X94A 1ZI6A 3AZOA 5FPPA 2WFMA 2PSEA 3KSRA 2VATA 4J0GA 4GDMA 1HDEA 4CIAA 5AH0A 1ZD2P 2VAXA 1SCIA 4MWSA 3N0TA 2Z5GA 3WZMA 3B12A 1WB6A 3WWCA 2FX5A 1I6WA 1L7RA 2X8BA 3G0GA 4BVKA 4QDZA 1C4XA 3OPMA 4EBBA 4ETWA 1QIJA 3QH4A 5EIHA 2FJPA 3WYDA 4HS9A 4LXGA 3FNBA 4KE6A 4H0CA 2XUDA 3FSGD 1JKMA 1OILA 3ZLUA 4B82A 3WL7A 3WA7A 2O2HA 5E4TA 1F0PA 5IVKA 3QMVA 5JATA 2QZPA 3KD2A 5ALEA 1E8NA 4I4CA 3WYNA 5DNUA 3H18A 4OYYA 3CN9A 3DS8A 3FBWA 3PICA 5CH8A 2WTNA 2DCMA 2QKYA 3HYSA 3FCXA 4KR0A 1MT3A 1A8SA 1DT3A 2ZVDA 5JD6A 5K3CA 4BC0A 2DQYA 5K3AA 1ZJ5A 1CR6A 2I03A 1MAHA 3HRHA 5IVDA 2WG2A 3QITA 4B85A 3WK6A 2HFKA 4YK7A 4KE7A 3QYJA 5EHXA 3WZLA 5ALOA 1Y7HA 4PSCA 1TQHA 2WUDA 4C4ZA 2QXTA 1FFEA 4BBZA 2VJBA 3WK4A 1R4ZA 4QNNA 1ZI9A 3QPAA 5KBYA 2WUGA 5AOBA 3FOBA 2VF2A 4OCZA 5EHNA 4P93A 4K6KA 5ALGA 5DYWA 3EQ8A 1XLWA 4FFVA 1TK3A 5CT6A 3AIKA 3WJ2A 3ZI7A 3HEAA 4UBNA 1QONA 2OQVA 3AILA 2O2IA 3W2TA 4XWGA 3VJMA 1XZAA 4EY4A 1XRQA 3WKCA 4W1RA 2V98A 4J03A 4FTWA 4OU4A 3L1IA 3D2BA 5LZ5A 3PI6A 4FKBA 4U2EA 2WIDA 4BB0A 4CCYA 1GQRA 3K2IA 5CTAA 3H17A 1YAHA 5AI8A 4QLAA 4F0JA 1UZAA 1UK9A 2WUEA 4B7ZA 5LZ7A 4BTVA 2E3JA 2PU5A 2Q0XA 4BTLA 4X3CA 5CXUA 5K3EA 4HZGA 3IDAA 4X90A 1IVYA 3ZWQA 2X76A 4KACA 1BEZA 3ICVA 4ARAA 4WY5A 2WJ6A 2WIKA 5A6VA 2WG1A 3ANTA 1F0NA 2J4FA 5A7HA 1MN6A 1GGVA 2AJCA 4J0JA 5JZBA 1QE3A 1ACLA 4X6UA 3AZPA 3C6XA 5JYCA 3H19A 4J0IA 1RWQA 4FHZA 3PFBA 3WWPA 1WM1A 4X92A 4C4XA 4U2BA 4HTAA 1XQWA 3VVMA 1DWOA 4LHEA 3D0KA 1CIJA 5HFAA 1Y37A 1HQDA 1VE7A 4FBMA 4H7EA 2CMFA 4FBLA 3AUKA 4EY5A 2PPLA 4U2CA 4DTCA 4FLEA 3A2LA 2HRRA 1H23A 4X91A 2WU4A 3W9UA 4WDQA 3EQ7A 3SK0A 1QIMA 4ZV9A 1PV1A 5ALNA 2GZRA 5T4HA 1FJ2A 4Q1VA 3W9BA 1A8QA 3QPCA 5AK6A 4Y2TA 2QTBA 2XUPA 1UWCA 2CEKA 3O4GA 5AKHA 3D4LA 1E66A 5BOVA 1H2ZA 5D7BA 2CUTA 2XMDA 1QIHA 3IUJA 5AHXA 5ALTA 4H7IA 1A7UA 4J0DA 3M81A 3ESDA 1CUZA 1TRHA 5KWIA 4FNMA 4JH0A 2HA0A 2HFJA 4DYHA 5CH3A 5K3DA 4AN0A 1IZ8A 1CUHA 3KDAA 4K6HA 5DNWA 2OCKA 5ALXA 1CPYA 3SC2A 1L7AA 4M0FA 4WY8A 1ZGCA 2YASA 3KXPA 3PFCA 3RM3A 2HU8A 3I2JA 1UK8A 2ZJFA 4J0HA 1YB7A 3S8YA 2OGZA 3DDUA 1R50A 4KAFA 4JYPA 2WUFA 3NWOA 1ZI8A 2XUJA 5CW2A 5HZGA 3HC7A 4KRXA 4B9EA 2WIFA 2AJ8A 1U8EA 2ZJ6A 3G8YA 4UBIA 4AO8A 1UKCA 4JEIA 3LCRA 5IKXA 3QMWA 3O4JA 4G4IA 2C58A 4TVKA 4TGLA 5D6OA 5AM1A 2QJRA 2Z3ZA 3O9VA 4ZRDA 4KRYA 3P2MA 2HA3A 1B41A 5AM4A 5AP9A 3WKDA 5D3ZA 1XKTA 2XMGA 3AZQA 1XZCA 4FWBA 1XLVA 5JD5A 2QOEA 3I6YA 1LGYA 3V1NA 2RI6A 4W1PA 5HKAA 4OYLA 1XRLA 2ONCA 1LPNA 1U2EA 5IVIA 2XUQA 2EEPA 3O4IA 3EIOA 2W6CX 1OCEA 3QVMA 2XUHA 4W1QA 1EXWA 2GBIA 2J3QA 4W63A 1AURA 1FFBA 4HRYA 5EFZA 1ZD3A 1FFAA 2QMQA 4YX9A 3HLKA 1IUPA 1UXOA 5ALFA 1JJIA 3F98A 3D3NA 5AO9A 4UHEA 3PUIA 5LZ9A 1BCRA 5CXXA 1TCBA 3IURA 3WK5A 2WILA 3W05A 1UK7A 1CUYA 2QJWA 2BFNA 2I3ZA 1BE0A 3MUNA 4GLBA 3FSGA 3A2MA 1H2WA 4O08A 5AKJA 3R3ZA 3RARA 3AINA 2HRQA 4BE4A 1WHTA 4FFWA 3IVMA 1QGED 4AN1A 3D2AA 3FYUC 4DLNA 3R40A 2XLCA 1CUWA 3IIIA 3G7NA 3R3VA 3SX4A 3VISA 1GKKA 4Y9SA 5FOQA 5CRIA 1J07A 1XRNA 3I1YA 4Y2SA 1WCYA 1XZHA 1XZJA 4B6GA 1XRMA 3C6ZA 5LZ8A 4DNQA 3VJKA 4BATA 1J1IA 2RGUA 3U0VA 2WQZA 5ALLA 2QUAA 1CUVA 3R3YA 5AM2A 1UKAA 5A2GA 4BE9A 4A16A 4EA6A 4PNZA 1RYYA 1BN6A 2JEYA 4MYDA 2WHRA 2QR5A 1CLEA 1YA8A 2WHQA 1Z68A 1A88A 4UFPA 5AKXA 3H04A 2QT9A 4Y2JA 5AKIA 1ACJA 1X2BA 3C43A 1NU6A 2JGJA 3PUHA 2BGNA 3DJYA 3JYHA 4OSEA 2JGKA 3Q0TA 4C01A 2ZSIA 3ANSA 2WFLA 3WL8A 2HM7A 1VKHA 2YH2A 5SYMA 2XDWA 3ESAA 3LIIA 4K6GA 5ALJA 1CUJA 4G4GA 3NOXA 4LIPD 3FWHA 2PL5A 5EHQA 3FLEA 1DX4A 2VT6A 3G9ZA 4H35A 1T2NA 2ACKA 7YASA 3HJUA 3V1LA 5JADA 4H7HA 3D2CA 4DMHA 1CRLA 4BVJA 2QS9A 5LKRA 4A23A 3GBSA 3N2ZB 4J3JA 4AQDA 4H18A 2C5GA 3D59A 2XUAA 4UBMA 1CUFA 2O2GA 5AI4A 1XZFA 4DNFA 3DCNA 1R88A 3DNMA 1XZEA 5C8ZA 3T52A 2H7XA 4PW0A 4RE5A 3DQZA 4UFOA 5K3FA 1MPXA 1AKNA 3MVEA 1DINA 5FXMA 2XB6A 4JUIA 4JYMA 5HF8A 3DD5A 1SFRA 4J0KA 4LXHA 3YASA 2Y6VA 2WHPA 4C88A 2O7VA 2RONA 1VZ3A 1EHYA 3GROA 4UPDA 1UOOA 2OGSA 1O6GA 1XZKA 4B0OA 4X6YA 3IA2A 2G5PA 3DL4A 2OLEA 1YSCA 1SCQA 2P8SA 3I2GA 4P9NA 5IVHA 4N8EA 5LZ2A 4B81A 2QUBA 5T4BA 4KAJA 2CJPA 2XMSA 1UKBA 3RLIA 1U4NA 5ALWA 5AICA 3OM8A 1YAJA 2CZQA 1R9NA 2OXEA 5JAHA 3ZLTA 3HI4A 1AX9A 1Q0ZA 4BAGA 4QE3A 1CUSA 2V9ZA 4KJXA 3WIBA 4OPMA 2ZSHA 1JFRA 2IITA 2IIVA 4L0CA 5AK4A 3B3QA 1AZWA 5AIAA 1JJFA 5A71A 2GBCA 5AJHA 1TCAA 2ZYHA 4EY6A 4FLFA 1YR2A 4EY8A 2R8BA 1ODSA 3TRDA 2UZ0A 4UBKA 1GZ7A 5HF5A 2WIGA 1CFJA 2HA7A 5FKJA 4IH1A 2H7YA 1EVQA 3STVA 4J7AA 5JALA 1XQVA 2VJCA 4MEBA 5EI5A 1CUBA 1YS1X 1GKLA 2XE4A 1ODCA 1T4MA 4DMKA 3IUNA 5FV4A 1W1IA 3HABA 1AUOA 5ALZA 5CMLA 5HKBA 1GPNA 4QZVA 2IX9A 3PF9A 5AKGA 1M33A 4Y2QA 1TKRA 1FFDA 4NZZA 5AK3A 2RAUA 1DWPA 4G8DA 2PU7A 1CQZA 4QEKA 3I1IA 4S0XA 2V96A 4BRZA 3LIPA 4BDTA 4H7KA 3DOIA 1QO7A 1C7IA 2GBGA 2PKYX 3M83A 3O0DA 5E4YA 3FYUA 4PV7A 1VZ2A 4W9RA 3H1AA 4PQEA 4G4JA 3L1HA 4PF1A 5T4EA 1IUOA 2VAVA 2XMRA 1XQYA 1XZBA 1Y7IA 5DJ5A 5JZ9A 2V97A 3G9XA 4G1FA 4LKOA 3BIXA 1ZD5A 4GWLA 1ZIXA 4DMCA 4EUSA 3FAKA 2ECFA 3WWOA 3GZJA 1UT6A 4GXNA 4UHFA 2OGTA 3I2FA 5EHZA 5C8VA 4Q82A 4F21A 5ALVA 4E14A 4BRSA 2X5XA 1EDBA 1G42A 4AX4A 4ITVA 1CQWA 1CUIA 4P92A 5I8PA 3MUOA 1F6WA 4BCDA 1ZJ4A 5ALUA 3JWEA 4Q3KA 1G4HA 2Z3WA 2ROQA 4B0PA 2ZJ7A 2LIPA 5E2IA 4BAUA 1EB9A 1BS9A 1ODTC 3I6ZA 3I28A 2C0QA 4CIBA 3F96A 4C87A 4Y7DA 1UK6A 1VXOA 4EHBA 3MGAA 2PUHA 4DSAA 5CH5A 2DHCA 3U1TA 1LPBB 3H2HA 3DYVA 3H2IA 5JAPA 4C6HA 1YS2X 5LKAA 1BN7A 1MX1A 2VTVA 2PX6A 4Y2PA 1G66A 1MU0A 4L9AA 4J0CA 1LLFA 3LLCA 4LYEA 4H7DA 3FCYA 4X7BA 3D7RA 3BXPA 1CV2A 2HA5A 2XUOA 1E8DA 4FDMA 1ZIYA 5JARA 4IH9A 5K3BA 3PF8A 2PSHA 1L7QA 1X70A 2Y6UA 3OC0A 1E5TA 3K9BA 2ZYRA 2WG0A 3I2KA 1D07A 4MJ3A 4OUKX 4UFNA 5HQ3B 3ZPXA 1BEEA 3STWA 2WFZA 3NGMA 3WLAA 2DQZA 1USWA 3TJMA 5FUMA 3C70A 1LBSA 2JGIA 3WWEA 2Z8ZA 2GYWA 2ZYIA 2XQIA 4IH4A 5F4ZA 4WCVA 1QFSA 3BIWA 1MNAA 2WTMA 5C7YA 2I3DA 1CVLA 1N5MA 3C45A 4EY7A 5AK5A 3WKEA 4LXIA 3C8DA 4K5QA 1HBJA 3UUFA 4BCCA 4BZZA 1NX9A 1XQXA 4DNOA 2H1IA 3QBJA 4GI1A 2XQFA 1VLQA 3I2HA 1VXRA 3OURA 1CUUA 4GBGA 4IHAA 4X00A 2HA6A 1XRRA 1THGA 4DGQA 1P0QA 1CUDA 4XIIA 4I19A 3I6MA 4HVTA 4X95A 1AGYA 1VOTA 3HZOA 1DQYA 1H2XA 2DHDA 5FPQA 1QIGA 1WPXA 4GHWA 1VJ5A 2PSFA 1ORVA 5ESRA 4CG2A 2H7CA 3ZV7A 1ZOIA 5C8XA 3ESBA 2HIHA 2B20A 2D0DA 1EDDA 1DT5A 4Y2RA 2PSJA 1LZKA 3IB3A 3OTQA 3D5EA 4QA9A 4GEGA 1GXSA 3PDCA 1C7JA 1WOMA 4CCWA 2CB9A 3DYIA 5C81A 3E1GA 4Q3LA 4BCBA 5FDFA 3WK9A 2HDWA 4Z49A 2RIPA 1XROA 2VJDA 3C5WP 3ED1A 1J06A 4X97A 5HQ3A 5LZ4A 1EH5A 3A2NA 1H2YA 5AKYA 3RKSA 4EZIA 5KWJA 1NU8A 4ZI5A 5D3KA 1MJ5A 3A6ZA 5AOAA 4AZ0A 1W76A 1ORWA 4QDTA 3W04A 1WB4A 2CKMA 4QWMA 3E3AA 3UUEA 5ALIA 2JGMA 3TGLA 4WDRA 5AI6A 3ZLVA 2YXPX 5DYYA 1G5FA 4UBJA 3QZUA 2J4CA 1W6RA 4MWTA 3STYA 1W4LA 2WFLB 1HPLA 3G0DA 3F8SA 2OCIA 4AO6A 5A62A 5DLPA 3O95A 1CUCA 1LPPA 1JI3A 3EBLA 4X85A 4BVLA 1IMJA 1HL7A 4MQLA 3WI7A 5AI0A 3BJMA 4RNCA 4TPKA 2BUBA 2XUFA 3WK8A 1YCDA 4N8DA 5SYNA 2R11A 4AZ3A 2PVSA 4GECA 2GYUA 2JBWA 3OOSA 4KE9A 4WJLA 3G0BA 5JZSA 1EK2A 1JJBA 1ETHA 3DEAA 1UFOA 3W06A 4X93A 3KOOA 4PSDA 5ALPA 6YASA 3QM1A 2YYSA 4WFKA 2FUKA 3CN7A 4Q34A 3BJRA 4QDOA 2G63A 5A7FA 3HSSA 1KU6A 1LPOA 4BZWA 3DOHA 4XX1A 4G9GA
chains in the Genus database with same CATH superfamily
3VA7A 1Z0FA 2QTRA 3S2YA 3WSTA 3NHLA 3CEJA 3M2PA 3TOXA 3R5HA 1UDBA 2Q2WA 4KLRA 3DDOA 3LP8A 2VDOB 4H16A 1R5OA 2AMVA 4MWBA 1VE6A 1YRWA 3HE3A 2CFTA 3HU3A 3PE6A 3OCJA 2R6R1 1QR6A 1AHHA 3L0ZA 4YJFA 4DCUA 2I80A 2CHFA 4DVJA 2YDXA 1QP8A 4P0QB 1P9NA 4ZCPA 5IT4A 1EP3B 3OQOA 1E6CA 3LVFO 5D01A 1KERA 4BP1A 2HLHA 3FPSA 4Z2YA 4PNEA 3A32A 2DKOA 5DIFA 4RTKA 1E92A 5BN5A 2GJ8A 4UNQA 4YYEA 2WA1A 3T7JA 1YHNA 1LZLA 3RYIB 3D8NA 5BSHA 2J6CA 1RWWA 3BDIA 2Z6QA 5K0EA 4EGSA 2ZRGA 1A8UA 5H3HA 4EQ6A 1AKUA 3D1JA 2C83A 1NTOA 2CDAA 2AEFA 1JZQA 2VK1A 1TM7E 3AMVA 2X3UA 1IM8A 3FNEA 1U65A 3KE8A 1NQVA 1KJJA 3GLIA 2TMDA 2XUZA 5EXEA 1OQAA 1OGJA 3AEUB 3FOCA 5G4KB 2HMWA 4NCJA 2YWHA 2ASEA 3DL7A 1EU1A 1HO3A 1LPAB 3GW8A 1VIAA 4HAIA 3V33A 3GEBA 4B40A 5KNDA 2BFMA 3NFRA 3DVQX 1JG6A 1GTZA 1MGPA 1XCGB 4JB3A 4DYVA 4ZVUA 1K4MA 1B8UA 1NY5A 3EGVA 4MQEA 1H8EA 5KHAA 4N6NA 2ZDGA 2Q9UA 1CY0A 3EHEA 2OYSA 3KAKA 4PAGA 4JR1A 2VT7A 1TU0A 1H3FA 3WIOA 1HFEL 3MXOA 3HXPA 1NDHA 4UUQA 2PLFA 4R8VA 1M5RA 2A35A 4WAUA 3QKRA 4IMIB 5KYTA 2OHIA 2QXYA 1O89A 2G5TA 3D4IA 3HADA 3HV2A 1PQWA 3LS2A 4EHKA 3BF7A 3R8CA 2QXUA 1YJ8A 1BMFD 3DT9A 1OBCA 1HNZB 1XP5A 1J39A 3AB8A 2WSSD 5CBKA 3T35A 2EBHX 3U3ZA 4BNJA 2CD7A 2IOFK 4PX2A 3I4LA 3Q1LA 2OBLA 3GZNA 5CA0A 2EVWX 2EZUA 2O8DA 1JHAA 4YDHB 3DUWA 4YJKA 5CPBA 1R5BA 1ZW6A 3K0FB 2OAEA 2QM0A 2PFGA 2B7CA 2P9TA 2OCPA 3I12A 4V2IA 4CMJA 3WQHA 4B4UA 2ZCVA 3MYRA 2YIDA 2X4LA 5FI5A 5DNVA 3LO8A 3ADOA 2AOXA 1O5OA 3JZDA 3UFXA 1XZIA 1NL3A 3A0RB 3IA7A 4CWAA 4UOEA 3PR1A 2QGNA 4IJWA 4J4HA 4II3A 3TLGB 3QI7A 4U2FA 4HNAB 2F1IA 4D26A 3IR5A 5KQMA 1SUPA 1P2UA 2X0RA 2PGDA 4I3HA 5EUBA 4JBXA 2G9ZA 2V4UA 2E82A 1WAMA 1N8SA 1REQB 2HMUA 4O4IA 1IBSA 3F46A 5AW7A 5CAEA 4DV5B 5LMNB 2R62A 4U7PB 3I92A 2QWXA 5G4LA 4FX2A 2WOJA 4FD3A 2YWCA 1RBQA 5J1TB 2IK8A 2IHZA 2V7EA 3GNLA 2I6UA 5LYJB 3WQBA 2H9YA 3OPXA 5CLFA 5IJ0A 4GPBA 1G8JA 2G4LA 1ZM3A 1QFMA 1USKA 1CB0A 2QX6A 3UATA 1OV6A 3W2EA 1IVSA 1CXZA 1RHUA 2R0QC 4MEAA 3UMCA 2YXLA 3X43A 5IULC 2CV1A 2DUNA 1BS2A 3FNHA 3DFUA 4O0MA 1VE3A 4LC1A 4OJMX 5HTOA 2RJNA 2PJRA 3HXTA 2H2GA 2XUIA 3EEQA 2FVYA 3A37A 4MEJA 4Q24A 3KWJA 1E5DA 5BT9A 2HH9A 1DDOA 3CVOA 2XVXA 1OU4A 3COZA 5IJWA 1VL6A 1CP3A 3NBAA 1LNZA 2BMDA 3PFKA 3D4PA 1EM6A 3X2EA 1YDHA 5M04A 4UBOA 2HEIA 3KQSA 3VR4D 3LBIA 4QNRA 4AKHA 3OPVA 2NXCA 4KIGA 4WMLA 5ERGB 4NNOA 4GX1A 1YZLA 1TNDA 3JYQA 1T36A 4XB2A 2ZW9A 1L4YA 2FV8A 3MWGA 4IX9A 4BB6A 3DLTA 3A1FA 3PWKA 1UANA 2W2KA 5AKKA 1B6GA 3N7AA 5CGQB 2BAGA 1SOVA 3SICE 4BFXA 5BSGA 2ERYA 1F8FA 4YAUA 2JJQA 1SIOA 4PONA 3PHIA 5I7HA 3NUZA 4WERA 1RHQA 2X6TA 1Q84A 4ID9A 2XVZA 3CCBA 2H0RA 3OT1A 4MR8B 1EQUA 1OYOA 4G85A 1XTZA 2IDKA 3KB2A 2EDAA 4P0TA 4OLHA 3UG7A 3F8TA 3RRBA 3DM9B 2GF0A 2W70A 1NZJA 2XEDA 5A02A 1YU6A 5EYPA 4QG7A 4BLRA 5BOSB 2ABWA 4YUWA 4KK4A 1XJWA 2RAVA 3GLHE 5G0WA 3DHVA 1DRKA 4BP8A 2WU3A 2V0GA 1PGJA 2OV4A 2X4IA 5KWEA 6Q21A 2FEOA 5JI2E 3I3OA 2HK7A 1KI4A 4QUHA 3GDFA 1SIWA 1EFTA 2FFQA 2V7BA 2KMLA 3RLFA 1DBIA 1ECPA 1KYQA 3QI2A 3DWFA 2PDAA 5BQ3A 1MAAA 2XOKA 1GQSA 1XRPA 2J0QA 1NBMA 5K9ZA 5H82A 2J1LA 1A9QA 3TQOA 5L4SA 4JYAB 2IYAA 3KV1A 2C8KA 4F60A 2AR7A 1JL3A 3T94A 2DC1A 3T15A 3T7SA 4P7KA 1IU9A 1KJIA 1P1FA 1DZ3A 3IILA 3JR7A 1NVFA 4CM8A 4ZT7A 2WMYA 3I52A 2NU7B 1I13A 2AS0A 3IV7A 3NPMA 3Q12A 4H7FA 4HDKB 4IWYA 1P17A 3TYXA 4Q9KA 1VG1A 4C05A 1C3LA 1DIHA 3VQTA 2YN4A 1H2HA 2ACWA 4K03A 4UDYX 2ZUFA 3REQA 3TRIA 4V03A 2JD1A 1NJSA 1CQJB 1QHHB 1V0JA 2EKLA 4N49A 5TEVA 3H7IA 5AM3A 1O9GA 3FOZA 1T6XA 5LN1A 3LY7A 1DC4A 4PHTA 3VYWA 3DHNA 3KKOA 1OLXB 3INNA 4MUAA 3CLSC 4XX0B 1P44A 5ARBA 1J22A 4US2R 2IVZA 3N0XA 3KBBA 1Y5RA 3G9UA 4NZNA 3ONWA 5EP4A 3BL8A 1EJ0A 1XL1A 4ZVVA 3GPLA 3PNVA 1EQAA 1P9WA 1DWQA 3TM5A 1K86A 4Q3EA 3UK6A 4DN6A 1ML4A 5HM6A 1E20A 5TGDA 3WB1A 3LO5A 4CVNA 5A5VA 4D9FA 5DI3B 3DZIA 3R24A 2FMTA 4M8SA 1MVLA 2EBFX 2UVQA 4UJ3A 1V5WA 3F7TA 3KAQA 3QA3E 4U9HS 1QAQA 1UPTA 3VKFA 2EKBA 3DB2A 4CMKA 2OG1A 2IS1A 4UHDA 1W2GA 5FCDA 3IULA 1MX9A 3C85A 5IC5A 1W5SA 2IUUA 4LFAB 1QYCA 3P1JA 3MJVA 1KEKA 1HYEA 2A4KA 2XE6A 5KJEA 2Z1DA 4HYYA 2JI9A 3R5KA 4FKMA 4ZALA 1KOGA 4ML3A 3LHIA 4QDUA 5IN5A 4BQSA 2VZ8A 4ECEA 4XWTA 3VR4H 2ZI6A 2EFCB 2CYCA 4F5WA 3AUJB 1D9XA 1FFYA 2PAFA 2WOOA 3LQ2A 4K9OA 5CFNA 4Q66C 2BRUA 4EGFA 5ICMA 4RDIA 2REQB 4LCJA 1PDOA 1E1YA 3O8QB 4M1KA 4QUJA 1MXHA 1MZPA 3SHTA 2COEA 4E13A 4CM8B 3EUWA 1T1JA 1QLHA 1VG8A 1XDZA 1YK1A 3GFOA 1D2MA 2CBGA 2IEYA 3TB6A 1PZMA 2OZPA 4Y98A 4N03A 1AGNA 5IAJA 5IJXA 5FOSA 2BF7A 2WIJA 4F2WA 3NP7A 2AIRA 4LF9B 3HUFA 2BEUB 4R7GA 1NQTA 1ZJJA 1H66A 4QQFA 3RVPA 3MRVA 1MTZA 2JLBA 1XI2A 3H3XA 3HBJA 1RXSA 2ETXA 1EGQA 4E31A 3JV7A 3CWQA 2J6IA 1TEZA 2XKKA 4QECA 5CPFA 3DV9A 3FOAA 3S2GA 2V5UA 2WZCA 1PCXA 3BEDA 1Q19A 4MLDA 3KVVA 2R6JA 1GT6A 4LJSA 1TCCA 4G9BA 4YREA 4KEAA 4OJYA 3OD1A 3TQHA 1ZONA 2FMKA 4B45A 2AMLA 2CUKA 2V9CA 3N2KA 5JWOA 1E6WA 2CD9A 4MYRA 4CT4B 2QP3A 2IS2A 2V45A 3RROA 1LS6A 2PLNA 1Z16A 4XW2A 1HKHA 4JQOA 1SHKA 2QD5A 4A92A 1QQ7A 2FMIA 3KSZO 4HUJA 4UVGA 3HCRA 4JU8A 4TS9A 2F1JA 3B6EA 3SKYA 4PVDA 1WMAA 2IBMA 4HPWA 4D8XA 1SXJA 3DF7A 1B3RA 1LI7A 1CHNA 3LHDA 4RIFA 2QRPA 4NOMA 1U0RA 3L1JA 1WKVA 1U0NA 3SDSA 3DAPA 1FNBA 4MS1B 3ZHXA 1P45A 4OMCA 4JI6B 3F90A 5CITA 1N1MA 3MERA 5U4XA 3A6KA 2JL1A 1NLUA 1XKQA 3PNMA 2BDTA 1LW6E 4GEKA 4LVUA 2HC9A 2XI4A 1WZUA 1T26A 3LBHA 1YASA 2JVIA 2RKBA 2Q5CA 1QGYA 5CVVA 4Y6PA 4YASA 2G6TA 1JIQA 2AE1A 2I66A 3LP5A 3PPWA 4LXYA 4L7VA 4CG1A 2C57A 2WJZB 2PMBA 3E48A 4NFSA 3FWKA 4WX2B 4N12A 3TLCA 1IWOA 4F7WA 4HEHA 4DSUA 2NVUB 1DBQA 5GINE 3IB6A 3EZ9A 2YX1A 4N3BA 4A6PA 5IXJA 1UEXC 2HU5A 2VHQA 5JD4A 5HP4A 3E2PA 4JUAA 3REQB 4EI8A 1FFCA 3CLUD 3ZIDA 3QMMA 1PUJA 1SB9A 3K8QA 3F67A 4RF5A 1QYXA 1Q0QA 4CL2A 4JC5A 1LI5A 2I3BA 2O7RA 1A4IA 1RABA 2CHUA 3P0JA 3SDZA 4P5EA 1P19A 3FDFA 3KQMA 1BHO1 4HRXA 4LPKA 1GZDA 4KO2S 2H4XA 3ETJA 2PTHA 1KYVA 2YJ3A 3IVGA 1PFKA 4BY9E 1N2JA 3RHFA 4CFZA 1QVZA 1N7HA 2NV6A 3A05A 3OLVA 2C4HA 2ESRA 1DKRA 1Q77A 1ZVJA 3DHYA 3GRPA 5CM8B 4FFOA 5AKEA 5JD3A 1ISFA 4DNPA 3FNGA 1D5CA 1JG7A 3MBIA 2QUKA 3ZY3A 1Q83A 1HI9A 1WDLA 3CINA 3CVUA 2BN4A 1ESEA 3S5JA 4E2ZA 4H15A 2PZJA 3PQ5A 1KC3A 4J7CA 4NABA 3V1KA 4L16A 1GZ5A 8ADHA 1T5BA 1YOBA 4ZI7B 1Q5PA 1G21B 3CS3A 3SHQA 5B3AA 1JS1X 4TYWA 1T9GS 1SVWA 1YQQA 2O0JA 3GNSA 4IM7A 3M6VA 5JLJA 1H94A 4Z4EA 4EFMA 1U1IA 4MB0A 1COZA 2Y3IA 4W5WA 2BV3A 2JAUA 4G8CA 4ZYTA 3IPLA 5B7PA 3H0CA 5LQKA 1OZAA 2IHJA 3ROPA 3CLUC 2VHYA 2XV1A 4GOXA 2A94A 2UZ3A 3IPAA 3MJTA 4E5KA 4F1WA 4B31A 4RO0A 1GQ2A 3BDVA 4HYEA 1SG6A 1J20A 4Z0PA 2VIIA 1DDIA 2HWKA 2GZSA 1U11A 5K0LA 4W8OA 5DULA 1ZXBA 4BNDB 5H1YA 4L72A 1MXFA 3LF1A 1D6MA 2WSIA 3GD5A 1Z3IX 4RBNA 4P08A 5DK6A 2UDPA 2Q29A 3AHDA 2ZOSA 4PPNA 1UQRA 2VDKB 3BSYA 3DOEA 1XHEA 5TPWA 5EJMA 3A70A 4KPYA 2XADA 3KDSE 2VDQB 4I3FA 1A5AB 2JAOA 3L9XA 1KU0A 4G5QA 3FNFA 5DTIA 5F51A 5IUKC 2QZ9A 3N76A 3V6MA 3W2HA 5DN6D 3LGSA 2ID8A 3LOPA 4HQKA 2R4QA 3KEOA 4IZHA 4OU5A 4Q39A 1J0CA 3LDUA 3NGLA 4AZ0B 2R5NA 1PT8A 2VHEA 1Q50A 1WW3A 2ANBA 2B5WA 2ODPA 3KQTA 3R5TA 4KV9A 4ODIA 2A0YA 1CEEA 1JU3A 3GJ6A 1G1MA 2GD6A 2JGEA 3X3HA 4BFCA 1LVGA 1QP0A 2JCSA 4ZEXA 4KX5A 1Z5OA 4MVJF 2C2YA 4YAOA 1Q15A 1QQ6A 3CXUA 3WRVA 2OXTA 2A6PA 3ZXXA 4FWTA 1VL2A 2Q5EA 2ZJ4A 3IUMA 3TOZA 3QLUC 3A1CA 3HKDB 3OPYA 1A5ZA 4AJ1A 4LDNA 4MWEA 4V38A 4IX1A 1UFRA 2ZJBA 3H4TA 4MUBA 4O2BA 3DGEC 4J1SA 1L1FA 3UK1A 3ZY4A 5I45A 4B83A 1TYBE 4QAQA 1HEIA 5DHTA 1GPUA 5KHLB 4UE3S 2C2KA 4IJKA 4BDSA 1ABFA 4RFVA 3NDRA 1Q6YA 4LY6A 1SUEA 1SHZA 4L76A 2XB4A 1M1ZA 2RKOA 1FDVA 1BE8A 1K88A 2QMEA 3E9QA 4HXFB 1EFVA 1I1HA 1U04A 1IZ7A 2B4QA 4KQFA 4NOLA 5F64A 5BNFA 3BMNB 3RS7A 3UHAA 1ECLA 1VGRA 4UREA 3D3EA 2OWEA 1BGWA 3FZNA 2NUBA 4ZGWA 4JBGA 3ANMA 4RAOA 4H9GA 3N75A 1L5NA 3G13A 2B3TA 4JIMA 2OZEA 2CJXA 3RK1A 5FNVF 3WLRA 1BE1A 3A06A 2W6OA 3T34A 1ZK2A 7ADHA 4PQRA 3ZHSA 2DFVA 3GC6A 4RPCA 2PS0A 4CL8A 1SUFA 4M53A 1E3TA 2TMGA 4LXXA 2QUHA 2CFOA 3K9WA 4ZV7A 4DJTA 4YQFA 3QPDA 2EKQA 1F2TB 1TO1E 2DTDA 2WKSA 5EKUA 4ZTBA 1Z29A 5MFZA 5LQAA 3F6EX 4CLXA 4ES6A 3UQYS 2JFPA 3H2JA 3GLUA 3VR3A 4PWZA 3HSKA 4OK6A 4RKYA 2R4UA 3IHKA 1VP3A 4RVFA 4Y3UA 4EG4A 4F5ZA 2FW7A 4MV1A 2R96A 4F7DA 1WZ2A 4GLOA 3UA3A 5EZYF 2JIOA 3C7DB 1AQLA 1JFLA 3SQOA 2ZRPA 1AV7A 4KU4A 1J42A 1ZH4A 2E48A 3K53A 4RCZA 5TXGA 4EI9A 1ZL2A 2HQBA 3BZBA 1U6IA 3R3XA 4K8OA 1M5TA 4US0R 3U4MA 2BGJA 4B3FX 3M3HA 2QP4A 4KLZA 1QG2A 2CMHA 3AM4A 3P9QA 4NTZA 3WBJA 2Z9CA 1DS6A 1O87A 2V5VA 3C6BA 4KQHA 1ULAA 3CVJA 3GJZA 2ZJ8A 3EFOA 1QFJA 4P32A 5F33A 2XHEA 5FBRB 1N5LA 2R1TB 5LP6C 1J56A 1I9CA 1WDWB 2NGRA 1BYUA 2HNKA 3FXAA 4G36A 4JXJA 3WIVA 5BWNA 2WKRA 5BUZA 5LL6P 3ME5A 3G2OA 4TROA 4ETMA 3HWX1 3WIUA 4EB0A 3MPOA 4NPAA 1KO7A 2JZCA 1J99A 5IEBA 3ZY6A 2OD9A 1ECBA 5HFNA 4DCCA 3ZU6A 5LPNA 3W4JA 3W3AD 4OLBA 1KI9A 1NQXA 5FRDA 1JXOA 3CUEF 3NT2A 4B9AA 3U6BA 4EUNA 4RW0A 1NVGA 2LR0A 4DMFA 1TAUA 3L1VA 3RS0A 5K51A 1X2EA 3ZDRA 2GNAA 3QSGA 4PG8A 3NRBA 4RJJA 3FW1A 4D97A 1RZRD 2IUYA 1J0BA 1HFJA 1R6TA 2C2MA 5EXDA 4AFNA 4TWAA 5LQUA 3E0QA 3VSBA 3GMTA 4EB6A 1FRFS 1IUKA 2XLBA 4FNAA 1SUAA 1GCUA 1Y9AA 1Z4IA 2IYVA 4M1MA 3NOQA 2FGKA 4DT1A 5KYNA 5M7EA 1DKUA 1EG2A 1ZEJA 3DWEX 2W00A 4G9EA 4HWGA 1NYLA 3P45A 4K9LA 3TTVA 5I7UA 4IZ6A 3RR2A 1E61A 2HHLA 4DRZA 4XWAA 3D4NA 3I5YA 3KOXA 1F17A 2Z2JA 1SQSA 4D3XA 5ISMA 5E3IA 1KOFA 3B1ZA 2Z2KA 3I9KA 2JAPA 3O26A 3O9MA 4XSHA 3TTXA 4CV3A 5C2JB 3LT1A 5K5EA 1U8UA 3ADBA 1LF0A 3DBRA 3GRFA 4WWHA 2ZAOA 5LIPA 1U9IC 1L4LA 4BMZA 2RGXA 4AG5A 2DLNA 4JU9A 2BJWA 4LE0A 4JJGA 3KPVA 4JB0A 3MOIA 3R09A 2Y1DA 2VEOA 4HLQB 1BVHA 1U2PA 4UEQA 2Q62A 2XW6A 2OC4A 3TR5A 3U3JA 4CKXA 3ZWAA 3QTBA 5SZJA 1ZWKA 1UBSB 2J3JA 3DL0A 2WDPA 5ED0A 1WKCA 3ZLJA 2JEZA 3NJ8A 1PJTA 1OD6A 3EMKA 3ZXIA 5BMVB 3PGMA 4M0PA 2FY8A 1SXGA 1S5PA 3GUUA 3I73A 5BRJA 5FBQB 3L0OA 1U9JA 2DOKA 2IYQA 2QQGA 3Q7TA 4V0RA 1AKQA 2B5VA 2ID7A 4NMWA 4E15A 4CCYB 4Q7LA 4ARZB 1EFVB 5C3MA 2ALJA 2LKDA 3DBOB 3DDSA 4DCOA 2JJ1A 4TRJA 1WMFA 3ORYA 2JBAA 1XALA 2XUGA 4B87A 1QZ3A 4G5OA 2P9FA 1INLA 1Y8RB 3OJEA 4O25A 3BE8A 5KJ6A 2K5UA 3CVXA 1SC1A 4N5DA 4YP1A 2W42A 3EGDA 1RCUA 1XTTA 1YFLA 4WBNA 5I48A 4F38A 4UM5A 3LH5A 1GUDA 2FPLA 4IIVA 3WYBA 5IJ9B 5BO5A 1TJYA 1U7OA 2BJHA 2Z83A 3HZHA 5E4JA 2QT1A 2J87A 1NDUA 5TNXA 1ZAKA 3H1EA 3PHHA 5EJGA 4OHVA 2E4WA 5FNZA 4ZIRB 3DAYA 3QSYA 4C4PA 4OHPA 4M1WA 2AEEA 2WUWE 1D5WA 2FLVA 3AWDA 2DZDA 4YRQA 2D1QA 5ALHA 5CFRA 2G1PA 4P36A 3FDXA 2C2OA 2I8CA 1TIBA 3KQKA 4YONB 3EF0A 2QVXX 1DC3A 2VRNA 4UU1A 2JA1A 1KJZA 5JISA 4FEAA 3JALB 1SU8A 3WWYA 4BN5A 5HR5A 3OJCA 2NVWA 3TZHA 5JBNA 3FPFA 2H7VA 4PLCA 4ZFNA 4CYMA 2R7LA 3QKTA 1J2EA 2FP3A 5LA6A 4K2AA 3SHVA 5JRZA 3A1WA 2O2SA 1Q11A 1WBDA 3C4JA 3BWMA 1R4AA 4O3FA 5E95A 5JCZA 2B7BA 3HPQA 4A8JB 1SQ0A 1S89A 1Q0TA 4EVQA 1IBLB 3QFRA 3G7UA 5I9NA 4J0GA 2Q6KA 1HDEA 4GDMA 4FOSA 2C2GA 3SEZA 1EQ2A 1ZD2P 2EJWA 2EV9A 1SCIA 4MWSA 4QXOA 3NKLA 1Q7BA 4IEIA 3UK7A 5CDHA 5JFGA 2VF8A 1OH5A 3RUEA 1DJOA 2GJ9A 3DEJA 2C2BA 4UNNA 1E32A 1PT9A 3CF4G 3CLHA 1L6IA 4OXNA 4RK4A 1D1SA 1GAQA 2YRXA 4WIAA 2XVAA 5FUVA 2KLBA 3ZWCA 4YRTA 1KSGA 5BR1A 2LXNA 2H48A 3G1WA 3MWEB 5TJHA 2X8BA 4LA4A 3USZA 5TEWA 2O3TA 2VOEA 2GGSA 1NW6A 1C4XA 4QFDA 1ZMBA 1C2TA 1OLSA 1XD2B 1EVKA 1T5DX 1UEIA 2E49A 4HO1X 2OXCA 4MCIA 1TUBB 1M6YA 2VHXA 2IZ0A 1PG0A 4ZQFA 5ENVA 5EIHA 2FJPA 3FPCA 1V1RB 1E1NA 2NWQA 5A9TA 1EFPA 2XUDA 2Q5JA 3OEHA 2NO6A 1L5ZA 3F7OA 5G0SA 3U39A 1JKMA 3F4BA 3CO0S 2Q4BA 3ZLUA 3ZIUA 5F3RA 5K8TA 1SBIA 1IIBA 3E81A 1CSEE 3GLQA 3UNXA 3NKVA 2DFDA 3WA7A 2W2LD 1LW7A 5HGXA 1SIBE 1J2JA 4XUGB 3FPEA 4NDNE 5E4TA 1MOPA 3IHLA 8GPBA 3RTGA 3ZWKA 4GR4A 1TYCA 2CFRA 4BKUA 3ZK8A 3IRUA 4ZKEA 2IYTA 2DTEA 4OQXA 1RM5A 3HBFA 3OTGA 2QN8A 2QZPA 2W2QA 2WD9A 1VRWA 1O6ZA 2HLDA 4JP5A 2KBFA 4X20A 4DCPA 1WZIA 1W1WA 4HDMA 3F3YA 4I4TF 4IQGA 5IBCA 3AKZA 3RS8A 3P2YA 3JQDA 5GONA 1P2DA 2C94A 2QTWB 4I4CA 3WNZA 2IYEA 2EIXA 5HE9A 2MYPA 1YS7A 3K0BA 3R44A 4EO7A 1O2DA 4B76A 3G0HA 3DTVB 5FEMA 2Q1YA 3B53X 1V8BA 3H18A 3HVHA 4HJXA 3BSFA 4RWEA 4F3YA 1WSAA 3MMXA 2AOVA 1D0SA 2HRDA 4IIJA 1RXIA 3DS8A 4OGFA 4NQZA 5CH8A 1Q2UA 2DCMA 2QEQA 2QKYA 2WJJA 3ABOB 3KJFA 4ZQHA 3ZE6A 3F47A 4CIYA 2A30A 3ZG6A 1MT3A 3HCWA 1TK9A 1A8SA 1QCYA 2ZVDA 4KZKA 3QPBA 1IG3A 1ZNZA 4NLLA 5JCJA 3W0LB 3WFIA 4E2XA 1W0CA 3D3QA 1M1YA 2QN2A 2X23A 1EBUA 3A3YA 3KZKA 4FCWA 3RAPR 4PCUA 4AJ4A 1FTQA 4M4SA 2V7QA 1ZJ5A 2R86A 3Q5DA 4JA2A 3UJPA 1LRJA 1MH1A 3LT0A 1W581 2CHQA 3NALA 5TDHA 4W9NA 4CV0A 4D2IA 2UAGA 4C14A 4PZLA 2ZBFA 1XD2A 3G8BA 1KAQA 5IBQA 2QQ5A 1MH9A 2QTCA 3NYIA 1VDZA 3ICPA 1NMXA 1U90A 2HJSA 3BQ9A 3IE0A 5DX1A 4KR3A 3MN1A 3C3MA 4KE7A 5H5JA 4EYGA 2JAXA 2PAAA 5ALOA 1YIAA 1C4WA 1N77A 2HN9A 4O1HA 4C03A 4DNXA 4E0BA 1VBFA 2GAAA 2AT1A 2EHDA 2B69A 1Y9DA 2QXTA 1E2GA 1N9ZA 3GCZA 3EE6A 4MKFA 5DGXA 4V3CA 1TUIA 4QLBA 5IHXA 1QO0D 1BFDA 1MUUA 3USES 5HJEA 1CJCA 4ZAGA 1R4ZA 1EGVB 2BFCA 5TLSA 4EK9A 3PXUA 4R2XA 4DJDC 1PR4A 4UVEA 1NXQA 1UKYA 3T9CA 3TXXA 3AESB 1ZRNA 4HOYA 1CZHA 3AX6A 3JQQA 1R8JA 1NT4A 2Q8NA 4GYKA 4HEA1 1MB0A 2XF2A 5KAPA 2PLAA 4OCZA 2X14A 1E59A 3BB1A 4R2LA 1E5VA 2SICE 3I32A 4I7EA 2FP4B 2OT3B 2QTMA 5DYWA 2AOWA 4QU5A 4G89A 1UJ6A 4GRAA 5F52A 3HZZA 4IRXA 4FFVA 1Z4MA 3ZI7A 1KO1A 1N5IA 5BV1A 4PFJA 4RK6A 3EW9A 4FEYA 2OQVA 1P4GA 1WULS 4KO3S 1JUDA 3VR2D 4BNZA 1QUEA 3W2TA 3EOAI 3TTYA 2LP4Y 4OGLA 4MRPA 4XWGA 3MB8A 3T5BA 2HDOA 4WNYA 5DSXA 1Q6ZA 5FA5A 3PS9A 4FGLA 5CYOA 4A8TA 4B35A 1H0RA 4MVJD 1JHUA 1O95D 4KFTA 3WKCA 1BU5A 2H57A 3DTNA 2BR4A 2V98A 4OO3A 2PFSA 2R5FA 4Z7JA 4J03A 1EFDN 2FW8A 3ASUA 2PUBA 3L1IA 4YLYA 3D2BA 5BMOA 5LZ5A 3RWMB 2CUNA 2R2GA 3PI6A 5TS2A 4YT5A 3HBAA 1U6JA 4RKFA 2WWTA 2GYYA 2IIBA 3ISJA 2ZANA 3N9IA 3VR4A 4E33A 1T0UA 5LVAA 2RAPA 3HXOA 4KLCA 1NJ6A 1KK0A 1Z47A 2CDBA 3EVGA 3CX7A 3H17A 4M37A 2E4YA 2BCJQ 1EM8A 1QYWA 2BONA 3BORA 2F3QA 3BC1A 3I30X 3NAQA 4J2HA 1YL6A 5FQNA 1EVIA 3ZJTA 4F0JA 3HXMA 4UAGA 1R0YA 2DT5A 1XEFA 3OE5A 4PPFA 1MVOA 5F2OA 1TEXA 3KR2A 5JCXA 1GUZA 4B7ZA 3IAM1 4WKOA 2VG8A 1W34A 1GZVA 3RBZA 1A4XA 3HJRA 1JECA 1P39A 2G08A 3K8OE 3IUEA 4A6XA 1KJNA 4HQOA 2Q0XA 2PMCA 4F12A 1WD7A 5JTUA 5KMGA 1SBZA 2Q9AA 3BBPA 4EBBA 1JKIA 2PSSA 4ZOLB 3GU3A 1NC1A 1YB4A 4WBNF 1A72A 3ROTA 3B13B 4JLKA 1WXGA 1MJFA 1DIBA 4KACA 1BEZA 1YR3A 3PPYA 4FONA 1D6SA 1E9DA 1A2BA 1UZNA 4WY5A 5I9MA 1NXOA 4QUDA 3DTVA 1RKVA 4TYMA 3RO7A 2JLXA 2WF8A 1QYDA 1G64A 4J3FA 1F0NA 3KUXA 1V7QA 1G38A 4JA0A 4KYIB 1NV9A 1CRWG 3CRNA 2VPZA 1HDIA 4DREA 4TXMA 1XMOB 3FHTA 3DEHA 1XF9A 4M7RA 1K7SN 2AJCA 4ZRNA 5C1IA 4COOA 2FF7A 1YK0A 1C7FA 2C92A 2H5EA 3I2YX 3KVNA 4FW9A 3SS8A 1N75A 4ZDKA 4OSPA 5CX1A 3VR6D 3M5PA 4DLUA 5DCUA 1JPVA 5FH9A 1PR6A 3H19A 2G4CA 1U31A 4J0IA 1QP7A 2O8EA 3OY2A 1VIDA 2HPVA 2BHNA 4ALLA 5BQXA 1WM1A 4F85A 4K9SA 3OIYA 1IH8A 2XGSA 2VH2A 4C4XA 3HGQA 1T0HB 3P2KA 1CF4A 1KKLA 1K7YA 2Q2QA 2QORA 2QNBA 3FNQA 3SC6A 1EFPB 2VJYA 2ZROA 2REXB 3QOWA 2JD0A 2PWZA 1X1BA 1W6UA 2DFLA 2G67A 3I0NA 2GQ0A 2FPGB 5J2TA 1L7NA 1L4GA 3SBXA 3GP8A 1TUBA 2HRZA 3CZAA 3EQ2A 2GT1A 2YBDA 1RAFA 4I14A 1YRQA 4BEWA 1MENA 1JDUA 2G9VA 1H1LB 3AUKA 1I7DA 2OP0A 3F2IA 5B7GA 1ZK1A 1CTQA 3MQ2A 1N7JA 2PPLA 4AZWA 2IPAB 5L40A 4JGBA 4RA6A 1RD4A 3ICOA 3CF6R 4YQZA 4X91A 4YJ3B 1MLDA 1OX4B 3DLPX 2JLYA 2QTLA 2PX5A 1RHRA 1OFUA 1QIMA 3B2QA 4UXJA 3FFAA 3GLHA 3K92A 3WP1B 1W7AA 1Y5IA 4YRRA 4I9NA 3P4XA 1Y5LA 4Q1VA 3CNEA 3Q72A 3KOZA 1TZMA 4PCVA 2OENG 5ITWA 3QQPA 4ZU3A 4CKBA 4GI7A 4OHFA 5G0VA 3T9EA 4FC6A 3UPDA 4IKPA 2QTBA 2CC2A 3OQNA 5EUMA 4J4BA 4ND6A 3W5VA 3ZDEA 2UXDB 2GI4A 1PVDA 2P0EA 3AKDA 2KPOA 4RZHA 4H08A 2J9XB 2MINA 4L6CA 5BOVA 5EPEA 1F2VA 1XPRA 1H2ZA 2FQWA 1QJCA 4UZSA 3ZQ4A 3SCZA 3T3OA 1Q1NA 3Q3HA 3MWJA 3IUJA 2A84A 2YHAA 4LDRA 3ZWPA 3CKLA 2OD7A 1K7XB 1QH1A 3Q7EA 3T9FA 4J0DA 3EA5A 1L8LA 1M6EX 2FE1A 4ND2A 1H2RS 2BFDA 1JQKA 2J48A 4NEQA 3ESDA 3HCPA 3UT6A 3V7WA 4EEXA 5IF9A 3W5BA 2JHCA 4RVDA 2N9UA 2IZOA 2O2YA 5B30A 5C5IA 5KWIA 3EH2A 1HORA 2MTBA 1CJUC 2C99A 2D0OB 3AJRA 3GDHA 4HLDA 3EXHA 4JH0A 4YXWA 2XVMA 3S27A 2NNWB 2ZZNA 3WNCA 4WXYB 2HFJA 1BXKA 5K3DA 2K7ZA 3FZGA 1UBRS 3QWAA 4M7OA 4Q3BA 2UUOA 1PYOA 2YWFA 2QX7A 4QYTA 4ZAXA 1M8GA 2OCKA 2AJTA 1X8JA 2CFSA 1L7BA 2AUTA 3BG5A 2HCJB 4HP8A 1L7AA 1ZSNA 2VDLB 1RYBA 3SC2A 4AS3A 4DWJA 2HK8A 3FMGA 5CW1A 1DXQA 1ZGCA 3QVOA 2H6EA 3I05A 4XJXA 2VUTA 3M4NA 1Z2OX 3JAKA 2O1WA 4CM6A 1R8XA 3K8YA 1H1LA 3FUTA 3K2QA 1E79A 4FR0A 4J0HA 4L57A 5DE3A 3S8YA 3DDUA 4GXQA 4I4NA 3EVZA 3VU8A 3OU2A 2WUFA 4ID3A 4C2AA 3F5FA 1CBUA 1ZI8A 4LF7B 1X9GA 2FYTA 1L4HA 3GDWA 2FSUA 4P2GA 5D8DA 4MRMB 5CW2A 4QICA 1LTKA 2GRAA 1YQGA 3LPNA 5AVOA 1AB5A 1P1JA 2V7UA 1P1KA 2GHRA 3OEED 3U4QB 5LQJA 3FM9A 3IOYA 4FEGA 4BASA 3U6KA 2P6PA 4CNQA 2ZJ1A 2VUHB 2E85A 2VNHA 1UKCA 1VM6A 3NIDB 4JEIA 4PFKA 3R0QA 4CM9A 1R0ZA 2DUWA 4ENQA 2VQSA 2YOHA 5IKXA 1S02A 2Q4OA 1NKTA 2EX1A 3O4JA 3LP6A 3LGAA 1OI7A 2Q49A 2AD1A 2Q1WA 1FUEA 1PX0A 5F2EA 3L6BA 5KVQA 5LP6B 2Z5VA 3ZVLA 4ZQIA 3A7DA 3BK2A 4N3CA 2C4MA 2X5KO 5AM1A 5IBPA 4Y30A 3THWB 1D2NA 2HJ9A 2J30A 4A0SA 5I7SA 3HU1A 3QIAA 4P6VF 5AVRA 4ZRDA 4Y9DA 3THYA 2AKAB 3KJHA 4HVLA 2Y0CA 1FDRA 3JCZA 3D7MA 1E6KA 1ZK0A 1O5TA 1M73E 2B8JA 2Y27A 4RTOA 3MINA 3MUFA 2AA3A 5D3ZA 4RKWA 1Z7YA 2B78A 3R6DA 1IY2A 2IDZA 2XMGA 1EXMA 3V2GA 2NT4A 3RB8A 5J5VA 4XE5A 3RC3A 5KUTA 2ZRQA 1ZK4A 4KQMA 1TF2A 1EJBA 4OLJA 1LGYA 2HMSA 1Y82A 2IEBA 5A0FA 3KSAC 4JJZA 3IP1A 3CVYA 1FTGA 3L4BC 2ODEA 1E9AA 5CK4A 3V1NA 3R9XA 1CRPA 1RE1A 4G56A 4LOJA 1X8XA 1QTNA 2CLHB 4E6PA 5REQA 1E60A 2X7HA 4ZI2A 1RXWA 4P0PB 3IALA 5JS2A 2ONCA 5HDQA 1DAFA 2QVYX 3IOMA 4PZYA 3PENA 3DVRX 1Q1BA 2NAFA 1NBME 1QX4A 4OI4A 4QVIA 1AV6A 3RSCA 3ZQ6A 2RC6A 1ESMA 4IG9A 3NJRA 4XPZA 1A9YA 2Q6OA 2ZRMA 3O4IA 2BZ1A 1JEOA 4GOOD 4YUYA 4S35A 3A1NA 4LECA 4D81A 5E3JA 4O4HB 2IV7A 1SBHA 3U0BA 1UBKS 1W87A 5AQ1A 1NF3A 1WV1A 1OCEA 2H1LA 1FDUA 3QKSA 4M54A 3O6VA 2XUHA 3QVMA 2JIZA 3INGA 1EXWA 2GBIA 2R6CA 3KYDA 1L5HB 3R2JA 4Q4AA 1JI0A 1T1GA 1IMOA 1T5LA 2Z4TA 3BSWA 3ECSA 1YMUA 3I01M 3PDIA 4HRYA 4JK3A 5LBIA 5LXTF 3TIFA 5DLDA 1ZZEA 4YX9A 3NUGA 2IS4A 2PQ2A 2HCTA 3T06B 2JNWA 5FI0B 5ALFA 2LCIA 4MAFA 3GQBA 3H9UA 3QWFA 4DUGA 3FLMA 5FA8A 4NYMR 5E6UB 4GUAA 1JJIA 1WCIA 2IYRA 3QYAA 2V3CC 3MCTA 1YF3A 4RQTA 2ZSJA 1PFYA 2F3TA 1PS8A 5K20A 2ZZMA 1ZLYA 3OX4A 3VNVA 3JAWA 1KARA 2BFDB 3GLFE 3IIMA 1GA6A 2VSYA 4GX0A 4Z9YA 2HJRA 1FZQA 4TVOA 1X7ZB 2QTAA 3M33A 1UK7A 2F8LA 4QOJA 1B1CA 3D6NB 3HJBA 3IT1A 4RYLA 3UB2A 2O0HA 1T5HX 1T1EA 2QN9A 1CK4A 4BGVA 2P3OA 2QN6A 2XTNA 3WDKA 4E5PA 3BH7A 3P9ZA 1H2WA 3BWCA 4BYGA 4O08A 2JHPA 4EJSA 3P5BA 4I55B 1PP4A 2O2JA 2GCOB 5A3SA 1MHPA 3RARA 4O4JF 4O4JB 4IDFA 4EW1A 5LBTA 4QUKA 2IHBA 3H83A 2OEPA 1F4VA 3O8CA 5DMXA 1Z06A 3AERB 4GRDA 4PAOA 4UD2A 3A3KA 3D2AA 5B4UA 2BEWB 4EG0A 4DLNA 4PBTA 3NM6B 2B98A 5B6PA 3F6YA 4FYJA 2N42A 4X8OA 3DLBA 4PZ0A 2GD0A 4E70A 2IQIA 1KEPA 3KB6A 1C1HA 2ONYA 4OJNA 5JROA 1ZBDA 2BE7A 2OBMA 2J6BA 2ORWA 1TC2A 5LYJA 2WTEA 2X15A 3WJAA 2R97A 3U3XA 1XZHA 3TBHA 3V4ZA 3JD1A 4B6GA 5AWFC 2ZYWX 4O2BF 1RKQA 1G7CA 1XRMA 5LZ8A 3SY8A 1V6SA 2C8JA 4OF4A 4OMFG 4PEVA 3VJKA 5DM1A 3BWDD 1UBMS 1GGKA 1L5FA 4GT1A 2IEZA 3SZOA 1K8YB 1TCVA 3I53A 5IWAB 4OP1A 1CC1S 2WQZA 5LXTB 3K71B 5TS3A 3I64A 4AECA 3ZI0A 5C7OO 3E5HA 3FRIA 4GC9A 4W6ZA 5IC4A 4DBLE 1SVKA 2O8CA 4JYCA 2JGDA 1IHDA 1XAJA 2WD7A 3W1VA 1V1MA 4AKGA 1XVTA 4GMHA 3I1FA 3RUHA 5A2GA 1EPUA 2ZLBA 1GRCA 4M1SA 1I7PA 4FMDF 4R98A 4EYSA 4A16A 1ZRSA 5E2BA 1KS9A 1ARZA 1F4PA 1NAHA 5C34B 2AFHE 4GOMD 2JEYA 3H5TA 1JH9A 1YQDA 2BKVA 4JX8A 1R0SA 1U98A 3EB9A 3UHOA 2AX4A 1IHOA 4M0KA 1GNLA 3ILVA 4E2WA 3NHRA 4YRGA 1WUTA 1W36D 4KVAA 1I51A 2WHRA 2CUZA 2PPVA 3VU0A 1USIA 2H54A 4I5FA 1YA8A 3SIPA 2G36A 4RHXA 4Q4HA 2Q5FA 4WCFC 3UYLA 1P60A 2SBTA 4B5KA 4KNVA 1R7RA 4U4AA 1QRRA 4JB2A 1FDOA 1A88A 2ZRKA 1J8YF 1W5FA 4RPIA 4YIKA 3L2OB 3AU9A 5IAGA 3H5LA 4Y2JA 3WLJA 4EKIA 3FZEA 1L5VA 4RFSA 1B15A 4LF8B 3N2LA 4DLXA 1LNQA 3CNLA 3MFYA 1NASA 1TX4B 3AVPA 4MUHA 4K6MA 3ER8A 3DKPA 1NU6A 1UBGA 3GJ3A 4XQCA 1R6AA 1SXJB 6ADHA 3WMGA 4DQKA 4JGIA 3ESRA 2GK7A 2HMTA 3LBNA 3JQ8B 4GXTA 4IVPA 3ZZTA 4D99A 1SUSA 3ASYA 4J75A 2QRZA 3JYHA 3CVWA 4ZEOA 4PYJA 3LRXA 1T6BY 1W0JD 2JGKA 3RU9A 4AIRA 2ZSIA 4C01A 1PW7A 4LWQA 3WBBA 3WL8A 4KVZA 2HM7A 1RVV1 2YH2A 3ICQB 3AP1A 4FFDA 4BPRA 2CLFB 4D0RA 2Q0HA 1J9EA 3D3KA 1EVLA 2OK8A 4D3YA 1W47A 3FCEA 2OYRA 3H11B 4B79A 3T99A 4I0WB 3TSYA 2VF7A 1N2XA 1JTEA 1CUJA 1GNRA 5B53A 3O7MA 1NXPA 1RXYA 1ZITA 3A26A 4EKYA 2AXQA 5E7QA 2OFFA 5CVCA 4ETNA 2EJCA 2EP5A 1QF7A 1RAGA 3BPSA 3HJGA 1GZ3A 4DIFA 5LMUB 3MWEA 2UZAA 2IZ1A 3Q9UA 4RWZA 1N2IA 3IQWA 3HJCA 2P5UA 2OQ2A 2F8SA 3QU9A 1FS5A 2ACKA 4BMSA 3NIGB 3O8QA 2P6UA 1TCUA 4V1CB 1SXIA 4N7JA 5JADA 1I32A 1U8AA 3D2CA 4H7HA 5DTEA 1H69A 4Y6QA 1G6Q1 3TSOA 5EIXA 1I4TD 3V3KA 3OE7A 1JE0A 1JSCA 2GA9A 3EDCA 3HY3A 4BVJA 1M6WA 2ZJOA 1KXZA 1J8MF 3GBSA 2D5AA 3N2ZB 4J3JA 4S12A 2ZTHA 2C5GA 3PUWA 4YXWD 1U5AA 2GCPA 4UBMA 2PUWA 5K0NA 1KBOA 3JWGA 4A36A 2FUEA 2O2GA 3AVXA 3TZEA 4J8PA 1JWBB 1FRVA 3NHPA 4TTJA 4ZMSA 2LDXA 3S1LA 3BQMB 2CXRA 1B26A 1DB3A 1ZUHA 3DNMA 3NEAA 3U80A 4YT8A 5KSOA 5F2KA 1RHKA 2EW2A 1KPIA 3PDWA 3PJGA 4YBRA 2H7XA 1BMFA 2XZDA 4PW0A 1PV4A 4I9FA 1WABA 5SYAA 1M2WA 2MSNA 2I6GA 3L8MA 1FQJA 3QG5A 2GZMA 2X8LA 1DKMA 1MPXA 3TM4A 3UO8B 2HI0A 1W19A 3ISTA 3SSAA 4G23A 2GMWA 4IRUB 1DRUA 1NNUA 1YU9A 4J94A 1A82A 4CCAA 4U6SA 1Q3HA 1EUCB 3VUEA 2P5YA 1IFXA 1USGA 1CEQA 3O5AA 5BQFA 1RC0A 1SFRA 2PMFA 4DCMA 1TDJA 3DFZA 2G07A 2XITA 3BGSA 1RXEA 3JQ7B 4LXHA 4MQ5A 4MS4A 3RRYA 4F11A 3WNQA 4C7OB 4MQUA 3SOZA 4C88A 2WF7A 1FK8A 3VSEA 1P33A 1NRXA 3PLAE 1CZOA 1UBJS 2WPDA 4IXNA 2GPTA 2H1FA 4PO8A 1YFKA 5TSDA 4D8TA 2BH2A 4I6JA 3AB7A 3L7YA 1HX7A 2VSOA 3B7WA 2VYVA 4IICA 3KG2A 5BYKA 3T8YA 1G2PA 3FRJA 3H65A 4B3MB 3AF6A 1WIWA 3WL4A 3ZGLA 2C98A 1M8JA 2GN6A 1WUKS 2G5PA 1XPJA 3QWBA 1RI3A 3WYFA 1OAOA 4BTEA 4DBLC 4DLTA 3CUTA 2OAQ1 1FYXA 2R5WA 1AS3A 4XGQA 4YMHA 4Y1FA 3VDMA 4RPKA 1QGAA 3ZDZB 5ADHA 3JASA 1DG1G 1MAWA 4B81A 5CJ2A 3W5JA 4KAJA 3AXTA 1DADA 1O0BA 1UKBA 3P2EA 1CJSA 2HUNA 3OM8A 5AICA 4LY3A 4RY0A 5ALWA 3WB9A 4QPZA 4AS1A 1IXRC 1ZVVA 5TQ2A 4LUCA 2H59A 1Q0ZA 3HI4A 1I14A 2I62A 3G79A 4KSCA 1G5RA 4PS1A 1RAAA 2BHSA 3PLNA 3AF1A 3UK2A 4P3PA 1G20A 2B8EA 2DFTA 2A9QA 3A8TA 1M66A 1QZXA 3LPAA 1GYQA 2NO0A 2WWHA 1JFRA 3BGDA 3MWFA 1UKVY 1L7VC 1Q1EA 3LGXA 3OZWA 2GDZA 4NPCA 2WSYB 3RUIA 2IU3A 3EEOA 3R3SA 4GC5A 4URWR 1ZOPA 2JFUA 3X2SA 2DBVO 4NARA 5FULA 1HQYE 4L8WB 3VYUB 5JMOA 5ECGC 2OFPA 1GNQA 2EGUA 1L6RA 1OASA 4J1NA 4B3HA 1CZUA 1JDPA 4HB3A 3O75A 1GR0A 2PRZA 2ZYHA 4P31A 5TVKA 4QGGA 3WTCA 1YZKA 5IYZF 2ZSUA 2R8BA 4X20B 2VXCA 4DV2B 4CQLB 2NUAB 1XWIA 2UZ0A 3GZNB 4ENUA 3LVQE 4Q7QA 1G9XA 1P74A 5HF5A 1ZISA 1M6VA 4NNJA 1EEHA 1ELOA 3FUWA 1JN0A 1S8NA 3M6FA 3PDHA 2JGAA 1ONOA 4D0GA 4MJ7A 4JUFA 2GHQA 4IH1A 1XDDA 3BL5A 2H7YA 2C29D 3ZZ0A 2PKXA 5L8VA 3STVA 3PQDA 4J7AA 4UM7A 5B58T 4XCVA 2EBWA 1ZKMA 1VG0B 2VF4X 4JLVA 3T1QA 1C3VA 1CUBA 4NZ9A 3WGVA 2DMRA 1GO2A 4ONEA 5EHIA 3SF0A 5JWRA 4XDGA 4I1RA 3EPHA 3NHZA 3RSOA 2IU0A 3BCRA 3WNBA 5ICFA 4IIGA 4B47A 4L8GA 5F78A 1ZOSA 2XE4A 4RSHA 1ODCA 2YVKA 2GK6A 1YJ5A 5DMHA 1P5ZB 5LDHA 3DZCA 5D00A 5FV4A 1W1IA 3A9CA 5HZHA 3K1JA 1PTJC 4N6OA 1Z25A 2RHOA 3H87A 5TB5A 4X8LA 3WHIA 5D3MB 1JBQA 2DKNA 1ONSA 3OF2A 5E0KB 3VPSA 3KAJA 4QZVA 1V4BA 3HP1A 4X62B 2A1TS 2IX9A 1G20B 1XAIA 1NNLA 1GWNA 2Y1WA 2OAP1 3DUFB 5AKGA 3ACDA 2R25B 1REQA 3QX7A 4HN9A 4Y2QA 3SS9X 3UEOA 5KDDA 3TQQA 3UGJA 3NAZA 2XNHA 1Y9ZA 3TW0A 1WXEA 3TCNA 3G5AA 3BD6A 7MDHA 3OQJA 1DWPA 1ZA2A 3P5SA 4G8DA 2F48A 4RZ2A 4OHYA 1EAMA 4E1AA 1GDHA 1WHTB 3EQZA 1CQZA 2WFAA 4URYR 4NULA 4AK9A 5D6NA 2KYRA 1AE1A 2RGAA 2FPOA 1BH6A 1S9HA 4QBTA 2XZPA 4TV9F 4WINA 1J7KA 4AN4A 4D0NA 4D43A 3VPFA 1NLZA 1NOIA 2A0XA 1ML3A 2YRFA 3DOIA 1QO7A 4H7KA 1BJRE 1XL0A 5ITZA 2VHZA 4FDTA 4YNBA 4F84A 2ADMA 2F6RA 5CA0B 4NV1A 4BNVA 2O8DB 4QU8A 3LL7A 4EPWA 1J8DA 3ETLA 4AKTA 4FJ0A 1B0AA 3N6VA 1JZTA 3AYXB 4ENRA 1CZLA 5K2MA 2WWRA 1OF1A 1TM2A 3P9SA 4WOBA 3TECE 3ONVA 4KHPB 3WGOA 3MG9A 4ISCA 1WTAA 4RIGA 5I7EA 2F9FA 1EDOA 3H1AA 1E7QA 2AN1A 3IIKA 1ILWA 5HBGA 4NOKA 1H4QA 3D02A 4MWCA 2XMRA 3ELDA 4DZTA 4LWZA 1XZBA 3T3HA 5E1DA 1Y7IA 2NXEA 1E9CA 1RLJA 2GN4A 3O8DA 5EE9A 2HPZA 4F2DA 3NTXA 2QG4A 5EKXA 4LKOA 4ARZA 4QFCA 4U7TB 2A86A 1NURA 4JUDX 2WMDA 5C3UA 3BIXA 3JTMA 3N0WA 4GWLA 1MIOB 3DYBA 2ZPTX 1K75A 2RHCA 4MUIA 4U1RA 1BVYF 2ECOA 3FAKA 4KUGA 2E87A 3L7NA 1A76A 1II8B 3FOFC 2C5HA 2C3PA 2QX9A 4FDLA 3M3PA 1JDBB 1UT6A 4GXNA 4D3DA 2R6AA 3AVYA 4TT8A 4GMGA 3LUGA 4LW8A 1RJGA 4Q82A 1U2DC 2H2IA 2HWYA 5CFLA 5LP6F 5INTA 3PU6A 2YIMA 3DHEA 1YZNA 2NNLD 3GGSA 3TW8B 5IJ0B 3MW8A 5K0CA 2WSSA 3D0QA 4GSYA 1CUIA 1Z37A 2P65A 1NQOA 2R1ZA 3PBKA 3GPIA 1PLKA 4WZBB 3R7DA 3N05A 3OCVA 4RNDB 4G84A 1BWQA 2AHRA 2QTHA 1Z6PA 3I42A 4M46A 1JKXA 4Q3KA 5HRUA 1NVTA 3ZNOA 3QU7A 2FQYA 2YHUA 4MVWA 4A0RA 2MINB 2VYND 4Q3AA 3EXG1 3DAHA 5I9SA 2G76A 2X1VA 4XARA 5C5EA 3USCS 1PHPA 2ZJ7A 3KCQA 2VT3A 4BUJA 2W43A 1KVUA 3KOYA 3Q3IA 2EG5A 3CHYA 3ER9A 1FLNA 1DC6A 2HGZA 2Q45A 4BAUA 2VL7A 3IIEA 2AB0A 4CKBB 1ODTC 1NY6A 1TO2E 1Z2EA 1G3QA 1I2BA 2C0QA 2ODNA 3NU1A 4KI7A 4MPJA 1NXWA 2VBGA 4LK3A 4MV7A 1CNFA 1CHDA 3M1YA 2GASA 1R74A 3QUBA 3IJPA 2NU8A 4F72A 3HYTA 4QKQA 3L6UA 5CLLA 3WADA 3L5OA 5KYYA 1C9JA 4HMQA 3CC8A 4NK5A 4C0KA 4CDGA 4ZZ1A 3O3OB 4HX9A 2MHCA 4LOAA 4G86A 3H2HA 5JNRA 3NZEA 4DA9A 4JOQA 2VRBA 2NPIA 3TE6A 1N4DA 3ABSB 2IY7A 3ASVA 3C7AA 1MX1A 2H06A 2Y68A 4NAUA 2PX6A 4RMJA 1GLGA 1FYWA 4I5EA 2QL6A 3OM9A 3AHGA 2HIMA 1NXXA 5F7OA 1PX2A 4CLHA 5AESA 4QEDA 2A88A 4EFLA 4O4IF 4P5DA 2XZOA 5ADVA 2BZGA 1TZJA 1A2QA 2HJVA 3L8HA 4LYEA 3WGYA 3FTPA 1GV1A 3MT7A 3FH0A 1L7MA 3RSZA 3UHFA 4J49A 1FXUA 4TTRA 3S7ZA 4O1IA 1O96A 1T5OA 3ELWA 4OXIA 1ZVMA 4KX3A 4KGDA 3WLKX 1VJ0A 1WMBA 4ZAVA 4ZHQA 3WHLA 4B7UA 2MDTA 2OFWA 2N47A 3KR9A 4UUAA 5FBLB 2KE5A 1LK0A 4TSFA 2RAFA 5K3BA 1B14A 3PF8A 4CEIB 2R7KA 4YROA 3FIJA 4LJ8A 4NY1A 4GR5A 4GZLA 3MRSA 1VSBA 3OC0A 4C22A 4HRAA 3U3MA 1GSAA 4KG7A 5CLGA 3FSRA 5CIWA 2WYWA 1JAXA 1D07A 2JI7A 4XB1A 2EYQA 1KC1A 1T10A 3RKUA 2QL7A 4JBNA 2IXGA 4OUKX 5D85A 3RDPA 4TKLA 5HQ3B 3EH1A 5G1NA 2QJOA 1L4KA 1KJYA 2SKEA 4MPRA 3WSVA 1BEEA 1GNSA 4DSTA 4G2TA 2F67A 2HAEA 1ZU4A 1FEZA 3WLAA 4FZ3A 2DQZA 3UCEA 4L5AA 1USWA 4PGMA 4WXMA 2G0NA 2WT4A 3WYEA 2UYQA 2XPCA 3TJMA 5FUMA 1FLDA 1NVKA 2QPOA 3C70A 3OO0A 1D2RA 5JG7A 3A6PC 3HU5A 3E15A 4ETIA 2X2PA 5L53A 2H8GA 4HH0A 1WB9A 2WA2A 2WWGA 1V7ZA 3BCSA 3V1YA 1XK6A 2GYWA 4J4TA 1DC5A 3RVOA 3LYUA 4DXDA 4G97A 1GNVA 1JRLA 2OWDA 4DBZA 2I34A 2EX0A 3ROMA 3G2IA 4JQYA 1PBNA 3HB4X 1BDHA 4Z0TA 4AJIA 4ME6A 2PQ0A 4KFCA 2WKPA 1A9PA 5B1EA 5ARDA 1CVLA 1FX0B 1QH8B 1QVWA 4RFLA 1MG0A 2IEIA 2X0FA 1VP9A 4AMGA 5AVUA 5J59A 5KNDH 3R6LA 3WKEA 2DE0X 5K03A 1PU2A 4R2KA 4LXIA 3DZBA 3FVVA 3ZCSA 3KSDO 4B3GA 2HCFA 1JDVA 1U94A 3LRTA 3N5CA 1HBJA 4UOQA 4BCCA 3ZBTA 1IXKA 3CYFA 2ZUCA 4RF2A 4PBRA 3U7HB 3QE4A 4TOIA 2AW3A 1FU8A 5JSZB 1U9IA 1VLQA 4DCSA 2GM3A 3I2HA 3OJFA 2I6SA 5FL3A 3V00A 1QFXA 4Y1RB 4KQJA 1RLMA 1XDGA 2ZAIA 4GBGA 2NZWA 4PCAA 4BMNA 5A1TA 3S2IA 2R8ZA 2DUJA 3B48A 3C3AA 2XD9A 4X00A 5A05A 3M9XA 1IYZA 1ULTA 3H2SA 4JP8A 1XRRA 3MMNA 5IAKA 5EIBC 5FWXA 3HK2A 2GK4A 2YMMA 2DQKA 3Q98A 1KZ4A 4JJ7A 5KNCA 3SSNA 2PXCA 2A8YA 3QF4B 1Z6YA 3PKIA 1N36B 1V47A 3JD3A 4YJ3F 4QXMA 4RK7A 2VUIB 5L3VA 3KX2A 3SLGA 4KQEA 1LUAA 3EMDA 2O2DA 1RWMA 3BK7A 4JI3B 5IT5A 1GY8A 1PQPA 4REQB 1PJZA 2P9QA 4CEHA 2QU7A 3VPHA 5EQDA 4W5JA 2JHGA 2D5BA 5LMCA 4M9QA 4JOCA 4OG2A 1KI6A 1YH3A 1CR4A 5HM8A 4GHWA 4I4LA 2AG0A 4IV0A 3MFQA 4HQ6A 1G18A 2M6KA 3IQZA 5SV2A 4F06A 3NV9A 1H05A 4DYDA 3TQRA 1Z0UA 1TZKA 2WWWA 4CG2A 6AT1A 1TJNA 2H7CA 3FD8A 4R6WA 2ZU6A 1KYZA 3OWOA 5ESXA 4BO2A 4I50A 3CIOA 2QLMA 1NF8A 4LF4B 3KT0A 3ADPA 5FEUA 1ECCA 1JH8A 1ONPA 2P7IA 2QD4A 4F56A 1N2OA 3ESZA 4B73A 5F9FA 1OWOA 4WASA 1YVRA 1EA7A 1X1CA 1PR1A 3AM3A 5FFFA 2QE7D 3LM8A 3P7MA 1LZKA 2RGDA 1SVSA 1MV5A 2YCLA 4C07A 4U3JA 2LWIA 4L22A 4PYIA 3W77A 4NBSA 1KH1A 1SURA 3D5EA 4L4SA 2OYCA 3JQ7A 1GA4A 5TX7A 2UVPA 1ZHOA 2VHWA 5JPIA 2D1TA 3Q87B 1P1BA 4K9DA 4EVIA 4CLEA 3LNCA 4JFAA 2CB9A 1FE8A 3AF4A 3ADCA 3ZTWA 1LVHA 4MS1A 4KK3A 4IIUA 1IN8A 2GN0A 4FW8A 1J8FA 3TUZC 4BCBA 1JIUA 4O1MA 2HDWA 4RACA 1LKZA 4Z49A 2I7DA 2FK8A 2ASVA 1YQ9A 1HT3A 3ED1A 5AW9A 4BHTA 1J06A 1W85B 3E3NA 3C48A 3F5DA 3PNYA 3HN7A 1K0UA 1D4FA 1ZBQA 2QN3A 3BL6A 1EH5A 3EGIA 3ENWA 3PV0A 4KXXA 4Z8XA 1H2YA 3GJ0A 4A0FA 4EW3A 4HDRB 5FUQA 1ADFA 2GN8A 5KC9A 2G3YA 4BJ1A 2PL1A 3OPNA 1VI6A 5A5GA 3PIRA 4Y0VA 1BW9A 4I6EA 3LYHA 4WACA 1NU8A 4L08A 5ER9A 2ZZKA 4MYUA 5DSZA 3E9NA 1Z63A 1J6UA 1WCIB 4ED9A 5BNIA 3U7FB 2O7QA 5DH9A 1EXNA 1VHDA 1P8JA 3E8MA 3H9JA 5AOAA 4PG4A 3H84A 4Z3DA 2BTEA 3DMPA 4NK4A 4YJDA 2HQSA 1K27A 4IQ0A 1WB4A 3JAWB 1ADGA 2B2NA 3JZAA 4ZT2A 3ZWDA 3DDWA 4LQ4A 3E3AA 3U7QB 4ARSA 2VOJA 3MS4A 5DIZA 4AW9A 1K8ZB 4B6PA 1UJNA 1XDWA 2NU9B 4YP0A 1RPNA 2JLAA 1CF9A 3T5AA 3TGLA 4HR7A 2AR9A 1LDEA 4FQ7A 1M2NA 3O1LA 4GP7A 5AI6A 3U7IA 1NXTA 5DYYA 2BM1A 4FMCB 5HTKA 1FJHA 3ZD8A 1QSGA 2JIMA 3KTFA 3L4SO 1Z62A 3OE7D 5ANRB 1K3UB 1YI1A 1DQPA 5TE9A 2EGGA 1WO8A 3I9NA 3CCFA 3L0SA 4XDZA 1L4BA 1Y3FE 3L1KA 4HX2A 3HDJA 4J43A 1OAOC 1W4LA 1O97C 4GBJA 3GFBA 2A1UA 3GFGA 2J9GA 4YWHA 2E5WA 3DZDA 5HDBB 1IVNA 3ZIAD 5H8WA 3VH3A 1H65A 2XX3A 3O95A 3TGPA 1LPPA 5A3VA 1JI3A 3F5QA 3WGKA 1VKZA 1N6PA 3ZI4A 3VU3A 1JIJA 2JFFA 1Z0SA 3C7CB 4X85A 2RHDA 3K6JA 4BVLA 5HZKA 1HL7A 2R1UA 3GZ4A 3KOMA 4FYIA 1JDJA 1ZMOA 1A8PA 2MT9A 1AQ6A 5IK2A 4Q7KA 3VR0A 4W9MC 3A6GA 3B1YA 2BUBA 5CGZA 4P5PA 1YCDA 2ANCA 2ECKA 5SYNA 2ZI5A 1FSZA 3IT3A 1RLUA 2D7JA 2SECE 2ZRLA 2FEMA 3HKBA 3QPUA 4D3SA 5AVWA 2IDJA 3OT1B 3I23A 3LYAA 4DLYA 4MUEA 5JH7A 1E1CA 1HY3A 5SY6A 3RAFC 1ZUIA 3DWIA 1AZTA 2OHOA 2Z6UA 2TMKA 3GO4A 1QHEA 2CVHA 3LUBA 4PFQA 5EJIA 3D7KA 3K1AA 4EW6A 1A97A 4D25A 1Y6RA 3CSUA 2OMKA 4YGYA 4EKDA 3ILXA 2L42A 9GPBA 3HNPA 3LCMA 1THMA 2PRKA 2NUPB 3N74A 1C29B 3EC1A 1EK2A 3HH8A 2LD4A 4MIKA 3BE6A 3IAFA 2UXCB 3PKZA 4MICA 4QYIB 2QZ4A 3LA8A 1Q12A 1NDQA 4GZMA 1IHUA 4C6RA 2SKDA 3OCUA 5EE1A 5ECWA 2V7TA 1I33A 2FUG6 4CR8A 2J9FB 3I34X 1KY2A 1UL1X 3KQQA 3KHTA 3KOOA 5CJJA 3EPLA 1HTWA 4C2TA 4GWKA 4GF5A 4R1NA 4BB5A 4KMSA 3CLVA 3EEBA 2EWVA 2XF8A