4AO7A

Zinc bound structure of a novel cold-adapted esterase from an arctic intertidal metagenomic library
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
243
structure length
223
Chain Sequence
MSWNGKDERKLSVQERGFSLEVDGRTVPGVYWSPAEGSSDRLVLLGHGEYIEQVAKLLVGRGISAMAIDGPGTDVVGLDAFPRMWHEGGGTAAVIADWAAALDFIEAEEGPRPTGWWGLSMGTMMGLPVTASDKRIKVALLGLMGVEGVNGEDLVRLAPQVTCPVRYLLQWDDELVSLQSGLELFGKLGTKQKTLHVNPGKHSAVPTWEMFAGTVDYLDQRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title Functional and Structural Studies of a Novel Cold-Adapted Esterase from an Arctic Intertidal Metagenomic Library.
pubmed doi rcsb
source organism Unidentified
molecule tags Hydrolase
total genus 78
structure length 223
sequence length 243
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ao7A00
5JALA 1E66A 3FLEA 4UFOA 4B0PA 5AKIA 1AURA 4O08A 3A2MA 4W1PA 4Y2VA 3FYUA 1Y7IA 3ZWQA 4OUKX 3V1LA 4E14A 1U8EA 1MPXA 3DNMA 2VJAA 2DQZA 2PBLA 3PUHA 3IVMA 2O2GA 4NMWA 1THTA 3O9MA 1CUUA 1MU0A 4K5QA 3BIWA 3OURA 4FHZA 3AJAA 3KDAA 4Q34A 1UKBA 5EHXA 4H7JA 2DFPA 2ORYA 2DR0A 3LIIA 4MJ3A 3EIOA 4HVTA 1AX9A 5AM3A 4X97A 3CN9A 3DKKA 3U0VA 5AI8A 5AKGA 1W52X 4C6HA 4H35A 2AJCA 2WSLA 2Z8XA 1X70A 3EQ7A 3DL4A 3Q8WA 3FYTA 2B61A 2OCLA 2EDCA 1UKAA 2Y6UA 2HA4A 5HF9A 1TRHA 4H7EA 4M0EA 3PICA 3C43A 2NW6A 1QIDA 5AKKA 5KWIA 2QRUA 5D6OA 2PL5A 2XMZA 3D2AA 4UBKA 3GZJA 2WUFA 3ESBA 5E4JA 1EXWA 2AJDA 4AO7A 1VE6A 2K2QB 4Q3OA 2PU7A 4GEGA 5CT4A 5ISMA 2R11A 3G7NA 4J0HA 5AK6A 1UOOA 5SYMA 4P08A 2XT0A 3DYIA 1UK7A 1WOMA 3WK8A 3FCXA 4QDOA 2G5PA 4BC1A 2WUEA 5HQ3A 3WWOA 1K4YA 1CUVA 1M33A 4FLEA 2IIVA 4L72A 1IVYA 3V1KA 4J0CA 3H2GA 5ALHA 1MNQA 4LXHA 2V97A 2QTBA 1ZI9A 1EX9A 4DMFA 3DEAA 2XMSA 1JJIA 2BAGA 4UPDA 3H2HA 5HK9A 1JJBA 1R88A 3OPMA 4G5XA 2Q0XA 4K2AA 4KE7A 3DJYA 1R50A 1QIIA 1C7IA 5KWJA 1G5FA 5A7FA 1ZD5A 3PFCA 3HABA 3STVA 3O9VA 3W04A 4GDMA 1BS9A 1MO2A 3ZPXA 1JKMA 4OCZA 1ACJA 1UOPA 2LIPA 3EQ9A 1VA5A 3IUJA 5C7YA 3HJUA 4BRSA 1GKKA 2WM2A 3SK0A 1A8SA 3C45A 1WHSA 2JBWA 2WTNA 3VXKA 1N5RA 1A8QA 5EI5A 2BUCA 5H3HA 1YAHA 1AKNA 2HHAA 5ALUA 3C6ZA 3V1MA 1UKCA 1QIFA 1P0PA 3G9XA 3H2IA 1IZ8A 4UFPA 3IIIA 2XQFA 3R3UA 3H1BA 3IBTA 5FKJA 3I2JA 4U2FA 1NX9A 2ZYHA 1CLEA 3A6ZA 4P93A 1EH5A 4X94A 3PF9A 1DT3A 4H0CA 5FLKA 4V2IA 4A23A 3K6KA 3STYA 1R9MA 2PX6A 4L0CA 1U65A 3WZMA 2QZPA 4YASA 3BXPA 3H04A 2PU5A 4LXIA 1CUHA 3KD2A 4BAGA 1VE7A 3DL7A 4HAIA 1B41A 1UZAA 1R9NA 3U1TA 3O0DA 3G02A 4BRZA 1CUJA 2X5XA 4CCYA 1XZFA 2JGEA 5DJ5A 4F0JA 4W1QA 4B9AA 3AIOA 1PV1A 4G4IA 1QIMA 5ALGA 3HI4A 2ZYSA 5JYCA 4FBLA 2WILA 4LYEA 4XJVA 5EIAA 1H2XA 1QTIA 3PFBA 2OAGA 3MGAA 1DWPA 1QLWA 4WY5A 5DLPA 3LS2A 4FLMA 2E3JA 1CIJA 1JMKC 6YASA 2ACKA 2JGFA 4KAJA 2XMGA 1ORVA 1QZ3A 1GPKA 5K3FB 1N8SA 1AZWA 3R3WA 4J0JA 3ZV7A 2DSNA 2Z3WA 4XVCA 1NU8A 2WJ6A 2OCKA 5IVDA 1KU0A 4MYDA 3S2ZA 2Z8ZA 4G4JA 4B0OA 5LZ2A 2QS9A 1CUGA 2QUBA 1QFMA 1YSCA 3DOIA 4QA9A 1XLVA 7YASA 2XLBA 5I8PA 1HKHA 2WG0A 1SCKA 1XRMA 4OPMA 5E2IA 1MN6A 5DNWA 3RLIA 2GBCA 4U2EA 3WK9A 4J0DA 1R4ZA 3IULA 5AI9A 5EIHA 1VOTA 1THGA 4X3CA 1CUXA 3AILA 1Q83A 4PSUA 4BBZA 3R3ZA 3AIMA 4BE9A 1EDDA 5LZ4A 1JFRA 2YYSA 3OTQA 2H7XA 1BN6A 4F60A 3WK6A 3H2JA 1FFAA 3V9AA 5EHZA 1TKRA 1F0PA 3FLAA 2XUPA 4UHFA 5LZ9A 1QIKA 3DD5A 4BVLA 2FJPA 5ALKA 1FJ2A 4X00A 4CFSA 1LPPA 2HFJA 4FFWA 2ES4A 1HLGA 3C6XA 4OD0A 3H19A 3WKDA 4K6KA 3UMJA 1ODCA 4J0KA 2VEOA 2XQIA 3CN7A 3JWEA 4FKBA 3WWPA 4U2BA 2VQ6A 4MWTA 1LPSA 4H7DA 1FFEA 5T4HA 3WK5A 5ALNA 2H9YA 3EQ8A 4I3FA 4JUIA 2VT7A 5CXUA 1ETHA 4ARBA 2WG1A 5AM1A 1XFDA 4OU5A 1CUEA 2EEPA 3G8YA 4PO3X 1G4HA 2UZ0A 2GYVA 5JZSA 5FPQA 3LP5A 4DLNA 1H22A 3F67A 2XMCA 3RK4A 1L7AA 2H7CA 4KYVA 3I28A 3EBLA 1TCCA 1Q0ZA 4QDXA 4AQDA 1GKLA 4C01A 1JI3A 4Y7DA 2B9VA 4B80A 3QZUA 1EHYA 4FDMA 1YASA 5ALWA 1XZDA 3VVMA 5ALOA 3G9UA 3FWHA 3WQHA 4KJXA 2WIJA 4OB6A 5ALRA 3CXUA 5HK8A 1CUDA 1ZI6A 2WHQA 3T52A 3LIPA 5A62A 4J3JA 1P0MA 2HA2A 3M3DA 1JT2A 4MYSA 1UOQA 4TVKA 1ZD4A 4BZWA 1XRNA 5JADA 4RE5A 3C8HA 4DSAA 2AJ8A 2JGLA 3FSGD 5HFAA 2HA6A 4CCWA 5BWCA 1LZLA 4Q05A 4ZV7A 2ZYRA 3BJRA 2RAUA 3W9UA 1IMJA 1ZOIA 3I2HA 1CUBA 1UFOA 3VKFA 1UWCA 4HXGA 1DQZA 3QH4A 3PI6A 2ZJFA 4FLFA 3C5WP 4BATA 2QKYA 3HYSA 5JD5A 1AQLA 3ILSA 5D7BA 3I2IA 2JGIA 2B20A 2XQKA 5ALDA 3IDAA 1BCRA 1MX1A 1MT3A 1ZIXA 4OSEA 1WB5A 5AIBA 1WPXA 1XQXA 3BWXA 3HC7A 3FYUB 5ALLA 1XZEA 3DDUA 5AICA 2BUBA 5FPPA 2JEYA 3R3VA 2RGUA 3I6ZA 3QPAA 1USWA 1X2BA 3ED1A 3JW8A 4QEKA 4CG1A 4NS4A 2RONA 2DQYA 1P0IA 3KXPA 5E4YA 4JYPA 3I2KA 2WFLA 1K63A 3WA6A 2RIPA 3I2FA 1U4NA 2CKMA 1H23A 4BB0A 4Y9SA 3HRHA 1YS2X 2OGTA 1GQSA 5CH5A 1GPNA 2WG2A 2QJRA 5BOVA 1O6GA 1W4LA 1VZ2A 3JYHA 5K3DA 4RE6A 5K3BA 2PM8A 3H17A 4IQ4A 3M81A 2ONCA 5IVHA 2C58A 4DMCA 4UHHA 3NGMA 4IH4A 4MQMA 2ZSHA 2O2HA 1ZICA 1YCDA 1QGED 5AM4A 1BE0A 3I1YA 4DM7A 4FOLA 5AI5A 5JAOA 1BU8A 5AK5A 5FRDA 3I6MA 3KWJA 4N8DA 5JZBA 1UK6A 5JATA 4Q3LA 4AO6A 1ZI8A 1X2EA 3H18A 4H7HA 3HLKA 1BN7A 2GZRA 4MQLA 4INZA 3PUIA 4BYMA 2YXPX 1ODTC 3NWOA 1WB6A 2QR5A 2QT9A 3TGLA 3GFFA 4UUQA 4BE4A 2C4HA 1XZAA 4J0GA 5ALTA 1HBJA 1EB9A 5CH3A 5ALSA 5T4FA 2HM7A 1VJ5A 5LIPA 4QLOA 1G66A 1EB8A 2XUDA 3WWEA 1YR2A 5K5EA 4PQEA 3D0KA 4EY8A 2C5GA 4X6YA 1JU3A 4PW0A 2D5LA 3HZOA 5JIBA 2V96A 4AZ0A 3PDCA 4U2DA 3AINA 1Q84A 3BF7A 4GBGA 3WJ2A 1CFJA 2XUHA 4DTCA 1L7QA 4PF1A 1H2WA 3BJMA 5E4TA 1CUFA 2Z5GA 3A2NA 3WWCA 4N8EA 4GI1A 3VJLA 1SFRA 3WK4A 2BJHA 5AP9A 2XUKA 4H7IA 4FNGA 5EHNA 1CUAA 1HDEA 3P2MA 2HDWA 4A5SA 2XUJA 1N1MA 1GXSA 5JARA 5EGNA 5T4EA 4LKOA 2QOEA 4QDZA 1HPLA 5HCUA 1S8OA 5CRIA 1E8NA 1LPMA 2O2IA 2RHWA 2VAXA 4N8SA 5AKEA 2PUJA 2GYUA 5AKLA 5K3CA 3PF8A 1CQWA 3G0IA 2WUGA 5ALMA 5A2GA 5AOAA 3WWDA 4ZI5A 2CZQA 1FFCA 3WI7A 3F9CA 5EFZA 3WA7A 2HA7A 1CEXA 4RNCA 2HL6A 4UBNA 5KREA 3D5EA 1HL7A 2JF0A 3R41A 3WZLA 1EK2A 4Y2YA 5CTAA 5I9IA 4ITVA 3AUKA 1EINA 4AB1A 2QJWA 3CCCA 4OYYA 4Y2PA 5FDFA 5FP0A 3IA2A 4G8DA 1OXMA 5D3ZA 4QDTA 5I7UA 1R1DA 3E0XA 2C5FA 1XROA 4EY5A 1LBSA 5AKJA 3T4UA 4PNZA 2WKWA 1T2NA 4UBIA 4WCVA 3D4LA 1MAHA 5DWDA 1F6WA 1CQZA 2HIHA 4N5HX 1RYYA 1IUPA 4C89A 2ZJ6A 1LNSA 1GZ7A 4P9NA 1TCBA 4P92A 5A7HA 1I6WA 4KE6A 2VAVA 1EDEA 1VA4A 2H1IA 3WIBA 3I1IA 1Q0RA 3BIXA 3VJKA 4H77A 3FVRA 4JEIA 2HA0A 5HF6A 2JGKA 3SX4A 5HKBA 5AHXA 4DMHA 4UHBA 4X92A 4BAUA 2I03A 2VJDA 1ZGCA 2WIKA 4X93A 3IUMA 1FSSA 3M83A 4DNOA 2QVBA 3F97A 2QM0A 2B4KA 5AK4A 3C8DA 4N5IX 3C70A 4Q3KA 1WB4A 5JANA 3H1AA 4BP8A 2WIDA 2VA9A 1XZBA 1CR6A 5AH0A 5CT5A 4ZV9A 5SYNA 1JU4A 5T4BA 4E11A 5DYWA 3OOSA 4OU4A 3DLTA 1GT6A 2OGZA 3DCNA 1CV2A 1K6EA 5CT6A 1LBTA 4CI9A 3ESDA 3DYVA 5JASA 3VJMA 5ALJA 4UBMA 1XQWA 1VKHA 3DOHA 2Z3ZA 1QTRA 3ZLUA 1JMYA 3UUEA 5JD4A 3E1GA 4H7KA 3NUZA 2DHCA 3AIKA 1VXRA 5AM0A 1QO9A 4BP9A 4EUSA 3IUQA 1CRLA 4HZGA 4H18A 2GBGA 3G9TA 4Y2XA 4A16A 3BF8A 4B82A 2XUIA 2HFKA 4W9RA 2ZVDA 2CEKA 2I78A 3MVEA 4DNQA 1TAHA 3ZI7A 1CPYA 3DS8A 5K3FA 1UT6A 4AXBA 1P0QA 4DMKA 5AIAA 1VXOA 5AM5A 2OCGA 5HF8A 1QFSA 2WHPB 2GZSA 3QMVA 1LPAB 5AKYA 1E5TA 4WJLA 1QOZA 1A88A 4DSZA 1GPLA 1DWOA 2OQIA 5CH8A 3TEJA 1E3QA 3W05A 2JIDA 4F21A 1ISPA 1J1IA 1KEZA 2JGMA 5AKZA 4EA6A 2WTMA 1OILA 3L1IA 1F8UA 3GA7A 3FSGA 4UBJA 3EF3A 3ESAA 3O4HA 1ORWA 4EY6A 4X71A 4WDQA 2WUDA 4M0MA 2JGJA 3S8YA 4B81A 3G0CA 2DHEA 1IZ7A 4BCBA 4E15A 4QZVA 3AZQA 4XX1A 3LCRA 4X90A 5ALQA 2OAEA 4UHEA 1J07A 4K6HA 3FNBA 4PV7A 1LPNA 4KE8A 2JEZA 5AOCA 2PKYX 3G0GA 2AXEA 1W76A 3STTA 2I3DA 4KRXA 3WMRA 1WM1A 4KRYA 1PFQA 3M82A 1E8DA 2RHTA 3O4GA 3SC2A 2PSDA 3N0TA 3QVMA 4OYLA 5JAUA 4DYHA 4YPVA 4B7ZA 2D0DA 5IH7A 2G63A 3GROA 4ZXFA 5FXMA 1DINA 2BGRA 4X85A 2RI6A 1JJFA 5DYTA 3HSSA 5ALYA 5EIEA 5LKAA 2WFLB 4BTLA 5AKXA 5CBKA 2PSHA 1CUSA 3WIOA 3YASA 1A8UA 4KEAA 4G8CA 4C4YA 1EK1A 4ZREA 1H2YA 1B6GA 1QIEA 1SC9A 5EHQA 3R0VA 4CIAA 3VISA 2PPLA 1EVEA 4Q1VA 2I3ZA 4TGLA 4NZZA 5LYYA 5A71A 4G8BA 2CMFA 3BDVA 4WFJA 1U2EA 3HACA 1QIHA 2X8BA 4OB8A 2VTVA 1Y7HA 4DNPA 1FFBA 3R3YA 4BCDA 1YB7A 4C4ZA 4QE3A 3QM1A 3TRDA 4EBBA 2IX9A 5DTJA 1QIJA 4EHBA 1A7UA 4AZ3A 3H2KA 3OC0A 5CURA 4W63A 2AJLI 4B85A 4G4GA 3WK7A 2XUAA 4K6GA 1RP1A 4WFIA 1YA4A 2HU5A 3OG9A 3GUUA 3STWA 4Z49A 2OLEA 4LXGA 3AZPA 3RARA 1WCYA 3ICWA 4KE9A 3WL8A 2OPHA 5AI4A 4CIBA 4MWSA 2J4CA 3G9ZA 4M0FA 1K8QA 3QPDA 4G9EA 4GXNA 3H0CA 4IHAA 3QMMA 1WHTA 1CVLA 1XRRA 2XUFA 1ODSA 4UBLA 2H7YA 3D7RA 5ALPA 4UFNA 4UHDA 5DNVA 2XQJA 1UK9A 2QXTA 3B3QA 5JD6A 1MTZA 5HQ3B 5CT9A 2YASA 2J3QA 3FAKA 3L1JA 4YK7A 3NOXA 3FLBA 2J3DA 4C4XA 2ZSIA 3A70A 4Y2JA 5ALZA 1MNAA 3I6YA 1LLFA 5FOQA 4ZRDA 1T4MA 1CUWA 2CJPA 5LKRA 2W6CX 2ECFA 4CG2A 4ZGBA 3KOOA 4IH1A 3FYUC 5YASA 4FFVA 3WYDA 2PVSA 2WU3A 5BV7A 4Y2SA 3D3NA 1XLUA 5F4ZA 1HQDA 3E3AA 4C87A 1XZMA 1BROA 3D2CA 1CUCA 3F96A 1YA8A 1ZD3A 4HXEB 4IO0A 1QONA 5ALVA 2XMDA 1MAAA 2OCIA 1LPOA 2EDAA 3BE8A 5AO9A 5K3EA 2CBGA 1F0NA 2PSJA 2WHRA 1IUNA 2GBFA 4IH9A 1EVQA 1K5PA 1H2ZA 4GWLA 3VDXA 2QXUA 4XWGA 1O6FA 5IVKA 3WKCA 5AI0A 5HKAA 3C87A 1DX4A 2HRQA 3A2LA 2QMQA 3PE6A 5CT8A 3ANSA 1KU6A 2DCMA 4LIPD 1XZIA 4JYMA 5ESRA 1AUOA 1SOMA 1CUIA 2J4FA 3CCBA 1AMNA 5HZGA 1W1IA 4J0IA 1FFDA 4B84A 4X7BA 2XDWA 4X6UA 4Q82A 4CCYB 1CUYA 1YAJA 2VT6A 2G4LA 5CXXA 4C88A 1Y37A 2HU8A 4BDSA 5LP1A 4AMZA 2BFNA 1UK8A 4KR0A 1E89A 5AKHA 4TPKA 2ROQA 4GW3A 2ZJ7A 4HTAA 1QJ4A 4DGQA 4EZIA 4AN0A 1QO7A 3B12A 5DNUA 1XRPA 1YS1X 5FUMA 3RKSA 3ICVA 4JNCA 4LYDA 4UHCA 2XB6A 5A6VA 1IUOA 4HS9A 1VZ3A 2HRRA 1GGVA 4L9AA 3ANTA 1XZCA 4DIUA 4PSCA 2R8BA 3D2BA 5IVIA 3SWWA 3AZOA 1SCQA 5C8XA 4ROTA 4D9JA 3C5VA 4BC0A 1LZKA 1W6RA 5BWBA 5AJHA 3L1HA 1DQYA 5C8ZA 1ZIYA 3IUNA 3V48A 3DQZA 2AJBA 1DU4A 4XIIA 1N5MA 1EI9A 3WJ1A 3X3HA 4BAZA 2WLSA 4FMPA 1BCSA 2HA5A 1ZJ5A 3R40A 3G0BA 3HXKA 3N2ZB 1J2EA 5LZ8A 3WL5A 4WDRA 1XKLA 4NVRA 1Z68A 1ZD2P 3QITA 5CMLA 1DWQA 1XZKA 2IITA 4X95A 4U2CA 3W2TA 2VJBA 1PJAA 3WKBA 4S0XA 4UBOA 3O4JA 4PSDA 1VLQA 1DX6A 4QLAA 4QDUA 3O4IA 1W75A 4LHEA 3C6YA 2ZYIA 1CUZA 1EDBA 3DKRA 1XKTA 3STXA 4AMYA 3MUOA 1MX5A 3WL6A 1C7JA 3HEAA 5A7GA 3BL8A 3R3XA 4GECA 3E4DA 2VF2A 1NU6A 4WY8A 3K9BA 5C8VA 1WPRA 4MXDA 1ZGBA 1TQHA 5DYYA 4B83A 1OCEA 2WFMA 5JAHA 1XQYA 4BVKA 2WIGA 1UXOA 4EY4A 1ACLA 5ALIA 4H7FA 4RGYA 4KACA 1XZJA 3IURA 4QWMA 1J06A 5ALEA 3TJMA 3FVTA 5J3JA 4B6GA 2CUTA 2XE4A 4BZZA 4JH0A 4J03A 1BEZA 3KSRA 2XUOA 4ARAA 4I19A 4FTWA 5C81A 4G1FA 2PSFA 2FUKA 1AGYA 1DT5A 1EA5A 3ESCA 3KWFA 3F98A 4GLBA 4W1SA 2XI4A 4ETWA 2P8SA 3RM3A 5AI6A 1G42A 4J7AA 4W1RA 1E8MA 4G9GA 1XRLA 5JZ9A 1C4XA 1SCIA 2FJ0A 5IKXA 1R3DA 2C0PA 2Y6VA 4L3WA 5AM2A 4HRXA 4EY7A 3OM8A 3W06A 1AC5A 3FCYA 2VATA 5JAPA 4AX4A 1GQRA 4RPCA 4BCCA 4BVJA 3QMWA 3WLAA 2W22A 3LLCA 2GBIA 3GBSA 3ZLTA 2XLCA 1QIGA 1TIBA 5D3KA 2HU7A 4OB7A 3UUFA 5LZ7A 4FNMA 3QBJA 3AFIA 2YH2A 4KAAA 2HADA 3VVLA 5HF5A 1XRQA 2WQZA 1L7RA 2XQGA 2WHPA 5K3AA 5DTIA 4KAFA 1RWQA 2OQVA 3F8SA 2Y2UA 3W9BA 5ALFA 2OG1A 4E46A 4AO8A 1TK3A 4QWWA 5KBYA 3V1NA 2Y1KA 2X76A 2WJ4A 2OGSA 3I2GA 2O7RA 4YX9A 4MEAA 5AOBA 2WFZA 1LGYA 2XUQA 3STUA 1LPBB 2XMRA 4FWBA 1XZLA 2ACEA 1ZJ4A 1QE3A 3BDIA 3D59A 1BRTA 1YB6A 5AK3A 2WIFA 3O95A 4X6XA 3Q0TA 4QNNA 4Y2QA 4FBMA 2BKLA 2QUAA 3IB3A 2C7BA 4HRYA 2BCEA 2O7VA 4DNFA 4GHWA 2C0QA 4CG3A 2BUAA 5HFNA 3G0DA 1XZGA 2PUHA 2XMQA 4Y2UA 2G5TA 2WJ3A 3WYNA 4B9EA 3B5EA 4Y2RA 2Y2VA 4HXFB 1XLWA 5LZ5A 4F5ZA 3WKAA 2HA3A 3FBWA 3ZLVA 2CB9A 3C6BA 4Y2TA 2GYWA 3QPCA 4ZWNA 2VSQA 4U2GA 4AN1A 3FOBA 5ALXA 2PSEA 2V9ZA 1BEEA 1DTEA 3K2IA 4BDTA 3WL7A 5CW2A 2XUGA 2XMBA 4BTVA 3MUNA 1XZHA 3GELA 2FX5A 1XQVA 4EB0A 2DHDA 4I4CA 3WKEA 1MJ5A 4X91A 4MEBA 2VJCA 2WU4A 4WFKA 2OXEA 1TCAA 1D07A 2BGNA 1MX9A 3QYJA 5LLSA 2V98A 5FV4A
chains in the Genus database with same CATH superfamily
3VO2A 1N1EA 3MUEA 4QOGA 1P73A 4CQJA 2HD4A 2ZIUB 3JXEA 4KDRA 3UMCA 5ERXA 4OMFG 1PW5A 3NV9A 4TXJA 2PZLA 2GO7A 3U1BA 3M2TA 3G6KA 4KQXA 3PR1A 3FIJA 4YIKA 4J49A 3KKQA 2WYHA 3LX8A 1FMLA 2ZB2A 3O8OA 1QOPB 1ORIA 4B0PA 3LHKA 1AURA 2D4HA 1JLHA 3DBIA 3DMPA 3H1PA 4O08A 2REOA 3IPLA 4JI6B 3CNQS 4QGFA 3NH9A 3JASA 3KOUA 3NXSA 4E12A 5IF9A 2FG5A 3AEYA 5FO0A 4L8YA 4M55A 3ZWQA 4E14A 4F38A 1MPXA 2V74B 5F12A 4CEIA 1AKRA 2DQZA 2LV8A 2VPYA 3CH7A 5FF9A 3GEDA 1A27A 3MGCA 4EG6A 2PVPA 3K09A 3DMYA 4HQ0A 4JI7B 2C5LA 3NNDA 4CCAA 4PYNA 1XNJA 4TRRA 4DSNA 2HLHA 4MPTA 3O9MA 2RHLA 4INOA 4R8MA 2HHJA 3UH1A 1DKMA 1MU0A 2NXEA 5B58T 2DFDA 5DI9A 2GEUA 1AY0A 4ZMBA 3GGPA 4FGUA 2F43B 3T3IA 1IAVA 3ZTWA 1NW8A 4FHZA 1I7NA 1NI4A 2FEWB 4KQEA 4GMHA 4N01A 5DM70 1E61A 2DFPA 5FTWA 4Z9XA 4YECA 3LIIA 3O94A 4B73A 1SIWA 1KFCB 2Q3BA 1SIBE 3AFOA 1NVBA 3VSDA 5TPWA 5BMVF 2PQ6A 4JYCA 3SBEA 3HYLA 5AM3A 1YRYE 1L7BA 3E0QA 4P4SA 2BKVA 1H8ED 3ZCQA 1QP8A 3B9PA 5FOTA 5CP8A 2OSBA 4MGZR 3VV3A 1WL8A 3CN9A 2HLPA 2Q3MA 3PDIB 2YTZA 4A8JC 4L5CA 3BAFA 4L1KA 3PIIA 5F21A 1W52X 4DY6A 2FFAA 3HUDA 4LHVA 3K4HA 1H65A 5IBQA 3UCEA 2CFIA 2XXAB 2ONZA 3EQ7A 1S3IA 4GF5A 4AZTA 3PX7A 4E2YA 4FMDB 2X3YA 4BB5A 5FWDA 3EGIA 2EDCA 4ZPXA 4H7EA 3AP1A 3AOEA 3SVLA 2VCYA 1FDUA 4DCGA 2V0GA 3A9RA 4YJKA 4KR7A 3KDSE 1BS2A 1UT5A 1FLAA 2NW6A 1KEKA 2R7MA 3SJAA 3TZ6A 3AUYA 3JTEA 4GKBA 1SVMA 4LJAA 3ROTA 3SZ3A 4D9MA 4RVFA 5LWQA 3OQIB 1ZESA 3EFBA 1Q92A 3EVZA 3NQ41 2PL5A 2XMZA 3MYRA 3LUKA 4C4AA 2ZAIA 2GSWA 1QQTA 2X4GA 1T9GS 3EUAA 4UNNA 3L8ZA 3TSYA 3X2FA 4MQEB 1KYIA 2GPTA 1EXWA 3D8SA 4AO7A 1IOVA 1JHUA 3UOWA 2NQ2C 2X4DA 5T8KC 1VE6A 4KQ2A 2IZ1A 2VK2A 1Z34A 4Q3OA 4G01B 4B6PA 3COJA 3GRUA 2GEJA 4DDUA 3OZUA 3KOXA 2I8AA 3AEUB 5ISMA 1GAXA 1YXMA 4MB6A 2HKIA 1ZQ9A 4CODB 4IQGA 3DYIA 1UK7A 1WOMA 1F0YA 3KD3A 1SXJD 1R0CA 1ADJA 1NI3A 2PRZA 3IA7A 1C1DB 2HI0A 4FWIB 3B5JA 3ZEIA 4UOZA 1X77A 4J9VA 5CDFE 5M04A 5HQ3A 1JVSA 3WWOA 3G23A 4MKRA 2IZZA 4M1TA 1NXOA 1E3WA 3V1KA 1FE8A 4J0CA 4ZGWA 1F14A 3C4JA 1M2HA 1NBME 1NVEA 1M7GA 1N6HA 2G9ZA 2VHEA 3SHQA 1RBYA 1ZO8A 5KS2A 3NHRA 3PC3A 4YTEA 4E5PA 5GIPE 5IHXA 1FDSA 4KMMA 2AOWA 2FKAA 4HDRA 2EZUA 4JQOA 4KWIA 1KZ7B 4H2DA 3KTAB 1J0BA 3EY9A 4ND6A 2OHGA 3B9BA 4MIYA 3R75A 4QQ8A 1RWXA 3UXHA 2UZ4A 4B3TB 1KPIA 2A14A 4M8NE 3RNOA 5MFZA 3F5FA 4UPDA 2XNDA 4ZI2A 2CMKA 1V37A 3KB8A 5FI0B 4EMBA 4JV5B 1SBIA 3FFXA 1XDZA 5M2QA 3AHIA 3OPMA 2Q0XA 1D6NA 1A04A 1CY4A 5LA6B 4W82A 1QIIA 3GAZA 1OI3A 1U8ZA 1JW9B 4FILA 3ZKAA 1DEAA 2FJUA 3RS2A 2HR1A 1X3LA 3GUYA 3JARA 4RCVA 1EBFA 3PFCA 2B6HA 1GGMA 1DG1G 3HABA 2HJWA 3AGPA 3DE2X 3KOZA 3O9VA 4M46A 2CHVA 2CLKB 3EC1A 4KNWA 4D8WA 4DA7A 4WCDA 2NAFA 4ENPA 3L7AA 1CHDA 5C5DA 1R0SA 5C8YA 1B73A 4PX5A 5AW1A 2CUZA 3AC0A 2IOHA 1BS9A 2H4FA 3EGOA 3EPRA 3KHSA 3LO8A 4MLDA 1J00A 1JKMA 1UOPA 1EQAA 1JTVA 2LIPA 3GOQA 4U7JA 2E4ZA 4MGHA 4WNCA 1CFZA 5EJIA 1V11A 4OAPA 2DAPA 3L6DA 1E2MA 3UEOA 3GLFA 2P7HA 3R7LA 5L7TA 2JH9A 4LVCA 1YA6A 5FWYB 3MS4A 1EUQA 3ZHCA 4E5YA 1QG0A 3RKRA 1G1MA 1FSGA 4HNHA 2QYHA 4TMYA 4HDNB 5K4AA 1FP2A 4U7HA 3B82A 3E9YA 4WRRA 2I4TA 4O4LF 2JBWA 1YBVA 5LQJA 5L51A 5EI5A 3DKIA 3QF4A 4C0JA 5TLSA 2YWCA 4CEJA 3O26A 4P4TA 4I3HA 3THXA 3B36A 2YHIA 2X6QA 3OZDA 4RMJA 3S28A 4Q9IA 3X44A 4IWYA 4GKVA 1Y1TA 3AKEA 1QOQB 3PK0A 4MAMA 4LJ4A 1DCFA 5G0TA 5GOZA 4CM9A 4EW2A 4ER7A 4NMMA 3KAJA 5LYJF 4MUYA 1AGPA 1L0BA 1IM2A 1YI8A 2LBPA 4YAIA 5HUQA 4MIEA 2FQYA 4JQCA 3W90A 4CNQA 4D56A 3L0BA 1ONPA 5TF4A 5JBQA 2N9UA 3I53A 1PR0A 5DGDA 4Z4GA 4MYHA 1V4BA 1ZP6A 1RI4A 2XIJA 1PJ8A 1FEZA 1NPYA 1XN4A 4DQ0A 1W73A 3R3UA 3A6EA 1RSZA 2YJ3A 3KFXA 1NBOA 4HDKB 5I3CA 2UXDB 1W0KA 2ISSD 3H1BA 3IBTA 3QX3A 3IP5A 2XODA 1UDBA 4FONA 2Y93A 1BYUA 1U2GC 1CLEA 4GRAA 3K0KA 4F97A 5JSZB 2IELA 3N75A 4HDOB 1ADFA 3OEEA 3X2SA 1G4UR 1Y82A 1VBNA 4A23A 3QOFA 3K6KA 4BNJA 4DA4A 3V5NA 4EGFA 4NU0A 1CS0A 2DKFA 1ZXLA 4L0CA 3WLEA 4UXHA 3WZMA 3LKZA 5KYYB 1VDMA 4NDZA 1DC8A 4ZV4A 3OC6A 2JLBA 5AVOA 2DB3A 3ZHTA 1KARA 4BBPA 5K8TA 2YYYA 2H92A 4C6TA 3RU9A 1BDBA 2GMWA 2QGZA 3MJEA 1E9VA 1X3SA 1L5ZA 1PGJA 1X92A 3MCVA 3MLAA 1VPTA 3C3CA 3VYVA 3MMNA 2O8CB 2WNIA 4KGVA 3R9KA 1MXFA 4K86A 2J5KA 3RNLA 4PYJA 5CGQB 2BF7A 1OVGA 3OD5A 4QDKA 3CLTC 4JJ7A 4EPTA 5JTUA 3KLBA 2J5RA 1R5NA 2ODWA 1ZL2A 3EH2A 3LCCA 3SZLA 1GTMA 1SXHA 4O2AA 4UDNA 2X4LA 1GAEO 2UUCB 4YPFA 4L16A 5GVSA 2IYTA 4EGSA 3H9QA 3DV0A 1OPRA 4B9AA 3GG2A 4QODA 1J9GA 2HGSA 4PZ9A 4M7WA 4BQSA 5LQKA 4P1ZA 2BISA 2PK3A 4R16A 1G21E 4IVPA 5HVNA 3I5AA 2FPSA 2FSHA 4BLWA 1IATA 2JLXA 3LF2A 5JS8A 1HG0A 2FHSA 1C3OB 3U81A 5DWQA 3AB7A 5JYCA 1PV2A 1RZRA 3BUSA 1A82A 3RCBA 2NUBA 2QSYA 4GL4A 4RMIA 2JJMA 5C0OE 2XAAA 4U9UA 2IZ6A 4C22A 4LYEA 5EIAA 1H2XA 1ILEA 1CY0A 5C53B 1QTIA 4BMZA 1PKEA 3G68A 2EJCA 4BP3A 3FJOA 2QL6A 4A8HA 4BNWA 1HWYA 4FFLA 5GVRA 1XEAA 2VRNA 2IPAB 3DPUA 1LF5A 4FLMA 2E3JA 1SO8A 3EUEA 3GJYA 1AKQA 1JMKC 2ZI6A 3GNSA 2ACKA 4GQBA 2JGFA 1CRZA 3G9QA 1G98A 2JI6A 3ID6C 1A4UA 4DJAA 2XMGA 2B99A 2IOFK 3NORA 3WMXA 5K8LA 1MA3A 4TSFD 3DCIA 1ECJA 1QZ3A 4XUDA 3O8NA 4RFSB 1IXKA 3PRJA 3FZQA 4ZVMA 1GL9B 3GLGA 1EWTA 1U99A 3ZVRA 3IVRA 3LT2A 5BN5B 1TAQA 2DPXA 1YWGO 3ECSA 4PPNA 3ZV7A 2DSNA 1G9XA 2I1QA 3CPHA 1GPJA 1KSHA 2GAAA 3NOOA 2A9OA 2OCKA 4H4EA 4JL6A 5KVAA 1FQOA 1EESA 3GFTA 1KJIA 2WT9A 1SWWA 3WQSB 4QICA 1M1YB 5IVDA 2G82A 1RYFA 3OKAA 5D5QA 1KU0A 2E5WA 1ZVKA 2P4HX 3EQ2A 4NFHA 4LUCA 4EGQA 4ER6A 5J5AA 1G64A 4ZQEA 4HG2A 4MV4A 2BJWA 2AK2A 3X1MA 3U9LA 1T2UA 3JRNA 2Q5HA 2ZSAA 4PO9A 5EQTA 4B0OA 1XCOA 2Q07A 1XU9A 1N3LA 2XB4A 1RYHA 3GGGA 4MV8A 4RPLA 3RGGA 4DLZA 4PTZA 4X8HA 1YZUA 1QFMA 2X22A 4HQFA 3ITKA 2RGAA 3U5ZB 5KYXA 3ZUGA 2J85A 2O2XA 4F5DA 2WG0A 2PL9A 4YR7A 2BSAA 4XDGA 5DLQC 3VO8A 1XMOB 2FWAA 1YZQA 2QTFA 3O31A 3KR0A 2Z83A 3UT0A 1Z08A 2Q41A 4Q12A 4UMDA 1Z2AA 1EG7A 3CX6A 3H42B 3DXXA 2W6NA 3TO5A 1O1YA 2XDYA 5JECA 5DNWA 4DV4B 2O8BA 4QPCA 3PXUA 1NA5A 1GWNA 1C41A 5CU7A 3R7FA 1QCYA 1XVAA 4J1TA 4PLGA 1R4ZA 5A05A 3IULA 4W5WA 1KY5A 4XWAA 3DVAB 1VOTA 2OBNA 1GSOA 5C4MA 3HB7A 2QQGA 3B1WA 1KR2A 3WSVA 4LJ7A 3OIVA 4XWKA 1IK6A 4EB6B 4AF6A 2FZEA 3H1GA 3ZV6A 3ZHUA 4D79A 2BKEA 2XD9A 5H5JA 2YYSA 5JAQA 5IJAA 2FR0A 3QKTA 4AG5A 1JKXA 4HAWA 3ZX4A 3W1EA 1VFNA 3QBDA 4DKJA 3NP7A 3AKCA 3KJXA 3PWTA 3EVAA 1WZIA 2XEXA 2ZXEA 4G5OA 3K71B 2JAUA 2J59A 2G4CA 3GA0A 2PX8A 4C30A 1Z2NX 5A06A 3DLBA 1X9HA 1RWMA 1W4BA 3L2OB 4DBZA 2RGRA 2FFJA 5AUNB 4JT2A 1G20A 4S24A 3WDKA 1AQJA 4X65B 1RADA 1F0PA 4MGKR 1G9SA 4NYJR 1T1GA 4JBNA 4HT3B 2ZYGA 5LZ9A 2YW9A 1Z0KA 4BVLA 3D4PA 4WQMA 2EVWX 1BQ3A 4B4UA 5IZCA 4BYGA 2C96A 5HMMA 3FRJA 1Z56C 4TWZA 4L5BA 3P9RA 1SUPA 3K0AA 1E6WA 4XQCA 3QW4B 4FFWA 1XMPA 1MO4A 4X20B 3KPYA 4ESOA 1IBLB 4FJ0A 2QT1A 2WF6A 3I42A 4EHDA 4Q3AA 1ODCA 1PR1A 5F3WB 1GPDG 2ZANA 4DQXA 3B8EA 4OTZA 3G85A 3HU5A 3JTMA 3W79A 2NT4A 3FYSA 5MFPA 1U0EA 3IKJA 3T8YA 1ISSA 1N3BA 2D00A 1XT6A 4H3SA 4D4MA 4H7DA 1QGUA 4X63A 5BMVB 1F17A 3WK5A 4X54A 3Q85A 3EAFA 5A6SA 3UBTA 4QM7A 1YUNA 5DTEA 4CVNA 4DZRA 5JD3A 2PGDA 1Y4DE 1JSRA 1GGFA 4UM5A 4F96A 2K5UA 2YWBA 1T10A 5B57C 3DE5X 5I45A 3UFBA 4TYYA 3L4EA 1M6EX 1Q1NA 3BMXA 1ETHA 1XZ8A 2ZIZA 4DLTA 5I4BA 2WK1A 2J48A 2PT5A 2WZDA 3ESYA 3M6VA 4LJLA 2I4RA 1MV8A 4ARBA 2RHCA 2VDRB 3LG2A 4RHYA 3KVYA 3ZI4A 1Z45A 4L02A 4OU5A 1P1CA 1TK2A 2WRZA 4H7PA 3PDUA 1C0KA 1EHIA 4YYZA 4QM6A 4JLSA 1OZFA 3G5LA 1IC6A 2V5VA 2MDTA 3D54D 5IPFA 2Z95A 4CMBA 2JI4A 5T3UA 1BDJA 1Z4MA 3EISA 3F67A 3IP6A 4HRAA 2QAGA 3BXHA 2NO4A 4TL9A 3UMFA 2O50A 5CM9C 5KJCA 1BZYA 2Z30A 5IK2A 4E3ZA 1Z18A 3W1VA 3BQ9A 4AMGA 1V1RB 2EKQA 2H7CA 3EIXA 3LAWA 4KYVA 2YY7A 3WFIA 1B0PA 2VDKB 3OZVA 4TMXA 5H4HA 3MHTA 5A9RA 3F5MA 5HUJA 4REMA 2QVZX 2C4TA 4V02A 1ZQ1A 1OJ7A 2CEAA 1HZJA 1Y3DE 2QGFA 3AO0B 4QDXA 4TV8A 4DT1A 5BQXA 4YJ2A 1WCWA 2V7XA 3K6JA 5F35A 3UV3A 4EJSB 2IC5A 2P0EA 4LX8A 4CL3A 1SVLA 3NIFB 4RVHA 4TLLB 2ORWA 3DLHA 3SBDA 4KYUA 2A5YB 1SG0A 1IPFA 1T4BA 1UC9A 4B80A 3TZHA 3NT5A 1GV1A 3IAEA 5J9FA 1R10A 1FXUA 1EHYA 4EHFA 2ZJ2A 3D5TA 3IEUA 1F12A 4PSAA 4HX5A 3QBEA 3CYFA 4JJAA 2VHWA 1NJ8A 3QOYA 1UBEA 2IK8A 3RANA 2WKRA 4L4XA 5ALWA 5SZIA 4DLKA 5CB0A 4RY2A 5G1OA 2CC2A 2I3BA 1S6YA 2JIZD 5IUKC 3RTEA 3Q7IA 2ZG6A 1OHHA 1Y6RA 3ZKWA 4KJXA 3E1KA 2WIJA 4OB6A 1Z12A 2ZUFA 5E6SA 3S8EA 1U1EA 4M83A 1ZI6A 2WHQA 4RVUA 2F55A 3EW9A 3AWDA 2ICAA 3CSUA 1GZSA 2JIPA 4TKZA 2JLYA 1UZUA 1QFJA 5SZHB 3VPAA 3N2KB 3HBNA 4TLAA 2HA2A 4AMBA 4DGSA 5B1SA 3K6SB 1C0EA 1KAEA 3MOIA 2WWRA 2GCOB 1L9KA 2R6ZA 4LSGA 1U8XX 4B6RA 3B38A 3HGTA 4IVRA 2HIAA 5ED4A 1KIMA 3OOYA 1KI2A 4DSAA 3C8HA 4OXIA 4FFBA 2NU8A 2YUTA 1DC4A 4TLDA 3FSGD 2NO1A 2G1KA 3Q72A 4J0QA 1STOA 4KTVE 4W5RA 2F00A 1LZLA 4TL8A 3L6EA 1G7TA 4Q05A 3URKA 2L19A 1KEUA 1KH3A 4QBKA 1AK1A 1HG1A 1JQ5A 1TKBA 2WABA 2ZYRA 3M34A 4IXNA 4QSHA 3TJRA 4BX9A 4EECA 2YVKA 2O6HA 4PR3A 5REQB 1A8IA 2VTBA 1P7ZA 2DLDA 3HVUA 2QLTA 2HHLA 3UW3A 2FPPA 5C5CA 1YQGA 2CV1A 3HP1A 2YRFA 3GA5A 2Q5OA 4PC3A 1C8VB 2OBMA 3RE1A 1C30A 1XTQA 2IL1A 1VE1A 2JIMA 1IL0A 4GP6A 4HXGA 4MWBA 1ORTA 3GW8A 3F3KA 3JAWA 1DQZA 1XFAA 1NNEA 1Z06A 3I4FA 3GIWA 3H13A 4P54A 4B4OA 2ZS9A 1D4AA 3CA8A 4BATA 1ATZA 1SIUA 2YOGA 3E9ZA 3Q98A 4U6NA 1AQLA 2GGSA 1BD4A 3I2IA 4B2IA 1EFVA 2KWIA 5ICEA 2FQ1A 2HMWA 4BNZA 3I5XA 5ALDA 4AQYB 4URWR 3I04M 3VH4A 1QF6A 2ADOA 4BB9A 1TUIA 1MX1A 1T8UA 1BQ4A 3K1ZA 4HZUA 4OSEA 2ZSEA 3BORA 3PZBA 1ZCBA 5A5FA 4LJ6A 2OCPA 1QDUA 4AJKA 2FYTA 4F72A 3TW6A 4EL5A 5AIBA 3BC1A 3D7KA 3I83A 5CNIA 5IH3A 3WGGA 4M9UA 1U2TA 4XIFA 4L85A 4BO7A 4PFSA 3P2JA 1CZNA 1IDOA 2C2HA 1RQRA 1WPXA 1MAWA 3FYUB 1U2SA 3HC7A 3CU5A 3NDPA 1KAQA 4OHYA 3UJDA 1XZEA 3E1SA 4LRXA 2JANA 4QYXA 1OFUX 4JSTA 5FPPA 4FEYA 3EF1A 4Y6SA 3VR4A 2RHRA 1NC1A 3A4IA 3MD0A 1MTOA 3R3VA 4AM8A 3EBPA 5BV0A 2X6TA 5FOWA 1SBHA 1VM6A 1DO8A 2HXGA 3QPAA 4NKRA 1X2BA 4ABYA 1CR0A 2P4SA 4KKXB 1YFZA 4YUAA 3P9NA 4TMZA 5DRTA 3FNFA 5CBPB 4YI5A 4JJZA 2P2LA 1P80A 2HCJB 2RSLA 4Z3KA 5CA0A 2DQYA 3RUDA 1N0VC 2CWDA 3U62A 3HB5X 3AEZA 4NSNA 3WP1B 3PBKA 3MJSA 5E4YA 4JYPA 1MENA 2WFLA 3IOBA 1KMHB 4PZLA 5B5SA 4WLNA 1TPYA 1UZLA 2WJWA 4LWOA 1L8QA 1DP4A 4G0VA 3DLIA 3WJ7A 3PXCX 4F2WA 1G4AE 3Q2OA 4X8LA 2AUMA 4MLZA 1UFVA 1RM3A 4R7TA 4Q9HA 3CKYA 1GPNA 1DIOB 2PJZA 3AU9A 4I4NA 4QYIA 4S1OA 5BOVA 4V39A 3UAYA 1CS4C 3VMMA 4WWHA 4GE0A 4A8JA 4N7MA 1K2VN 4I2VA 3H3FA 1W4LA 4GRDA 3NC4A 3Q2IA 2A33A 4UCFA 5K3DA 4RE6A 1XCLA 5IJ9A 2QZJA 2R6AA 1DDOA 1Y89A 1S9DA 4IIJA 1HL3A 2CDNA 4GPEA 2W00A 1Y3BE 4BMPB 1H4SA 4G8JA 2G8NA 3F8TA 3TLMA 5HHTA 4F6LA 5TGZA 1HFWA 4UHHA 3KK0A 4MQMA 2NPFA 3BWBA 1ZICA 3GC6A 3QLEA 2HV8A 2X0NA 2SNIE 1YVDA 5AD1A 3VR3A 3ZVKA 1BE0A 1EUDB 3GFBA 1WUTA 3UYKA 2GAFA 3ETLA 4L27A 4RIFA 5AI5A 1C8KA 4KNYA 1PT7A 5BSTA 1BU8A 1EEXB 1Z26A 1CY1A 1VP9A 3HWWA 4Q4AA 1G21B 5AK5A 5KQPA 4ZJPA 3TI7A 4CFYA 4HSEA 1RFGE 3FCUB 1VHWA 1KQ3A 4DA6A 1ZI8A 3RSQA 5BOSA 2GJKA 1EZ4A 2WZQA 5DEOA 5KYWB 4ONEA 1GAWA 3HLKA 2GZRA 3B3FA 1W48A 4KNVA 2OM2A 1JXMA 2Z2IA 1ZEJA 2NXCA 4I55F 1V9SA 2HQOA 4INZA 3PQ7A 2BBWA 4XCXA 4BYMA 5DYIA 3FFBA 4EPRA 3NWOA 5LC1A 3EXIB 1RHQA 2VT2A 2IFTA 4O63O 5I9SA 2IHTA 2F9LA 3LWDA 3UWSA 5KJ1A 2QVGA 3NDIA 4ARIA 2QBYA 1N2XA 4WCFB 3QXSA 3K05A 3CNBA 1O96B 2AKAB 3NWEA 2XA9A 2C4HA 1YL5A 2YXEA 3S6JA 4OK3A 2I6XA 2ERYA 1WEKA 4NG5A 4F9GA 4J0GA 5IG2A 1ZD8A 1O94C 2GN6A 3BK2A 5HG0A 4MVJE 5CG1A 3LMKA 2VJQA 3QHPA 4B3JA 2PZGA 3GCGA 4MVJF 3IQGX 2EKLA 1FTSA 3TLGB 4ARZB 1KWKA 2IDJA 2QTTA 1F51E 2VYVA 3ZHOA 1WF6A 3AFGA 3QNMA 1O57A 3LWBA 4PCAA 2UYGA 2JHFA 1Q7TA 2H2GA 1CF4A 1SKYE 2CLEB 1K6JA 1WCIA 1CRQA 2PUEA 2Q4DA 1E1YA 2X5NA 3D0KA 1D9ZA 3F5DA 3UJ9A 1F2UA 5JAZA 3OE7A 2UUPA 4H6PA 3DAOA 2GPAA 5EIBC 1DKLA 1DNPA 1Q6ZA 3I9V6 1HLFA 2QIPA 3UT6A 3LOPA 1LK0A 1I3OA 1SCAA 2X0RA 2XH8A 1GLNA 3DE7X 3HZOA 4HB0A 4JL5A 5EJFA 4DQDA 4NXNB 3GFQA 3O8DA 4IMIB 1XQ9A 4GPTA 4Q1FA 4UQPA 5I4IA 3LLSA 3HCFA 1WXXA 4HDMB 1Q84A 1VYVA 3D02A 4URVR 4CV1A 3GJ5A 1IJKA 4DTCA 4MWEA 1H2WA 3UOGA 1YBMA 2Q2WA 2CW5A 4DUGA 5HX7A 4L5IA 4X7MA 4JJIA 3ADBA 2HT1A 3KB1A 3ZWDA 1ECCA 1N2CA 4AMVA 2QORA 1QF7A 1OX4B 2TYSB 2WSIA 1I8TA 3N8DA 3OPQA 3D6HA 2O3RA 4YY3B 4LXTA 2HWYA 4GLLA 3ZQ6A 3UGKA 1KYWA 1TMYA 2CFCA 1I5EA 3AW9A 3KVRA 3UXYA 1MX3A 2XUKA 3WGHA 1X1DA 2OKCA 4OHCA 4FNGA 1RWWA 4JLWA 3B85A 4G5YA 2QX4A 3WMGA 2WJGA 1MV5A 4EYSA 3BD9A 3P2MA 4HVAA 2NZUG 4IDAA 4URZR 7ADHA 2OPBA 2JB9A 2JCVA 3KG2A 2PT9A 4CFZA 3NJ4A 1HORA 3NCTA 4Q18A 4CQMD 4FM9A 4I5IA 5T4EA 2X1VA 1KEPA 4N0PA 2OMEA 1BE1A 4QDZA 4ZHQA 2Q5FA 1HPLA 5KTPA 1PHRA 2AHRA 2NNLD 5CGZA 3PDIA 2BR5A 2FGKA 4EAAA 2RG7A 4UE3S 3NKLA 4KO1S 3O90A 1Z5PA 4NJOA 1XVIA 3CJTA 5KYNA 2GBPA 2PUFA 1DO2A 2B8WA 3DDNA 3KP1A 2XXAA 1U8YA 1ST3A 1S7CA 1DCTA 1Z0UA 1R0LA 1Y8AA 3WOHA 2GFHA 4YP9A 5FUXA 2I55A 5CNKA 4HLNA 1LPMA 2VJKA 4JQZA 5B2ZA 2RHWA 1TK9A 1MRSA 1K6IA 2IH4A 5AKEA 3NRCA 5IARA 2GYUA 1OPXA 5AKLA 3UKOA 3WGUA 2PD4A 4WVFA 1CQWA 1XK7A 3N9IA 3RJTA 2XZDA 1U2GA 2WUGA 3G0IA 1DRJA 3TLJA 4RULA 2O8FB 3LHFA 5A4KA 1ZR2A 3WYEA 4MP6A 4YQEA 2JIQA 5ED0A 2IS1A 3WI7A 3F9CA 1O54A 1L1QA 3GD5A 2JLZA 4QVIA 1BFUA 4O3MA 4LTMA 3EK2A 3P94A 3L41A 4MQEA 5ES4B 2IX3A 1O97C 1R8XA 3DHVA 3EQ6A 3ZWXA 2XVXA 2HL6A 4OHPA 4UBNA 8ADHA 1B2RA 1KORA 3D5EA 4OBEA 5CVVA 5LLTA 3R41A 3CNHA 2J0VA 3VR1A 4BVAA 1HH4A 2X7XA 3GEEA 3K8QA 4Y2YA 1TTTA 5DK6A 2YY6A 3OP4A 4ITVA 3H4MA 3KVVA 1A5AB 3AF2A 1IZ9A 2UZ1B 2C88A 3H7IA 4MP3A 2B7CA 2WNSA 4O4IA 5G1NA 2ON6A 1I6MA 1EINA 4AB1A 2R8OA 4WCFC 1UFRA 1V6SA 2VHYA 4Y2PA 4J29A 1OA0A 3D8HA 3ZNOA 1BCSB 4QPPA 2Q8QA 1BMFA 2ZBEA 3S3TA 3DUFA 5AKHA 5JH7F 4BO0A 1DRKA 2RHJA 1MZPA 3FI9A 1ONBA 3GLQA 4FU0A 4I08A 2IHNA 2R00A 4DEVA 5I7VA 3W1WA 3A6GA 2G7MC 1X1BA 3GFSA 4EY5A 3R0XA 2AQKA 3A6PC 3T4UA 1XMIA 4ZMRA 4PNZA 3KTAA 1X74A 2Z3VA 1XVVA 3CSDA 3CEHA 5EA2A 1ZKMA 4IGKA 4UEWA 4OO3A 2OFFA 1VLHA 4RZUA 1XDDA 2R25B 1N75A 1NXSA 1VKOA 2I4OA 4KODA 4LZPA 4R1SA 1Z4KA 3I34X 3VTKA 4B48A 4EJFA 1GD1O 1B15A 2DTEA 2HIHA 2YJGA 4IJVA 4RZHA 5LQMA 4CEHA 4PLTA 1RC1A 5LA6A 5BSWA 2IE0A 3I32A 5JJ5A 1OXTA 1N0UA 2C5SA 3LUFA 4MOWA 2C9MA 2BR4A 1AZSC 1BHSA 1X9IA 2WP8J 1RHJA 1GY8A 3DONA 3KL2A 3OKFA 4M1QA 2I8LA 4MUKA 4QX6A 1PJLA 2I2XB 2P75A 3FTNA 1UBLS 1YS6A 2J3IA 4GMGA 2HXSA 4XKJA 4Z54A 5HOEA 1R0WA 3I37X 1RXWA 2OBBA 3AEQA 3BGSA 2EG5A 3BMQB 3G59A 1J9ZA 1G291 3LY8A 3NHLA 4WH0A 3AVTA 4FFDA 3OCUA 4G5FA 2FX2A 2GK6A 1JQBA 4NPAA 4OOFA 1TCBA 2EBFX 1B8PA 4P92A 5A7HA 3IXQA 3WQRA 5EIXA 1V43A 1E0KA 2OV3A 3M6MD 4FWTA 3AP3A 3E8MA 1H94A 2I6UA 4KE6A 5FOVA 4NCAA 4OP2A 3MA0A 1JDTA 1EDZA 1TM3E 2VPPA 3CUTA 2QRKA 3PD1A 4NI5A 2QU8A 3IDZA 2R8XA 3KQVA 3WIBA 3SN6A 3SXJA 3RTAA 1CZLA 2N46A 3G1TA 4ETMA 4E5VA 1Q0PA 3QEBZ 4H4DA 4KK3A 3TECE 1TYAE 4HDNA 4C05A 3OIUA 1A2QA 3FPKA 3USES 4H77A 1W9MA 3VSCA 5CAEB 1RXEA 1QV6A 2BKXA 2HPZA 4B3HA 2XNJA 5M7EA 3UJBA 1RXUA 5HF6A 1QRTA 2JGKA 5D3MB 1PTKA 3TMKA 3CFYA 4PZCA 4N12A 1KY2A 3I30X 4CG0A 2EP8A 1PRYA 1OQAA 3OEYA 4UHBA 1KQFA 1RKUA 10MHA 4PY2A 3BMNA 1PFKA 5EMMA 4JVNA 1GTVA 1K7SN 4YN3A 5C32A 3HA5A 2BFPA 3TSZA 4BWYA 2I03A 2VJDA 4IGIA 3MWLA 3QXCA 1OXBB 4FUQA 2DBZA 2BDTA 2WTAA 1KYYA 4M1KA 4OAQA 1PLKA 2WIKA 1BMQA 4P3XA 4Q1CA 1S89A 3FGNA 2RAFA 3ZU6A 4EKNB 5KX5F 2BYTA 4PIPA 4V1CB 3PWSA 4RKWA 1FSSA 3FCSB 1J5XA 4DNOA 2B82A 2LIVA 2QVBA 3V1YA 4DWJA 2RH8A 3IQIX 3BDAA 1QGYA 2TRSB 3IOYA 3NHPA 4HJXA 4DHWA 4I1RA 3KWMA 4K1XA 1ZJ6A 2X9NA 5JJBA 4AG3A 3C8DA 4N5IX 1YB2A 4JR1A 5HPYB 4NY1A 1ISRA 1PFWA 1WB4A 2IYEA 3MWEB 4Q02A 1QGDA 1Z7YA 2QPTA 3U7RA 3OZ7A 4IDNA 5HSGA 2IHZA 1KFKB 1M8PA 1ZOLA 2WV9A 3C98A 5IM5A 1XE3A 2OBLA 2YFYA 1GYRA 5DBHX 4JIGA 4W5TA 1XZBA 1VHQA 2X42A 4IX9A 3L8GA 3K1YA 5AH0A 4F4IA 3PKJA 5CT5A 1B23P 1Y4UA 1UC4B 5SYNA 1EFPB 2CLSA 3ZHBA 4Y9DA 4JA0A 3I04A 1WKCA 3FX2A 3OZSA 1WR8A 4UU7A 3OEED 2IEAA 4K9PA 1L4MA 3D6NB 1Z7BA 4NAVA 4TTAA 4BWFB 4Q47A 3LFHA 1Z82A 1H6CA 2A9QA 2ODEA 1JHZA 3C3DA 2WVAA 3ONFA 3RTCA 3HMKA 4YAOA 4DCSA 2OAQ1 1U7DA 4EFLA 1V96A 1BU5A 3DCNA 3DFUA 2Q2OA 4H15A 4I6GA 2QVLA 2DKOA 2IP4A 2GI4A 3KIPA 1CF2O 2R87A 1JG7A 3R2JA 4QU9A 4JUCA 4XR9A 3U3ZA 3ESDA 1O4WA 4O8CA 5EVJA 4NMHA 3DYVA 1D3AA 3G8AA 4RJIA 5ALJA 1BXRA 1T36A 1JFVA 4UBMA 1XQWA 4LJKA 5EMJA 1RMYA 2QA5A 5EEHA 5IJZA 2O9JA 4W9NC 5AUOB 3ZLUA 3CVUA 5K6AC 5AJWA 3PE4A 2UYQA 3OESA 4RD0A 4RMNA 2PMKA 2WT8A 3F6RA 3L0ZA 2FK7A 3DVLA 4K6FA 3ZU3A 3T6KA 3FPAA 5JCJA 2I91A 3OX1A 1EYZA 4JI2B 1JB9A 1PNRA 3CWCA 4YV0A 3IXMA 1C3OA 1J7JA 4BGUA 5AM0A 1WA5A 3SEFA 2IOQA 5DHTA 1RI1A 5C9ZA 4EUSA 1GQFA 4OQFA 5FAKA 1NXQA 1OC2A 4H18A 1UQRA 4IKPA 3M1YA 3DXFA 4WJKB 3FPHA 2NQ8A 1RVDA 2XUIA 3N87A 4YP7A 3BMOA 4OOEA 3LY5A 2WEKA 1AA9A 1X14A 2CEKA 2DX7A 3OETA 5FQNA 4Z2YA 3WHLA 3EGXB 4A0RA 3LU1A 4OQYA 1XRJA 2CFTA 4J8PA 1NQVA 4PRYA 4ADSG 2QLNA 4OI1A 1YJQA 3W6OA 2MSLA 2WWGA 3E05A 2N3ZA 3E5HA 1S2LA 1Z0DA 5B3AA 1MFPA 5AUPB 4RFSA 4XPIB 1QHSA 4WKCA 1UT6A 1P0QA 3LQYA 1AUPA 3MXOA 3OTWA 4C43A 5BN5A 3T06B 2WNHA 3NV7A 2ZYAA 4R41A 3ONEA 2WHPB 5JROA 4KREA 3TSAA 1PR6A 1AM4D 3AEKB 3PVCA 2CL6X 3V2IA 4QXRA 3AHGA 3PFGA 3ACCA 4CL2A 4OGLA 5GIOE 4DCJA 4K9SA 3PFWO 4IVNA 1E1LA 2XD4A 4DCPA 2NYAA 4AJPA 1I3MA 4JL8A 5L3RA 4WJLA 4NXMB 1Z47A 1Q3TA 3GCWA 3CZ9A 4NESA 2IWHA 2W93A 1MH1A 1QYVA 1NHGA 5EWJB 5JZOA 1DWOA 2PMEA 4Z8YA 1JZQA 5CFMA 1BNCA 3P32A 4I55B 3EA4A 1US8A 3PEFA 1RJEA 1ZZGA 1PT8A 3QPWA 1ZJJA 1HFKA 2YJ4A 2VUIB 1NMSA 2VNJA 4G0YA 1OF1A 1O4VA 2EC5A 4GSYA 2W0MA 5LM3A 3GRYA 2JGMA 1GU0A 2R7LA 4UREA 2E1PA 4J0EA 2K6GA 4GPBA 3D8NA 5FWXB 2ZT5A 3CG0A 3LY9A 5F52A 3SC4A 1XWWA 3JAMA 2IU3A 2R1VB 5DGTA 5TNXA 3L1IA 5HTKA 2FFRA 3TN7A 3S2EA 1UXGA 2VO1A 1F8UA 1JR3A 2QL5A 3WB9A 4K9LA 1QUFA 1VHLA 1VCHA 1NV9A 1XVLA 3OX4A 4QJ5A 1XB2A 2BZ1A 3KLNA 5D1NA 4EPWA 3QF7A 1UMDA 1UWLA 1AB6A 4JC4A 2Q3EA 3W8EA 3DVAA 2I76A 4LDAA 1XGKA 4JASB 1XLTC 1LWNA 3CF6R 1IY2A 2WWIA 3F2VA 4XUCA 1NYRA 2FTKE 2NTJA 3GRZA 4WDQA 4X71A 3NHZA 4B6EA 2NSYA 2TMYA 2YQZA 1T0BA 1JS1X 1RTTA 2IT1A 4M4SA 1SKYB 4LBZA 4LZWA 5CLLA 3FTEA 3K53A 2GVZC 5DNYB 1KHTA 4XJSA 5EYPB 5BO5A 2FWJA 4JBXA 2QE7D 3VPDA 5JDCC 1G3IA 3QKWA 3A26A 2F3UA 1OH7A 3EOZA 1IQPA 4KBFA 4WI1A 5FUVA 2R4UA 2C7VA 4US1R 1ZLXA 3IHLA 3QYPA 1JIXA 2Q4OA 1OFIA 4QECA 1KKUA 4K0RA 4YAFA 4F4FA 4JIMA 3G7SA 3KHTA 4GP7A 1HY3A 2HCRA 5DBFA 3DZBA 5BW4A 2BFDB 2WE8A 2QNRA 4X1KB 4BHTA 2WWXA 1E5VA 1LPNA 4KE8A 1QCDA 1YT5A 1E9CA 2OUIA 3U80A 1H0KA 3D7LA 1W76A 1NW7A 3ZJUA 1JV2B 3PHBE 4ILEA 6CHYA 5K8UA 2JASA 1QG4A 1T3ZA 3IUYA 5AHKA 1U0RA 1P2BA 3IT0A 4V0QA 3V33A 4HGOA 2CNOA 2FHPA 1GR1A 4KMOA 2J07A 3A4YA 4LHSA 1S3SA 1Y98A 3IDQA 2AN1A 2C4NA 2FF5A 1GM5A 4B44A 1LSUA 3C5HA 2LCFA 2W8BA 1PK7A 1M8KA 1M2GA 1T5DX 4M86A 2F64A 4P53A 3N0TA 4B47A 4M9XA 5EE9A 2E5LB 1SKBA 3MTAA 3BRSA 1EM8B 4NOLA 4MGEA 4LYJA 4V0OA 3UGQA 1S4MA 2O23A 2Q50A 3HZZA 4OYLA 2W2LA 4Z53A 1C50A 3Q1KA 3O7MA 4H6WA 4D25A 1NUAA 3ZD9A 1VGRA 4EHIA 1T1EA 3GDOA 2QW1A 3TLBA 3EIEA 3ZHVA 3TLXA 4WGFA 3WNBA 2NO0A 3KR9A 1OFHA 2CL7X 4JCOA 3RWOA 4EELA 2XB2A 3E5RA 5DE3A 5JMOA 2DG2A 2Q4TA 3GROA 5EOVA 5FXMA 4ZAXA 1SRQA 4QD3A 2B25A 1GUYA 3TQIA 2YBDA 1RXSA 3TRJA 4DPKA 1JJFA 2XRZA 3KU4A 4JMLA 9LDTA 4LOKA 2YMLA 5JSFA 3BE4A 2GJAA 4HLUC 4TS4A 1UJCA 1NFFA 3HSSA 3ZDQA 3MGGA 1YTUA 3ZWYA 1LDYA 1OU4A 1REQA 2E37A 2H0AA 4M2LA 4EH1A 2P30A 1OWOA 2PLWA 2QXYA 5LKAA 1QRUA 1THZA 3RVMA 3ZIUA 4BTLA 3V4FA 3GLKA 5AKXA 1T9GR 3NTOA 4RIGA 4LRWA 4F45A 2CHUA 1CQJB 2XYPA 2D2XA 4IUBS 3ZZ1A 2NYUA 2QWXA 5AW8A 3SYNA 4GL2A 2VKTA 1CUSA 4LGMA 4NCIA 1A9TA 4AY4A 4AWAA 2SKCA 2AMJA 4KHZA 4C4YA 4MPPA 4YAGA 1OLUA 3IPCA 4ZREA 1ICIA 4YRGA 1Q7CA 4LY0A 3B78A 5ERYA 4BJ5A 4FN5A 3KUCA 4G5QA 1NT2A 3ZHRA 5IHPA 1CEQA 2G67A 4X3OA 4CYMA 2X13A 3INGA 4F5YA 4MYRA 2JLCA 2OY0A 1XYGA 1RCUA 3ETEA 2I3ZA 3FNIA 4LDRA 4MV9A 1DHTA 3QVTA 4P2GA 3VQTA 1SPBS 3A04A 4IIHA 4R0NA 4I1YA 4RTQA 1QBKC 3GVCA 2VQ3A 3NHSA 2PX5A 2QAIA 1SVIA 2CMFA 3OLVA 4EPXA 3E58A 5I7FA 2FSVC 1TFRA 4FDAA 1TM1E 1XJQA 5CDFA 4H4CA 1YQTA 3LHSA 3LUGA 5D3QA 3Q6NA 2EKPA 2NU9B 1HNZB 3KQKA 4C3OB 4DJFC 4BCDA 2PSSA 3I9V1 4ZDWA 1RE0A 4HJRA 3RUCA 1RQXA 3R5SA 4NYIR 3ZCTA 3LUHA 4YCNA 5J5VA 3Q0EA 4R8SA 3N2KA 2WSSA 3RFVA 3PGJA 1JVBA 1CLUA 1YQ9A 4JLMA 3STHA 3H87A 3K6SA 2J33A 2OO3A 3P96A 3ABZA 4FP9A 4JWTA 2K4MA 4MUHA 3WLRA 3A7EA 3WBKA 1EXMA 3T5GA 2A1TS 4BGIA 2PMDA 5WRFA 1U5BB 3DAFA 1B1CA 4EHBA 3GY0A 1A7UA 1IZ0A 1GITA 4G89A 4YBRA 2VDNB 2F1IA 4I8IA 4O33A 4HYYA 2SHKA 3BS4A 3L07A 3QLJA 4DHEA 3A06A 3I58A 4S2EA 1N9GB 2A0KA 4KVAA 2RI0A 3CX4A 1VBFA 5CURA 4RJTA 2AJLI 1ZS9A 3H2BA 5JV5A 3WK7A 1Q20A 2Q3DA 3QFFA 2XUAA 3QVXA 4W5HA 4R8KA 3RJMA 4E51A 1RP1A 3BXFA 4GYKA 1P2TA 3G7UA 3OG9A 2OHXA 2FE1A 4J16C 2AJTA 4XLZA 3U3RA 4H3KB 2W6MA 1DC6A 1MG0A 3HKCB 3G49A 1KHHA 5HXAA 5KNCA 4XJXA 1U90A 4LXGA 3COSA 3SKXA 1WCYA 1LRJA 1IM5A 3OFND 1P6UA 1BWPA 2AF3C 1O94A 1ENOA 3QJYA 2OPHA 4D97A 4ZYLA 3DTVD 4V0LA 4EG3A 1RBQA 1NKVA 4PLPA 4W7IA 4MWGA 4MWSA 2J4CA 1MUUA 2ZUUA 3G9ZA 4WERA 3UAWA 1VLVA 2GQ0A 4H9GA 1K8QA 2MJLA 4ZOLA 4G84A 1KDVA 1C1HA 1Q1AA 1GEEA 3OWOA 2ZRPA 1GHTA 4JT4A 3E5NA 3PXXA 3D81A 1RBMA 1DHRA 3PL1A 3MCUA 4REQB 4AW9A 1E4VA 3A3PA 4PC6A 2XUFA 3U4DA 4B2PA 5T5QA 3DTTA 2OC4A 3QUBA 4ND1A 2H7YA 4FX5A 4LJSA 5IU6A 4X24A 2GN0A 3WLTA 4TLEA 5ALPA 2GD2A 1XJWA 1NMYA 3ISJA 5DHRA 2IPXA 4ENVA 1PQYA 4RK6A 1VYUA 3AVUA 5EE3A 2IYXA 2C3UA 3RV3A 2QXTA 3CZMA 4AUNA 5KNBH 3TZKA 2OORA 4HEA1 5JSQA 3T95A 3PJGA 4HN4B 3EZ6A 5KX5B 4JBLA 4CLHA 4M49A 5IKMA 3UCFA 5CT9A 4BX8A 2PANA 2YASA 3MJVA 4JSYA 2ZS7A 3LUJA 4LRYA 4ZOAA 2J3QA 3MWFA 3FAKA 4YRPA 3FLBA 4KHPB 4HAOA 3ZW9A 4DV1B 5CBPA 3VR4D 8LDHA 1DEOA 2ZSIA 4YP1A 1I6KA 3OQNA 2C1ZA 1P9WA 3A70A 3W3AA 4L2IB 3QW2A 1I7SB 4Y2JA 4GGOA 5ALZA 3IL2A 3QEAZ 1W4ZA 1YBAA 1CYDA 1YKSA 3I6YA 3ZV3A 1GXSB 1EVIA 2COUA 2DBQA 4Y9RA 1ML4A 2Y27A 4FI3F 4QU8A 3W9SA 2AFIE 5FOQA 5EUMA 4WACA 1KMHA 1SHUX 1EP3B 3CEPB 4EO7A 1CUWA 2H00A 3FCEA 1Z2OX 4MW1A 4AL4A 3GARA 2ZIXB 2JFBA 1KIFA 1S0UA 2ATXA 2RB5A 3LBYA 3T9FA 1GGJA 1QGZA 3ROXA 5CIYA 1I7DA 4MRVA 4OI0A 3JQAD 1LB1B 2PVSA 3WNCA 2C99A 4R7GA 5AXBA 2DPLA 2W7TA 3C3WA 5LIRA 1HI9A 3ZWWA 3UF0A 1H6AA 1BGXT 1Z0ZA 1C0LA 1G6Q1 2G9UA 1L8OA 4Z9YA 3IR6A 3SLRA 2DRIA 3G5UA 5BRJA 1CRPA 2AYYA 1M67A 5C3UA 5T3YA 2CDCA 2QGNA 3H9UA 5B3LA 4EVRA 3E3AA 1QKIA 2O5RA 4C87A 3IB6A 3LDUA 5C7IO 2FPWA 1YFKA 2UZAA 1EUDA 2ZATA 3CGWA 1X86B 4OK6A 4DXAA 4CGYA 4XD7A 1E6UA 3GG9A 4AKEA 2BI7A 4IOJA 5JCOC 1G5IA 1YA8A 3CIOA 4HXEB 1G21A 3GP3A 4TWIA 4ZYTA 2FRDC 3USCS 1KAHA 3G2NA 4MP8A 3WYGA 3OZIA 4R1LA 5FHQA 5C7LO 3LK6A 4B7AA 3W5VA 4GQAA 5KYWA 1G1AA 3FETA 2HZBA 3VR3D 1PF7E 2HMUA 1XP5A 1ESEA 3AL2A 1PEDA 1CHNA 4FFOA 1D9XA 4R8RA 3TX6A 4BX2A 4KL8S 3EDYA 3CWZA 4TSKA 4O1HA 3BEOA 1OLOA 4AJ4A 4QGSA 2DUJA 4IR7A 3FCCA 3EXIA 3BJIC 4P5EA 2CBGA 2YV1A 5KAMA 3SR3A 1M8JA 4JZKA 3D6FA 2FSFA 3GR6A 4KXMA 4M3NA 2PSJA 3PUVA 1PGNA 3HUUA 3X1WA 4WCFA 2J7KA 3Q8XB 1YKGA 1IUNA 3CLRC 3O84A 2PGNA 3OMWA 1W5TA 1YNSA 2GBFA 3MTEA 3VR5A 4GYYA 1FVXA 1JG1A 3KYJB 2GS9A 2Y0CA 4JBWA 3NAMA 4JJEA 4LRTB 4BP1A 4YMUA 3ODPA 4UVHA 3ZS8A 4W7SA 1NKSA 3E82A 3UJCA 1SC1A 2Z9CA 5DGIA 3TLGA 3WKCA 4ARZA 3INTA 4A6PA 4F84A 3T9AA 3C87A 3CLSD 1YJAA 3H3XA 4BLOA 2DY0A 3VKWA 3JQFC 1RAGA 2QMQA 4P3NA 3M0EA 4YWHA 3PYXA 1LW7A 4OHOA 4Y8VA 5EZ6B 3GFRA 4LIPD 3UK7A 2ZJ3A 1XZIA 1IBSA 4N3NA 4ND5A 4DR4B 2IYLD 3BPSA 3RAEC 1Y7PA 1PI3A 1BEUB 5ESRA 5A03A 1AUOA 1IVSA 3EMVA 1CUIA 1K4MA 2VFAA 3AQ4A 3R6TA 2KM1A 1GZHB 1TQ4A 2FU5C 4FKZA 1U9JA 1H9AA 3KYIB 2Q1WA 1E7QA 4G07A 1JIIA 1E7SA 3MBKA 1E98A 4HDMA 1PKXA 3FDZB 5DSZA 2HCFA 4INPA 5JNVA 3UQYS 2AN9A 2HEGA 2V3VA 5HE8A 4PC7A 4UHJA 2VQEB 3NKFA 1IIBA 1CY2A 3IMGA 1NQTA 2WPDA 4Q4LA 4CCYB 1U81A 2Q9CA 4EJ6A 1YAJA 1C8LA 1KYVA 4EAQA 4PZEA 3TLEA 3AR2A 2ZZNA 2G4LA 1UEJA 3ESXA 1P61B 1LJUA 2VDQB 3L82B 5JY1A 3BFXA 3M4YA 5CXXA 5D5PA 5BSUA 2W4QA 4C88A 1E9SA 4L8LA 1GDDA 3A11A 4ITRC 4EENA 1Y37A 1SXJE 2HU8A 4BDSA 5LP1A 3E5MA 3M3HA 2BFNA 1XUOA 1E69A 1LF0A 2FZGA 4PIMA 1KRWA 1QZXA 4XEHA 3WLNA 2FE4A 2JLQA 4ZXPA 5EE1A 4ZPJA 1O89A 1K7CA 1TADA 3NDRA 3QHAA 3W8DA 3RKUA 3I92A 3PT9A 5EKTA 2XT9A 3MRTA 5F7ZA 4DXHA 1Q74A 3LL4A 4J7UA 5KNCH 1N5OX 4KFUA 4HTAA 3ZJVA 4KDEA 2HLDD 3VGPA 4DGQA 3H5LA 2COEA 2Q1XA 2HRZA 4FNOA 1QO7A 3B12A 4O2BF 4RMGA 3HY3A 1B00A 1SH7A 4I9NA 4TX1A 5J59A 4XQ9A 1XRPA 2D7CA 3C3BA 1PQ4A 2B5OA 3KSMA 3LC0A 5A0TA 1PNQA 1KI4A 1Q57A 5FUMA 3TIIA 3ICVA 7REQB 1RKQA 3EW7A 3OCYA 5A4MS 4JNCA 4LYDA 3DD1A 3CC8A 4RQAA 6LDHA 1IUOA 5FULA 2J7PA 4CHGA 2DFTA 1PL7A 1YRQA 5AVYA 3ASZA 5KC9A 2IYUA 3MMXA 4UD2A 4L9AA 5CHYA 5DEIA 3CKKA 3RQIA 3ZBUA 3LKDA 2GNAA 2FPOA 5F51A 4NBKA 4YHHB 2B1RA 5IVIA 2QMHA 5TS2A 4IIUA 4I99A 4D8UA 4DNXA 1LCIA 1P3DA 2ZR8A 2O8FA 2Y1DA 3L9WA 2LWIA 2KPOA 1HDIA 1GQOA 3NETA 3AZOA 1E1RD 3ZDEA 4GT1A 1XTJA 5BUSA 4NULA 3OFKA 1AXRA 4KU4A 2WPNA 4ZC8A 3RODA 3Q3VA 2V54A 3VAAA 4W5NA 5JOQA 5JMPA 3AXSA 1ZCZA 4BC0A 1CIPA 4QELA 1Z38A 3DR3A 4O25A 4WVLA 5B7PA 3IOCA 3FNGA 5JPIA 1EHCA 3E7PA 1DQYA 2ZRBA 3GRFA 3K35A 2IYZA 3H1EA 1ZIYA 1U28C 1X1SA 1UIRA 4RENA 3V48A 1ONSA 5CVCA 1IHDA 2HQSA 2UZ1A 3EB9A 1N5MA 4XIIA 3KBBA 3V32A 4EFKA 3W3AH 1EI9A 4GSLA 1F2TA 3WJ1A 4BAZA 3OTOB 2Z4RA 4UEQA 3TEMA 1J33A 621PA 4BO8A 2WLSA 1E64A 1KPGA 1GYPA 1BCSA 1MBZA 1P72A 2EZ8A 3DMFA 3ZDBA 2XVYA 1FU7A 1N4DA 1SOVA 1CEYA 4XZ3A 1FMJA 4OM7A 3RYCB 2AEEA 3MCAA 2A5FA 3EVEA 4NABA 4E1VA 3U7HB 5BQFA 3QU4A 5LZ8A 2V7UA 5COQA 2B1JA 5KB3A 1ZONA 4RMHA 1H66A 1S2DA 2BJVA 1XKLA 2J32A 3HY6A 4WDRA 3GN2A 5F2KA 1FFXA 1U0LA 5K6AA 3RFFA 4B46A 4WL0A 3ZOKA 2DY1A 3F4LA 1QE5A 5EMLA 1TF7A 3NCHA 3K1AA 2SICE 3EFEA 2B78A 4HLQB 4CE6A 2GF2A 4GM4A 3SF8B 1CZKA 3PPVA 4U2CA 3FPGA 5KVCA 3AR8A 5ADVA 1VIVA 3BTSA 2G6TA 1SOAA 3I61A 1ECLA 2VTEA 1J25A 4NRDA 3ZYCA 4R69A 1QDEA 1AQUA 2H1RA 2HPAA 5C5EA 3LGAA 4XDYA 3VZSA 1VJRA 4AYTA 1JBQA 1MAVA 1UH5A 3OHMA 1P31A 1ZC3A 1VYTA 2QTZA 2FR8A 4QDUA 3L0PA 4MV7A 1W75A 4YGYA 4P3OA 3IE1A 1DIRA 1FJGB 4HEQA 4EZEA 4QSMA 2EGUA 3B7PA 2QE6A 4N54A 2WJIA 3M6IA 2MYUA 3OFSA 1VYHA 4L78A 2R6FA 4UASA 4CM6A 4GZ5A 3CVJA 3FR8A 3NAQA 2QEQA 3PXDA 4H17A 3UMRA 3CVWA 4MTCA 4W5QA 3HEBA 2FWMX 1I94B 2YWHA 4MV5A 2F8SA 4YUXA 2REBA 4LJ9A 1L5GB 2R6GA 4CF5A 5A7GA 4DLVA 3ORYA 5A4JA 3T1NA 3U4AA 2H08A 4TS9A 4YR9A 1M1ZA 2YWDA 1GR0A 1N9ZA 1BC5A 1G3UA 3M9WA 3ZNPA 2Y68A 3IYLW 4WY8A 3I9MA 2QYSA 3FGZA 4BNNA 5CAEA 5C8VA 3UFXA 1LQUA 2D5BA 3VOTA 3VR5H 5JO0A 3UV7A 2PL3A 1W44A 5AUQA 1NBIA 5LB2A 2ATIA 2O07A 4HOYA 4FVTA 4O2RA 3NXKA 5D3MA 4Z5XA 1Z8FA 5JYDA 2G1UA 1JDZA 2INGX 4KQMA 4UNSA 2YRXA 4B83A 2E89A 1DELA 1OXVA 1S7GA 1QZTA 3EZ2A 4AROA 8MHTA 2H52A 3OZFA 2H2WA 4TVBA 3P9SA 3LECA 5LBIA 1LQTA 2B34A 1HRDA 3RD5A 4BXOB 5E6UA 1GZ4A 1JHRA 3GRKA 5FNVF 2HYIC 5DF1A 3A1WA 3V4PB 5A5EA 1Y9JA 4C9BA 2VH2A 2CVPA 3IIEA 1ZD9A 1NP3A 3MLEA 4NBVA 5I9BA 5LOVF 4V1CA 5JJIA 3KQMA 4JI0B 4RGYA 4WK0B 2XRMA 1BSVA 4NBUA 4QGHA 1E2LA 3IESA 2HB6A 3G8DA 1DRWA 2BGJA 2A4KA 1A2OA 1QHYA 1UBMS 3FJYA 3JVIA 3KR2A 4ZP1A 1JHPA 1NXTA 1XZJA 2NZWA 1E3TA 1KH2A 2QPOA 2ZZMA 1EFHA 1AS2A 3RC3A 4YAKA 3WLFA 2HV9A 2CLCX 4C5BA 4G1UC 1UDRA 3MWEA 3P27A 4UC0A 1PEKE 3W6PA 4B6OA 1LFDB 3O82A 1R8QA 3DL0A 4QRIA 3WV5A 3ZHXA 1J06A 2Q4RA 1I2MA 5ALEA 3V3TA 4TXMA 1J0DA 3TJMA 4E5DA 1XLTA 4HMOA 3NVAA 3HYTA 1TVCA 4HL6A 3UAZA 4YYEA 1JG3A 1XI2A 2XZPA 4BZZA 5JFTA 4JI4B 1QU2A 3NASA 2JHCA 5K6TA 4BWVA 1WZUA 3F9IA 1ZEMA 1YK1A 4ARAA 2AQHA 4ESHA 3OICA 4TXLA 1YZTA 4PM4A 3K0BA 4OFBA 1GSAA 3QE3A 4GI3A 3PD0A 821PA 3KWFA 4W1SA 3L7KA 4J3FA 1DKOA 1L5OA 2W4MA 4G37A 4JI5B 4E31A 5INTA 1DWUA 4PLHA 5JDCA 4C2BA 1WG8A 3VPHA 4EHKA 3MWKA 4B31A 5K03A 1C7FA 4PQFA 3DEHA 1Z5GA 1OBCA 1COWA 4PS0A 4RTMA 4DR1B 8AT1A 1Y8RB 2P9ZA 1SMKA 2RBGA 1F38A 2V6GA 3K92A 4J76A 4MW5A 5FAXA 1YZKA 5KAPA 2PGAA 5JZ9A 3TH5A 4IMJB 4XSHA 4AU1A 3E7WA 2CGEA 3K5HA 5IKXA 1N3YA 1ZHHA 5GADl 4F1WA 4BCBA 4E6EA 4YMHA 4H1TA 3T5DA 3TOXA 3GLIE 3GJXC 4WKBA 3CRVA 1KC3A 2B1GA 4EZBA 1S1CA 1M9NA 1S96A 1YNOA 3IERA 4R5MA 3OM8A 2ENWA 3PC7A 4OYRA 1DBRA 4EY7A 3Q8LA 1ZRHA 5H70A 4AZVA 4ZI3A 5G40A 1N5JA 2PUCA 4OHBA 4PBTA 4BJ1A 4WSOA 4MR9A 4J2HA 4YRCA 4H6VA 5KOHA 2AFIB 2PZEA 2HZ7A 4HNSA 4AWBA 1X0VA 2A35A 1QP4A 5EVCA 1OZ0A 2FMFA 3KV1A 4GLOA 4R9RA 3TRHA 2AW5A 4MQFB 2QVXX 3WLAA 1U1GA 1KI6A 3GJQA 4FYYA 4IZHA 3TL6A 4CMAA 5B4TA 1OXXK 3LUBA 1P4JA 2X86A 4B7XA 2P2CA 4CKEA 1R74A 3ZLTA 2MR6A 2XLCA 2QTCA 1G8YA 1FTYA 3FR7A 4LI3X 4G4SP 5D3KA 2ZT8A 1IPEA 2FVXA 2C42A 2XMPA 3EVGA 2C92A 3M1LA 3R0IA 5DLYA 5LZ7A 5SY9A 1W0JD 1T1JA 1WV0A 1TYCA 2YH2A 3AFIA 3KRTA 4XPIA 4YCDA 4WKGA 5HE9A 4EHJA 2IQ5A 1P4GA 1VGVA 4QQFA 1Q7BA 2JI9A 3HCAA 1M0SA 3KSBC 2WHPA 4L8WB 1YR9A 3AEKA 1D0SA 1R4MB 1U94A 4UCQA 4KAFA 1O77A 4KWTA 5EUCA 2OQVA 5IWCA 1TO2E 2HMYB 2JNWA 5LBTA 1HDYA 3NM5A 3IJRA 2OG1A 2X1LA 1OGJA 1AN0A 4ZT4A 5KBYA 2VPQA 1VL6A 3MT7A 3T7KA 1B16A 4ARVA 1D2RA 3AWIA 2X76A 4UM9B 1QV9A 2OGSA 4WZAA 4CU2A 3EA5A 4YX9A 2JRLA 4O4HF 3WLPA 4ENSA 3S68A 3NZEA 5AW2A 2H0QA 1MOPA 3STUA 3PGLA 1PZNA 1KA9H 2Z2JA 1Y1QA 2O8NA 3A7DA 3SD7A 4ZZ1A 1D6MA 4FIZA 1UDCA 4DXDA 4FWBA 1TJ5A 2ZXUA 1AKMA 2P6RA 1M8FA 4DG5A 1E3DA 5FWXA 2GO1A 3O0TA 3UWDA 4M0CA 2YINC 3KT0A 4JJFA 1M2OB 3VR2A 2DSTA 3HLYA 4ENWA 2ISCA 2R1VA 5AHWA 1NTOA 4ASUA 1FK8A 4OXQA 3DC2A 1JG4A 1M1NB 2FSVA 2WIFA 2BN4A 1ZK2A 3Q0TA 4FOOA 4OQDA 5HCNA 3N28A 1W85B 2IPMA 2EEZA 3PT5A 1AS0A 2CZCA 2DUMA 3MTQA 1SUEA 5KOJA 2QUAA 4S04A 4M9RA 3X1JA 1KEVA 3BK7A 3RSOA 4HRYA 2BCEA 3B3GA 4IDGA 4DNFA 4M1YA 4RK1A 2ATVA 1XNRB 8ATCA 2Z2YA 3DHWC 3QI7A 1SUSA 5HFNA 1CQXA 4CKWB 4ZQBA 5EP1A 3K3PA 1F9AA 2AGVA 2XUZA 3BZUA 3I23A 4GGPA 1RZVA 4Q4DA 4NTZA 3B70A 3UAOA 4AS2A 4YRRA 1O5IA 3GWZA 3F4BA 2ZYDA 3I4LA 1EXVA 2AE2A 2XBMA 1ISFA 1IYZA 4RD2A 3B3AA 3LPAA 1C7EA 3W7BA 3AI1A 3G79A 3ZDRA 2ZI9A 1EVLA 3D3WA 3CT4A 3JRWA 4G23A 5EYPA 5GQSA 4Q6WA 2R5FA 4KMSA 5HGXA 2X58A 3QU2A 2BMEA 3NHYA 1Y0BA 3VU8A 3WYNA 4UTRA 2FZCA 3EOBI 1JLLA 3DB1A 3NOVA 4RHXA 4W8GA 4KPUB 2A2ZA 1QH1B 2HW8A 4MQUA 1E7YA 5ENDA 2CXHA 3TOSA 3DZJA 2Y2VA 4HXFB 2EKBA 1XLWA 1R7RA 3HWRA 3IQXA 4IFEA 5J2UF 1Y4ZA 3FWYA 2H85A 2CJWB 3EEQA 3RVNA 5LZ5A 5CB4F 3GNLA 2BFDA 1ZSNA 4J16A 2WC1A 2H1CA 3M9LA 1JXQA 3FBWA 4D8XA 1VB3A 2XCQA 1N2OA 2A86A 2ETVA 3BZBA 4D8YA 1XU4A 4KLNA 1PR3A 4Y2TA 3OMXA 1ZUD1 2HGZA 2GK4A 4IPTA 2FEPA 5EKSA 4RKFA 1DE0A 3LXUX 4ZFNA 3PRKE 4FI3C 3RHTA 1F4VA 1SXJB 1VI6A 3HU3A 4BMNA 3C3KA 4PVCA 4W4TA 5FNZA 3L92A 1N0HA