4AO7A

Zinc bound structure of a novel cold-adapted esterase from an arctic intertidal metagenomic library
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
243
structure length
223
Chain Sequence
MSWNGKDERKLSVQERGFSLEVDGRTVPGVYWSPAEGSSDRLVLLGHGEYIEQVAKLLVGRGISAMAIDGPGTDVVGLDAFPRMWHEGGGTAAVIADWAAALDFIEAEEGPRPTGWWGLSMGTMMGLPVTASDKRIKVALLGLMGVEGVNGEDLVRLAPQVTCPVRYLLQWDDELVSLQSGLELFGKLGTKQKTLHVNPGKHSAVPTWEMFAGTVDYLDQRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Studies of a Novel Cold-Adapted Esterase from an Arctic Intertidal Metagenomic Library.
pubmed doi rcsb
source organism Unidentified
molecule tags Hydrolase
molecule keywords ESTERASE
total genus 78
structure length 223
sequence length 243
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ao7A00
3DQZA 2ZJ7A 2B61A 4OPMA 4AO6A 4G8CA 3UUFA 1TAHA 5CT8A 1E3QA 4TGLA 2VATA 4LIPD 5LLSA 2V96A 3HZOA 3TGLA 3WJ1A 1F8UA 3BF7A 4BAUA 4F0JA 1J07A 1UT6A 2XE4A 2QTBA 2Q0XA 1MNAA 3AIMA 5D3KA 5K3BA 3H2GA 5DNUA 3H2IA 3QITA 1R9MA 4GI1A 1CQZA 4M0EA 3D2AA 4X00A 5FKJA 5HFNA 1IVYA 5EGNA 2FJPA 5ALPA 2ZYRA 3O4HA 1VA4A 5EHXA 3FYUB 3WKCA 2WKWA 4GWLA 1GT6A 1VE7A 3IIIA 3DL7A 1AQLA 2Z8XA 3DL4A 5FDFA 5I9IA 4N8DA 3C5WP 2WUFA 3JYHA 2AJDA 2RHWA 5E2IA 1XZEA 3QPDA 1CUZA 1GKKA 3H1AA 3SX4A 4UHBA 3R41A 4UBLA 4OUKX 1UKAA 3UUEA 4NZZA 1J1IA 3WKDA 2WIKA 1K5PA 1B6GA 3FOBA 1XZGA 3BDVA 3R3ZA 3STYA 2GBCA 4MQLA 1SCIA 4PSCA 2GBIA 4A23A 2XMRA 3HABA 4A5SA 2HU8A 2WHPB 2O7VA 5ALFA 1F6WA 4BC1A 1CUAA 3H17A 4CIBA 3G9UA 3HI4A 4Y2TA 5A6VA 4BTLA 4BCDA 4UHCA 5BV7A 1UXOA 1EDDA 2D0DA 1G42A 1C7IA 5ALVA 3RM3A 2R8BA 3O0DA 3C6YA 4RPCA 3WL8A 3QYJA 2JF0A 2V9ZA 5LYYA 3TEJA 4P93A 4W1PA 4A16A 4CG2A 2O2GA 4B81A 4L0CA 1XRMA 3T4UA 1K4YA 4C4ZA 1CLEA 2LIPA 4UFNA 5DLPA 5JD4A 3PE6A 5K3DA 1YS1X 2DHCA 5AO9A 5I7UA 2VEOA 2XUHA 3SC2A 2G4LA 1XRLA 4BTVA 4F21A 3BL8A 4AO7A 2RONA 4H77A 2VJAA 5LKRA 4X6UA 5AK6A 4UUQA 4PSDA 4IQ4A 2HRQA 2H1IA 2DFPA 3G0CA 3IUJA 1Q0ZA 4Y2UA 4ZGBA 3UMJA 3NGMA 4WFIA 2VT7A 5FOQA 4C01A 1YASA 3DKRA 3K2IA 2XUAA 4G4JA 1OXMA 2WILA 1ACLA 3STWA 1HBJA 4E46A 1AC5A 2WU4A 1KU6A 1A88A 1QGED 1IZ7A 5ALQA 4QWMA 3X3HA 4RE5A 3HEAA 1C7JA 1U8EA 4GLBA 1JMKC 4H7EA 3IA2A 1H22A 3I1YA 2BUBA 3AZOA 1ZGCA 3R3VA 6YASA 3KOOA 2W22A 1SCQA 4J0CA 1YA4A 1VLQA 1IZ8A 4Y2RA 3HACA 4BVKA 1ODSA 1XRRA 2YASA 3GFFA 1LPAB 1CUSA 5JZBA 5ALDA 4XX1A 1G5FA 1CUWA 2HA0A 2PU7A 1CPYA 2QMQA 3IUMA 1WCYA 2O7RA 5DNVA 5CURA 1MPXA 3FAKA 2Z3WA 4P92A 3AIKA 4Y7DA 4V2IA 1LPNA 3GROA 3DJYA 3A6ZA 5AM4A 2XUDA 1XZCA 5JADA 4K6GA 2WHQA 4IO0A 4WY8A 3WI7A 1LPMA 3H04A 1EK1A 4U2EA 4B85A 4XVCA 4ARAA 3K6KA 1JJBA 4FOLA 4LYDA 3C43A 4WCVA 5IVHA 1O6FA 4DMFA 3MGAA 2XMZA 4K6KA 4EB0A 1VXOA 1XROA 3F67A 1J06A 2GZRA 4TPKA 5AICA 4K2AA 1ZIYA 4AMYA 3PF8A 4DSAA 2XLCA 2XUPA 1WPXA 2CKMA 3D3NA 1JU3A 4BVJA 4F5ZA 4DIUA 2BGNA 1VA5A 1IMJA 2WLSA 5AI6A 2OLEA 3IBTA 3N0TA 4K5QA 2GBFA 4HTAA 1P0QA 1HDEA 4BBZA 4ZRDA 3DKKA 1ZD3A 4Y2XA 3A2MA 2Z3ZA 3AUKA 4BCCA 2HFKA 2OXEA 4J0KA 1PV1A 4KEAA 1FSSA 5AOCA 2WFLB 4Q34A 5ALGA 1GQRA 4B0OA 3DS8A 1UK7A 1MX1A 3HLKA 3HRHA 1BE0A 3WWEA 2P8SA 3B5EA 3H2HA 5CT9A 3ESAA 3C6BA 4DSZA 1TCAA 2BGRA 2WIGA 2PPLA 3LLCA 4Q3OA 2XMDA 5AI4A 1R1DA 1H2YA 1THGA 1WHSA 3WMRA 4O08A 1ZD5A 4UHEA 2YYSA 2X76A 5DYTA 4GHWA 4KYVA 2ACEA 4MWTA 1CUUA 3G9ZA 3CCBA 5T4FA 4YK7A 4KAAA 2HU5A 5IVIA 2BJHA 4OYLA 3AZQA 3V1LA 3BIXA 4N5IX 4UHFA 4RE6A 1AGYA 1FJ2A 2ROQA 2IIVA 2OCLA 1LPOA 4S0XA 2VJCA 4UBOA 1HL7A 4X90A 3G02A 4BP8A 3CXUA 2O2HA 2WUDA 3H19A 5ALWA 1LPSA 4DNFA 4IH9A 3I2HA 5ALKA 3U1TA 2UZ0A 2JEZA 1VXRA 4MXDA 2GYUA 1ZGBA 2WG0A 3RKSA 1EXWA 3R40A 1W1IA 4E14A 3DOHA 2B4KA 1QTRA 2WJ3A 2BUCA 1HKHA 1H2WA 1EB9A 5HQ3B 5ALUA 1MO2A 4C89A 2C0PA 3S2ZA 3F98A 2XB6A 1XQYA 1Q83A 5JIBA 4NVRA 4KRXA 2HL6A 1EX9A 2QUBA 1MAHA 4MEAA 3MVEA 4Y2JA 4OU5A 5JZ9A 5LZ9A 5FP0A 3IUQA 4IH4A 1P0IA 3G9TA 1XQWA 5JALA 2WHPA 2CB9A 2JEYA 1CUDA 1JMYA 3KWJA 3IUNA 2JGFA 4B9AA 3E1GA 4B9EA 2OQVA 4AZ3A 3KSRA 4FBLA 5A62A 4P08A 3I2IA 2Z8ZA 5A71A 3STVA 5JAPA 5DWDA 2QJRA 3DYIA 4WFKA 4MYDA 4X6XA 3WLAA 4IH1A 4C4YA 3FLBA 1XZMA 2X8BA 3C45A 2I3DA 2BAGA 3W05A 5LIPA 1GPLA 4Y2VA 2JGIA 1QE3A 5AKHA 5JD5A 5AM1A 4UFPA 3WYNA 4CFSA 1CIJA 2VAXA 4KE9A 4M0FA 2QS9A 2WSLA 2H7XA 5HK9A 3GA7A 5A2GA 3FYUA 1K6EA 2AJBA 4H7HA 3EQ7A 1UOOA 5AKEA 5YASA 5LKAA 1T4MA 2XUQA 3AJAA 4EHBA 1EDBA 5HK8A 2ACKA 1CUFA 4C88A 4BAGA 3OG9A 1AURA 5E4TA 5H3HA 5LZ5A 1LGYA 1CR6A 2AJCA 5FPQA 4BATA 4DNPA 5J3JA 4C87A 5ALSA 4HZGA 3WK9A 1BU8A 3STTA 3WZLA 4AQDA 4UBMA 2OCKA 3PI6A 4AO8A 3GBSA 3C6ZA 3W9UA 4DM7A 3KDAA 1EH5A 2RIPA 1AUOA 3JWEA 2XI4A 5ALLA 4FWBA 5AOBA 2BKLA 2QUAA 4AB1A 3VJMA 4KE6A 4B0PA 4FNMA 1MT3A 5ALRA 1U2EA 2VA9A 3DOIA 5EHZA 3M3DA 2JBWA 5K5EA 2XUGA 2J3QA 1EA5A 4FNGA 1E8DA 4BDTA 1A8SA 4W1SA 5DYWA 1HPLA 2CZQA 4N8EA 5IVKA 5AM0A 4GXNA 4U2CA 4EY6A 3DEAA 1F0NA 5D3ZA 4J7AA 1AMNA 5LZ4A 4MJ3A 1QOZA 4H7DA 3L1HA 1BEZA 2JIDA 2CMFA 3U0VA 1KEZA 1IUPA 1JJFA 4BE4A 3A2NA 3R3UA 5AI0A 4H7KA 4EUSA 1U4NA 4Q3KA 1XZJA 3VVMA 4QDXA 3O4GA 1XQVA 1UKBA 4BRZA 4H7IA 5KWIA 2WG1A 1TQHA 2IX9A 3KWFA 5KWJA 1BCRA 3WL7A 4G5XA 1CRLA 3M81A 1E5TA 3VISA 2Y2VA 2XUIA 1A7UA 1BN6A 3OOSA 2C5GA 3V1NA 1JFRA 4ETWA 3AILA 5JZSA 3VXKA 2WIJA 1XZKA 4QWWA 1JJIA 2HDWA 5CT5A 2OCGA 1QFMA 4B7ZA 1W4LA 3ILSA 1BN7A 2XUFA 4X97A 3C70A 2OGZA 3FNBA 4OU4A 2HIHA 2OAEA 4DGQA 1PFQA 3HYSA 2H7CA 1XZLA 3WYDA 1GGVA 3AZPA 5EIEA 5AOAA 3ESCA 4G8BA 3ANTA 1SCKA 2XT0A 1YR2A 4G9EA 1X2BA 4OSEA 4I3FA 4JEIA 3ZI7A 1QZ3A 3HSSA 2W6CX 4AN1A 1H2XA 5AKXA 2PVSA 3FYTA 1BS9A 4E15A 1F0PA 1XZBA 4G4GA 5AHXA 3SK0A 3D59A 4BYMA 5EFZA 2Y2UA 2WFLA 5JAOA 5E4JA 1QONA 3EBLA 5LP1A 3QBJA 5CH5A 3V1KA 4QLOA 1M33A 5F4ZA 3I2FA 2JGJA 4FLEA 4I4CA 5AKZA 1CUBA 1QIIA 1W76A 4DYHA 2C58A 5AI8A 4BRSA 1WB6A 2HA7A 1UWCA 1MAAA 2WHRA 4Q05A 3C8HA 4QEKA 4TVKA 1YSCA 2D5LA 2WUEA 1QIFA 3A2LA 5ISMA 2VSQA 1S8OA 5AIAA 5K3CA 1LLFA 2PL5A 3P2MA 1ZJ4A 4FDMA 5D6OA 3F9CA 2QT9A 3R3XA 5A7HA 1DINA 1BCSA 3G7NA 1UFOA 4Y2QA 4OCZA 4QDOA 5AIBA 4WY5A 1CVLA 1MNQA 3F97A 4ITVA 4GBGA 4BC0A 3DD5A 3B3QA 4XWGA 4DMHA 4U2DA 4F60A 3ZPXA 3G0DA 4G9GA 4KACA 4KE7A 4EY7A 3FBWA 4HRXA 3WK7A 4BCBA 4WJLA 4FBMA 5ALXA 4ROTA 1QIEA 3WJ2A 3G9XA 3O95A 4Z49A 4BZZA 4UBNA 5JYCA 2VT6A 4JYMA 1XZIA 2B9VA 4U2GA 2DHEA 4J0JA 2VAVA 4QE3A 3WWDA 3GELA 3L1JA 2JGMA 2I3ZA 3FWHA 4KRYA 3QVMA 4WDRA 1CUIA 5HF9A 5KREA 3WQHA 1MX9A 3FYUC 5D7BA 5JAHA 2XDWA 2J4FA 4FLFA 2H7YA 7YASA 5C81A 1R50A 5ALIA 3EF3A 4QDZA 4Q3LA 1AZWA 3C6XA 3QM1A 4W1QA 1XRQA 3ZLUA 4AZ0A 1BRTA 2EEPA 3DLTA 3PUIA 1CUYA 4I19A 2PM8A 5AM3A 1WB4A 1D07A 4BZWA 1CUGA 4X71A 3ESBA 2PUJA 3WWOA 1YCDA 1XRNA 5T4EA 1E8NA 3OTQA 4J3JA 4EY5A 5AM5A 1PJAA 2WJ6A 1XLWA 4L72A 5AM2A 1UOQA 3D0KA 1G4HA 5HQ3A 1EDEA 1U65A 1XZDA 2XQGA 1R3DA 1VOTA 1GXSA 3H18A 3IB3A 3FVRA 1E8MA 3STUA 1WHTA 1Y7IA 5CT4A 4ZWNA 4RNCA 3ICVA 2AXEA 5JATA 4NMWA 5HZGA 4HXFB 5DJ5A 1LZLA 1XQXA 4OB7A 5ALEA 4FKBA 1BROA 4HRYA 1XFDA 2HA2A 5JD6A 5K3EA 4LKOA 2ECFA 2XQFA 1UKCA 1W75A 3D4LA 5LZ2A 1QIMA 4W63A 3CN9A 4DLNA 4AN0A 3G0GA 1G66A 5AKLA 1E66A 5A7GA 1EVEA 5AP9A 1UZAA 1YA8A 3WL5A 3FVTA 2RHTA 5ALZA 1XZAA 4AX4A 1DWPA 4PSUA 4X94A 1RP1A 2K2QB 2VJDA 2HA3A 1ZI6A 4J0IA 1UK8A 2PU5A 5HKBA 1CUEA 1NU8A 5AK5A 1GPNA 2NW6A 3I2JA 2XQKA 3VJLA 4U2BA 5CTAA 2Z5GA 5EHNA 4B82A 5ALTA 2GBGA 2JGEA 4Y2PA 1TCCA 3G0IA 5ESRA 3EQ9A 2V97A 4CCWA 2QRUA 2VQ6A 3LCRA 1L7RA 1FFBA 3R3WA 3LP5A 4J0GA 1Z68A 2J3DA 4PO3X 1XZFA 1YAJA 1ZIXA 3ANSA 1Q0RA 4INZA 3WKAA 4XIIA 4AXBA 1SFRA 3I1IA 3YASA 4OB8A 1CUHA 1N5MA 4DTCA 5C8ZA 1N5RA 4EBBA 3BDIA 1ACJA 4CI9A 2B20A 5CBKA 4M0MA 5I8PA 1TK3A 1JI3A 2CBGA 4G1FA 3WZMA 2HU7A 2OG1A 4P9NA 2WU3A 1CUVA 3WIBA 4W9RA 3FLAA 5HKAA 1WPRA 4ZREA 4H18A 4BE9A 5AKIA 2QM0A 1XRPA 4D9JA 5CH8A 4C6HA 4DMKA 3VVLA 1KU0A 2XUJA 5ALJA 2XMSA 4GW3A 1AX9A 1FFCA 4KAFA 2HA6A 2ZYSA 2XQJA 1K63A 1BEEA 1DT3A 3KD2A 3FCXA 1DQZA 3G0BA 3V48A 1VZ2A 2WFMA 4PV7A 3A70A 3RLIA 5HF6A 3TJMA 2I03A 1ZI9A 2FJ0A 3I28A 1C4XA 2WQZA 3M83A 1N8SA 2WM2A 3DCNA 5AKYA 1IUOA 5LZ8A 1ODTC 3WKEA 4FLMA 4BB0A 3MUNA 1JU4A 1TRHA 3STXA 1UK6A 1HQDA 1FFEA 5AJHA 3G8YA 4K6HA 1ISPA 4GECA 1EHYA 1ETHA 2ZSHA 4CCYB 2XQIA 4MQMA 4Q82A 3I6ZA 3NWOA 3WK4A 1DX6A 4B6GA 3WK6A 1USWA 1VJ5A 3LS2A 3O4IA 3HC7A 4HAIA 2DR0A 4YPVA 1Y37A 3B12A 5DNWA 4RGYA 5C7YA 5FV4A 1TKRA 2E3JA 3AIOA 4CCYA 1NU6A 4NS4A 2GYWA 2PBLA 2YXPX 1SOMA 3ZLVA 2OCIA 2DSNA 1XKTA 3R3YA 5ALHA 5HF5A 2OGTA 2PUHA 1ZJ5A 4UBIA 3WIOA 1VKHA 4U2FA 3RARA 3H0CA 3N2ZB 2CEKA 5SYNA 5T4HA 3F96A 3V1MA 4YASA 5E4YA 5JASA 2BFNA 4FFVA 2WG2A 3WA7A 3ICWA 5LZ7A 4FFWA 1O6GA 3BWXA 3QPAA 3QPCA 4X7BA 4DMCA 1CUXA 1UK9A 3PF9A 4EA6A 1L7AA 5CT6A 4Y9SA 2JGKA 1XZHA 1Y7HA 3I2KA 1QFSA 1XLUA 1GPKA 1QIHA 2ZYIA 3QMMA 5C8XA 2ONCA 1B41A 2DCMA 2Y1KA 2HA5A 2XMGA 1GKLA 3IVMA 3C8DA 5C8VA 3KXPA 5BOVA 1DQYA 4YX9A 1E89A 1CEXA 4LXGA 4X85A 3OC0A 4HXGA 2ORYA 4UBKA 1MTZA 4H7FA 5CH3A 2IITA 5IKXA 5CRIA 4ZXFA 4KR0A 5CMLA 1OCEA 4JUIA 3HJUA 1P0MA 5AKKA 5IH7A 4XJVA 4W1RA 3NOXA 5IVDA 3LIIA 2C0QA 2C7BA 2HHAA 1R4ZA 1T2NA 4H7JA 5AK4A 4X6YA 3ED1A 1QIKA 1WOMA 5EHQA 1X70A 4N8SA 1EVQA 1FFAA 2HADA 2VF2A 5JARA 2WUGA 4WDQA 3PFCA 2GYVA 1QIDA 4FMPA 4AMZA 3H2JA 3T52A 4BP9A 3JW8A 4E11A 4BAZA 5HCUA 4JNCA 1TCBA 1LNSA 4H0CA 2Y6VA 3Q8WA 3PDCA 1H2ZA 5EI5A 3WKBA 1MN6A 4UHDA 2PSDA 2HA4A 1K8QA 3WL6A 1EK2A 4Y2SA 1ZOIA 4X92A 1JT2A 1CFJA 1VZ3A 4HS9A 1QO7A 3W04A 3CCCA 4B83A 2XUKA 1DU4A 4J0DA 1QJ4A 3BF8A 4PNZA 2BUAA 3VKFA 4MYSA 2C4HA 3GUUA 5JAUA 2ZYHA 1QIGA 3D7RA 4B80A 3NUZA 3RK4A 2V98A 3AFIA 3DDUA 3PICA 2QXUA 4CG1A 1ZD4A 3E0XA 4FHZA 1HLGA 1YB6A 5FPPA 4X91A 4EY8A 5AH0A 2PSJA 5K3FA 3MUOA 5CXXA 1L7QA 3R0VA 3HXKA 4X3CA 5FRDA 5FLKA 4LXIA 5FUMA 3OM8A 3QMWA 1FFDA 1ODCA 3H1BA 4ARBA 3SWWA 4OYYA 2FUKA 2X5XA 2DHDA 4Q1VA 4HVTA 1VE6A 1XKLA 2FX5A 3D2CA 1CUJA 3IULA 2QXTA 4LXHA 1ZICA 2RGUA 5DTJA 4OB6A 5EIAA 1QLWA 3TRDA 3I6MA 5CXUA 2DQZA 2WTNA 1YS2X 2WTMA 3BJMA 1DWQA 4OD0A 2OQIA 1CQWA 4DNOA 5AK3A 3EIOA 3FLEA 1RWQA 3GZJA 1CUCA 2PX6A 2XLBA 1EINA 2QKYA 3BXPA 4C4XA 2C5FA 1DT5A 3DNMA 3O9VA 1IUNA 4UBJA 4QDTA 4ZV7A 4WFJA 3WK5A 4GDMA 4DNQA 3S8YA 2OGSA 3D5EA 2CUTA 1WB5A 4IHAA 5KBYA 3WK8A 5BWBA 3QMVA 1R9NA 4L9AA 3BJRA 1OILA 2PSHA 3EQ8A 1I6WA 3H2KA 2ZSIA 1EB8A 1MU0A 4UFOA 1LZKA 3I6YA 5EIHA 2I78A 2Y6UA 2EDCA 3CN7A 3ZLTA 3IDAA 3O4JA 1EI9A 3K9BA 4ZI5A 4JH0A 1A8QA 2QR5A 2CJPA 4PQEA 5K3AA 1DWOA 2AJ8A 2G5TA 5T4BA 2WFZA 4G4IA 1QO9A 4H35A 5ALOA 4HXEB 4KE8A 2JGLA 2J4CA 2XUOA 4QNNA 5DYYA 5JANA 5ALYA 3OURA 1LPBB 3WWCA 4CIAA 2G5PA 2OPHA 3QZUA 1X2EA 1JKMA 1GQSA 2HM7A 3PUHA 1MX5A 5AKGA 2YH2A 1XLVA 3D2BA 4J03A 2RI6A 4LYEA 1UOPA 1YB7A 1RYYA 4UHHA 2HRRA 4ZV9A 4BVLA 4MWSA 5AI9A 3O9MA 3WWPA 4X93A 1A8UA 1H23A 4KAJA 1QTIA 2WIDA 5AI5A 2WIFA 2H9YA 4G8DA 1N1MA 3IURA 2RAUA 2ZJFA 3C87A 1ZI8A 3VDXA 3I2GA 5CW2A 4PW0A 3FCYA 1ORWA 3Q0TA 3ZV7A 4X95A 5AKJA 1QIJA 4JYPA 4GEGA 4QZVA 2QJWA 4QA9A 1J2EA 2OAGA 3OPMA 1R88A 3LIPA 2QVBA 1ORVA 3WA6A 4QDUA 2QZPA 3PFBA 3ZWQA 1GZ7A 2ZJ6A 2XMBA 1THTA 1TIBA 2VTVA 1LPPA 1DTEA 5BWCA 1P0PA 5ALMA 2ES4A 4UPDA 2HFJA 5FXMA 3W2TA 4J0HA 4LHEA 1W52X 3BIWA 3E3AA 1MJ5A 3FSGA 3BE8A 4BDSA 4EZIA 2O2IA 2WJ4A 3M82A 2PSEA 3DYVA 4FTWA 3W9BA 3L1IA 3E4DA 3VJKA 5HFAA 1NX9A 2AJLI 2EDAA 1DX4A 3FSGD 5SYMA 1WM1A 1ZD2P 2XMCA 5ALNA 5A7FA 2DQYA 5DTIA 3ESDA 1LBSA 2XMQA 2ZVDA 4CG3A 1YAHA 3F8SA 1Q84A 2G63A 2PKYX 3QH4A 5HF8A 1AKNA 4L3WA 4EY4A 2BCEA 4KJXA 3C5VA 4N5HX 2GZSA 1W6RA 2VJBA 4MEBA 3W06A 4Y2YA 4PF1A 4QLAA 2R11A 3AINA 1LBTA 2PSFA 5K3FB 1SC9A 1CV2A 4B84A 2QOEA 3V9AA
chains in the Genus database with same CATH superfamily
4FKMA 3O6VA 1FY2A 5F1PA 2G0TA 1YR6A 2Q3EA 3RU7A 2W6PA 4YT2A 5ITWA 1UBEA 1ATZA 1RU3A 1KPHA 1JFVA 1LLQA 1YZNA 3EFEA 3IS3A 2ZVQX 1JHMA 1TAHA 4FSXA 1R0YA 2DBVO 3GHHA 3QE2A 1E3QA 2BONA 2QRZA 3DV9A 2IHNA 1A5AB 2OT3B 3N74A 3ETCA 3TNLA 1JGTA 2JAWA 2RGNA 2VATA 1OLXB 2P35A 1R0LA 1TLLA 2X4IA 3MXTA 4H2DA 5L3ZA 5BVGA 3TGPA 2XSZA 4CKCB 1BC5A 2WHXA 2ZIZA 3AF3A 1A9ZA 3IE0A 3HJTA 1WD7A 3ZHBA 4EG7A 2TMDA 4YMTA 3B1JA 3DMTC 2WNIA 1BU5A 5KJFA 4F0JA 2E55A 3QUSA 1L5HB 1P1FA 2PNJA 2NZWA 3LC2O 5HDBB 4JKOA 2KPOA 2Q0XA 2ZI4A 4HCJA 1NNLA 1F4PA 3CKYA 3RJMA 2NTNA 1Y4DE 1ZX1A 3BD6A 3CJQA 4L8WB 3TZQA 5CLGA 3RYHB 4OLHA 3VFDA 5DNUA 4KBFA 2Q21A 1NQ5A 2E1RA 4QO8A 4F3RA 3R9XB 2BKEA 4X7MA 1IAVA 2A3RA 1EUCA 3FRIA 4FYMA 1KSJA 3M70A 4UTOA 2FZCA 4PNPA 4Q4HA 3FD8A 2LD4A 4MVJA 2VAWA 1NIPA 2EKDA 5KKAA 1EXNA 5KTKA 2O19A 4G5RA 3N0XA 1NI5A 2AXNA 5ALPA 2O3RA 2R9VA 2HJVA 1XL1A 2QD5A 3F2VA 4ZODA 1JKFA 3RTBA 5CDGA 5TGDA 3LRPA 2IPNA 1DQNA 4J9VA 2IWHA 5BW8A 1HTTA 3FYUB 2A0UA 4WECA 5B1DA 4ZCTA 2WKWA 2L42A 3O4VA 3MTQA 1WU8A 4H17A 4EA7A 4BMNA 2PZMA 4V3CA 1U2GA 4KNVA 2AA3A 1FUIA 1DP4A 2YUTA 3FMPB 4HWOA 4MWCA 1XZNA 4GBJA 3KO8A 3S28A 1USKA 1U3VA 3U5ZB 1XLTC 1KSHA 2B1QA 2PY6A 4DABA 2F3SA 4ZCPA 3PNVA 4LOJA 5DSXA 4ZVOA 3UKOA 4BKUA 3SCZA 1Y9EA 3RU2A 3OZRA 3L0IB 3K2QA 5DM4A 1ZPDA 3RBZA 3ZXXA 4DJ5X 5CEEA 2X2OA 4Q16A 1J9EA 5MGNA 2RHWA 2FN8A 3JAWA 1I3LA 4QFBA 1I3CA 3AUUA 2H65A 3W5AA 5FBVB 2QD3A 1GKKA 4K9QA 3KQPA 4O33A 3SQXA 4W82A 4IEFB 4MGIR 2B4RO 3JTEA 4CGZA 3EFOB 3R41A 1VKOA 4FWIB 2UVQA 3PKZA 3DMNA 2GPAA 4M87A 4MV0A 2AI1A 4JUCA 1UKAA 3M2TA 4TS4A 5ERGB 1PI3A 2R62A 1OFIA 3E2MA 5DPMA 4NZZA 3UUEA 3ZUPA 5K0EA 5KNDA 1UMCA 3SG0A 1TXGA 3AVTA 4CQMB 1VI5A 1VPLA 5HTOA 4DF3A 1XTBA 4CKYA 6GPBA 3WKDA 3OQMA 4M4SA 3IMEA 4CWAA 1ACMA 4CN9A 1Q17A 4BLOA 1IAQA 1DL5A 3Q10A 3F9IA 1O96B 2AEEA 5AWFC 5I9BA 4MW7A 3RVOA 3BDVA 1OAOA 1BE1A 5JDCA 3K73O 4H0NA 3I30X 2CHQA 5DGHA 5JNUA 1TEXA 1PZHA 3HKEB 2B78A 4CEIA 1IEVA 2XMRA 4MV7A 4ZOAA 4TLBA 1YVDA 2C3UA 2WDPA 3H5OA 4MVJI 2HWWA 1GCGA 2QPLA 3EIWA 4P81A 1MJGA 3AUJB 1SHLA 1EUQA 3SAJA 2IZ1A 1SU8A 2O0HA 2O7VA 4HDSA 4LJ7A 3ZE1B 1COWD 3HO1A 1XAIA 1ZNQO 2VPPA 3W77A 3VPCA 2CCKA 1ZCZA 1P2GA 1IJBA 4CUZA 1YDFA 4Y2TA 1SY7A 2YWHA 4BQOA 5A6VA 5KOJB 2Q6OA 2FFRA 3ORQA 3P9XA 5DB4A 3NNNA 5BV7A 2PZKA 3GLHB 3L0ZA 2VTBB 1UXOA 2GHQA 1D7AA 4K3UA 1EDDA 3I42A 1E18A 4OXXA 3QEJA 4G36A 5IKPA 2DWUA 1WXFA 4EB8A 2ZYWX 1BGWA 4B7CA 2EL9A 2YMQA 4IIDA 2O06A 4XFKA 4D5GA 4IJ6A 4JP3A 1Q21A 1P7WA 5ALVA 2JBAB 3JVUA 4NAVA 2BFAA 3ELWA 1VI6A 2C83A 1HT1E 2R8BA 3PFGA 4HWSA 5F9HA 2F62A 2SKCA 4IG4A 4Z7QB 1F9EA 2QD4A 2WJYA 3ND9A 1N57A 3FCCA 5T6BA 4QQ8A 4ZQIA 1FNSA 2IUEA 2PWYA 2V9ZA 1Q7GA 2VJYA 3E27A 5LYYA 5A02A 2KS6A 2Q7XA 5LP6B 3TEJA 4MITA 4DBLE 2PHZA 1R6XA 4RAOA 4W1PA 3HHPA 2G9VA 3WMGA 3NDJA 4B81A 3B1ZA 2XITA 1KORA 1HLFA 1EP9A 4ZAVA 5FOXA 5KS2A 3ER8A 4LDNA 4RD6A 3RNOA 2G9RA 3BGVA 4C4ZA 2FSIA 2J3IA 1Z74A 4D9HA 2I2FA 1NF9A 2NVOA 3AESB 3I8XA 5JD4A 2ZSJA 5K3DA 1I36A 5FL7D 5F5LA 2DERA 5FHQA 3NHMA 3PC6A 1ZRHA 2IHYA 4CM1A 5I7UA 4CODB 4BVBA 1KKLA 5KSPA 3EJWA 1IN6A 1PL0A 3RI3A 1BOOA 4HFNA 5K4GA 3BL8A 4UM9D 2IV2X 2P78A 2PS0A 1ZU5A 4CF6A 2JH8A 4D80A 3VM6A 1E4YA 1M2EA 5BQ5A 2A1TS 1AZTA 5LKRA 1W4RA 2BEKA 3DKVA 1D1SA 4HB4A 4M89A 1UPCA 2Q6LA 3LOQA 2NVUB 4GUAA 4OQEA 1E2UA 2WKPA 1FBNA 2CNKA 4M22A 3CQ9A 1N3LA 5ELMA 4BGUA 1G6HA 2GI4A 3OT5A 3SHVA 3IUJA 4GMKA 4W7HA 5GPBA 1CSEE 1G3UA 4MDYA 4W9NA 4ZGBA 2QBYB 3BD8A 2IIBA 1KR2A 2Q62A 3NGMA 3IUEA 4C0HA 4EENA 1NT2A 1AXGA 4HSEA 3URKA 4U39A 2POQX 3GUZA 2CVZA 4NZOA 4E3ZA 5FOQA 3I5XA 1K2WA 1VCMA 2H4ZA 4YGXB 2B3DA 1UQTA 1Z6QA 2HBZA 1HEYA 1R2QA 3NYIA 4TLEA 4EHDA 3OX3A 1LD3A 1YASA 3K2IA 4HZUB 1MAWA 2Y3IA 4U5XA 4R8KA 1RWMA 3GA0A 3T7RA 1ACLA 1BYUA 1RQLA 3IRUA 4XR9A 1XHFA 3WY9A 3VRHA 1KOGA 3I9KA 1BSVA 3G2NA 4M0PA 1OROA 1O5TA 5JSQA 1ZUWA 2IGTA 4IHKA 4MW1A 1DWUA 4ZI7A 4TLAA 3SIRA 3UWMA 1AC5A 1ZVVA 2O48X 4F4IA 5DOZA 3AY6A 1JSCA 3MB5A 5I7OA 4QBIA 1IZ7A 3IX7A 5ALQA 1U7WA 1UPAA 2IEGA 1L8LA 3NH9A 4F9FA 1DEOA 4H7EA 1OT3A 1SKYB 3QU2A 4KBYA 2B21A 3IA2A 4MGHA 1YCGA 2ECPA 4IDDA 4UULA 2GLUA 2DWOA 2WF6A 3WB1A 4YCAA 3RUFA 3BREA 3SYNA 2H1SA 4AF7A 3KETA 5JJIA 4I81A 3BQ9A 3L40A 4YMUA 2BUBA 3AZOA 1D8AA 4PIPA 5EMMA 3THYB 1G20E 4YMIA 4R7GA 1PS9A 1T43A 2P5YA 4JYZA 3ASUA 1N2SA 1H6BA 2ETXA 3KOOA 4M6WA 5HZMA 3HB9A 4WL0A 3OFJA 3DAPA 5AVQA 2W22A 4PX3A 3TVDA 4LPKA 4QASA 4MIKA 5EHIA 3O2NA 3OE7D 1IJFA 2E4WA 5CW1A 4AYXA 4EFDA 1GA1A 2P77A 4Y2RA 1WKBA 3LCMA 2AG6A 3C3MA 1QH1A 3GGSA 4F8EA 3N6XA 1TQ6A 2FPWA 1DRJA 1CUSA 4IYRA 1CCWA 1PZNA 4CZ2A 5IEJA 1X77A 2FKNA 2L82A 3LDHA 5A5VA 3QE4A 1NF8A 4ZI7B 2ZDHA 2O0LA 2P11A 5KEIA 2FQXA 3RVSA 1Z63A 3ERCA 2TMKA 3OF3A 3ZDZB 2I7DA 1L7PA 3PEWA 2HA0A 3AFNA 5EJ6A 1RXCA 4PFJA 1FMTA 4NYJQ 5ETJA 1NLMA 1BFDA 1AUXA 2E6UX 4MAFA 1CPYA 2V6JA 1JQJC 2RAFA 1PF7E 5DULA 1ZD1A 3WWZA 1CVIA 1S89A 2O7RA 1G8YA 1MPXA 3FAKA 4RPKA 2Z3WA 2NU9B 1GN8A 1GVHA 3FX2A 1BX3A 2EKZA 4ACBA 3PYLA 1GG9A 2M9MA 2X9VA 4V2IA 5J4LA 3RC3A 1OXUA 2GCNA 3FWNA 2AQHA 1Z4MA 3EZ7A 1CBUA 1RQXA 3A6ZA 2H2FA 1KOJA 3DJYA 2IUUA 2GPTA 3W1VA 3UK0A 1B76A 1G41A 3GPBA 4G3XA 2DHRA 1XZCA 3LFHA 3M1YA 3SYLA 3QYAA 3NHSA 4LNUA 1LNQA 1T35A 2CKDA 2HCJB 1XTTA 2O2SA 2HK8A 4WY8A 1JHRA 4HK4A 4H08A 2QRGA 5E3JA 3WLEA 4YJGA 2FH5B 4MCAA 5JAQA 4J3NA 2C98A 4RTLA 4B85A 2C1EA 4N3AA 1NM5C 5DNAA 3I9OA 4IIXA 3OBBA 4CLXA 3K6KA 5HKKD 1U98A 3ISTA 2FSHA 4Z9BA 1PK7A 5LXTA 1O0CA 4ER6A 3HR7A 4LYDA 4BNYA 1V6SA 3TTYA 3WDLA 1O6FA 4IMIB 4QD3A 2QHXA 1T9KA 2XMZA 4N0QA 5BN5A 1NAHA 1W2WB 4ZYLA 3GRFA 2Q2QA 2NUAB 4ERXA 2Q1WA 5M29A 2BSXA 3AK4A 3MRXA 2GPYA 2RFLA 1VXOA 4ZPXA 1QP0A 3AU8A 4FYWA 4ZO6A 3RU3A 4YQFA 3ED5A 4HS4A 1Y6JA 4II2A 1J06A 3WRXA 2GZRA 4ESOA 4MQFA 3U60B 4IMPA 5AICA 3HUTA 4IFIA 1WE2A 1P4RA 2IRWA 2VTKA 3FTFA 4YP5A 4K2AA 4D1YA 3HA2A 3KKKA 4D99A 1Q12A 4AMYA 2IH5A 1U2DC 3C5CA 5EMJA 1YZGA 1OW3B 3D3NA 4ZO7A 1GPWB 4WA8A 3KSAC 3Q7SA 1KAOA 3LTNC 4MKXA 3AEYA 3C7KA 3GJSA 1XL0A 3GRCA 4HEHA 1M6VA 3X1KA 4B2LA 4F5ZA 4HAYA 2BGNA 3ESZA 4WK0B 1H2EA 5CDFA 2WLSA 4YT4A 3OLYA 1TVCA 2J85A 1QGUB 1ZGAA 3IO3A 4K5QA 4CLOB 4EW3A 4HTAA 2ZB7A 2J32A 3UNXA 1YULA 4Y6SA 4KUGA 1JEDA 4JFAA 4YCDA 4KLAA 4WLEA 3VOAA 4BNGA 4CE6A 2C3OA 4IP0A 2ZROA 1M7HA 2QQEA 3LUGA 4ZRDA 5AVVA 3DKKA 4U0JA 1B15A 4KQCA 4PIMA 1X80A 4BVAA 4C6TA 2FSFA 3LC1O 1GGEA 3ZKAA 4DRYA 1U4SA 4Y2XA 2PRJA 2L18A 1R6VA 1H5NA 2WC1A 2A1UA 2XNSA 2YNMD 1SUEA 3AYZB 4PX5A 2NU9A 1T3LA 1Y6ZA 2OXEA 4MR9B 4E6PA 4UASA 3FW1A 1PV1A 1P75A 1VG8A 4N9WA 3EIFA 4KH1A 4AUEA 1VSTA 1TW2A 3JQFA 3DE2X 4HDSB 2FEXA 3BH6A 1NSYA 1JIQA 4WVLA 1Z4OA 1JFSA 2J3KA 3CUSA 4J94A 3AR9A 4PM4A 4Q34A 4G09A 2Q07A 3MJFA 4GQIA 1FLAA 3ECAA 4NV3A 4B0OA 3ROFA 4KB5A 3SFZA 3HPQA 2JB9A 3DS8A 1MRZA 3BD7A 4MLCA 1UK7A 3MELA 3ROGA 1RI4A 5IMSA 1KYTA 3UMRA 3LRTA 3HKBB 3VHLB 1J2TA 1Y8AA 3RVDA 4DA9A 2UUCB 3FZYA 1DAOA 1H8HD 1RABA 1A2OA 1Z75A 3E1SA 4DQKA 1OT5A 2OSVA 3RDPA 4JJIA 3WSTA 5L7TA 3AVWA 3FNIA 3OOHA 4H27A 5U4QA 1RRPA 2Q5EA 1XQ9A 4MWEA 4LY0A 3EHEA 3QLUA 4IGKA 1HT2E 5FO0A 1JAZA 3F3YA 4RXMA 1A82A 4DZRA 4DSZA 5L9AA 1HNZB 3DC7A 5EVJA 3IE2A 2PJUA 2GEKA 3GFSA 2XMDA 1THGA 2QW8A 2LR0A 2WB4A 4ZQHA 2PMKA 4WZBA 3WMRA 3H0EA 121PA 3VR0A 1ZD5A 3EXG1 2O8DA 3DAHA 2WEKA 3EFOA 4UEWA 2YWCA 1GZDA 1VI2A 2ACEA 5LQSA 1YOBA 3S1AA 1KRXA 1E6CA 1CUUA 3G9ZA 5I7SA 2PQMA 4WXHA 1KEKA 4FB4A 2P1ZA 4IEEA 1IWOA 3UATA 3DZBA 1V5GA 3DFIA 5EWJB 3UJ3X 4YK7A 1ZOOA 1M8JA 3DSRA 2Q2VA 4EYSA 4G0UA 2A9JA 3MTIA 4KAAA 1EPUA 2HU5A 1N6PA 2FLVA 2VLIA 3BUSA 2FPLA 4LOIA 3DBIA 4HUQA 1C9KA 3GMSA 3RJ9A 3F4LA 4DANA 1D6JA 2YN2A 3V1LA 2CWDA 4Q6WA 4QULA 3SC3A 3VDQA 5KMGB 2UUBB 3ZE7A 1MW9X 2BGIA 1KARA 3L4BA 3VNAA 4RE6A 1MHTA 1ZAKA 1L6IA 1P7PA 4JSRA 1BNCA 2W2TA 4FCVA 3W90A 4BGVA 4ZVMA 1ZCJA 2ZM6B 1P4AA 2QW0X 1Z2NX 2NO0A 2QZSA 2H2DA 3FSEA 4LUCA 4CV1A 1CZNA 4C7MA 3CNLA 4KSCA 5J1TB 2GARA 5KKNB 1VMAA 2F1RA 2ATCA 2I4LA 2Y1OA 2H29A 4JX9A 3VKHA 3D3KA 2FHSA 2JI9A 3D8BA 3FMOB 3QKRA 4HGZA 4UBOA 1HSOA 3O9ZA 1O54A 4FFBB 2YINC 1FFWA 1KH2A 1THZA 3F90A 5B6JA 4DNFA 3C41J 4IH9A 2G9ZA 2O3JA 2G71A 3B3AA 3X1ZA 3OEED 4O2BF 5HIKA 2GYUA 1X86B 3HMKA 3PFIA 5FWYB 5TMDA 1K75A 2PVCA 3RKSA 3WG9A 1FFXB 4OXKA 2I62A 1XWIA 1AZLA 5GP1A 1JQKA 1VGQA 2PN1A 2HEGA 3GLUA 4M86A 4QOIA 4E14A 4V24A 4YQZA 2YN0A 3Q3EA 3DOHA 1D8TA 1ISMA 2A0WA 3LFTA 2AZDA 5FOUA 5BN4A 5LB2A 5K3OA 5CA0A 2WJ3A 4WKOA 1UH5A 2BSQA 2QN3A 5BMVA 3Q12A 2HTEA 3OJFA 5K6TA 1IOVA 1VCIA 2VP5A 3O75A 4N76A 1HKHA 1UM8A 1YC5A 5FTLA 5ALUA 2VDJA 2ODQA 2R66A 1ADCA 3M5PA 3LUKA 4Q4AB 3SLGA 2YHIA 1VP3A 4JBGA 4PGHA 4C89A 5LQUA 2G1PA 3KQHA 3EVEA 4NRDA 3S2ZA 4HYTA 3F98A 4B7UA 4N48A 3NM6B 3ZHXA 1W88B 5ITVA 5F3WB 5JIBA 1ZVJA 1ZK2A 2GJKA 2HEIA 3CISA 5FFNA 5JVDB 3DKIA 2XEDA 1DC3A 3UV3A 4WT7A 4I46A 4MEAA 5JZ9A 5LZ9A 1JIXA 2ERXA 2MMCA 1NRXA 4OU5A 5F3DA 4NE7A 4LFAB 1ZK4A 3R6GA 2FPUA 1CD5A 3PPVA 2I1VB 1EHIA 2DMRA 3CZRA 2IWRA 1X7HA 5GJBA 3G68A 4RY8A 1I2CA 1Z0KA 3DFKA 1XNJA 5DXAA 4H1VA 4O2AF 4XA8A 4E22A 1CZRA 5F2EA 4HO1X 4Q1EA 1N2EA 3OZDA 4DXDA 4JASB 1H2RS 4B9AA 4OHOA 4Y9DA 3E1GA 3A0UA 5L7WA 1UKZA 2RJOA 3MWKA 3S3TA 4PZPA 1KY5A 4JLDA 3FSRA 3KSRA 1TYBE 4AI6A 1H0HA 3TZ6A 1JIKA 3M0EA 3QVWA 1XZQA 2CXOA 1QBKC 5EYPB 1W4CA 3R7LA 3PSHA 4HQRA 2RGDA 1K3TA 3STVA 2PMCA 2B36A 3MSCA 2DFDA 5CFLA 3KALA 4ZARA 4YRNA 1HNXB 2X14A 2QJRA 3TSWA 2E82A 2WHYA 2GFHA 2EIXA 1GRQA 3OFND 1N1DA 4H3SA 3H1EA 2WMNB 1J0DA 3WLAA 4I4TA 2IXFA 1NR1A 2VVTA 1XOIA 2V7PA 2FZWA 4V1CA 3Q8XB 3P2YA 3MOGA 4N12A 4EM6A 3HXMA 3NOVA 5ADUS 5LSAA 1XZMA 2GK7A 2X8BA 3N86A 4CM9A 1OYVA 1IEXA 2DBZA 4YRSA 1H5QA 4ESVA 1XTQA 3ZHZA 1HH4A 5LMCA 3OU6A 3KQNA 5J63A 1RZVA 4Y2VA 2PGDA 4CI0B 3DHVA 3JSXA 2C8KA 1NJ1A 1UPTA 1DADA 2PYZA 3D3QA 3HU5A 3R7AA 3U4DA 4B4UA 3Q98A 5AKHA 5F1KA 4RD0A 5TE9A 3WLPA 3WYNA 4UFPA 3B1YA 4YRDA 2GF0A 4G5GA 1XB2A 3HCBA 1CIJA 3AL2A 4FGJA 2NSLA 4FONA 1W4BA 4PG6A 1FQJA 2ZE6A 4BIMA 4JV5B 3C3KA 3LE8A 4Q01A 1NNSA 2WNSA 3RUIA 2H7XA 3M5DA 1NAIA 3L05A 4QYIA 1QPBA 1NASA 4GGOA 2BFDB 3KKZA 1PEDA 1J90A 1HYBA 1RZRD 1RXSA 4J43A 3T3IA 1ZM2A 1RM5A 2RHLA 3ABSB 3DEHA 1EMDA 3KE9A 3L0PA 4IRXA 1UOOA 4JJGA 4RZXA 3KV3O 3HCPA 1YE8A 1RVDA 4OBBA 5AKEA 3S99A 1UJNA 4REQA 4WOJA 3NRJA 1DCKA 2OV8A 4O4IB 3RS4A 3KUDA 4EF5A 5HK8A 5EJ2A 2C29D 4GGPA 3A1TA 3OG9A 4BAGA 1H4TA 2R7MA 2I2BA 1KY2A 3B8EA 1NUAA 3JR7A 5LZ5A 4RSMA 1YDHA 3N87A 1J24A 1K6JA 2FVYA 4L57A 1ZISA 4HYEA 4AMVA 3RFCA 1DDIA 2OLJA 4MEJA 5KTPA 2X4LA 3L1KA 4MYCA 3SFTA 3LWBA 1GRVA 4EHFA 4F2PA 4C87A 2X8AA 4UMEA 1ULZA 3SYMA 3STTA 2HRCA 4AQDA 5JPCA 4FS8A 4L6CA 4Y30A 4DA6A 1CYEA 1VMKA 2LDXA 3PI6A 3DP9A 4KMOA 3I05A 1ZCBA 4NK5A 5TVGA 3B6MA 1XA3A 3Q41A 4AO8A 4FE4A 1M2VA 4HFRA 3KDAA 1EH5A 2G0AA 4UAGA 5ESXA 5C5CA 2QVYX 1NBMA 3KHUA 1FNBA 3ZWWA 1RYMA 5K6AC 1ZN7A 3JZAA 3ZR4B 4FWTA 4KFSA 2JGNA 1NFFA 5TQ2B 3QPWA 3QX9A 3VHRA 3ESRA 4FWBA 5AOBA 1WMAA 2P9QA 3GDHA 4MQUA 4MCJA 1NVTA 3TUJC 3ZWYA 4KE6A 3MWDA 4K03A 2R86A 5F77A 5AVTA 1J49A 3FNEA 3M3DA 1L5SA 4MYRA 1OA0A 3FOZA 2Q9UA 2XUGA 3BTSA 1J99A 3KLNA 2OBFA 1EA5A 1Z7GA 2OO5C 3COVA 3EG9B 3AF4A 3UICA 1AO3A 1N36B 1R4MB 3EGXA 4IAOA 1NE2A 3RSFA 2CZQA 3A1FA 4GICA 4BMCA 5IVKA 1ILEA 3DFUA 3H9BA 4GXNA 1NN3A 1IZ0A 3AB8A 4HN9A 5DGDA 3RV4A 2HN9A 2WD8A 4W8OA 4BO6A 5IWCA 4NJEB 2J30A 2JIQA 3CUKA 1RHRA 5D3ZA 3F6SA 1SC6A 2WYHA 4KR9A 4G0VA 5TIIA 3Q7RA 2IOQA 3CF2A 4M8IA 4EL5A 2FRDC 2IPMA 1DAFA 1GUBA 2OG2A 1GGMA 4L9WA 4CM4B 1K6XA 1QCCA 3CW2A 3L1HA 3OM9A 2P62A 4X62B 2LP4Y 2JIDA 1UINA 1VCOA 4R3WA 4CIWA 2B4YA 1JBQA 1CJMA 2BEVB 2COUA 4JB3A 2ZG6A 3E7DA 3U0VA 2DZDA 1T8PA 3V4LA 4X64B 5KYNA 2FGJA 3VR5H 5IJXA 3K9FC 2E5FA 5IKMA 4FR5A 3VZRA 4PFKA 4BE4A 3R3UA 5AI0A 4H7KA 1DFHA 3LZCA 1RLIA 3EWNA 4MW5A 1QU2A 1U4NA 3KSUA 1RKVA 4P58A 4GZMA 1V9CA 2EV9A 4XVUA 3QUCA 4NFLA 3DF9A 2ZBDA 3KZKA 4XYGA 3R5HA 1OA1A 1XUOA 2X3FA 1XQVA 1YC2A 3SS8A 2JFHA 4BRZA 1YA6A 3GL9A 3RAEC 4TXNA 1HE2A 1P1JA 1Y9AA 1TYAE 5KWJA 2XRYA 2H8KA 4ECEA 3O74A 4G5XA 4BU0A 3CZCA 1V5WA 4E13A 4M1QA 2HIGA 2DPXA 2P2DA 2V0GA 3UAWA 1RNLA 4J4HA 1QH8B 2XX3A 3OFNA 4CIVA 1KVTA 3M6LA 5T67A 2Y2VA 2X2EA 3D8TA 3IHWA 1RYDA 4HQKA 4ZAYA 1HSZA 2WJAA 3R6WA 3WHPA 1C7FA 1YHYA 5KPDA 4BY9E 2C9ZA 1GG5A 5ADVA 1JHVA 5ELXA 3ENKA 5EWLA 1ZRMA 1JHQA 2PWPA 1Z3CA 1V5EA 2QJTA 3OSZA 5CNKA 4BMXA 2DCUA 3VO1A 5IEBA 2OO3A 2OKCA 4CQJA 5TARA 1RXWA 2ILTA 4CJXA 1W4LA 2VHVA 5JQGB 1JKJA 2PGAA 3C70A 2R60A 4BO4A 7MDHA 2OAEA 1E2KA 3JVDA 2X7HA 3OUZA 3PR2B 3RVKA 4DGQA 2F8SA 1Q2XA 1YZ3A 1SHKA 5LL6P 4D4JA 1CZHA 5IUJC 3HYSA 4Y3UA 2C2XA 3R7WB 3OTOB 4RIFA 3GMTA 1N6OA 4OMUA 3U4MA 3LECA 4JQYA 5I7EA 1GGVA 1Z35A 4PZEA 3NBXX 2JH3A 3DUFA 3FDXA 3GK3A 5AOAA 2F9MA 1QYRA 4M83A 4JBLA 3UWDA 4G8BA 5FFFA 2P6NA 3PQ7A 1YJ8A 4UVGA 3ZIAA 821PA 1P19A 4Z1OA 3MGBA 3PZBA 4NAUA 2RCNA 1XDZA 2QQ5A 3ZJYA 1UJCA 2GKGA 4GXQA 2E85A 1YR2A 4US1R 4E1BA 3S1AB 1PRYA 1Z06A 4I1VA 2X7XA 3TVTA 2C97A 5C35A 2J3EA 4DRXB 4D9CA 1IXZA 4GT1A 3TSAA 4FC6A 1A2BA 1F0KA 1J42A 3QQPA 4OQ4A 4WZBB 3CKMA 4Q18A 3KNZA 5THKA 4DR1B 1TA4A 3OCZA 3WB0A 3W6OA 3UBTA 3EUFA 4OSEA 4XYBA 2M2IA 4CT0A 1WABA 1BGXT 1ULBA 5KQSA 4I3FA 2PUVA 3QEMB 1BKYA 1EQ2A 5JDIC 2ERCA 3RVNA 1I5RA 2JIPA 4DLXA 2E21A 1CZLA 1QYXA 2WT4A 2IF0A 3KSZO 2OR3A 5AKXA 4QPJC 2X8JB 3O73A 4YRGA 4FR0A 4CTKA 2MTBA 4OGKA 4C3ZA 2ZXFA 1BS9A 4E15A 1ZC4A 3ONFA 3A37A 2I2CA 2Q4DA 3E9QA 1WW8A 1X15A 2LKCA 3G2HA 3NKLA 4NBTA 4Q7EA 4BNWA 2WV9A 5LJLA 4G4GA 5JMWA 5AHXA 4QJ3A 1RRFA 2QD1A 2ISCA 4KO3S 4BYMA 1K88A 4JFRA 1JFLA 3G2OA 3P20A 4O4LA 4OV6B 3LGSA 5E4JA 4I4TF 4KHPB 4LOAA 4TQGA 4EHAA 3ONWA 1UMBB 1X1SA 2NYVA 3B51X 1V7CA 2LZ0A 1SBCA 3I37X 5JXGA 3GT7A 5CH5A 4QLOA 5F4ZA 2ZJ8A 4HEA6 2W37A 1Z26A 2Q5HA 2YZNA 3LT2A 3Q11A 4M37A 3OCUA 1JE0A 2X41A 2Z3VA 1I7LA 4LVCA 4OHZA 2A30A 3KL2A 3QWBA 1QIIA 1ZGJA 3GLKA 1JZSA 4DYHA 1PGPA 4PLGA 3FNGA 3CBGA 2FXIA 4PTZA 2ZBQA 3C3WA 1NKVA 1MB9A 3THOA 4NZPA 1G9SA 2C58A 3H13A 4YJDA 5AI8A 5EJGA 3ZZUA 4ZZ1A 4NABA 2GZMA 1W19A 1W0KA 3RV3A 4IBOA 1GSHA 2NPFA 1YSCA 2GCPA 4Q00A 5LBUA 3WX0A 4BX3A 2LIVA 2WUEA 5HWSA 1DUSA 4CMEC 1RKBA 1QIFA 2WZBA 2NUPB 3A2LA 5ARCA 3IEXA 4KQ1A 4CM6A 3ZDCA 2ZJ0A 4BNMA 5DISB 2O7SA 5A5EA 5EJ8A 5K0TA 4YCJA 3MILA 4D9NA 1WEKA 2BTOA 5AIAA 2PL5A 1EWVA 2NACA 2P1DA 1DIRA 2CFSA 1X1CA 1JVSA 2AC4A 4GO1A 1C1YA 1A7JA 4IIJF 4ND5A 4B3DA 2VPQA 4LI0A 5FQNA 3EIUA 4QPPA 4BKMA 2AN9A 1SK8A 1X8XA 4NIMA 4Q1AA 3G7NA 1UFOA 3ZE2B 3LUAA 1CNFA 2W7TA 2OHVA 2XOKD 4RA9B 4AKGA 1P3DA 2YIJA 1OUMA 1Y1QA 1JTVA 2ZR0A 1U3FA 4HGNA 1XE3A 5KYWA 1NBHA 2R8YA 1T8RA 1FUEA 4JJZA 4ITVA 1QNFA 1OZAA 2OKGA 1DAPA 3AR8A 4W5NA 1NNEA 3DTVA 3DD5A 3AHCA 4U7FA 2EZTA 3WGJA 4G5OA 4BECA 3B3QA 3IDFA 5ES3A 4D56A 4HQOA 2GN6A 3EAQA 2GPNA 3D7NA 4ZHQA 4U2DA 4GXRA 1PDOA 3AB3A 4YNBA 5E3IA 1Q92A 4R7TA 1SCBA 3E9YA 2AUNA 2Q41A 4G86A 3HBMA 3G0DA 3T1TA 4XH9B 1XMVA 1ZK1A 1JTEA 3GJ6A 3I3OA 3JD0A 1I32A 4KE7A 2CE7A 3KKNA 3TIXB 4D7AA 1W7AA 1UPFA 1BAPA 1Q1GA 2RHGB 4HRXA 4RVHA 4TS3A 4TUYA 4LZOA 1T5HX 3RTGA 2Y1EA 4BCBA 1ZD8A 5P8WA 5ALXA 1HA3A 1V4BA 2GF2A 3OJEA 5ERXA 2OVFA 1XCBA 1JB1A 4YUWA 4UHJA 1KY3A 1NOIA 2AR0A 4D2IA 1YQQA 1DARA 4EYKA 5KNBA 2A9VA 3GJ0A 3CH6A 3IVXA 4X44A 3DHWC 4MPRA 2IDJA 3WGMA 1K4MA 4AP9A 3T5TA 1FTNA 5K7SA 2DFNA 2CFCA 1E4EA 3C97A 4K9MA 3S29A 3W34A 4B6RA 1BTOA 3AVXA 4NYIQ 1KEVA 1ZLXA 1XWFA 1N2BA 2B9VA 1ZEJA 2GJ4A 2J5BA 1W5BA 2Q3FA 4HY3A 4O2BB 2R00C 5DYGA 4D9FA 2I7TA 3IPYA 1USGA 4MW4A 1GCIA 2GZ3A 2F1IA 3L1JA 3N2GB 1ICEA 5CIWA 2JGMA 2I3ZA 4U5QA 5J9FA 4BV3A 4KRYA 3R7BA 3D54D 3EVNA 3KZ1E 3QVMA 4U7PB 1BDJA 3KLBA 5D7NA 4LDQA 3GW8A 4BN5A 4Q4JB 4GR9A 1Q15A 5JLJA 5HF9A 4G0YA 4ZQFA 4CM8B 1O87A 4J4TA 1K06A 3L84A 1TK9A 2CNWA 1DAKA 2Q6VA 2WT9A 3RFTA 3WQHA 5F9FA 3FYUC 1GNRA 5D7BA 4EGQA 1GKIA 4RC9A 5ENVA 3GIWA 1N78A 2O54A 4TMVA 4AU1A 5JS1A 1JLLA 1FXSA 1CJBA 1UJMA 7YASA 1ZDMA 5C81A 3NHPA 1PL6A 1C0EA 3HY3A 1BGVA 2H2WA 3EF3A 4FQ7A 3TLGB 5FPKA 3B1KA 1YIDA 2HH9A 4JQZA 4MTLA 4U9IS 4D26A 3QM1A 5PGMA 1K2VN 4R4JA 1LF5A 4RVUA 4QJ5A 4PNEA 2VBIA 2FU5C 2QJOA 4AZ0A 2V45A 2QAGA 2BFEB 3TZBA 2C4MA 5EUMA 3CUTA 5JCJA 2ODPA 1L4KA 5T7BA 3QNWA 5C1PA 3IYLW 1CUYA 2WK1A 1I2DA 3JQ6A 4QL3A 4UE2A 4KPEC 3TQSA 2CMKA 1FW8A 4G5FA 5FR2A 2MSLA 4DJJA 1ML4A 5EY5B 4DCPA 1Y98A 3TZHA 1L8OA 2H48A 3JALA 1VRCA 4JA0A 1PV2A 4LYGA 4RQUA 3KXKA 3D3JA 4I66A 1I3MA 2CLFB 2X0KA 4P22A 1XRNA 4CMGA 5JFTA 1C3JA 3AF5A 1CG6A 4EY5A 1M6EX 2FJUA 2I8CA 1PJAA 2ZUVA 5IYZA 1S1CA 1XLWA 1QB8A 2BBWA 3JSAA 3PFNA 4G24A 3WVNA 4CNBA 1GPMA 4RF2A 1PNVA 4NYMQ 1UOQA 1WNFA 3D0KA 1FJXA 1G4HA 3P52A 3V7YA 3GXBA 4UMDA 3HKCB 5HQ3A 5AVJA 2A9PA 1YQDA 3G6WA 4W8GA 4EMTA 3MMSA 1RYHA 1TECE 1ZYUA 3L2OB 4WZAB 1GG8A 3H18A 4BWYA 1A4UA 3GZ4A 4QBFA 3VZSA 1ULAA 4GMFA 1UQUA 2B7BA 1C4WA 2O3UA 1WHTA 3AR7A 3DV0A 3TR6A 1YVPA 2G3YA 4LJ9A 1JH9A 1CNMA 2C95A 3WYCA 5JATA 3DHEA 3DL2A 4NMWA 2VXYA 3B36A 2OO5A 4MB2A 1UDXA 2ODAA 3COZA 3FF4A 4IQGA 1S1MA 2O8VA 4O6VA 1ZNZA 2Q4TA 3PXUA 4G5YA 4C6SA 4OB7A 4QXPA 3W7VA 4TS1A 2ZE7A 4UATA 3SXPA 3NKFA 3K4QA 2M6LA 1FSPA 2IYVA 3HEMA 4TQUS 3RM3A 3TTXA 4DVGA 1MDBA 2Z98A 1SUAA 2H85A 5K0FA 2CDAA 4B3FX 4OKIA 1JDZA 4KQHA 4B47A 4EABA 3ZD6A 2FF5A 1M8PA 1J0XO 3MNFA 5JD6A 2PKWA 3T5GA 1T5BA 2XQFA 3E18A 2GBLA 4INAA 4X8OA 5EJ7A 2XTZA 5DGXA 5GONB 3RBAA 3FHLA 2FPGB 2IHVA 3LBNA 5LZ2A 2I87A 3RO7A 3D8UA 4YP9A 1C1XB 2HB6A 2HK7A 3AW9A 3MCWA 1K08A 4JYBA 4W63A 1CT9A 4GGMX 3J7AC 1RWVA 5BN3B 1DAMA 3CLSD 3VSBA 3ZTYA 2YDYA 1C8LA 2JZOA 3DWIA 3FWPA 1WEHA 1WXQA 1TYCA 5E6UB 2F9LA 4F96A 1I94B 2VK4A 1OR8A 3I34X 4FFDA 2GLXA 1MO3A 1N0HA 3P9ZA 2D0PB 1XU4A 2BY4A 2XGMA 5EHGA 3UJ9A 2A8YA 2DE0X 5AKLA 5A7GA 3TR0A 4MPTA 3WNDA 1YBMA 4W5OA 3EBPA 5FWXA 5B2EA 4GM0A 2CSXA 4POOA 4TKLA 1NW4A 4D3YA 1X13A 4KN8A 4MPJA 3PGMA 4XZ3A 1G8FA 4ND8B 1POWA 1XCJA 1XZAA 1YVRA 1KAQA 5JAIA 2EARA 2BZGA 3ZHVA 2OORA 4X0EA 3V4FA 4PYJA 4V1CI 3A0RB 1D1PA 3JY6A 2X6RA 4GSYA 3ZG6A 3M4XA 4WV3A 5IBQA 3ZE0B 2PRYA 2PS3A 3NC1C 3BFKA 2AL7A 2VNSA 3TJRA 4P5DA 3VR3A 2VJDA 4LW8A 3GP8A 2RK3A 1RZ3A 4J0IA 4NECA 3PXBA 2SCUA 5JAMA 4D4GA 1NLYA 4EP1A 4F3YA 1SXHA 4RGQA 3KT0A 1FFYA 1GPNA 3L93A 3WYGA 2NW6A 4E2FA 2GZ1A 2AOXA 3I2JA 1RAAA 2XQKA 1OWPA 1QVRA 2OFXA 3GCXA 4QICA 3ZD7A 2RKOA 3DXXA 5K8LA 3U1VA 2XTNA 1O96A 2OAP1 1NP6A 1GDTA 3N07A 5BYBA 1P3Y1 1MTOA 1GNLA 2A67A 2ODNA 2VNKA 3LGAA 5EHNA 3UTCA 3VYSB 1Z07A 2GD1O 3D6HA 2GBGA 3HCAA 4EL0A 2XMPA 1CB0A 1KMHA 2ZTLA 3JQAA 3KOZA 1W48A 1TCCA 1NVWQ 5ESRA 4ZALA 3T1QA 4CCWA 3FHJA 4F2GA 4M1OA 3WLTA 2BI7A 3LCRA 1G21B 2G09A 3C3BA 1P5RA 2IZ0A 4LC9A 1L4HA 4KXQA 1FFBA 1QSGA 1XLTA 2Y1WA 4R1LA 1JYSA 3CLTD 4TSFA 5DN6A 5J5CA 1N6IA 4AJ9A 1Z68A 2J3DA 3DFFA 4LMPA 3USCS 1LSSA 1ST3A 1VHQA 5FNVA 2W83A 1GZSA 3NC0C 2YW9A 5JNTA 1ZW6A 3I1IA 3YASA 4E5PA 3BTVA 2N47A 4F5YA 2BFBB 2HAEA 4R6WA 1QPGA 2NTJA 3ODGA 2OFFA 4EUEA 1KI6B 3GJ5A 4ZVQA 4B3SB 1RYBA 3U3KA 3UK7A 2JIOA 1FC0A 3K9LA 3QLVA 5DT9A 4EG6A 2ZUCA 4WKGA 1IU9A 3I9FA 3DZGA 3ZYZA 1B74A 3A05A 3ROPA 5BW4A 2ODTX 4FZ5A 4TN5A 4M9UA 5K0CA 5J2TB 1YR1A 2EQ5A 1QTQA 3WAJA 3HA7A 2V6BA 3BDIA 3ZH9B 5GINE 3ONEA 1QFZA 1INLA 2BCJQ 4CI9A 5DNYB 1WW2A 2B20A 4GYWA 4FUTA 3I64A 1VLZA 2IYAA 2YRFA 4NYIR 1YD7A 5I8PA 4OHMA 2JEOA 2PJZA 4XWOA 3STHA 3QVXA 2BFEA 1JI3A 2CBGA 2GEVA 5ECDA 5BUZA 5J40A 2OG1A 4J6EA 4OGGA 3X1XA 2ZWAA 5IARA 3VU8A 2WU3A 3IBGA 1FQOA 1GUZA 4QUBA 5LXTF 1DNPA 1XRSB 2P2SA 3H2BA 4D0SA 3PNBA 1ADFA 4OF4A 4W7SA 2XD9A 4N3GA 1CP3A 3WWYA 3H11B 4RQAA 3WLHA 2W2QA 1CZUA 3TAXA 3LPMA 2GM4A 1NDUA 3TB6A 5EZ5A 2DPLA 3KQSA 3K0AA 1U2QA 4OHBA 2PYDA 3H1PA 2MINB 4BE9A 5AKIA 4WE3A 2QM0A 5SZJA 2J0SA 3OLVA 5CH8A 5E6SB 3AWIA 3Q4GA 5FA6A 3A4LA 2ZSFA 4C6HA 4FDAA 4DLYA 2JG3A 2GERA 1JDTA 5IC5A 1KU0A 4EGSA 1DBIA 2H0QA 3LHFA 3MWEB 3L18A 1IEWA 4K6CA 3UB3A 4PVCA 3I58A 1SVNA 5JNLA 1T15A 1KSFX 3ESYA 1AX9A 1FFCA 4KZKA 3AHGA 4MV6A 3TX2A 1WVGA 3K20A 4OGFA 2BTQA 4DCJA 1KNXA 4DUYB 2OCDA 3KD2A 4KQFA 1DQZA 5BVGB 2EZ8A 2UZ4A 1B2RA 3N70A 3V48A 4ABYA 1OLXA 1C3VA 1T91A 2MYNA 5AJVB 5FUBA 2WFMA 4AFNA 3F5FA 1XEXB 5A9RA 4XQEA 1KEPA 1V6CA 3PI7A 5B1EA 3GCGA 1W46A 3TUZC 1T10A 3SHOA 2KW5A 4YMLA 2BH2A 2NPOA 1Y63A 3RVPA 2JDIA 1IPHA 2OGUA 1DV2A 3FFWA 4Q12A 4RL6A 4CGYA 3J81k 1AQ6A 3PFKA 4JBYA 2PE5A 2GCGA 1JAXA 5JRJA 4TWJA 5IBPA 3E84A 4QUAA 2Y9MB 3N3BC 4OQLA 4OXRA 5C0OE 4D96A 4DB2A 2I03A 2KWIA 4BFLA 2FJ0A 3QG5A 1NBME 2QM8A 2O4CA 1C4XA 1KO5A 2WQZA 2L69A 1N8NA 3DOJA 3L8GA 4LRYA 4TQ9A 4EVSA 3DA8A 4B3GA 1SURA 3GB9A 5LOVA 4IXWA 4P3NA 1SKYE 3BKWA 3L8EA 1ISIA 1Q77A 1GZUA 3FVVA 3PXCX 4HQLA 1Z45A 4FD2A 4JGGA 4Q9DA 3RYFB 2CVHA 3VR4A 1KQGA 5I45A 4ENSA 2G5GX 2IXEA 4ER5A 5EP4A 3NVAA 1R8QA 1L5KA 2PZJA 3DCNA 1SOAA 4GLOA 1K6IA 1ZNYA 2AMLA 2EL7A 3FRJA 1IUOA 1QTNA 3H1GA 4LSGA 5DU2A 3UJBA 3VNRA 4YJGB 3ETJA 2D8AA 4BJ1A 1U3UA 4HC4A 5EXPA 3WKEA 3SQWA 4NBLA 1A9XA 4BB0A 3MUNA 3STXA 1PJQA 1UK6A 4DC9A 3OI7A 1S2NA 4M7PA 1L1QA 5IUNC 3WQQA 1VL6A 4ZYTA 3V46A 3G0OA 4GECA 3RPEA 2VHCA 1NBMD 1IK6A 2MHCA 5AJZA 4PAGA 1C3OB 5DZSA 2R8OA 4UDNA 2OESA 3EPPA 5MN4A 3VC3A 6CHYA 1A9RA 4QODA 3MJVA 1WZNA 4I7EA 4XFDA 5IBRA 2VH1A 3GIDA 4I5DA 1OXVA 3LL7A 5CDSA 1R7RA 4Q82A 1A27A 3EZNA 3NWOA 4U7JA 4F9EA 3CPJB 3TD2A 3AC0A 2C8LA 2HUNA 1PQUA 3ZH2A 2PUEA 1G2IA 2I1QA 4NNPA 3ITDA 3AXTA 4LGVA 3WK4A 3EDQA 1DX6A 1KA9H 1SBYA 1UBJS 2R87A 5REQB 5KJ1A 1L4GA 1QZTA 4GC9A 3LL4A 1E2DA 1OU0A 4MS4B 1LDYA 1ZFNA 3LXRA 3A26A 4D92A 4CLRB 1FUUA 1NL3A 2VUSA 2YXEA 3LS2A 4GKVA 1OH8A 1UC5B 3MRSA 2HXYA 3O4IA 1V8FA 3WHIA 2PX4A 2DR0A 2C77A 4NMLA 3HL0A 2P9CA 3W9SA 1JA1A 2B92A 3ONNA 4DA0A 3E9NA 3GFRA 5A9SA 1ISJA 1UBKS 4FGWA 4DV0B 1CW2B 2FDXA 2QORA 4MR7B 3V4RA 4ENQA 1Q2UA 1TKRA 4RD4A 3FOAA 4ER0A 2CV0A 3R5SA 3KK0A 4I8XA 2OBBA 2OZLA 4H31A 3HLTA 5FORA 3DEKA 2F3QA 3W4IA 4NX2A 4JR2A 4QYWA 2OCBA 2YXPX 5AJWA 2WIBA 4N39A 3K0CC 1AXRA 4RV5A 1TPZA 3R7FA 1XKTA 3W5JA 2GEUA 3AEUA 4R5HA 3AF2A 2OGTA 2FHPA 2F1JA 1ZJ5A 2G25A 2JANA 4B3MB 3H97A 3AL3A 3QKIA 2NIPA 4KQ2A 4A6DA 3KCQA 2JAOA 3M6AA 3LPLA 3FAZA 4UBIA 2W98A 1PGNA 5E8RA 3GVCA 1VJ0A 1VL2A 2QE7D 4U2FA 1KRWA 1WV1A 4HPWA 2ET6A 1ZM7A 2KB0A 2GX6A 2SNIE 2Q6KA 4N7RA 2A1TR 2FZLA 3N2ZB 2P3QA 1ZONA 2GUWA 5SYNA 3TSCA 3DDOA 1XNGA 1J9GA 2FRDA 2JFFA 3DZJA 1SVLA 2MSEB 1Y1TA 3CZMA 2E49A 2BM1A 3O1LA 2HBYA 1U2TA 2O5VA 4A9AA 2ZXUA 1SQ5A 1DFGA 2HJWA 2BFNA 4IW3B 4AL4A 1CQJB 5GY7A 4HN4B 1UZNA 3K92A 4L6AA 2BGTA 5CIQA 3WC4A 5TV2A 3WA7A 5TMEA 5LZ7A 3OLQA 3Q40A 1SC3A 2IW1A 4P80A 1HZZC 4EG4A 3AERB 4ZEXA 1DJMA 3UV7A 1XCMA 4YCBA 4BKPA 4CKWB 2XKBA 4DMCA 4YDSA 4CTMA 1CUXA 7ADHA 5CVVA 1T25A 2Y4NA 4QGAA 1VMIA 2PRSA 3LY7A 3QXGA 2JGKA 3VR3D 1XZHA 2HIAA 3U7FB 3ZJUA 1K7FB 2D3TA 1QFSA 3K1YA 3LPNA 4RPJA 4ZTBA 3V2GA 2ZFUA 2IYEA 4FZRA 1DZ3A 2XB4A 1RWOA 4HZIA 3DBHA 2ZYIA 5CVDA 2OM6A 2N46A 4B2PA 5C8XA 3D6FA 3NJ4A 4LRWA 3A6KA 2D0IA 5A03A 1GA4A 3GEMA 5DI9A 3T38A 1XXHB 4JU8A 5CFMA 1M72A 4RHCA 5KOIA 3ST7A 3WLNA 2XMGA 4I55A 4IIJA 5E4FA 5LDDC 1GKLA 3TINA 3IV6A 3EXIB 2FFAA 4NP6A 4Q9LA 2PX2A 3MWGA 3TO5A 4LECA 2Z4SA 3H99A 3KYJB 3KXPA 1JAIA 4AIRA 3QIVA 4LC0A 5BW6B 2L17A 3WXMA 1ZCAA 2X0IA 3CNOA 3D7MA 4G1MB 4IEIA 2QSZA 3RVBA 2VNAA 2QYTA 3O7WA 3O1HB 3V97A 1FP2A 3PDHA 5DGCA 2R68A 3W6PA 1U0BB 5LBIA 2FB9A 4HRAA 5H1YA 2FE4A 4HXGA 5BV0A 4UVDA 1C8VB 2EHJA 2Y05A 2YOHA 1W47A 4H7FA 2R8EA 4OQMA 4ZJZA 1PBTA 2GTPA 1U8UA 1RDFA 1ZQ1A 4FEEA 3HU3A 4EKDA 5GM1A 5B4TA 3I5AA 1GAXA 1H69A 4CIXA 1YZQA 1D9XA 5FBZA 5HFJA 2AFIE 2IITA 2JJ2A 1U1FA 3EUWA 3FTQA 4IGFA 5FNVF 3VUFA 2ADOA 2IY9A 3NFYA 1PQ4A 2CVPA 1QM5A 4OREX 4ZXFA 5M3BA 4L1KA 3U7RA 3U56A 4OM7A 1E7RA 1OCEA 2AMYA 2V3VA 4I4LA 4XWWA 1P0MA 1GV0A 4RHTA 2QTFA 4XQ9A 1BXGA 2R5WA 1SPBS 3UAXA 4O2AB 5ICCA 2NYUA 3N2IA 4HGRA 4JN6B 3IMKA 1RJDA 2WKSA 3QUAA 3ZY5A 3A31A 3LGXA 3E5RA 2VRBA 2P4UA 1FMLA 4EPWA 1EVYA 3OZXA 4XJVA 3KJNA 2HXGA 4W1RA 2EW1A 5EESA 4BBJA 3ZY4A 3T7AA 5JZVA 3AEKB 2H0RA 2AK2A 4I1SA 5ED0A 1G5TA 2C0QA 2P1RA 2C7BA 1A1SA 3BMXA 3KPUA 3SBOA 1R4ZA 4YAUA 3GLGE 3VR6A 4AJIA 4IDAA 5DEIA 3ZOZA 1T2NA 3FJOA 2Z1NA 1MJHA 2GVZC 3LUBA 1Z5GA 1ZWKA 5KCZA 3AKYA 4X6YA 3T0IA 3ED1A 3VR4D 1X70A 4N8SA 1WCIA 1Z38A 4EQ6A 5H8WA 1WMBA 1B6RA 2ZUBA 4GRIA 2J3LA 2YN4A 1WMFA 1RM3A 5JARA 3PPYA 1PNRA 3UAOA 1FNDA 2GT1A 3IUBA 1EWKA 2C3YA 3PFCA 4GL4A 3KJEA 2QUKA 1Y1SA 4WDQA 2QDXA 5BYAA 1Z16A 1SXQA 1FDWA 1TJPB 1FS6A 1ZCFA 2H5JA 5EJ5A 1WDWB 1PR4A 3GYBA 2NXWA 3H2JA 3P2EA 4BP9A 1P33A 2A78A 3OJCA 1F5NA 4I55F 2O50A 2O4UX 2FPIA 1N1EA 3F8WA 3TXAA 4M1KA 3C5EA 4G0PA 3ITEA 4RY2A 3J80A 3M1LA 2C4TA 3ADDA 2ZRCA 3RSSA 4DDUA 3ENNA 3BH0A 3ABOB 4TMTA 3CRQA 2WJWA 3DMPA 3IEUA 3LVRE 1JL3A 2PQ2A 3QHQA 4H0CA 3RHSA 3S2EA 1NG9A 5CB4A 2XNCA 2ZJ5A 2HRZA 1AOXA 1X39A 3Q8WA 1WSDA 4C2BA 3PDCA 3UMMA 5EI5A 4P33A 1HFWA 4PGAA 4D9MA 5CB6A 1IHYA 5L6LB 1MN6A 3SX0A 5KYGA 3PXAA 1V71A 1IRIA 2FOIA 1S8AA 4JT9A 4EKYA 4BFYA 4PZZA 4WNCA 4HEQA 1NVVQ 1EK2A 4B73A 1GTRA 5KAMA 2FA9A 3EFHA 3GUYA 4WN3A 1I4OA 1ECGA 2WMDA 4YR7A 1M34A 1VZ3A 4JAVC 5EFOA 1FIUA 1U5CA 1X94A 4CHGA 4E32A 1U3CA 1KEEA 1U7PA 4QYMA 2WD7B 1P9LA 4F93B 3W04A 3QVGB 3U44A 2IUYA 3VO9A 4DLVA 5F3RA 1GNTA 1N0UA 4RD2A 2H9AA 1E7WA 3TX6A 3KBOA 3MGCA 4ZO4A 1SBHA 4F3KA 3NWEA 1NVGA 1P7ZA 3GRYA 5F12A 4BNFA 1M8KA 4IIJB 3F5QA 4O8CA 3L4BC 3HO8A 3A3OA 1XXHA 3P2JA 5DLDA 2C00A 3BF8A 3A04A 4DKXA 5CFOA 3NG1A 4OKSA 3VOSA 1TL7C 4D3XA 4EPXA 2C4HA 4Z4FA 2PLAA 3L8ZA 2IHUA 3JQBC 1I3KA 5ECWA 5KNDH 2AFHE 2AR7A 3B3GA 4I1IA 5LP6F 3B9QA 2A9RA 5KNBD 1SD1A 4CM3A 2Z8YM 3CURA 1QIGA 5M2QA 4XGIA 1O08A 2VBCA 2R6GA 3UJ7A 4RD1A 4QHTA 1QUFA 2LGJA 5KCMA 2JCXA 4YRZA 3AEUB 4WQMA 3NIDB 4MUGA 5E8JA 4N3NA 1EXMA 4OEHA 3DMHA 5TT1A 2QXUA 3GEHA 3MS7A 3W2FA 4CG1A 4ZK6A 4LYHA 4ZKDA 1Q0UA 1GGKA 3EGDA 3OT4A 3VPBA 3IL2A 2XKKA 1KI6A 2QDKA 3E0XA 1U9IA 2W2LD 1PLLA 2FE1A 4RXTA 2UKDA 3PUWA 3TIFA 1EU1A 4FHZA 3CNBA 3R1IA 5H81A 3LA6A 3C2QA 2A9OA 5DLQC 1YIAA 4IDNA 5J4HA 3DUWA 4TL6A 5EIBC 2QVXX 3SZRA 4KOEC 2VRCD 1M1NA 1FTSA 5EERA 3V8QA 2PX8A 2Z43A 4RLHA 3ZCVA 3P9KA 1WTAA 3PCRB 3R0VA 2Q5CA 3HXKA 4IHQA 1KYXA 1N9KA 1QWOA 2G82A 4FFNA 4X3CA 1FXWF 4OQFA 4ILKA 5FV7A 3T3DA 1XVTA 1EUYA 4BP1A 1SZCA 1YRQA 1ZOSA 4HI0E 1R37A 3ZHRA 1EG2A 1Z0JA 4L51A 4WBSA 4V0LA 3TCKA 4CLRA 1OAAA 3CS3A 2ZDGA 2EC5A 2F48A 5FUMA 2I66A 3JQCA 2GHTA 2UZ1B 3WL4A 3OM8A 1XSEA 4NBWA 1J25A 1XN4A 3MMZA 1GR1A 3OCCA 1PBNA 2QLMA 1DCMA 3CUWA 5DH9A 5DRYA 7ABPA 4PPYA 1Y7PA 5IN5A 2QENA 2R47A 3GN2A 4YQYA 5JS6A 4MVJG 5DI3B 1Y3AA 2UAGA 1FVFA 1NZFA 1K7CA 2W93A 2VF5X 2VYCA 4G0XA 3AW8A 4M0UA 5E95A 4BX8A 1BXRB 1C8KA 1CS4C 2GJ8A 1NVEA 1NW3A 3EZ9A 5HS4A 1RM0A 1PZMA 1IBKB 5A0FA 1VE6A 3I52A 3T5MA 3IOBA 3GDGA 2J09A 3K9CA 2ZRLA 1PDWA 1O94D 1CUJA 4EYEA 4C3VA 3IULA 3R6TA 2IP1A 1IPFA 5BQOA 4GWKA 3V6LA 1KNQA 2Q4OA 4QVKA 1XBTA 5BO5A 1MB0A 3GD7A 1DELA 1ZICA 3IAUA 4Y0AA 4RIHA 5DCWA 1QLWA 3OHSX 1PLJA 2J0UB 2PD6A 1UFKA 1RRGA 4BWFB 3ENQA 2WTMA 1P8AA 3BJMA 2HLDA 3O3CA 3CIFA 3E05A 2Z57A 1FLVA 4R31A 5BQPA 3S4YA 1MABA 1PR2A 1CJVC 1P9NA 2WWXA 3L0SA 5EP3A 1NW8A 2GDZA 3FUVA 3I6IA 1CQWA 1U0EA 2J0QA 4V0QA 1EBFA 4OYRA 2IZZA 5FTKA 1SIBE 3T7CA 2AT1A 5JFGA 2ZWMA 4ALMA 1ZUHA 1G55A 1YZVA 1TJNA 1YT5A 3MJDA 5HGXA 2IOHA 4HAUA 1I6LA 2XLBA 4DE5A 1JVNA 3BXPA 2PO7A 3GZNB 1L3BA 1HDCA 4E09A 3DNMA 1FMCA 2WNHA 1ZJYA 2FPGA 2H4JA 3UKDA 2DTXA 2J33A 4U7TB 1UKYA 1RW4A 4QDTA 4Q4AA 5TJHA 3AHDA 5F7OA 1P17A 3QYPA 3AM3A 1WF3A 4EUKA 1T2AA 1U2RA 3S8YA 1H94A 3R76A 4X7RA 1C7EA 4UTRA 2D1SA 4M8LA 1O6ZA 3L7YA 4KXFB 1T2DA 3KB1A 3PYXA 3DBRA 3VKWA 2FPSA 2BOVA 3ZY3A 4IHAA 2WOJA 3PWSA 1AF4A 4FT4A 3FWZA 1KMIY 2NXCA 5AXCA 5B6PA 5IT5A 1YKGA 5BWBA 1JUDA 3FIJA 4L9AA 3E9ZA 3FR7A 2QTZA 3ABZA 4DPKA 3P9IA 5LOVB 1EFKA 1LY1A 1T9HA 1XYGA 2AZMA 5FPSA 4WGGA 3R44A 4IILA 1RPTA 1KC1A 3A1DA 1ND6A 2H07A 2XE6A 3C4QA 5C5IA 2WU1A 1IG3A 3BBPA 1A4XA 4MI1A 5FTJA 2D54A 2CGEA 1O5OA 3RKUA 2JAXA 2V3WA 4EI9A 1CJCA 1MQAA 2OUIA 3QWAA 3ANYB 3RC1A 4AURA 4A2PA 4MUYA 4M1WA 2HNAA 4EPRA 4ZOBA 1DJLA 3TB4A 1QVAA 1J09A 3I6YA 3PJFA 4FHGA 1Y4SA 4O25A 3U4HA 3WLOA 1B23P 2I78A 3H84A 4DA4A 1U04A 3IVRA 3OQIA 1GAQA 1UPBA 1VFNA 2YZGA 5FIUA 4G0NA 1DXYA 3WNBA 2IC5A 5DTRA 1C0LA 2Q1YA 4AS3A 4WBNB 1G2PA 3EEYA 3LQ2A 5C9ZA 1U3DA 1MP0A 4JH0A 5IYZB 4DNXA 4MLPA 4HBZA 1VL8A 1RLUA 2X2FA 3GR6A 1PHPA 1E6WA 3EDRA 1ZEMA 1X1RA 3L6UA 3MWEA 1V4VA 3SJBA 3B13B 4OLAA 1TM3E 3REQA 4I36A 5CIYA 1SG0A 2ZJ3A 5ENDA 3G5MA 4ZVSA 4A8HA 1TJ3A 1EVIA 2G5TA 3SJ7A 2XE7A 5T4BA 5ITZB 4DSOA 4JUBA 5T8KC 2RH5A 2QN7A 4H35A 3ND5A 3N5KA 4B6EA 3UAZA 5TF0A 3E03A 3BD9A 1R6BX 3DEZA 5DMHA 3TLEA 3USZA 5HRCA 2YJGA 3H2ZA 4LZJA 4L22A 4WBNA 3ZVKA 1ZGHA 4GLFA 2YWFA 4QUEA 4E4YA 4QNNA 5JANA 4I1RA 5IH3A 4KLCA 4DR5B 3OURA 2B34A 1LPBB 1B1AA 2IE0A 2X5JO 3SVTA 1JRLA 1B8VA 1WULS 4CM7A 5B7PA 4DB4A 2G5PA 4ZK2A 2QEQA 2I3BA 2ETVA 4NESA 3EN0A 4Y98A 4G5SA 4L8VA 3FKJA 2WM3A 1YBVA 4LFCB 4EHHA 3E7FA 3IRVA 4TMKA 4Y6RA 5ITZA 1F2UB 5FUVA 1MX5A 3PJGA 2E4XA 3OHMA 4UM5A 1NQOA 1WBJB 1XDBA 2V7GA 2ZI6A 3KDSE 2HX1A 1LDBA 3JV7A 3L5OA 3OWOA 1T4GA 2YS7A 3AUFA 3AMVA 3PVCA 5DASA 1KH3A 2Q6TA 1P73A 4Q47A 4L4SA 4IS2A 1JTFA 4WCFB 1QQBA 3OQHA 4UHHA 5B58C 2IYZA 2GJ9A 4RM2A 4UCXA 1QCZA 1QE5A 3HKBA 4ZAXA 4YMWA 3R5FA 2A5FA 2JATA 3VOBA 1TAGA 4ATNA 4BVLA 2DR2A 1AHHA 4NZMA 4W5QA 3WWPA 3U0BA 4JP8A 4Q9NA 1NR5A 2XCLA 5KTSA 3MCAA 2WTUA 4Y9TA 1JPVA 1QLHA 3PCTA 3UT5B 2O5CA 3MERA 1T1IA 1DFIA 1DKLA 4XB6B 2WIFA 3INTA 5AI5A 5GIPE 4QBKA 3QU7A 3WOHA 4DMLA 4MQEB 3HCEA 1BS2A 5BQFA 1RC8A 1U1IA 2GM5A 1N1MA 1U0TA 1WQ4A 4L5CA 3GCDA 3IURA 4AJKA 3AB7A 3M6MD 1ZJJA 5LUBA 1DKUA 1KKMA 1YJQA 1Q22A 1ZI8A 2RAUA 3AV3A 4NPHA 4JLJA 4O4HF 3T34A 3AO0B 5TSDA 4QXMA 2CE2X 1A5TA 4LEIA 3Q0TA 1WDLA 3NHKA 3GD5A 5A2QA 2IHKA 4YJ2B 2II6A 4DV1B 1GILA 4N0PA 4AKHA 1JQLB 2NV0A 3TZEA 1CIVA 3CB2A 1KK1A 1HUQA 1YBHA 2QJWA 2C2HA 4WOKA 4HAXA 4QA9A 3SHQA 5A4DA 2V4UA 4GZ6A 4TKZA 3OPMA 3PP8A 4MWBA 2JHCA 4RETA 3G2JA 1I7PA 4IMJB 4W5WA 1HGXA 3LX8A 4F6RA 4QDUA 2QZPA 3FI0A 4COOA 4N49A 5B7GA 4EGJA 1ADJA 2IXTA 4ZU1X 4QOSA 3ZWQA 4C07A 2POCA 2DJ5A 2V1XA 1II8A 2P9YA 4RZ2A 4N0DA 4ZO9A 1ESMA 1GZ7A 1FF9A 4MQBA 2XMBA 2YCBA 2IH2A 1THTA 1TIBA 3IBYA 3WLSA 4LOLA 1LPPA 4RH3A 3ZZ0A 2NO1A 2EX0A 4GI5A 4HLDA 1DRKA 2E1PA 1XXHE 4UPDA 1BCRB 1W52X 2YR0A 3E3AA 4LBYA 2B8NA 3EF1A 4X9XA 5K4AA 2PXXA