4AO7A

Zinc bound structure of a novel cold-adapted esterase from an arctic intertidal metagenomic library
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
243
structure length
223
Chain Sequence
MSWNGKDERKLSVQERGFSLEVDGRTVPGVYWSPAEGSSDRLVLLGHGEYIEQVAKLLVGRGISAMAIDGPGTDVVGLDAFPRMWHEGGGTAAVIADWAAALDFIEAEEGPRPTGWWGLSMGTMMGLPVTASDKRIKVALLGLMGVEGVNGEDLVRLAPQVTCPVRYLLQWDDELVSLQSGLELFGKLGTKQKTLHVNPGKHSAVPTWEMFAGTVDYLDQRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Studies of a Novel Cold-Adapted Esterase from an Arctic Intertidal Metagenomic Library.
pubmed doi rcsb
source organism Unidentified
molecule tags Hydrolase
molecule keywords ESTERASE
total genus 78
structure length 223
sequence length 243
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ao7A00
4QDUA 1CUEA 4AQDA 1L7QA 2W6CX 1FFBA 3A2LA 1DWPA 1GQSA 5ALKA 2QT9A 1EHYA 1ZIYA 4WFJA 2QZPA 1WHTA 4KAFA 4UPDA 1Q83A 4EY8A 3V1NA 1LPAB 3OTQA 2HA0A 4UHFA 3AIOA 5JALA 1SOMA 2PM8A 1UT6A 4HXFB 5JYCA 2XQIA 2WUEA 5KBYA 3DS8A 4HXEB 2HRQA 4FLFA 3BIWA 2QUAA 3HZOA 5D3ZA 1MPXA 2CKMA 4DNQA 1XRPA 3G02A 2JIDA 4AMZA 4WCVA 4CIBA 3K2IA 3YASA 1CUHA 1BCSA 1XRQA 4B0PA 5FV4A 3LIPA 5ALFA 1GPNA 1CUZA 5JARA 2WUGA 1CPYA 5LZ4A 2DQYA 1R9NA 2QMQA 5KREA 5D7BA 2GBIA 4E15A 1H23A 1OILA 4P08A 4CG3A 3SK0A 5EHXA 4Q1VA 2RGUA 4PQEA 2JEYA 1UK9A 4W1PA 4XVCA 1HKHA 4QWMA 5DNUA 2WUDA 5AO9A 1P0PA 3HI4A 1J1IA 3QVMA 1THGA 5IKXA 3KWJA 5C8ZA 1IUPA 4EY7A 3H2HA 1CR6A 1OCEA 2JGIA 4UHDA 4Y2PA 2C0QA 1SFRA 4GW3A 2WFZA 1EB8A 4K6HA 5JZ9A 3L1HA 4UFOA 2QJWA 3DYVA 4H35A 1EX9A 3QPDA 1NU6A 4Y2XA 3FLAA 4C4ZA 3KWFA 1DT5A 2WFMA 2I03A 2JGFA 4FMPA 3C8HA 3TRDA 4Y2VA 4DTCA 2O2IA 4BDSA 2DHDA 3D59A 3F9CA 1N5RA 4A5SA 1TQHA 5ALWA 4OB6A 5CMLA 1LBSA 1XKTA 4C4YA 2VT6A 4UBJA 2OPHA 4ROTA 1QIHA 5I9IA 5BOVA 4CG2A 5LIPA 5AKXA 5JD5A 1XZEA 2C5FA 2OCKA 4QLAA 4B81A 2BGRA 5AICA 4Y2UA 2ZJFA 4FLMA 3I6YA 4DGQA 3QZUA 5CTAA 2VJDA 4L0CA 5ALDA 3R40A 5AI6A 4LXIA 4OB7A 3G9ZA 4KE6A 1GPLA 4KE7A 3FLBA 3WKDA 4OB8A 1OXMA 2JGEA 1G66A 3K6KA 4J0DA 4CCYB 1TAHA 3R41A 1JJBA 3F98A 2CB9A 2IIVA 2H9YA 3KD2A 4U2DA 4W63A 1RYYA 2HA6A 2DHEA 3JYHA 2WU4A 5DYWA 3PF9A 1XZMA 1GQRA 5EIAA 1CLEA 2WHRA 4BTVA 1DU4A 3E4DA 3BWXA 3C5WP 1XZJA 1QIDA 2BKLA 4UBIA 2XQJA 3VJLA 4G8CA 3R3ZA 1UK6A 2Z3WA 4ZGBA 4N5IX 1R1DA 3H0CA 5LLSA 4F0JA 1QZ3A 3T4UA 3FCYA 1IMJA 3DLTA 5K3DA 2VF2A 5H3HA 4TPKA 1GKKA 4P93A 1C4XA 4OD0A 2AJCA 3V48A 3AIKA 1KU6A 4WFIA 4J0GA 4CIAA 4DMFA 4OUKX 5K5EA 4KAAA 2B61A 1QIMA 3IURA 4MYDA 1YB6A 5HF5A 3H2JA 1HBJA 3QBJA 1VZ3A 2WTNA 5AKIA 3LP5A 4YASA 3G0GA 3RM3A 4J7AA 1BS9A 2Y6UA 1EDBA 1WCYA 3OG9A 3IVMA 4W1QA 5E2IA 5I8PA 4UFNA 1P0IA 2WILA 4DNFA 2XUHA 1VKHA 4BBZA 3ANTA 3G9TA 3BDIA 3D5EA 3DQZA 1MJ5A 1B6GA 4DSZA 2VT7A 1UFOA 4FTWA 5KWJA 1C7JA 3AIMA 4OCZA 4XJVA 3STUA 3WKAA 4Y9SA 2XUGA 1E8DA 4X94A 3O4JA 5ALSA 5JAUA 4PSUA 1IUOA 1XLUA 5AK5A 4QDOA 2PSDA 4BATA 1SCKA 2Y1KA 3WLAA 2XMGA 1VA5A 2ROQA 2BUCA 1A88A 2X5XA 5AI9A 5ALOA 1CUFA 4QNNA 5EIHA 3W9BA 3I2GA 1YA8A 2OGSA 2J3QA 4H77A 1J06A 4K2AA 2OAGA 3S8YA 3NUZA 1T4MA 2WG0A 3DJYA 4AZ3A 1XROA 4L72A 2GYWA 2JGJA 5FDFA 1VZ2A 4MEAA 4E14A 4Y2TA 4BCBA 1BEEA 2D0DA 4NVRA 1U8EA 1JKMA 1QE3A 1J2EA 2O2GA 3E3AA 1ODTC 4FBMA 3M82A 1LNSA 3VJKA 5IVIA 4GLBA 2BUBA 4MXDA 2RONA 5IVDA 2WTMA 3G8YA 2QVBA 2PKYX 4BZWA 1FJ2A 4DMHA 2J3DA 1W76A 2YH2A 3V1KA 3FSGA 4RNCA 3D2BA 2AJBA 4WFKA 2OGTA 5AM3A 3WIBA 2D5LA 4CCYA 3G7NA 3HXKA 4Q3OA 4J0JA 2ACEA 4HTAA 1ZJ4A 1UOQA 2OG1A 3FVTA 5F4ZA 1MAAA 1A8UA 3I1IA 3WK8A 4FHZA 5LZ7A 1JT2A 3BIXA 2GZSA 4QA9A 2VJBA 1W1IA 4CG1A 3WK6A 2YXPX 1XZAA 2B4KA 3O4IA 3STWA 2BGNA 4G4JA 1XRRA 4LKOA 3C43A 1YAHA 3QPCA 5A2GA 4KRXA 3G0DA 5AH0A 1QIKA 1CV2A 4F5ZA 1DINA 2ZYSA 2XMSA 1L7AA 1QO7A 2HA5A 5ALJA 5ALUA 3H04A 4BE4A 5E4YA 3EBLA 4AO8A 1ORWA 1EDEA 1LPNA 4CCWA 4KJXA 4HXGA 1EVQA 1DQYA 2PUJA 2DQZA 2I3ZA 1JJIA 4I4CA 4BTLA 2I3DA 5A6VA 3S2ZA 4B6GA 4P9NA 5LZ9A 3GELA 3F97A 4AO7A 1K6EA 2PUHA 1TK3A 4B9EA 3CCCA 4YPVA 1HLGA 2CZQA 2FUKA 1CQZA 4H7FA 4QWWA 5HKBA 2RHWA 3D4LA 4DSAA 5YASA 2HADA 2HU5A 5AHXA 1ZGBA 3EF3A 1QIJA 3I6ZA 1JMKC 3L1IA 4WY5A 3STVA 1E66A 3ESBA 3RKSA 3DYIA 2DCMA 1N1MA 1G5FA 3K9BA 2ZVDA 1GKLA 2Q0XA 3TJMA 3CCBA 2CEKA 2DSNA 3SX4A 2HU7A 1DT3A 3IUNA 2OCGA 3OOSA 5HFNA 7YASA 1JI3A 2G5TA 3W9UA 2QS9A 1FSSA 2H7XA 1JU3A 4B85A 4UUQA 1EK2A 1CQWA 4JUIA 4J3JA 3GBSA 2ZYRA 3QMVA 4RPCA 4E11A 4ZV7A 1WB4A 5ALEA 1CUYA 2VATA 1X2BA 2B20A 1WB6A 2AXEA 4GBGA 3OM8A 2OCLA 1MO2A 3QPAA 3WK4A 1ZJ5A 2C0PA 2XUAA 3T52A 5SYNA 2VAVA 1F0NA 4O08A 3VDXA 2H1IA 1Q0ZA 2PBLA 1AMNA 4G8DA 2HFKA 1W75A 3AZQA 2AJLI 4UHEA 4BP8A 1XZCA 1QIFA 2BFNA 5E4JA 2LIPA 3PUIA 1XQVA 2BUAA 5ALYA 1UZAA 3JWEA 4U2CA 1UK7A 4C89A 2WKWA 3ED1A 4FKBA 1E89A 2OGZA 3O9MA 4HRXA 3LLCA 1VJ5A 1P0QA 1E5TA 1TCBA 4JH0A 2XUKA 3MUNA 4BVKA 1LPOA 3QMMA 3N2ZB 3NOXA 4YK7A 5HFAA 4U2EA 2C7BA 2WHPB 3DEAA 3BF8A 4Y2QA 5FKJA 5JAHA 4I3FA 4ZRDA 5LYYA 3WA7A 2XUFA 1CUCA 2VTVA 3HC7A 3IBTA 1EI9A 5D6OA 4UHBA 2GBCA 1ETHA 2C5GA 4JNCA 3BE8A 1YS1X 2O7RA 1XLWA 1Q0RA 3WK7A 3ZI7A 4IH9A 1LZLA 5LZ8A 2WIDA 2J4FA 5C8VA 1MX5A 2ONCA 3CXUA 4X85A 1WB5A 1BEZA 4QDXA 4B9AA 3KSRA 2VJCA 1XZLA 2B9VA 3GZJA 3O4HA 4LIPD 4Y2YA 5LKAA 1R88A 4GEGA 2PPLA 3ZPXA 1HL7A 4BAUA 3KXPA 5A71A 4MQLA 4PO3X 1ZD2P 1SCQA 2E3JA 3WL8A 4BAZA 1BE0A 4PNZA 2EDAA 2R8BA 3AFIA 1ZICA 5AM1A 4S0XA 3DL7A 4ARAA 5HZGA 2XUDA 2OQIA 3VVLA 4JEIA 1BROA 1W52X 3C87A 2FJ0A 3E1GA 3WL5A 2HDWA 5AI8A 3P2MA 4WDRA 1HQDA 4FNMA 4QDTA 3C8DA 1RP1A 4IHAA 4X6UA 4GI1A 3WWEA 2HA7A 3RLIA 5JADA 4ZXFA 3W05A 5HF9A 1YASA 3M83A 3FCXA 3BXPA 2HU8A 4V2IA 3PFBA 3ILSA 3OPMA 1XQWA 2PSEA 2VA9A 5ALVA 5IH7A 1CFJA 4IQ4A 1XZKA 1ISPA 4LXHA 1HPLA 2AJ8A 3EQ7A 1FFDA 1ZI9A 3IUJA 2GBGA 3B12A 1XKLA 5SYMA 5ALXA 1ZIXA 2GYVA 2XT0A 5ALMA 4HVTA 3AZOA 3WL6A 3I2HA 3BF7A 1ZD5A 2WG1A 1XRMA 2G5PA 4BCDA 3HRHA 1A8QA 4U2FA 2GYUA 4Q3LA 2XE4A 1H2WA 3JW8A 4GDMA 5ALQA 3C6YA 3Q0TA 2QKYA 3DOIA 5C81A 5AOBA 5DTIA 1DTEA 4K5QA 2OXEA 4MEBA 1I6WA 1YA4A 2ZYIA 2WFLB 4N8DA 1W6RA 2RAUA 3PDCA 3O4GA 1XQXA 1TCAA 1G42A 3WWOA 4Z49A 4AO6A 1DWOA 4EY6A 2GBFA 3DOHA 3IIIA 4CI9A 4KE8A 5AK4A 5AKLA 5AJHA 1CEXA 3DL4A 2WIJA 3F67A 3D7RA 4BDTA 3FAKA 4UFPA 1QJ4A 1WPRA 2XMDA 1UOOA 4K6KA 5ISMA 3WKCA 3G9UA 5AP9A 2ZSHA 1XZFA 2XUPA 4INZA 3UMJA 4U2BA 1ODCA 1VXRA 1AKNA 2DHCA 4AMYA 2CBGA 4EHBA 1IUNA 1QTIA 2C4HA 5DYYA 2QXTA 2PU7A 2ES4A 4DNOA 1CUVA 4X7BA 5HF6A 2O2HA 5DNVA 2WM2A 1ODSA 4KR0A 4JYPA 5AOCA 1NX9A 4K6GA 2WUFA 4B83A 4X90A 2XUJA 1RWQA 4F21A 1JJFA 4LYDA 5A62A 3FNBA 1AURA 1THTA 1ZOIA 4EA6A 3WZLA 2EEPA 4MJ3A 1CVLA 3DCNA 1J07A 2HFJA 1BU8A 3GUUA 2PSJA 4UHCA 5DWDA 3H1AA 4G9EA 1IZ8A 3WK5A 1YB7A 1IZ7A 5FP0A 4OU4A 5C7YA 1X2EA 3HEAA 3ICVA 5DLPA 3W06A 4AN0A 3WMRA 1TIBA 3HACA 4BC1A 4BP9A 3TEJA 2WSLA 4FFVA 4PF1A 1LPPA 1K4YA 1KU0A 1VE7A 1ACJA 4ZV9A 2ZJ6A 1CUGA 5K3BA 1LPMA 1K63A 3EIOA 5DJ5A 3STYA 5EI5A 5ALHA 1YS2X 4PV7A 5ALTA 5LP1A 2EDCA 1VE6A 3STXA 3PF8A 5DNWA 5AI0A 4EY4A 2OLEA 3FVRA 3D2AA 4Y2RA 3D2CA 2ZJ7A 1EXWA 4WJLA 3IDAA 3R0VA 4KE9A 1XRLA 4FNGA 4UBMA 5KWIA 4OU5A 1A7UA 5CRIA 2JEZA 3SC2A 5HQ3A 4X95A 2WJ6A 5AI4A 4B82A 5EFZA 4H7HA 5T4FA 2IX9A 5FRDA 3DD5A 4H7JA 2XLBA 4M0MA 4XWGA 1NU8A 2UZ0A 4FLEA 3AZPA 2WLSA 3H1BA 3VISA 1R4ZA 4G1FA 4OPMA 4X91A 1CUIA 4DIUA 3ZLTA 3QITA 3KOOA 1EA5A 4N5HX 1GZ7A 5ALRA 1JMYA 2IITA 1AC5A 1QIGA 4NZZA 4BVJA 3ANSA 4L3WA 3F96A 1XLVA 2NW6A 2WU3A 3U1TA 3DNMA 2HA3A 2XQGA 4QE3A 5FXMA 1YR2A 2RI6A 1CUDA 2XMBA 4Q3KA 2CJPA 3ZLUA 3IA2A 2ZSIA 4C01A 1ZD3A 4F60A 1R9MA 2AJDA 4FFWA 4W1RA 2QRUA 3WYDA 1MAHA 4ZI5A 5K3FB 4HRYA 2V96A 5JAPA 1AX9A 4X3CA 1U4NA 4BAGA 4DLNA 3GA7A 4BYMA 2P8SA 2V9ZA 1LZKA 2PL5A 4DMKA 3WWDA 5AKYA 2CUTA 5I7UA 2QOEA 2V98A 1MNQA 4BC0A 3IB3A 4BB0A 2WJ3A 2K2QB 3M81A 3G0IA 1XZIA 4X6YA 3H19A 1W4LA 2Z5GA 2XI4A 1UKAA 3BDVA 1HDEA 3LIIA 4PSDA 1N8SA 1C7IA 4DYHA 4FDMA 1TKRA 1TRHA 3NGMA 4L9AA 1CRLA 1X70A 5AK3A 3RARA 1QONA 3I2KA 3VVMA 4DNPA 2BCEA 3A70A 5JD6A 1LPBB 2H7YA 5HK8A 3R3VA 1ZI6A 3B3QA 1H2ZA 1R3DA 2HHAA 5ESRA 3QYJA 4AN1A 5HCUA 4X93A 5AIAA 1XFDA 1E3QA 3F8SA 1CUBA 2JBWA 1D07A 3H18A 4QZVA 2ORYA 2WHQA 3U0VA 2HA2A 5AKJA 5E4TA 1UKBA 4N8SA 5HK9A 4W1SA 2OAEA 3H2IA 1LBTA 2ECFA 4CFSA 1IVYA 3UUFA 1USWA 4RE6A 3BJRA 3O9VA 3G0CA 4WDQA 1Y7HA 2Y2UA 1QFMA 3LCRA 1VOTA 2OQVA 5JD4A 4OSEA 1QO9A 4OYYA 1F8UA 2Z8XA 3D0KA 1MNAA 4B0OA 4G8BA 3QMWA 4Y7DA 5AKKA 5CURA 1LLFA 1EH5A 2OCIA 4ARBA 1MU0A 4MWTA 2RIPA 4XIIA 3QH4A 4C88A 4MQMA 5FUMA 1BN6A 5AIBA 3OURA 4MYSA 2CMFA 1MN6A 4NS4A 1JU4A 2R11A 1QIIA 3WIOA 2V97A 4H7DA 2XB6A 3ESCA 2YASA 3HABA 4M0EA 4J0CA 1LPSA 2VSQA 5CXUA 1CUXA 2DFPA 1DX4A 4Q34A 5EHNA 2VAXA 3L1JA 1PFQA 1SC9A 1FFEA 2XMQA 1VLQA 2VJAA 2Z3ZA 4KRYA 3WJ1A 1E8MA 1N5MA 2PSHA 1MT3A 3HLKA 4XX1A 4H7EA 4X97A 1WHSA 4J03A 1AQLA 4OYLA 1UXOA 4PW0A 1DX6A 1EVEA 3WQHA 3CN9A 1FFAA 4LYEA 4DMCA 3GROA 4E46A 3E0XA 1U65A 2WJ4A 4A23A 1MTZA 4QLOA 4TVKA 3ESDA 1O6FA 4QDZA 3C45A 1QIEA 2YYSA 2XMRA 5CT6A 5HKAA 4GXNA 2O7VA 5EIEA 4EBBA 3A2NA 4D9JA 4DM7A 3FYTA 3FYUA 5A7FA 4X6XA 3C6BA 1VXOA 5CW2A 4EUSA 3D3NA 4KEAA 3R3XA 3WYNA 4G9GA 5LKRA 5D3KA 1DQZA 4X00A 6YASA 1UKCA 3O95A 1AUOA 3PICA 1H2YA 5ALLA 4UHHA 5CT4A 3AJAA 1AGYA 4HS9A 1QTRA 3CN7A 3G0BA 4FOLA 3VJMA 1WM1A 4UBNA 3C5VA 4FBLA 2QUBA 3HSSA 3ZV7A 3PE6A 2XMCA 1CUSA 2VEOA 3C70A 3HJUA 2VQ6A 3QM1A 3EQ9A 2PSFA 3VXKA 3PUHA 1YCDA 4N8EA 5FOQA 1UWCA 3STTA 5T4BA 1L7RA 5AM0A 4ZREA 2WQZA 1XQYA 1EK1A 3SWWA 4BRSA 3PFCA 4G5XA 1H22A 4ITVA 3IULA 4UBLA 3PI6A 4IO0A 4BRZA 4J0KA 2FX5A 5DTJA 4QEKA 4KACA 1XZBA 4G4GA 4GECA 4UBOA 2BAGA 4A16A 1ORVA 3IUMA 5AOAA 1ZD4A 4EB0A 3WL7A 4J0IA 2JGKA 5T4HA 1ZGCA 4W9RA 4LHEA 4IH1A 4H7KA 4AX4A 4EZIA 1K8QA 2Y2VA 1TCCA 1F0PA 3VKFA 1EDDA 3I1YA 3W2TA 3I2IA 3I2JA 4H18A 5LZ2A 2ACKA 1CUJA 1R50A 2WG2A 4HAIA 1AZWA 5K3CA 4I19A 3IUQA 5K3FA 4AZ0A 1M33A 5CH8A 3A6ZA 4WY8A 5ALGA 4HZGA 2HRRA 1MX1A 5AKZA 3UUEA 2XUOA 2QM0A 2PU5A 1QFSA 4H0CA 5HQ3B 2PVSA 3WZMA 2W22A 3H2KA 5C8XA 5CH3A 5K3AA 5EHZA 5JASA 4NMWA 5JZSA 5BV7A 5DYTA 5JATA 3V1LA 5JIBA 3WA6A 4C87A 4X92A 2DR0A 3TGLA 3H17A 3I2FA 1BRTA 5ALIA 1FFCA 2HL6A 4C4XA 1UOPA 2X8BA 2GZRA 3G9XA 1QOZA 5CH5A 1KEZA 4C6HA 5EGNA 3ZWQA 1GGVA 4J0HA 1O6GA 3AINA 4FWBA 3FSGD 1F6WA 5AKHA 1U2EA 1JFRA 2JGMA 5CBKA 2QTBA 3BL8A 1QLWA 2WHPA 3AILA 5A7GA 5ALZA 3DKRA 4X71A 5CXXA 3I28A 2HM7A 3OC0A 1YAJA 4ZWNA 1XZHA 4RGYA 2PX6A 3A2MA 3MGAA 1ZI8A 3GFFA 4TGLA 2QJRA 1UK8A 4AB1A 4Y2SA 4RE5A 3WKEA 3Q8WA 3N0TA 2C58A 5A7HA 2FJPA 4ETWA 2JGLA 3FYUB 2XUQA 5BWCA 5AI5A 3WK9A 2HIHA 1XZGA 1CIJA 2XQFA 1T2NA 1XZDA 5AKEA 3WWPA 4B84A 1Y7IA 5FLKA 3R3UA 1EB9A 4H7IA 3X3HA 1VA4A 5T4EA 3WWCA 3ESAA 1ACLA 4EY5A 3B5EA 3EQ8A 2J4CA 4IH4A 4JYMA 5LZ5A 4KAJA 2G63A 3FLEA 3ICWA 4KYVA 3V1MA 3W04A 3M3DA 5AM5A 2G4LA 3C6XA 1XRNA 3MVEA 3O0DA 5BWBA 2HA4A 3MUOA 2WIGA 1B41A 5FPQA 3R3WA 3ZLVA 4B80A 2WIKA 3C6ZA 1DWQA 4BVLA 5AKGA 2Z8ZA 3FYUC 4YX9A 3LS2A 3WKBA 3H2GA 1WOMA 3NWOA 3FOBA 5FPPA 5CT8A 5ALNA 2WFLA 4LXGA 1BCRA 2Y6VA 4B7ZA 5J3JA 4G4IA 2H7CA 5CT5A 2X76A 1CUAA 5IVKA 5HF8A 2ZYHA 1MX9A 1GXSA 1PV1A 4AXBA 1E8NA 1K5PA 1A8SA 5K3EA 2RHTA 4U2GA 2WIFA 1Z68A 2XMZA 1P0MA 1Q84A 1PJAA 3RK4A 2XLCA 3DKKA 5AK6A 4M0FA 5AM4A 1WPXA 3HYSA 3DDUA 2BJHA 1BN7A 2XDWA 3I6MA 2QR5A 3WI7A 2I78A 3R3YA 2JF0A 1GT6A 5ALPA 5JANA 1EINA 1GPKA 5JAOA 4BE9A 4GHWA 1Y37A 1CUUA 4PSCA 5AM2A 4Q82A 5IVHA 2XQKA 2QXUA 1LGYA 3KDAA 3FBWA 2XUIA 5CT9A 1QGED 4Q05A 3AUKA 1G4HA 1SCIA 1YSCA 4UBKA 3FWHA 4BCCA 4GWLA 4P92A 3WJ2A 4Y2JA 5JZBA 3V9AA 1S8OA 5EHQA 1CUWA 4BZZA 3BJMA 1H2XA 4MWSA
chains in the Genus database with same CATH superfamily
1MTOA 4AQDA 2NTJA 4C05A 4WERA 2X0FA 1L7QA 1WG8A 2XYPA 3A2LA 1AIPA 4R2XA 2V1UA 1C14A 5CDUA 1ISHA 3RYCA 3FZGA 3WLFA 4R8SA 2QT9A 3DMFA 1EHYA 1ZIYA 1VLHA 2AT1A 2V1XA 3MWKA 3OU7A 4O4LA 3KX2A 4ER3A 5H0IA 1X0VA 3V2UA 4QGAA 3TZBA 5KWSA 1GGNA 2IV3A 4KAFA 5JT1A 3OTQA 1QQTA 5JNSA 2RAVA 3F71A 4YJDA 3WRYA 2HSJA 1C81A 1FTSA 4OM8A 3QKSB 2JL1A 4UHFA 2NO5A 5HG0A 4QKQA 2BEUA 4KX5A 5KEIA 2C00A 1E3TA 2WKSA 4QOIA 3JARA 1XPOA 3ZVKA 1W4CA 5U9CA 3SZUA 2DQSA 2VQFB 5DI3B 1P7WA 2PM8A 1UT6A 2IU4A 2KBFA 5JYCA 4P22A 3ZE8A 1M34E 4MQEA 4N82A 4YIHA 1TM2A 3EMKA 4Q1BA 4PAWA 1AN9A 4J0QA 3ZE9A 4D4GA 2ZWAA 4EH1A 3O6VA 2NSJA 4HNQA 2RK3A 2V0CA 4FLFA 5INTA 4IJ6A 3CIOA 3ZK8A 1JPVA 4B40A 3HZOA 3HUTA 2CKMA 1KIMA 4OXRA 2W70A 3B3FA 1XRPA 1T10A 4W7SA 3FKSD 2O8NA 2GJSA 2JIDA 3HBMA 2CB0A 4WCVA 2PKRA 2MMGA 1P77A 2VPQA 2BR4A 2IE8A 3K2IA 3VDMA 5IHXA 2HWKA 5C7LO 3RQIA 3C1AA 3EAGA 1FUUA 5F4BA 4ID3A 3SI7A 4E6PA 2BKAA 1N6IA 2Q0HA 1CWUA 4FHFA 5JTUA 1Y1SA 1MH9A 1FMLA 1JG2A 2AK3A 3IUEA 4IDNA 4G1CA 1XU4A 2Q2QA 1GPNA 4ODIA 1Z06A 5ALFA 5AWFC 3T7IA 2VDOB 4IDCA 4EVRA 2QG4A 3M1AA 4DSUA 2NP6A 1R8QA 4AKTA 4C78A 2DQYA 1VBNA 2G3YA 5GOZA 1UKVY 2SICE 3TLCA 2G5CA 2QMQA 5KREA 1PYGA 1XEWY 2ECKA 1X42A 1ZGZA 2O1XA 1OILA 2H1CA 3N0WA 3FHCB 1K3TA 3JALB 3UKJA 5EHXA 3EBPA 4PTZA 2I0FA 4INPA 4DLBA 3GT4A 4O5AA 5DHRA 4ZXPA 4D44A 3H0EA 2GARA 1YJBA 2VK1A 3NM4A 3CLSC 5LA6F 2PMEA 3U62A 3IELA 3PDIA 3DZBA 2WUVA 2ENWA 4OGLA 2QTGA 3T5DA 4WLNA 3WISA 5CDFA 1DFHA 4ZALA 1NUAA 1XTBA 4RM2A 1J1IA 1XL1A 3HU5A 3ZCQA 2FZKA 3TSOA 3WX0A 3HXMA 4RFSA 3U1BA 5IKXA 4CEIA 1FBTA 3ITEA 4MK4A 4WKPA 5E7JA 2PNJA 1IXYA 1LFDB 3TBFA 3QX3A 3NHUA 4EPRA 1V6AA 1ZG3A 3RRMA 3P96A 3R20A 3NVMB 4RF5A 4MHTA 1QF6A 1ZIPA 4TXLA 4EY7A 1JYEA 1CRQA 5DHSA 2NU7A 1JHZA 1CR6A 1H1LB 2Y1LA 2BEJA 3A3OA 1OCEA 4LTDA 4QAJA 4E5SA 5EJ5A 4CEHA 4EUKA 1TQ4A 2GKOA 1ML3A 3AVQA 1ZKDA 4YP9A 2BEWB 1BQ3A 3BB1A 5FYQA 1WABA 4BKMA 1OC4A 2WFZA 1M10A 1FFGA 1TYBE 1HA3A 2Z9CA 4FSDA 1ISFA 4ZEXA 2MYPA 3V7FA 2AX3A 9LDTA 1B1CA 3DYVA 1NTRA 1F2VA 1P2VA 3AM4A 3LHDA 2FP3A 2P6PA 2WJWA 4FIDA 4TLEA 3C6QA 1E1YA 3KEFA 5AVVA 3FZEA 4US2R 2ZTVA 3ES9A 3LK7A 4MLPA 1NBME 1IPFA 3RVQA 1N2OA 2IEBA 1UFRA 3E0QA 4B3GA 1S4MA 3LT5A 3LUFA 1LI5A 2WFMA 3B8HA 3GF4A 1G4AE 3TMYA 4A3SA 5KVVA 1NBAA 1Z26A 3OZAA 4GWKA 5K0LA 3PLNA 1WZUA 1C0EA 4DTCA 4LK2A 2O2IA 1PZEA 3H4VA 2R1TB 3VH1A 4A73A 3U6KA 2DHDA 1L5SA 2X0RA 3C6MA 3DGFC 2LP4Y 3DHNA 5GZ1A 1ZM4A 5JS6A 2Y1OA 5GZ3A 2VO1A 2WKQA 1F0KA 4Q01A 1N5RA 2V4MA 2AOVA 3FHJA 3NO4A 5A6SB 2P3LA 3QIVA 5AQ1A 1ZGGA 4TTQA 1C3LA 4B35A 3TMAA 4EG3A 5BSUA 3TR6A 4MUYA 2FP4A 3LVFO 2HAEA 3SEFA 4Q1FA 3E23A 2IYUA 2CDCA 4RZUA 1LBSA 2F9LA 5IUJC 3LPLA 4KQ2A 3ELWA 2GZDA 3NPMA 4AY3A 4M55A 1AS2A 1MKYA 5FPKA 3RAFC 1TTTA 1GDDA 4O3MA 4ME6A 4DV4B 1T5SA 3C14C 2YOHA 3H1TA 2ZQYA 1L7DA 1A96A 1T5TA 2NYAA 3GRVA 3KJGA 4ROTA 4ZOEA 1UXIA 2IU6A 4I1OA 4TT3A 1R9JA 3TW8A 3KETA 1NMQA 1HURA 3IVAA 3K3PA 4RHTA 4FOPA 1R9GA 2ZWMA 5BOVA 5E0OA 3AP1A 3DMGA 3QE3A 4GXQA 2I91A 5AKXA 1I5OA 1R6DA 4B81A 2OCKA 5H02A 5C51B 1NX6A 1XDGA 3QLVC 4FEAA 3T6KA 3R3SA 4YUWA 5LQJA 1SQ0A 3QZUA 2MHCA 2VJDA 2HGZA 4ICIA 2O4CA 2VK8A 3O75A 5KZMB 3GO4A 4YR9A 4F8JA 2OYSA 2YJ5A 3FI0A 4GFDA 1XV5A 3PZRA 1CF9A 2TRSB 1WD5A 4FFBB 4LPKA 4LXIA 4CL3A 1ZJYA 2BFPA 2ZAIA 3MPOA 1GUDA 4IGAA 1CY0A 1C3OB 2EVWX 4FFNA 2QTNA 2C42A 3C8ZA 4KE6A 4IICA 1O97C 3FLBA 3ZCSA 4DTIA 3OJEA 2W0MA 3UICA 3GMSA 4I9FA 1YU9A 2BP7A 3U44B 1PLJA 4QQ8A 4J0DA 4Q03A 5GOTA 2BEKA 1BS1A 2QN9A 1TAHA 3SJAA 2CLKB 4TWBA 1U1EA 1QG2A 4OOEA 1CC1S 1VQ1A 1AKTA 1L7EA 4MTCA 3F98A 4MITA 4LJ6A 3RG8A 4WVFA 5EE9A 2AFVA 3E2IA 1AQIA 2QRLA 2OVFA 4PO1A 1SVSA 2I7XA 3RIHA 4PFSA 3V4LA 2UYYA 2X41A 4WN3A 2H57A 1GQYA 2DWPA 2PJUA 1A0OA 2R5WA 2ZREA 3IVCA 4KQEA 2WMOB 4A8TA 3UCEA 2BTEA 4L02A 3SX0A 1Y1TA 4R2MA 4D4LA 3KU4A 3RWMB 1JJ7A 3WHKA 1HNZB 3Q7IA 3VM6A 3HWWA 3G1UA 4LC0A 4JL5A 5DYWA 4P1ZA 4PZ9A 1RPNA 3O93A 5CVEA 3EF1A 1ICIA 5JEDA 2CNWA 2CJWA 3L93A 4I3GA 3KFXA 3CR3C 4DEVA 1WHTB 3KT3A 3GA0A 4BO2A 4RMJA 2WHRA 4BTVA 3U80A 1P9NA 4A7PA 4KTVE 3E4DA 3K1AA 1XNQB 2NU6A 3BZWA 4LQ4A 1QIDA 2BKLA 2PO5A 4PPQA 1IB6A 1VKRA 4LDAA 3VYUB 5D87A 4YY3B 3VR6D 2DEUA 3IMCA 1RXYA 3VSBA 4G8CA 1E2LA 5HOEA 2E6UX 1Z5WA 2OGUA 1DG9A 4ZVNA 3OTIA 3R3ZA 4REQB 3P71T 3QKWA 2GO1A 3T1HB 1R1DA 1I13A 1QHHA 4OMFG 1U0RA 5LLSA 1G17A 1K6JA 3UQZA 4ALLA 3IVGA 1GPAA 3ZWPA 2VJNA 4N0MA 1T9HA 1DG3A 4JLWA 1Z4MA 2QRGA 4EI7A 4F7WA 4KAXA 1Z22A 4H1HA 3ZKWA 1CRWG 3UAXA 2PG3A 3LUJA 4ENVA 5IJWA 1K66A 4ZCTA 4YDRA 4I4NA 4FR0A 5K3DA 2VDPB 3B1JA 3O2SB 2HCBA 3GGCA 4P93A 2P11A 1C0PA 4CF6A 2PH5A 4WFIA 5AXAA 1QE5A 2IH4A 4AK9A 3NHAA 4DMFA 2WTUA 4OUKX 4KAAA 2ZJ4A 3QPBA 4KG7A 5B7GA 3NHYA 1FVXA 1QIMA 4B5KA 1DC7A 3W77A 3G49A 2CF6A 5CB4A 5JYBA 1LBEA 3UAVA 4QBHA 1UJNA 4FKMA 4FXOA 3VC3A 4EZBA 2WA2A 1ATZA 3FPAA 2XECA 4RYDA 3ESXA 3P26A 4TZKA 1G98A 1FP4A 4NOLA 3H2JA 4CWAA 1HZZC 4G2TA 5AXDA 3MT0A 5IT5A 1D04A 3M9LA 1AK2A 1SUEA 5CM9C 4UC0A 4YASA 4AYXA 3G0GA 4J7AA 1GGKA 4UAJA 1SU6A 3VVBA 2DKNA 3UGTA 2IXTA 1DUIA 2YJGA 1EDBA 3DL0A 1IB0A 3O8QB 4UVGA 4CLXA 1KFKB 4ARZB 3HPRA 2HBYA 1MOQA 1Q1NA 2G07A 3EIEA 5E2IA 4EYEA 1OX4B 1P0IA 2WILA 3ASVA 3P9NA 1T2EA 4X3OA 4KKVA 4FC6A 1D6SA 1NMYA 4IKEA 4XYLA 3W5IA 3MT7A 2QGNA 3HYNA 2XUHA 2GFQA 1YDMA 3LW7A 4I50B 4Z9BA 1VKHA 1U9YA 3QFHA 3ST7A 4X41A 3BMOA 3DQZA 4GT1A 4MB0A 1KAHA 3HKDB 1KVTA 1FOEB 1M72A 3A9SA 4WLOA 4DSZA 4R05A 5BWOA 1A27A 2CLFB 1FVHA 3KZKA 3TFQA 5I3CA 4BGUA 1W47A 4WACA 4FTWA 3V8QA 1HH4A 1T1IA 3QP9A 4XFJA 4CFZA 3P9QA 4NYMR 4M8SA 4P84A 3VSAA 5FBRB 4ID9A 4QBGB 5I7VA 4J1TA 1F2TA 4WSOA 4ZZ3A 2PGXA 4F2GA 2IYXA 2MR6A 3LSYA 1CR0A 1UAAA 2QTCA 3W4IA 1BIFA 1AGXA 5IKEA 1NVVQ 2VHTA 4R2IA 3PX7A 4ZTBA 4U63A 1QBKC 1OKKA 2Y0BA 1V2GA 4RLQA 3QJ5A 2MIIA 5D2CA 1WL8A 1VCOA 2WQ6A 4PGFA 5MHTA 1E6KA 4WXRA 4NCXA 4S1TA 3O4JA 2ANBA 4B3MB 1TQ8A 5ALSA 4I2VA 5JAUA 1WB9A 3OI7A 3R0JA 1PQ4A 2KLBA 1TZCA 3OLXA 4UTVA 4HLNA 1LK5A 3HBFA 3IAAA 2VJKA 4QDOA 1TF2A 3KSZO 1DKMA 3WLAA 3NBZC 5A4MS 1DBWA 1U3DA 1Q15A 1R00A 4IZ6A 2NQ2C 1LQTA 2ROQA 5K0ZA 2BUCA 1NW3A 3AUYA 3GFSA 4PFJA 5AI9A 4CXMA 3SAJA 4CLRA 4XUGB 4J4HA 3KUDA 4YV2A 5SY6A 4C06A 3SHQA 4P4TA 3FPGA 3HNRA 4I6JA 4QNNA 4ER6A 1NNSA 5LBUA 5BQXA 3I2GA 4GD3Q 2JKZA 5BV2P 1YA8A 2YJ6A 3K94A 1EFPA 2J3QA 2UUPA 3GK3A 1ZK1A 3S4YA 2NTYC 3O31A 3TLZA 1KAQA 3IV9A 5E0KB 1NVBA 4UTXA 3NUZA 4BECA 3DJYA 5LWQA 1N6LA 4Z8XA 3GCGA 4B8WA 2V7XA 4YRLA 1D7OA 4L72A 4KPEC 4LAFA 3AJ8A 1ZVVA 4DIOA 2RGYA 4H4DA 3UQYS 1GUBA 2WWIA 3M2PA 3Q98A 5HE9A 1VZ2A 4DUGA 5K99A 1A4IA 1YZTA 3X2FA 1IN5A 5I9NA 2F48A 5LCXA 2X8JA 3GJ6A 1GV1A 1W88A 4B6JA 4RA9A 5K3SA 3T3DA 2O2GA 4RQBA 5JCOA 4WMLA 1U3GA 3E3AA 2HY7A 3CBQA 4FDLA 5FEUA 1VCNA 3E7DA 4UEOA 1LNSA 3VJKA 3B48A 3K09A 4QFDA 5AVYA 1A5AB 2FV8A 1YZQA 1QV9A 3CHYA 3GZTB 1JDNA 1TECE 3KKOA 4Q4AA 2RONA 1VSBA 2I3BA 4PLFA 1WXWA 2W7TA 3G8YA 5IVDA 4K9KA 3RV3A 3V34A 3ZHQA 3B6JA 4Q1DA 4BNLA 1YVPA 1WX1A 1Y4DE 3DKIA 1QH0A 3ADOA 1KRHA 4Z0TA 1FJ2A 5GAJA 3UKOA 2Y0DA 1Z15A 3LWBA 2V03A 3ODPA 4L74A 4UDXX 1TX4B 4F5WA 5BXYA 4NG4A 2A35A 1HTBA 4PRKA 3PUYA 4TSRA 3V1KA 2FWBA 3QUSA 5LSAA 2P9GA 1PNQA 3U4QA 2AQIA 4K6FA 2BGIA 2JLYA 2AJBA 3SQDA 4WFKA 1PS9A 3ZXSA 4CCYA 3HXKA 1ZSNA 4FJ1A 5HF9A 5F3RA 4LDJA 4PBSA 2ZB2A 1IXKA 1RCFA 1SUIA 4XUDA 5J4KA 1W46A 2B7LA 1ZJ4A 1NJFA 2PTHA 4DV7B 1LK7A 1SVIA 2Q6IA 5GGXA 1NVKA 1QOPB 2M6RA 2AG6A 1IM5A 2JHPA 1M1YA 2VNSA 4KB5A 5EXEA 5I4KA 2O8FB 4HKTA 2RBKA 1PWYE 4FHZA 1OI3A 2YNMA 4BQPA 1GKUB 4C0LA 2VYVD 1CR1A 3EMVA 4LVNA 1NPYA 1X80B 3BIXA 1SEVA 3QVUA 4KQGA 4ZVKA 4XYGA 4EM6A 2FWMX 4Q9KA 1S02A 3K0CC 4URZR 1Z47A 3MTQA 1CY8A 4PS0A 5HZMA 3D8BA 1TZBA 1S3SA 1LLDA 3HV2A 4OAQA 2QTFA 4HDKA 2Q45A 1H3NA 2IELA 3P0FA 1COWA 2W8ZA 3RBVA 4MDFA 2WDZA 2FPOA 1KDPA 3WGZA 2XVYA 2HW8A 1V8BA 2H1HA 3KQPA 1LC0A 3VU9A 1CFZA 1SCBA 2R7KA 2ZTUA 3O4IA 1WP9A 2O4UX 2YWCA 4PC3A 1UBKS 3FH0A 3S5UA 3RS2A 1PK9A 1C1DA 4CU2A 3B6ZA 3R5HA 5KYKA 4QECA 1YAHA 1B14A 3FYCA 4PZUA 1AUXA 2GRUA 4U9UA 1ZAKA 4AY2A 1CEEA 2B3DA 3USES 4YT8A 1NR1A 3DBIA 2Y9PB 2A84A 3SZ3A 4KTTE 2IP4A 1GNTA 3DEKA 1LF0A 4YS6A 4JI4B 1T3SA 4HPJB 3RIYA 3TECE 4TMXA 4F5ZA 3U7HB 2ZYSA 1HSOA 1WW2A 3K0HA 5J5AA 4K26A 4XD2A 2GERA 1E7YA 1L7AA 2JFNA 3DB1A 4NXNB 2L18A 3GN2A 4UUPA 2O52A 2HA5A 3FIJA 4ZCPA 5ALUA 3K9HA 4LNUB 2OWEA 4IG9A 1SD1A 4LXXA 4R84A 4U5QA 3UM9A 4NV3A 2Q41A 1G9SA 3EJWA 5JAZA 4AO8A 1IQRA 1J25A 8MHTA 3NWJA 1XJ5A 1Y34E 5F2EA 4MUJA 2XPCA 1KKMA 1L5WA 3RAJA 4GQIA 1XTTA 4KH1A 3PGXA 3QVKA 2I3ZA 3GLHA 4FI3F 3V9PA 2VRCD 1HGXA 2ILTA 3KR9A 2C5BA 3OPYA 4OKSA 3S2ZA 4AMUA 4BX3A 1G6OA 1U2DA 4B6GA 2ZAGA 2G09A 3FAZA 4D99A 2R00A 3GLHE 1QWSA 1JG1A 1D5WA 1J2YA 1U2QA 2EHJA 4I1SA 2J31A 2XKBA 3G8CA 3LYAA 3MWEB 2RFLA 3NNDA 4YCDA 5TEVA 4BEJA 4C3VA 4UHKA 2RHBA 1U1DA 4ZAYA 1JV2B 4YLGA 2QUIA 3I9JA 2A7QA 3K72B 4DABA 1RXVA 3C3WA 4EELA 5JWRA 2NVWA 1CRPA 1VSTA 1IK4A 2BMJA 3OMXA 2A9QA 1ODKA 2KQUA 2PLAA 1Q0HA 2QD4A 2OAQ1 1RFLA 4O3FA 4QX6A 3IMEA 5B58T 3EVGA 1IOLA 2DUWA 2EJTA 2JAQA 1W2GA 5U4QA 4AZSA 2CVZA 1L7VC 1CXZA 3L5KA 1BOFA 4DSAA 3HZZA 3BYZA 4RESA 4V0QA 1ZGBA 3QPVA 3NHBA 2RHDA 1T1JA 1KC3A 1FFHA 1NKTA 4IR7A 4YH1A 4ALJA 4KI0A 2JFHA 3QOYA 4WY5A 2J0SA 2RARA 3LBAA 1VKJA 3HA2A 2L69A 3E2PA 3C1TA 3K35A 3RADC 1VG8A 4B3XA 4Y6LA 2VNKA 3K9BA 2R48A 2A86A 4N3GA 1W5AA 3VR1A 4F8YA 1HNXB 1W5EA 4LMPA 1RVV1 3W5UA 3LOQA 4YO8A 4O4IA 1RVDA 3BHMA 5AJWA 4G0UA 3IXLA 3NLLA 2CEKA 1P9OA 2VTEA 2DSNA 3RRZA 4I5GA 4AUNA 1MB0A 3DV0B 1IATA 2PRKA 1UJ2A 2V7TA 2EARA 1H4SA 1TM5E 2EFGA 4BO5A 5DWVA 3W5BA 2VWPA 4POAA 2O2DA 2WJVA 5LD2B 1ZN7A 2ZUUA 5JV5A 1QVVA 3HU3A 2P3OA 2GXUA 2C2GA 1G6KA 3EGIA 4KO8A 4PRYA 7YASA 4PWYA 3GR6A 3EEBA 2AXQA 3PR1A 4PR0A 1JI3A 2CMHA 4GICA 1DEHA 3GQVA 4Z99A 2QS9A 3RTBA 3W9UA 4Z53A 1FSSA 2DJ5A 3JQEA 2WR8A 4N40A 5HTKA 2VLIA 4N41A 2UV8A 3IRUA 3L6EA 4GNRA 1TYEB 4BKQA 5AW2A 1HK7A 4DV2B 1K8RA 2W2NA 1JBKA 3N6XA 3SDBA 4PYIA 4RPCA 3DZDA 3WKCA 1B6TA 1YKFA 4E11A 5L7TA 4MV7A 2IPXA 4NBRA 3URMA 3FKQA 4EARA 1BKSB 1TJ3A 2EERA 2RHMA 3GJ5A 3IR5A 2GNPA 5LXTF 2AOUA 4F45A 1JMVA 5LBIA 1R0BA 5F3DA 3L9WA 1C29B 1P7ZA 2OCLA 3OM8A 3R74A 1OH8A 2OHHA 3SQXA 1TB4A 3ORRA 4QYSA 1KEKA 2J6HA 4IY1A 1ZJ5A 5L45A 4BFUA 4AF8A 1HDIA 2JCXA 4L8WB 1Z6XA 4AS1A 4DM3A 4ENWA 4AU1A 1GCGA 1ISMA 2WC1A 4O08A 2D5IA 4P8RA 4Y67A 1KO1A 3VDXA 3WVNA 4BO7A 4D1YA 3B20A 5GQSA 3CH5A 1OZGA 1FXUA 1RKXA 4A4DA 5LXTB 1A4UA 5DSTA 4C29A 1XYYA 2B1GA 3IMKA 3IPYA 4G8DA 1B43A 5MF6A 3KKMA 4N3BA 1AK9A 1Q14A 5G53C 1IBKB 4BBPA 4YP5A 5IM4F 4G1VA 1A9RA 5HJEA 4EDFA 1O4WA 1NUUA 2FEWB 3AW8A 4CEJB 2AJLI 3MJVA 2BDUA 1R5OA 2B1IA 5M2QA 4K0RA 4NX2A 4M7WA 1D09A 4ZRNA 3SKVA 2BFNA 2XNHA 4N54A 1YQWA 1ELOA 1TYZA 1WD7A 3CEMA 3GJZA 1PFKA 4XKJA 4BU1A 5C18A 5J2TF 4D43A 3R77A 2QN7A 4JMLA 4HAYA 4BGEA 4BGVA 5KSYA 4M83A 2P4QA 2BUAA 4L07A 5CEEA 3OZRA 4MUAA 4LE2A 3NKFA 5JJIA 1YQEA 2W6ID 4UM9D 2Q9BA 1MV8A 3QY9A 4PBRA 3IFSA 1W2WB 4HDNA 1FJGB 2VJOA 4FBGA 5HSGA 2WKWA 4HB0A 2XOKA 2JW5A 5FUYA 5EP3A 3EG9B 2OGZA 2VHZA 4DDHA 3VDNB 1YL6A 3VA7A 2CXNA 5DXAA 3U4GA 1P0QA 1TCBA 1UM9B 1Z0IA 2AKAB 2C59A 5D7NA 4PG6A 3W4JA 1V4VA 4XYEA 2I6UA 1JA0A 3JD0A 1HFWA 3EMDA 3MBOA 1ILEA 2HQBA 3NOXA 3A4LA 4YK7A 2GVZC 5JISA 1RYDA 3TZQA 4J1QA 3TSAA 2QN3A 3WADA 4QRHA 2YHIB 3GDFA 4N6OA 1U63A 3AU9A 2IYPA 2JZCA 4G0XA 4HLDA 4OEHA 4PCAA 5LR6A 4BO1A 1RAGA 3TW0A 1JFFB 2ALJA 2J67A 2JFUA 3AR2A 3ILXA 4MHSA 2A0KA 4E22A 5JFOA 5JAHA 3T3IA 1E1RA 1NFQA 1UIMA 3KZCA 4ZRDA 3SHFA 2VNIA 4NDAA 4XGRA 1OFUA 5LQUA 4CKBB 1W7AA 3QW2A 1QV7A 1M2OB 4Q00A 3HC7A 1NSFA 3R1IA 6ADHA 3JYPA 3M1LA 2NO1A 4NY1A 4R1LA 1XYVA 2PH1A 3K71B 4FN5A 1EI9A 1MEJA 4JLKA 4AMBA 3DV9A 3LE8A 1UAYA 3N39C 2R0QC 1GG2A 3TR5A 1UEIA 4F6CA 1GR1A 3RLFA 2HD4A 4E1BA 2X5KO 4LZWA 3R0QA 1YK1A 3OT5A 3A1WA 4C3UA 3K73O 3ROQA 1Z5PA 3B1VA 4L3VA 5CFPA 5BR4A 3A9UA 1SHKA 2BCJQ 3PHIA 1O6CA 1P4GA 3D7LA 3SC3A 2RKWA 5G3YA 1XLWA 2WOOA 2Q7DA 3ZGXA 4KZPA 3O4FA 1NN1A 3L77A 3WLOA 2DZDA 2I8AA 2WF6A 1SK9A 3H5VA 4X5OA 3WK7A 4AQ7A 4B3SB 2ZRPA 1Z73A 1M6WA 1ZEJA 1LZLA 1LSOA 2X40A 3JQRA 3LXMA 4BVGA 5FLEX 3TAUA 4HEA1 5HWSA 3DBOB 2UYOA 4D56A 5C8VA 1P8JA 2PVPA 1J22A 1NPTO 4L0QA 3T9EA 4D3YA 1WB5A 2OORC 5LOVA 3OFVA 1YCFA 2B8WA 1N2SA 4MQ6A 5CCBA 1JDPA 2NT3A 3Q7EA 1ZNXA 2WWXA 3EPLA 2CHFA 1BMQA 1L4UA 3CW2A 4O25A 2C4MA 2FX2A 3EVEA 3CG4A 3UMFA 2BM0A 1GP2A 3MRXA 1E1LA 2PXXA 2UUCB 1KSHA 1EBUA 4I9HA 3IOEA 5IK2D 2WJYA 2H4FA 2GI4A 3L84A 2PPLA 1ZW1A 1H4QA 4FDVA 1YIDA 4WN9B 4PZLA 3ZE7A 4P81A 4TXJA 4F06A 2D2XA 4KITB 2VWHA 1GZSA 3WBJA 5ADWA 3ECAA 4MQUA 4F5EA 4TX1A 5EZ6B 1JR2A 4PO3X 2JA1A 3OTGA 4JP5A 3OHPA 3LO5A 1XMJA 2NUPA 3Q8KA 3GJ4A 3QHPA 1ID1A 3CNEA 4NCKA 4EOGA 5CW1A 1JIJA 3REQA 3WL8A 1BE0A 3JRNA 1G8JA 5DX8A 5KOHA 4D02A 2GWRA 4GPEA 4JC0A 2ZUFA 3Q3HA 2W37A 3ZWKA 2YJZA 4CM3A 2QE6A 3HVIA 4WBSA 3E8MA 4ROSA 3OH8A 4GYYA 3EOZA 3BGWA 4X20A 1QYVA 4WCFA 2XODA 3B9BA 3DT6A 4JFAA 4L2IB 1G8PA 5CA1F 1S3GA 4UXHA 4ARAA 2P9JA 4GYKA 3I62A 4BB9A 1Y98A 3IH5A 3JRXA 3AK4A 5BQPA 1ESCA 3X2SA 4HX9A 3ZZUA 4Z4GA 1BROA 3RNOA 4JUFA 2FJ0A 1EGMB 3E1GA 1N1GA 3I32A 4IVPA 4QUBA 2HDWA 2KE5A 3CTMA 2O3SA 5H82A 1AQJA 4DQLA 1FUIA 1NVGA 4NBVA 1Q6ZA 4YCNA 4IIUA 3B82A 1LH0A 1SVNA 2KJQA 3UT5A 1C5KA 3B78A 4ZVQA 2XBMA 3T3OA 2XRMA 2XOXA 4HYTA 4QDTA 4G41A 1V45E 1Y3FE 1E9DA 3C8DA 1KI3A 1BJKA 3AQIA 2YW2A 2GILA 4O4JB 1C8LA 4OJQA 1ZH8A 3EXG2 4BNUA 1GU7A 1PT7A 4KLZA 5L6MB 4X7PA 3SC6A 1N4DA 2YIJA 1YS6A 1A98A 2YV5A 1DS6A 1LNZA 3AB7A 4GI1A 4LRUA 4ZQGA 5AVJA 1E2EA 2OCXA 4KGVA 2O2EA 3RLIA 2AFIE 4JCCA 5JADA 4ZXFA 5AW9A 3N70A 2IPOA 1XNJA 3RJZA 1P5FA 3M83A 3A31A 5BYKA 4TYQA 3ZUPA 3D3KA 1NBOA 2EF1A 3R4CA 1Z7EA 4JXJA 2Y1XA 5H9WA 5IFKA 3LBHA 2FR1A 3ILSA 3LTEA 5JJBA 1WIWA 1I6MA 3VNVA 2A3NA 2HCRA 3H5WA 1XQWA 2VA9A 5IH7A 1BDJA 5ALVA 4YT4A 1MENA 3FTCA 2VH1A 2X3YA 1BH2A 2H1WA 2YXLA 4IQ4A 4KPUB 2AHRA 4RK0A 4IMIB 1XZKA 1C3VA 3OT1A 4X44A 3UXMA 4RF4A 1ISPA 1J2RA 4PY2A 3RVJA 4A0HA 3KIPA 3EQ7A 1FFDA 2FSVA 2ZWIA 3KLMX 3OF3A 2QW1A 3W2FA 1Z7BA 5IAKA 5HW0A 4CM5A 1MIOA 1XKLA 3B12A 5JAQA 5C4GB 2HJWA 3GH3A 2EFCB 3AR7A 3DPSA 5LP6F 1B8NA 2RIRA 2XT0A 3C97A 3EGCA 5C1BA 3BTSA 4ILKA 3G2LA 4WNYA 1K5DA 4DDWA 3AZOA 3WL6A 2A78A 5A3VA 1QP0A 3TI7A 3BF7A 3IP7A 2WG1A 1XRMA 4BCDA 5BOSA 3HRHA 4RIGA 2JHGA 1V3QE 2WRZA 3MTAA 4U2FA 1G38A 2F7SA 4IWXA 3COSA 1PR1A 1NL3A 1G0NA 4KQCA 1TD9A 1E1QA 3C6YA 3T4EA 4DV1B 4GUAA 1PG0A 3F0TA 1JZQA 4K7JA 1FX0A 2WF9A 1PWZA 1CJUC 3QQ5A 2A9OA 2ZVQX 2VH2A 3SF0A 1AA6A 2AQKA 2WAYA 3QNUA 3H42B 3GLVA 4UREA 1IHDA 3O2NA 2FZCA 4YAFA 5JYDA 1QHYA 1S7CA 1EUYA 1D2HA 3BD6A 1CJKC 1SG6A 2YZ7A 3OOWA 1ADCA 1YIOA 3DHYA 3FWNA 4OHRA 4R81A 5EJ7A 1YA4A 5JS7A 2WFLB 4CKZA 1KJYA 3PLRA 3EAFA 3F4KA 4KGXA 3RUHA 2HRCA 1AK1A 2Q6LA 4N8DA 1ABBA 2F8SA 1L4YA 3DT9A 4M46A 4G9BA 4TKUB 3V8EA 2DKOA 1GZVA 2BFMA 2JH8A 1M2KA 1TO2E 2Q99A 3MGGA 4ZDJA 2DGDA 1UJBA 1FXWA 3KJFA 1X7ZB 3WWOA 1XAHA 5B7PA 4Z49A 2R2AA 3KSAC 2XXAB 3OECA 1V9LA 1DWOA 5E7MA 4EY6A 5E1DA 2GBFA 4UNQA 2ORWA 3DOHA 2PZLA 3MB5A 4W82A 5LP6A 2OV4A 1KOGA 1DUVG 2H5IA 4X1YB 4OVKA 4PXYA 4D0LB 3VYRB 1GTSA 5JFGA 5IZCC 2GHQA 4C6RA 3F5MA 1GADO 3TQFA 3L8GA 1EJ0A 3DL4A 1ITZA 1JQDA 1IRIA 2IZ1A 2WIJA 3D7RA 3KTOA 1WNFA 3FAKA 4M1WA 5JEEA 2XA9A 3HR7A 2YIDA 1J99A 2ONZA 4MPDA 1QHIA 3FRHA 4K6KA 4YAOA 3G9UA 1JH8A 1SUCA 1PZMA 1TNDA 1WULS 2A0WA 4IQGA 2XVAA 4G4SO 2ZSHA 1R0RE 1EYZA 4INZA 3AF4A 5BWLA 2IHTA 3HLYA 3EULA 5DLYA 3JQ9A 5GJVC 3PA8A 3ZWWA 1VXRA 3RTDA 1TLLA 2YFYA 2JHAA 1X38A 1S5PA 2F62A 3RVNA 4NPCA 3GJ3A 4YRQA 4AN4A 4BO4A 4YN3A 1OWPA 2I7TA 4JT4A 3AY7A 2MOKA 1R4MA 1UF9A 4LG1A 4US1R 3WLRA 5DYYA 2O06A 2JI7A 2W8BB 4EHFA 2QXTA 2ES4A 1CUVA 4LDQA 4X7BA 4HK4A 1E2UA 3IPRA 3BHNA 2BKUA 2N3ZA 2WM2A 2XNSA 1JJAA 5DNVA 3VKHA 3RQSA 5HCNA 5DFAA 5C4MA 2ZQZA 5BRJA 1KSGA 3VGPA 1SKQA 2QM8A 3GRFA 4K6GA 4UE2A 4DC1A 3LDFA 5HDBB 4M86A 1BYIA 5A3QA 3B89A 2BGKA 5FI1B 3UJ9A 5JR3A 3PQ7A 2YV3A 4N03A 2ZANA 1IBRA 2F4NA 1DDIA 3OIWA 2PIDA 4AD8A 3NTQA 1JJFA 1KKUA 1V41E 3DOUA 3M6FA 5JSYA 5LMUB 4KREA 4UTZA 3ZEIA 2FKAA 3FNBA 3A9TA 1AURA 5KTYA 1THTA 1ZOIA 2LDXA 1HYGA 1H0HA 1MQ9A 1AE1A 3U7GA 3THWB 4DBVO 4PN3A 3Q0IA 3L7NA 1ECBA 2HFJA 1LRLA 4G1UC 4E88A 3S6JA 4U2KA 4RPGA 2OCBA 5IK2A 1JEEA 2D1QA 1JB1A 4JL6A 1K3FA 4KPUA 4Q7KA 3L92A 1KH3A 3FFXA 4FQ8A 5FA5A 4AJ9A 4D82A 4Z4HA 1YS4A 3FUUA 4BASA 5AVQA 4A0GA 1D2MA 4J4TA 4B7UA 4X24A 1RNLA 3GAZA 3LT2A 1L5NA 2HR1A 1JH9A 1QNLA 3OFNA 4QO7A 1A4RA 4JVMA 4BKPA 1V9SA 5C7YA 3EPPA 2ATCA 4MP8A 1I30A 1GL7A 1T8SA 1ENPA 1U9IC 3B7PA 3HYRA 1PQUA 4K9PA 1ESMA 3HFJA 2ZRNA 4LZLA 2VJPA 4MS4B 4TWZA 3V4VB 1YQUA 5M34A 5L7YA 3KFLA 1Q95A 3IOMA 3CIFA 4KP7A 2QD1A 3GQBB 3EPRA 3HACA 4U6QA 3ZWXA 2IH2A 4IXMA 1SHLA 2WSLA 3JQ6A 4FFVA 1O87A 1HRKA 1R0ZA 4LJLA 3EG5A 3EVAA 1QXSA 4X7RA 4C30A 1RPTA 4PLCA 4ZHQA 1PR5A 4J2OA 4MJLA 4YRCA 1RC0A 1F38A 4YPOA 2XRFA 4INOA 4JAVC 3AR3A 3W7VA 4XUEA 1KY2A 1L1RA 3WIDA 4O0LA 2EX1A 3RTEA 3EGVA 5LOVF 4DYVA 4Q4HB 4LYYA 3N0VA 3WXBA 4D9NA 5C37A 2WJIA 2ZM5A 3T3HA 3WE7A 2RKBA 5F2OA 1U31A 5KDOA 1CJTC 1LLCA 1U5AA 3IAS1 3K4PA 3RANA 4DIEA 4W5RA 2EDCA 4R2JA 1NUTA 7MHTA 1HE5A 4FX5A 2ERYA 3IXQA 1N2EA 1VFNA 5BSTA 3OY7A 2HHHB 2WD7B 3RC8A 1XTSA 4KWTA 1HDGO 2NTEA 4G26A 5FWYB 4HNVA 4JVSB 3LQ1A 1Q6YA 1ZIOA 1EXWA 2AFIB 1INLA 2JKYA 3R0VA 2AX4A 1W0KD 2BEVA 1XRLA 3BMNA 2QMYA 4A36A 4JHXA 5CM8B 4QTYA 5KVSA 1E99A 4FNGA 4M38A 4FWIB 2AOTA 2GCGA 1HLPA 1RQGA 3ZBUA 4AJKA 4PLVA 3AUTA 1FU7A 4I08A 4JU8A 4ZPJA 4EG1A 2W42A 5CRIA 2JEZA 1OZFA 3DDCA 5HQ3A 2PRJA 4KDFA 2RH9B 2ZAOA 5KYUB 2Z0MA 2QRMA 5GV7A 5LLTA 3J7AC 2ORED 5IABA 1BEUB 1KDTA 5E38A 1N5OX 3I4LA 4D4IA 2QZJA 3QA9A 3H1PA 4NZOA 3ETGA 1G5HA 1RYMA 3DE2X 1WSAA 4GR5A 2QAGB 3ZGOA 5MDHA 3W6OA 2FGJA 4YONB 2V7PA 1CJVC 1H0RA 2AQHA 3ND5A 2IXFA 3DOEA 3I01A 4XWGA 1NPDA 5J9FA 3WG9A 2FUEA 5U4XA 3C0KA 1WXGA 3CLTD 3BQNB 1NBIA 2OHJA 4UPVA 2OBXA 3GRPA 3AZPA 3QX9A 5EIXA 2WF7A 4WOCA 3H3FA 2PUFA 1E3IA 3AFOA 2HLPA 4MUNA 4OA8A 4PZAA 4KR7A 4XQ9A 2WLSA 3VKGA 5BRAA 1DC4A 2EBWA 2B8NA 3MINA 3OZSA 3RJMA 3UHAA 3JD3A 1NAIA 5CG1A 2XEDA 2O48X 4D80A 2Q1TA 4RHUA 2FPPA 3TLXA 1L5LA 1KI4A 2MSWA 3KR2A 3RC3A 3OWOA 1GKYA 2YBEA 2HCJB 4E7OA 1XDBA 3LECA 2AQ8A 4K87A 3TLGB 1RABA 4DIKA 3GLFA 2NV2B 4MYUA 4QPZA 1P73A 1OAKA 4C4SA 2FFJA 1NZDA 1MGOA 2P65A 1MDBA 1FDOA 3KOOA 3NHLA 3WL4A 3P52A 5CPBA 4ZKDA 5TIIA 2X0KA 2C7OA 2IITA 4MJXA 1J1ZA 3IEKA 4RKRA 5ESXA 3TINA 2C07A 4UTOA 4MKGA 3F3SA 1N2GA 4NZZA 3F4LA 1KHHA 4RD4A 2LBPA 4ZCSA 4U7PB 3D3WA 2BC9A 2QNIA 4CN8A 3IALA 2B4QA 1ZONA 3WMFA 1RYHA 1WAMA 2GEJA 2I4IA 3GYBA 3M1YA 3OEWA 1Q91A 3QEAZ 4JYAB 1GUAA 4NS1A 1XLVA 4ZO8A 3IHLA 4LHYA 2D06A 4ZT2A 3U1TA 3VSEA 2J5XA 3AF2A 3V00A 3KE9A 4H15A 1DC3A 5BW8A 1JIKA 2FZVA 4WHMA 2FW0A 5GPBA 2PYZA 2GMWA 3E9RA 1V95A 4MV9A 3MOSA 5JNRA 4Z4FA 4R3NA 4YGXB 2FXVA 3TX6A 3OZVA 4PG5A 3ZS9A 4F6RB 2WT4A 2XMBA 1BHJA 3RS7A 1PWHA 2BJWA 1B3RA 3H9JA 3O73A 5B3LA 4CMEC 3KPWA 4NEGA 5DXJA 1FLDA 3NBXX 3ZE2B 1GL9B 2QZ9A 3E8XA 1O5OA 1SXJA 4FYIA 4G5SA 4W8HA 4WX2B 2QD5A 4RZ2A 1JDVA 3LBIA 1JHPA 4NRDA 1JTFA 2ZSIA 3I2YX 3N8HA 2VP2A 4JA0A 5EP2A 3RROA 3ANYB 4DKXA 4KNVA 1ZD3A 4F60A 4QUKA 5LFAA 4OK5A 2XITA 2C8KA 1M2EA 3IAHA 2AJDA 4MW6A 3RKUA 2BEWA 4DPMA 4Z4EA 1SBIA 1WQ3A 4FFWA 4W1RA 1HOXA 1R12A 3WGNA 2VSNA 2SCUA 4B09A 1NVAA 3NRJA 4GBED 3T3GA 1UIRA 1AVTA 3DR3A 3NT4A 3RT7A 1Y1PA 2BPOA 4H4EA 2ZRGA 2V96A 4D9FA 2FZ5A 1NVTA 2O2YA 1YDFA 1AX9A 2YZGA 1Z4PX 2VYQA 1J8QA 4MIYA 4YJFB 4YYEA 4BAGA 4Z3KA 4KQWA 2DLNA 4B7XA 1V16B 4DLNA 3EA0A 1Z45A 4U7JA 4BWYA 4CI0B 5C46F 2A0FA 2YRWA 4XWOA 3ENVA 4I50A 2WNSA 3F5FA 1QMGA 2PGAA 4CE6A 1Z39A 1Z56C 5AUPB 4HG2A 1L5KA 2QIOA 3UANA 2E18A 3KBOA 3A6KA 4PHHA 4S2EA 4E4YA 1NI4A 5I7UA 4MQ5A 2V98A 4IYRA 4EEKA 2FE4A 4QGSA 2OD7A 2GUGA 1MNQA 3JPWA 3ER8A 1U2RA 1FU4A 1NT2A 1SKUA 2FK7A 4HDSB 4BB0A 5I7RA 3SHTA 1UKEA 1P2DA 1ZIDA 5I7FA 3Q5GA 3W3AA 1QQAA 3ZIDA 3OU2A 5C32A 2R4UA 2R97A 4I50F 1NF8A 2CK3A 3IA7A 4G85A 4X6YA 3KO8A 3MGCA 3U7JA 3ZV5A 5KTPA 4TOIA 1M66A 4BLTA 1R5BA 4N7RA 2HRZA 1V7CA 1NJ5A 1EWQA 4OSPA 2PWZA 2V65A 2QAGA 3K8ZA 1OR8A 3OY2A 3ONDA 4R1NA 4EUFA 1D1QA 3L7JA 1B7GO 3PQ8A 1NVFA 1USIA 1H3EA 5IBQA 5K01A 3TBHA 1JSCA 3AFNA 3I61A 5DMHA 2I1WA 5JUWA 4XIGS 4MMYB 4ZO9A 4Y3UA 3TB4A 1Z36A 2B36A 1WNTA 3DP7A 2O0MA 2OC4A 1U6IA 4CQMA 1TKRA 3IOBA 5GONF 1TRHA 3AR6A 4KFSA 3VKUA 3D7KA 4KKXB 3ICOA 4G5GA 3DVQX 5JAMA 1S0UA 3KZNA 1CRLA 2RHHA 3HNPA 2O07A 4BNKA 1M34A 1C0IA 3MXTA 4M9SA 3RYTC 5AK3A 2IH5A 1JIIA 4RV4A 2H0QA 3R7AA 2HH9A 3HR4A 4DNPA 1JNYA 1ZDMA 4OQYA 1LPBB 1IQ0A 3D02A 4UFPA 5D01A 1ZD8A 5DMXA 3PNSA 4IIGA 1LSSA 5BV8A 3FMPB 1P4HA 1M0SA 3BMOB 1IQPA 1TT7A 1UBFA 1UBHS 2ZRMA 2RSLA 4HDCA 1T2CA 3EIHA 3VR4A 4B46A 1SHTX 4EMSA 5A1TA 2H48A 5KNCD 1QPZA 1U0EA 2M2IA 1V1JA 3P19A 3TRFA 1PEDA 1WLSA 2LZ0A 3QYJA 1MD9A 2BH9A 5C7IO 4KNYA 2BFCA 2C88A 5HCUA 5AIAA 1XFDA 1J0XO 1P1FA 4L7QA 2I34A 3AOEA 2EGGA 3CJQA 1KMNA 3F8SA 3K0EA 4P4SB 2IWHA 3TAHA 1TEHA 2D8MA 2P5TB 1VPWA 2JGAA 1NNLA 2VF7A 1S9HA 4RIIA 4ZQBA 1PD1A 1D07A 2LD4A 3H18A 2JFXA 1V8OA 1Y4ZA 3CX8A 4YAJA 3RFTA 9GPBA 1ZW6A 4OI4A 1KXJA 2C31A 1L5HA 1GTJ1 4YAEA 1E4YA 2B99A 1IPHA 2Q62A 2Z6QA 1DKNA 1I5RA 3ZHSA 1OVMA 4ZZ2A 4M0CA 3FJ1A 5L95A 2XKKA 3IAFA 3HG7A 2Y71A 5E4TA 3V4SA 4DANA 1IL0A 4DWWA 4B2YA 5A4FS 1UKBA 2P5UA 1NZJA 3HS3A 5HKKD 1MH1A 1RXCA 4BFSA 2QX9A 1T4GA 2OAEA 1EWRA 2V6BA 3UNXA 2HYIC 4KSCA 1H1DA 4HRVA 3ZCUA 2CXTA 1VGQA 1FRNA 1JDZA 1H2FA 2NO7A 4IYJA 3WFJA 3ZK7A 3P2JA 2ECFA 1IVYA 1J9GA 5BXQC 1E32A 2QG6A 3LCCA 3CZMA 1ZQ1A 2X2OA 1USWA 4X1YA 4XH9B 5GM2A 3X1JA 4ETNA 1YB1A 3C3BA 3WLPA 3IQXA 3O9VA 4IUYA 1UBOS 2RD2A 3CS3A 3RK1A 2HREA 3CH4B 4RVGA 1L4NA 4EZEA 3AEUA 3BULA 1VOTA 3PXXA 1XMOB 4GM1A 2W0SA 1W34A 4PANA 4OYYA 2JFFA 3VR5A 2VTKA 3BEOA 1QV6A 1JE1A 2XD4A 4XSGA 121PA 3D6UA 3DXFA 1Z4JA 5C80A 3UBTA 5KYWA 1Q0TA 3K1AB 1NUPA 1Q16A 3EWIA 1V37A 2DBYA 4K3UA 2OCDA 3AP2A 5CURA 1MQ8B 1DJNA 1MQAA 4E12A 4ZI2A 2JD0A 1EH5A 1VDZA 4QJ4A 1L4EA 2QTMA 1IJEA 3NR2A 3WMEA 3GLGB 4MWTA 5K8VA 1GRQA 3B13B 1YZFA 5GJBA 2PFGA 3T7SA 1ZCBA 5HJ2A 3E9YA 3SYRA 1BGWA 4OHFA 3SJCA 1HE2A 5DX1A 2AEFA 1E3DA 2QYHA 4RACA 3W9YA 1Y0BA 2ZCUA 3H83A 3CBGA 4INAA 1RZ3A 2MYNA 3UK7A 4L8LA 1MN6A 2I6XA 1YH3A 3I9V6 2VF8A 3F49S 3SF8B 1ZNYA 3DHEA 4QRIA 3SF8A 4TRMA 1CIPA 1HEIA 2XB6A 3NG1A 4DKJA 5J2UA 4ZZIA 1NUSA 1M7GA 2YASA 4E94A 5IAGA 2FDCA 3AEXA 5HMMA 1T4CB 2GM3A 4PPNA 2YFKA 2HPVA 1G4UR 1LPSA 3GQBA 3IUSA 1C0KA 1Z2OX 1ZH6A 2NPOA 3WNCA 5CD1A 3C1UA 2EG5A 1R8SA 2C7RA 1RKUA 2ZRBA 4KR6A 3L1JA 4Q48A 1EUDB 1NWHA 4LE1A 1TPZA 4WCFC 3T7CA 4CKWB 4DJAA 5I6DA 2EYUA 2FP4B 3N6RA 4XUCA 2XMQA 3JQQA 5BSHA 1VLQA 1SM4A 2XZLA 5I5EA 1XCPA 1EDZA 1SD2A 2VJAA 4RLHA 5T8KA 4WXYB 1QGUA 2PJZA 2NM0A 1LTQA 3WJ1A 4TTVA 1E8MA 1XTVA 4M76B 3C74A 3UJ7A 1TTHA 1X1DA 2QYSA 2ZULA 5GTDA 5ICFA 1OGJA 4F9GA 1T5IA 1RHRA 2Z4TA 1X3LA 4P4LA 3CJTA 5AVTA 4PR3A 4ZO4A 4CG0A 1P9WA 5BW5A 2FG6C 2MU1A 4RMHA 4V1CB 3HEBA 4FVTA 1WHSA 2LNDA 2V9PA 1JXAA 2VXBA 2DOKA 2EX0A 4W5QA 1TDJA 3E58A 3K9LA 1I36A 3PENA 4GC5A 1EVEA 3VQTA 3KOXA 3AEZA 1FNCA 5MFPA 3NEAA 4MA4A 3CN9A 3K31A 4HGRA 3O8LA 1WMDA 2SKDA 1NR7A 1JP7A 4DG5A 4KQFA 3RAEC 4DMCA 3Q3JB 4Q4AB 4E46A 1RPJA 2NQ8A 3NBFA 4DLRA 1T3TA 4G81A 4UNIA 2HHCA 2EFHB 4YV7A 1RM4A 5KC8A 5AHOA 4B4VA 4A23A 4CT0A 2FEKA 3UMYA 4CMBA 2CK3D 1WKBA 4QLOA 4BU0A 1QS0A 1WZEA 2XEXA 4FZRA 2Q50A 4DA8A 1VE9A 3P4UA 4B3RB 2GCEA 3G2OA 1N1EA 3MWLA 4BMSA 2YYSA 1JAIA 1THMA 2FQQA 3DVRX 4FNAA 4PE5B 4ATNA 1Z0FA 1ZJ6A 4X3PA 5EIEA 1P2FA 1Q0UA 3RT1A 3VX4A 3UK0A 3WZ2A 2F8MA 2J6IA 1JEYA 1RKVA 1JTEA 2P78A 3TIIA 4Y98A 5BSFA 4G0PA 1PL0A 4HB3A 2XHEA 4RFVA 4BXOB 3FYTA 3CLUC 2WW8A 5A7FA 1JDUA 3O4VA 1E9CA 4LJYA 5CIYA 1X8XA 2GD0A 3AM5A 3CF2A 5JNLA 2C99A 3D3NA 2IE0A 3RAGA 3D3JA 1LVGA 3G2NA 3ZHZA 1P3JA 3IE2A 1JR3E 1JHMA 3NS7A 4N5LA 4PX9A 4AF6A 4E2XA 2W2MA 2Y1GA 2H92A 4O4JA 1GSAA 3VR2D 3FX2A 1H2YA 3M9WA 3OOJA 1F60A 2K2WA 2XCUA 3WFZA 1JLMA 4N49A 1E6CA 5ALLA 4UHHA 2VLBA 4J43A 1MOZA 2FTKE 3AJAA 1AGYA 1M2VB 2WMYA 3K9QO 3CN7A 5EE1A 4EW6A 4H16A 2ATVA 4D4MA 4ETMA 1NV8A 1ID8A 4FOLA 2VPWA 4WBXC 1A5SB 1PD0A 4OY3A 4UW9A 4IKOA 4LECA 1HSZA 1VJ0A 3A6EA 1DJPA 5C5DA 1Y82A 2H3EA 3CONA 1Z0SA 2QM7A 4IJKA 1M74A 1RFGE 4NBLA 2OBYA 3C3YA 2QLJA 5T41A 5BVGA 2P9YA 1VKZA 4LZJA 3UN1A 1PTJC 3JV7A 3NDRA 3T7DA 3RU7A 1LDYA 4DMGA 4XRGA 2FPLA 4PQFA 4JFRA 3C70A 3HJUA 1SZDA 4XGNA 2NZ2A 5EGSA 3MGBA 3FOAA 3QM1A 1FL9A 1O97D 4EA7A 2PSFA 5TQ0A 4E4TA 3RTAA 3WQBA 1PGNA 3ASYA 2PKCA 1PL8A 3PUHA 5HRCA 5BYBA 1JKFA 2F43B 3U40A 2UYQA 3FWPA 2I71A 7REQA 1PO7A 1L7RA 3NQ41 2P90A 3OEEA 2VQEB 1W4ZA 2OXTA 1U7PA 5FADA 4CM4A 2GR9A 1EK1A 1KWGA 1QAQA 3V4ZA 4BRSA 1E3JA 1J56A 5GONB 5JXWA 2ECQA 5WRFA 4DLAA 1E1MA 3L8EA 3ORFA 4F46A 1NNUA 1UQUA 4TLMB 4YALA 1WDMA 2VNHA 3WDMA 4KXMA 2PGNA 2AG1A 4OKNA 3G6KA 3SJ7A 2NTVA 4UBLA 3ZD6A 4YRRA 3IP9A 3TRHA 5DPMA 5J4HA 3O03A 3PX3A 3ZGVA 4CM6A 3K5WA 1NXTA 1XMQB 4F1KA 3GXBA 4F6RA 2F9MA 2GWHA 2NZXA 2PZ8A 2Y1FA 4QEKA 4KACA 2ECPA 1WW8A 2H08A 2JAUA 3G5TA 5CNKA 2P9EA 3K05A 2IHKA 3PT5A 1KK1A 2I2FA 4CCSA 4DR6B 1KDOA 3F73A 4XE5A 1SZJG 4MQEB 3IUMA 4HJRA 3DL2A 1L4LA 1Z07A 1XKQA 1Z35A 5CB4B 4HDRA 4Z1MA 2CNWD 1GFSA 1R6UA 3HCFA 3BZUA 4YCJA 4EHLA 6Q21A 5L40A 2AF3C 3KLNA 3KV1A 4J0IA 4BP1A 1OXUA 2D1SA 2P6UA 3GLTA 3KAPA 1GRVA 4LHEA 1PYOA 2HBRA 2WSMA 3K7EA 3Q7TA 3TOSA 3U3ZA 4MKZA 4IZHA 4N7JA 5JECA 2DM6A 3W7BA 4B31A 1TXGA 1RLOA 1QFJA 1VPTA 1U8YA 1FDRA 3FPFA 3NASA 3RABA 2JJQA 1WVMA 2BDTA 4DLVA 2JI6A 1YQXA 2Y2VA 2JJMA 3NTRA 1DC6A 4KXYA 4FT2A 1WF6A 3VO8A 4BNFA 1RJGA 3AXTA 1H2HA 2A9RA 4PZZA 2MINB 1QAOA 5F33A 3TLBA 4F04A 1U1FA 1JTVA 1VHTA 2EZ4A 2ZUDA 4CCAA 2I62A 2X9LA 3F2VA 3LLVA 4JR0A 3Q88A 2CFOA 1VPEA 3B2QA 3LUHA 5TMBA 4OHYA 3LX8A 4JLBA 3C4VA 1E2GA 4KXNA 3WGTA 3IL2A 4DCMA 1NP7A 2NU6B 5CFQA 1EMDA 2X8JB 4H18A 1MF7A 3VHQA 1ZQ9A 3AHHA 5TY0A 3BT7A 3UOWA 1TYCA 1YQDA 4N48A 2ZSFA 2CNNA 2VUIB 3IUQA 4FDUA 4U1RA 1F9AA 2GK6A 2OOSA 1TZJA 3L04A 4UULA 5IEJA 3HKDA 3EZNA 2YCBA 4GP6A 4ZQFA 3ML1A 2EJVA 3I5YA 5ALGA 1GV0A 1JF8A 1NN5A 1WHSB 2OLJA 1DADA 3UC9A 5TC4A 1V3TA 4MV5A 3KNZA 2DFNA 1IHOA 1R16A 2FPSA 3LNCA 4O2BF 4RJ2A 3EPHA 2W6IA 3WHPA 5HQ3B 4CF4A 2VR1A 5KQLA 2CBZA 2H4WA 2JH3A 4N3CA 4OI1A 3PE3A 3EZ2A 3JAKB 4HH4A 4NDNE 5ITSA 3GPCA 3HB0A 5ED4A 5EY5B 3WZMA 1MO3A 3OCYA 3P9YA 2J59A 4LSMA 1LI4A 5EWMB 1V25A 5CH3A 1BXRB 3C16C 5PNTA 5D5HA 4D4HA 1I3KA 3M6VA 2COEA 4DB4A 5DK6A 2W2KB 3NH6A 4BBZA 3Q8XB 3HDQA 2DETA 3PCTA 1E3LA 2O5RA 4OJMX 4RHCA 3C7KA 5BV7A 5F73A 3BTUA 4URXR 5F23A 4M21A 3F7NA 3GLGA 4E5KA 1ILWA 4ZOQI 4LSWA 4BPRA 2BJVA 3NVDA 3T99A 4CU5A 4JBGA 4F96A 3EODA 5I4BA 5K8CA 3PFNA 1I94B 1Q74A 3S27A 2KHZA 4TRNA 1VDMA 3NW9A 3WA6A 4I9UA 3GRKA 4EQZA 1DHRA 4X92A 2DR0A 4D8XA 3ZDQA 3PJGA 5C2JB 2AMJA 4UMVA 1U2DC 2BN4A 2QLNA 3QLUA 3IPXA 1D7AA 2AMYA 1YZKA 1FFCA 1OVGA 1ZRHA 1UOPA 4CM7A 5DNCA 2X8BA 1XCOA 1GR0A 1F1BA 2Q29A 1AF7A 2HF8A 4JI8B 3IB6A 3ZTYA 1L5MA 5LMCA 2AK2A 2W2LA 3VMFA 3U5TA 1YQGA 5B57C 1ZBQA 1NYTA 3KAKA 2IBMA 5KX5F 5KOYA 2NUBA 4XQEA 1G7RA 3KUCA 5JSQA 2AN4A 3K1ZA 5EGNA 4C6HA 4P0PB 1DP4A 3JQDA 4J0HA 3WBKA 3I76A 4NV0A 3VYSB 3AINA 3FSGD 3HDVA 2NTNA 2GS9A 2F1HA 1K68A 1W30A 1T1SA 1PYDA 2F1JA 2R1VB 3TDKA 1PR9A 4FHDA 1NJGA 5J43A 4NYJQ 2QLFA 1H6AA 3ZWBA 2C78A 4QNRA 2FFBA 2GF2A 3I73A 4QSHA 3W6PA 3BIJA 2XJ4A 1ZSVA 2Q5FA 3O7WA 1XMVA 5F21A 2G1UA 1GDHA 4OP3A 4LKRA 4BEVA 2YW9A 4WNIA 1M8KA 5TGZA 3A6FA 4IHKA 4BLRA 3UHOA 5LLDA 2BGJA 3KYCA 3L06A 1CKEA 2XJ9A 1KMCA 3O91A 4WJZA 5K8IA 3DKRA 4I46A 5ALZA 4X66B 5KPDA 2B94A 2C98A 5BUQA 1DBPA 3GW8A 4DCOA 1MO4A 1T36A 5KHAA 1E1RD 3F6EX 3TVDA 1IEQA 4TL7A 2AZXA 3MIIA 3QVTA 1JHUA 3WMWA 3ZD8A 4UOQA 5A4IS 1PS8A 4KXWA 4S1VA 1HDOA 3U4AA 5TPZA 3RWOA 1TVKB 3CZ4A 3ODGA 4GPZA 3UH0A 4TGLA 4N5DA 2A67A 3DBRA 4KLRA 3HP1A 1E9EA 1OFIA 4A0FA 4DWVA 5M5BA 1E9FA 4NIMA 1U0SY 5JNVA 2H1OA 3WKEA 3ZU3A 2H2GA 1U7WA 4L78A 2GZHA 4YRMA 3TCNA 3BPSA 1JWBB 1PUJA 2G40A 2NAFA 5LWHA 5A7HA 3W5CA 1W1WA 2WWRA 4LZPA 4G63A 4XDHA 3ESZA 3ZW8A 2FJPA 4TSFD 4CEHB 4G5FA 4GVPA 5E4FA 4YQYA 2XUQA 1O77A 1CQJA 5CNMA 2GM9A 2PXAA 1OXTA 4OLHA 4Y1EA 3THWA 2QORA 4GNKA 1KAOA 1M34B 3Q1KA 4RVSA 3VZQA 2D54A 1F48A 1Z4OA 1YUMA 2HIHA 3TSCA 1XHEA 3P2IA 5MGNA 2ZBQA 1GPH1 4DN6A 1T2NA 5DM60 4FD3A 1XP5A 4KO1S 2Y9MB 1F8XA 4JB3A 4TMZA 2QQ5A 1OF1A 1I4LD 3NHWA 2AN5A 4H7IA 3B6EA 3FN4A 2Q9AA 1SC4A 1GU0A 3PPYA 5THKA 3VU9B 1BWQA 2G76A 3GPIA 4R40A 3X3HA 2NXJA 1JUDA 4GZ3A 3MF4A 5AW4A 1RTKA 2NAPA 3L8ZA 1N25A 3ABIA 2BZSA 4QQRA 4PHFA 1A8HA 3T8YA 5CVTA 1RHJA 2COKA 4DILA 4EY5A 4NI5A 3JXEA 1TEXA 3B5EA 3ENQA 3PNQA 2J4CA 3K0KA 4JYMA 5DOZA 5F5LA 4AYTA 1CZKA 2W2KA 3L02A 1CU1A 4P4UA 1NV9A 4TTAA 1Z8NA 5JXGA 4R83A 3ZJ4A 2R47A 2C77A 4MO2A 3DBLA 1AY0A 3W04A 1TYDE 1FQKA 3D6VA 1YKSA 4WESA 1FTGA 6REQA 3C6XA 1B23P 3L4BA 2ZBDA 4FMCF 2OZLB 2XE6A 1HT2E 5K3OA 4IGFA 4WL0A 3FYSA 1RD4A 1JVNA 4PLZA 3NAMA 4BQRA 1WETA 1NYLA 3T7EA 3EC2A 4M0PA 4TWAA 4ZT3A 2P2NA 1JU9A 3UWPA 3O83A 1QFZA 3FXAA 5K03A 4G0ZA 1CB0A 2W2OA 4M6WA 4ACAA 3KKZA 1QVAA 3FYUC 1NLUA 5BW6B 3TZEA 4YX9A 3WKBA 3JZIA 2H29A 1OI2A 2VDWA 4EGAA 2Q4EA 3THYA 5DT9A 1B3BA 3I4CA 3HY6A 3TZHA 3NMUF 1DIAA 4F1JA 3DV0A 4G36A 1I6KA 5CT8A 5ALNA 3CNBA 4WXHA 3Q11A 2NZJA 4RV5A 2H17A 3HBJA 1DAOA 1H66A 3N2IA 2VDLB 3MNFA 2Z1DA 4G4IA 2D59A 4EMBA 4D9KA 4HDSA 4DR4B 2X76A 3KJIA 3VGJA 4Y9TA 3U3DA 3IEUA 1ONSA 4KOAA 4R3UC 1MX9A 1GXSA 3VOSA 2QPTA 2C0CA 4LJSA 3GJQA 2W6MA 4K0KB 1JECA 4ALNA 4M49A 1K5PA 4V2UA 3SLRA 4UOEA 2VKTA 4I6GA 3WR5A 4XR9A 4U2GA 1GA6A 3I30X 2A5YB 3AUXA 4K6CA 5LVAA 3UJAA 1JIUA 1Q84A 1FRQA 1RWWA 2DBQA 2O1EA 2VJMA 2XX3A 3KR0A 3OQHA 4E6EA 4DCNA 3NHPA 3ICCA 2TYSB 5JDIC 3V4RA 2REOA 1HDCA 2ZS9A 5JZVA 2ONYA 1B16A 5AM4A 1ZK2A 5IWCA 1O54A 1DBQA 2VHEA 1SCNE 1Z2PX 5CA0A 4F4HA 2TMGA 3HYSA 4K8OA 3TUIC 1AB5A 4AY4A 1OH6A 2C3PA 3IEXA 3MOGA 3O2JA 2WDPA 3VHRA 3DOOA 2XDWA 5TT1A 3MINB 3A11A 1L8QA 2A0YA 2HWYA 3I0MA 1LW6E 2PLFA 4GO1A 5KVAA 3L4JA 3U48A 4G01B 5BN1A 3H6GA 2QIPA 1XQ1A 4DDUA 1KI1A 1TZ2A 3D8UA 3OBBA 4KYTA 2HMYB 2JF0A 4ZYXA 5K0GA 2B0CA 4XASA 1TUBA 4RABA 3SHWA 2MYTA 3THYB 5HPYB 4F2PA 2O7SA 5L3QB 1UDRA 1T6NA 5JAOA 1IBCA 5KJFA 3PXGA 1SO8A 1ENOA 1K98A 1T9DA 3FMIA 4IO1A 4BE9A