4AOJA

Human trka in complex with the inhibitor az-23
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
260
Chain Sequence
ACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIGH AFFINITY NERVE GROWTH FACTOR RECEPTOR
publication title Discovery of Disubstituted Imidazo[4,5-B]Pyridines and Purines as Potent Trka Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 260
sequence length 290
chains with identical sequence B, C
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aojA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aojA01
4FEQA 3EH9A 4DGGA 3KK9A 3UOLA 4WA9A 4M69B 3DBQA 3EN9A 3WZDA 5BVNA 2W1HA 1JSVA 4BCOA 1Q97A 3SAYA 5CU2A 5AUYA 5L2WA 2VTAA 3EKNA 3F3ZA 1CMKE 3LCSA 4EHZA 3V5LA 5HESA 3QFVA 4IXPA 4QPMA 4C62A 2J5FA 3MFUA 4JX7A 5HLPA 3V5TA 1KV2A 2REIA 3ALNA 3IECA 2XK3A 1Q8WA 4OBOA 4R3CA 4ZTLA 4GUEA 5IQAA 3R21A 1IR3A 5L2IA 4HCVA 2I7QA 2QU6A 3MVLA 3HDNA 5GNKA 5CQUA 4CT2A 3UOJA 1VJYA 3PWDA 3H9FA 4J8MA 2VTHA 3VHEA 3VRZA 3DTCA 4IM2A 3OEZA 2UW4A 4NJDA 4PMPA 1BKXA 3ID6C 2PZYA 4ZTSA 2B52A 4WNMA 4CRLA 3SD0A 4GL9A 1WFCA 5IQGA 3R7OA 4BVUA 1J91A 3UO5A 4O86A 5FXSA 5JGDA 4D1SA 4E6DA 2R9SA 4XS2A 2OF4A 5A4CA 2E9UA 3H10A 4I92A 4Q5EA 5KNJA 1PXNA 4BBEA 3QQUA 2CLXA 5DEYA 3Q4CA 2E9OA 3LKMA 3JR1A 3MDYA 4RC4A 4JLCA 4R8QA 4IQ6A 4PWNA 3EJ1A 5GJDA 3TJCA 1L8TA 4D55A 1NT2A 5HI2A 4FKVA 5JZNA 4F7LA 2G2HA 4M14A 5CF8A 4LYNA 3RK5A 4ZSLA 3ZLYA 2VNWA 5KMNA 4FKPA 1Q99A 3QUDA 3FSKA 3LFQA 4DG2E 4KKGA 2CPKE 1W0XC 4L46A 4J97A 5A4EA 2JAMA 4ITJA 2B9IA 3QL8A 4V05A 4F0GA 4FE2A 2CGXA 3VUMA 4LV8A 5HBJA 4ZTHA 4U3ZA 3MTFA 3W33A 4X3FC 4MH7A 3LE6A 1PW2A 5J9LA 5IA4A 1AQ1A 5HE1A 4HGSA 4PMTA 3U87A 5E9EA 4S33A 5A14A 4FT5A 3GU4A 4O0RA 2ETMA 4NCTC 3D14A 3POOA 4XV2A 2PZIA 3QALE 4GJ2A 4RVLA 3QA8A 4ZMEA 5D12A 5EKOA 3VQUA 3VS0A 3RAIA 4O7WA 5I4NA 4BZDA 1AGWA 3D2KA 4D5KA 2PHKA 4F6SA 4PF4A 4WG5A 5E8ZA 1M7NA 2O2UA 1UKHA 4K11A 4ALWA 4CYJA 3ZO2A 4JS8A 4NL0A 4HW7A 3D4QA 2DUVA 3EIDA 4YR8A 4C4JA 5HO7A 3BEGA 4CFNA 1BL6A 4EC9A 4RG0A 3QQGA 4EK4A 1G3NA 5HVKA 3LCKA 4LOPA 3UOHA 4IZ5A 2V55A 2Q83A 3SXSA 5HG8A 5AV3A 2QI8A 1OL7A 1WBWA 3MY0A 4UWCA 5HD4A 3QD3A 4Z55A 3N4TA 3FLSA 1KOAA 1RQQA 5CU4A 4YGAA 4ZIMA 5CS6A 4I5PA 3R04A 3TIZA 2CLQA 5DHJA 3LQ5A 3AC3A 4X6RA 4WIHA 3F5PA 1ZMVA 3ALOA 3GEQA 5DRDA 4R7BA 4TYEA 5E7RA 5L6OA 5JGBA 4RJ4A 4I4EA 5M53A 3VF9A 2O0UA 5CAQA 4XX9A 1ZY4A 4AGUA 3VJOA 2FVDA 4QMTA 4ACCA 4D2TA 1H28A 4ACGA 5AA8A 3OFMA 3VAPA 1VZOA 3OROA 2GQGA 3LM5A 2HZ0A 3TTJA 4C3FA 2B9FA 1KE5A 3R8ZA 2CN8A 2F49A 2WTCA 5L2SA 2Y8OA 4V04A 3L8XA 2W5AA 3DLSA 1OL6A 3QTRA 3IDBA 2JC6A 2BRNA 4R5SA 1MRVA 5EW3A 5KKRC 3PXKA 4IX4A 1UU9A 5B2KA 1Q8YA 2RFDA 3HLLA 3BLHA 1Q8UA 2BALA 4QRCA 1GZNA 2XYUA 4RFYA 1UNGA 3AMAA 4GKHA 4G31A 3A7IA 4L44A 2WTJA 2YCFA 4UX9A 3UBDA 5A4QA 3D15A 2QVSE 3EQHA 4QYHA 3KK8A 2W17A 1YHWA 4E4XA 4G34A 4X0MA 4XV1A 1WZYA 3DK6A 3IW4A 3S2PA 3HV6A 4O0YA 3VS1A 3KRWA 4N0SA 3G9LX 2I0EA 2ETKA 3BE2A 3I4BA 3ZC6A 2J51A 2XNEA 5AX3A 4IX3A 4BCJA 3QTXA 4U6RA 2GQSA 1QPEA 2PMLX 1H00A 4U44A 2JKKA 2R3GA 4I3ZA 1JKKA 1DM2A 3VBXA 4DTBA 2X0GA 3EZRA 3PPJA 3BBWA 4FIFA 2UW9A 3AMBA 4RIWB 5I3RA 5GINE 4GYIA 4F0FA 2YJSA 4FBXA 4BCNA 4IJ9A 5FBOA 2XZSA 4A4LA 1H01A 3NX8A 3F5XA 3SA0A 3C0IA 4YZBA 4TT7A 2BMCA 3OBGA 4CV8A 3JS2A 4TYIA 5AUZA 3GU6A 2JFLA 3C4XA 1ZYSA 3D5UA 4BCKA 1R78A 4FV8A 1B6CB 2HW7A 4JI9A 2UW8A 5K5NA 5EYKA 3IW6A 2WIPA 3UVPA 4EK8A 3ZUVA 1DI9A 4XLIA 3GGFA 3I6UA 3P08A 4LOOA 4MNFA 5FM3A 3TNWA 4ZLZA 3PLAE 3OXIA 4A4OA 4FV4A 5D10A 3MGYA 3EN7A 3KGAA 2P33A 4BWPA 4FSZA 4I6FA 4CLIA 4GS6A 4E26A 2UZEA 4H3QA 3C51A 1PY5A 2ZV9A 1YWVA 2O65A 4NFMA 3CJFA 1H08A 5C4LA 4U43A 4RX5A 3ACJA 1UU3A 4UYNA 1XH9A 3E8CA 4MWIA 4U79A 4UZHA 3RWQA 3TM0A 5ANJA 3G9NA 3QHRA 3V8TA 3HMOA 2P55A 4IWQA 1I44A 3SKCA 4FNZA 4AP7A 3LCOA 4MNEA 4NJ3A 1H07A 4TN6A 4X7QA 5M4FA 4O0VA 1URWA 4YLJA 2DQ7X 3NUPA 4ZS0A 4L7FA 3Q4TA 3G6HA 4OUCA 3JUHA 5JRQA 3KULB 4NK9A 5M08A 4OTRA 3EQGA 3Q9ZA 5JH6A 3JPVA 3WOWA 3O0GA 1R3CA 2PUNA 4JAIA 1OB3A 3RPYA 3W2OA 1H0VA 3I0OA 4E4MA 4D1ZA 4H1MA 4UEUA 4UMQA 4YNEA 3V01A 4TYGA 4CTCA 3KXNA 1MP8A 3EFLA 5HD7A 3KMWA 4CT1A 2R0UA 3BI6A 3WZUA 5A6OA 3TV7A 1FBNA 1PXLA 2W0JA 4BDIA 2R3MA 3BELA 3L8PA 2ITUA 2R3HA 4UV0A 2BAQA 3KFAA 3MH3A 5EW9A 3ZUUA 3Q5IA 5CI6A 4BRXA 2E9NA 4HZSA 4DEBA 4E6AA 3KXGA 2IZRA 3GU8A 2OSCA 5G1XA 5AP0A 5FXRA 4F08A 3AC2A 3DFCB 3D9VA 4BCMA 4Y8DA 4E73A 3QZIA 3W8QA 2CKPA 5IA2A 5H9BA 1JQHA 3RHXA 1WBVA 4QYFA 4O1OA 5LWMA 4NSTA 4L8MA 2VX3A 3R00A 5M57A 1KE8A 2DS1A 4YJPA 4YHJA 4DH7A 5M07A 2OZAA 3UC3A 4HJOA 3MPTA 3KRJA 5DE2A 5D7VA 3RPSA 4ANSA 3R7VA 5D11A 1KWPA 2OGVA 3T9IA 3U55A 3T8OA 2BVAA 1Z57A 2QOHA 3GP0A 4QPSA 4QMPA 3AXWA 5EFQA 4BY9E 2X2MA 5IPJA 1RW8A 4CNHA 3ZBFA 3FZPA 2B9HA 5GHVA 2PVMA 2ZAZA 4RVKA 3DZOA 3BQCA 2ZMCA 2ZB0A 4YBKA 2QG7A 2YZLA 3OT8A 5IZFA 2F2UA 4AOIA 4EK6A 2ZV2A 2XIXA 1WBPA 3CTHA 3KREA 4E3CA 2HZ4A 5IH5A 4QQCA 5AFVA 5FP6A 3RZFA 4ONAA 3ORKA 1UVRA 2HWPA 2JBPA 4NWMA 5LVNA 2XJ1A 3HA6A 3WE4A 2VRXA 3GCSA 3ZBXA 4FKSA 5AIKA 5IEXA 3AD6A 3OXZA 3TKUA 4FIJA 4XNEA 2YERA 3MN3A 3VNTA 4KINA 4HVDA 5DMZA 4GU6A 4CVAA 1H24A 1OITA 4NM3A 3EMGA 5HG5A 2XEYA 3PIXA 3QLFA 4XG9A 2H96A 2SRCA 5C1QB 4S31A 4JBVA 1JLUE 1PXKA 3R02A 1H1WA 4IIRA 3ETAA 3T9TA 3OW3A 3R8MA 3NW5A 1H27A 2C0OA 4QMOA 4TZRA 2X2KA 2OU7A 4M0YA 2QQ7A 3TTIA 2VTRA 2YAAA 4J95A 3VQHA 3VULA 4E5WA 4G1WA 3OWKA 3DV3A 3Q3BA 4BC6A 4M13A 1FINA 3AG9A 3EN4A 4X6QC 2WQNA 3RI1A 4ANLA 5BYYA 4I24A 4L7SA 5IISA 3FMEA 5HIDA 4BBMA 4MVFA 2ZOQA 3AOXA 4XHKB 5CQWA 3ORMA 2YDKA 4X2FA 3HUCA 2BILB 4ANQA 1NW1A 2PZ5A 3QRUA 2CGVA 5ETAA 4BCGA 2A1AB 1BLXA 2IG7A 3CC6A 3OUKA 2OJJA 4KIOA 4EBWA 3ENHA 5ANIA 3NUYA 4PY1A 3VHKA 3DK7A 4HPTE 5GJFA 2WMQA 3OW4A 4FSMA 2IZSA 4HYHA 4ASDA 3RZBA 4GYGA 3NNWA 2UW7A 4FMQA 2G2IA 3K3IA 4JL9A 4K8AA 4PMMA 3W10A 3RP9A 4EH7A 5L3AA 4A7CA 5GZ8A 3ORIA 4FTRA 4LMUA 4BGHA 4O7LA 2HIWA 2YITA 3EQCA 3QQHA 4EHVA 1PJKA 4I5MA 4FGBA 1FQ1B 5JSMA 4JR3A 4G2FA 4DH1A 5J8IA 1G5SA 3QD4A 3FSFA 3FKLA 2WTKB 3A61A 5HE2A 1IA8A 4GRBA 4AE6A 3MH0A 3AD5A 2R3KA 4I6BA 2WAJA 3HA8A 2P0CA 2J0MB 2IN6A 1ZOHA 5I3OA 1IA9A 4EOSA 2W1FA 5TR6A 3QQFA 2NNWB 5FGKA 3ATTA 2XK7A 3FZRA 3SW4A 3U4WA 2OWBA 3OC1A 5DYJA 4YJTA 4DH8A 5HNGA 5HNIX 2F7EE 1H25A 3CPBA 5CSVA 3G6GA 4F4PA 3UQCA 2R7BA 3R01A 2V7AA 3L1SA 3NAXA 3RM7A 4BWXA 3EQIA 2JGZA 4TYJA 5FG8A 2WMVA 3II5A 1T46A 3TZ9A 5AAEA 2YHVA 4R7HA 5TO8A 4F9CA 4FSYA 2C6KA 3WZKA 1UV5A 3E3BX 2ITTA 3UZTA 5HEZA 3ODZX 1NVQA 3PP0A 2IW9A 3P7BA 4IB3A 3RAKA 4GFGA 3TNPC 1HOWA 4O22A 4IZAA 1OUYA 1FMKA 4CFWA 4NKSA 3SVVA 3Q32A 1UNLA 4V0GB 3SRVA 5H8BA 4CKRA 3BHHA 2BHEA 4O7TA 2OFUA 4XBRA 3FLZA 5M4IA 5HG7A 3VBYA 3PWYA 5E8TA 3HRFA 3EYGA 3R83A 5HE0A 4LFIA 4X3FA 5BNJA 5KZIA 2X4FA 1JKLA 2IJMA 2LGCA 3O71A 5AR5A 2YIYA 3NGAA 4JX3A 2BIKB 5I9UA 5IUIA 2PZPA 3FE3A 1DS5A 5HNBA 1NY3A 4M0ZA 3TDWA 5DRBA 5IQDA 5DWRA 4NCTA 1ZYLA 4BTKA 4QTEA 3HV4A 1W84A 4OAVB 3Q60A 1XBBA 3FAAA 1P5EA 2C3KA 4RX7A 4FT7A 3LXPA 4Y85A 3UMXA 3R9RA 2RFEA 3PA3A 4HGEA 3QC4A 5AR3A 5CWZA 4AT5A 3A99A 4C58A 4ACDA 3IGGA 4FNWA 3TT0A 4RIXB 3KF4A 3HVCA 4KAOA 5AP7A 5FD2A 3QRJA 3UVQA 4EQUA 5FDXA 2RFNA 3ZS5A 3PSBA 3FXWA 1Q62A 2R3JA 2UVXA 4NFNA 3WILA 1SMHA 2XF0A 3AT3A 3QQJA 4GT3A 3OCSA 2HZNA 5EH0A 4FL3A 4TYHA 4AGCA 4YZNA 3GVUA 3FYKX 3GU7A 3EHAA 4WSYA 4E5BA 4RIYB 2YAKA 2W1CA 2X8EA 4E1ZA 2R7IA 3BLQA 3FQSA 3V5JA 3WI6A 3LM0A 3DU8A 4BI1A 5F9EA 1Q24A 1OPKA 4FZ6A 3ZONA 2WIHA 4WD5A 3C1XA 4Z9LA 4EH5A 4LV5A 2PL0A 4GFOA 5E8WA 4Z16A 5JRSA 3R1YA 4AAAA 4IWPA 4F1OA 2QOKA 3PYYA 2BROA 1YW2A 1U54A 2XNPA 2C1BA 2YABA 4Y72A 1LPUA 3VBTA 5KMMA 4BFMA 3E92A 4KBKA 4FNXA 4ASZA 4EQMA 3BX5A 3UP7A 1WBNA 2QO9A 4AA5A 4E6QA 5AP1A 1URCA 2JD5A 4W4WA 5CEQA 3PTGA 3O8PA 4F9WA 4D58A 4JDHA 3PXQA 4DFYA 3WZEA 5M06A 4K2RA 2OJ9A 2V0DA 3FXXA 5L6WL 2FSTX 1R1WA 2VGPA 3BYOA 5T6KA 1ZZ2A 1GZKA 2HOGA 4TKSA 2X9FA 4MF1A 4ZEGA 4BI2A 4F1TA 5M4UA 4FKQA 4QP3A 2B7AA 2YISA 1ZYCA 3EQBA 1B39A 5CF6A 4L45A 3R8PA 3GCUA 2JDTA 1YXTA 5ANOA 3GCQA 5HIBA 3TNIA 3OHTA 3W2CA 4H39A 4D4RA 1JKTA 1JOWB 2UVZA 5AV1A 3TN8A 3VUHA 3DBFA 4YSMA 2ACXA 2JDOA 4LL0A 4X21A 4Y95A 5CYIA 1SNXA 4M3QA 4E6CA 2YJRA 1E1VA 2PVLA 2PZRA 1BYGA 1KE9A 2CDZA 1JKSA 2GPHA 2XM9A 3MA6A 2VTMA 5EW8A 3L8VA 4IAIA 4P90A 5LVOA 2X6DA 3FC2A 4JBOA 4PDSA 4F99A 4R77A 1BL7A 3QGYA 4A07A 2GFSA 2GNIA 3DDQA 5G6VA 1Y57A 5HO6A 3OUNB 3R28A 2C3LA 3E3PA 1CTPE 2JFMA 3LJ0A 3PG1A 4TW9A 5FEDA 3R9NA 2YIXA 3BIZA 3D2IA 3NUAA 4DEHA 2ETRA 4EJ7A 4WBOA 3A60A 1P4OA 3FMMA 2XA4A 4FTAA 4PUZA 5DOSA 4EOPA 1J3HA 2QR7A 5DGZA 3CPCA 3E63A 3PRFA 4D9UA 3CGOA 2BDJA 2WQOA 1JAMA 2C1AA 3P7CA 4IJPA 4FKJA 5TF9A 3L9PA 5K4IA 3ZM9A 4H3PA 4AG8A 1BMKA 1A48A 2R64A 2HXLA 4U0IA 5EQYA 3C4FA 3CBLA 3ELJA 4WUNA 4BR3A 4BB4A 1JVPP 2R4BA 1J7UA 2C5OA 5I9YA 5HCZA 3QQKA 4EWHA 1OKWA 4W9XA 2QOQA 1YI3A 4GVAA 3E8DA 4RFMA 5KZ0A 2XK4A 2YFXA 4FYOA 5KUPA 5FTOA 4DA5A 3BYVA 4XH6A 4JIAA 4KD1A 2VTQA 3FJQE 1KV1A 1IASA 2JDRA 2PVKA 3H9RA 4XOYA 3DGKA 2PWLA 3ROCA 4O2ZA 3I7BA 3UG1A 3VUGA 2CCIA 4JQ7A 1I09A 3OCBA 3ZH8A 4TWNA 5IA1A 5AA9A 3W1FA 3UGCA 2WQEA 4O27B 4MXZA 2VWVA 1BI7A 2WNTA 3ITZA 4NT4A 4QTCA 4U42A 3FLYA 4YUQA 3LXKA 4GIHA 3VS6A 3GENA 5HKMA 3D7TB 3KRRA 4MXOA 4H05A 2ZMDA 1CM8A 2OG8A 3GB2A 4FKTA 4AX8A 4HVGA 1QL6A 3LMGA 4XLVA 3NRMA 2XIRA 5E8VA 2Z7QA 3HAVA 5HU9A 3FZ1A 4O84A 2X7GA 4JVGA 1LEWA 3P7AA 1PMNA 3R2YA 5M09A 4NTTA 1YVJA 4YHFA 3QCSA 3SOAA 2P2IA 5BPYA 1FOTA 2EVAA 1RJBA 3A4OX 5DT0A 3C4EA 4CD0A 4R7IA 4FV0A 3C4ZA 2OKRA 5A3XA 3DS6A 4IANA 3MJ1A 3DBEA 3LLAA 4RA5A 4F6WA 4RJ7A 2C4GA 3UPXA 2XKFA 4C34A 3QX2A 4FT9A 3K5VA 4U45A 4XJ0A 3UP2A 4DFLA 3NNUA 3PA5A 2J0LA 3VUKA 1R39A 4ZSAA 3Q9WA 3QTSA 4RJ3A 4EH8A 2PMOX 2ITOA 5HG9A 3NCZA 4M69A 5DR9A 3ZLXA 2GDOA 2I0YA 2XNNA 4C2WA 3GNIB 4CGAA 2C5XA 5KE0A 2WKMA 3QZFA 2YCRA 3O50A 3WIGA 4GJ3A 2LAVA 3NYNA 4EOJA 4JR7A 3RALA 4QP7A 4FVQA 5HE3A 2YACA 4ERKA 3ORXA 5FTGA 4G9RA 4IAKA 4ZJJA 4AA4A 4KKEA 2WTKC 3KL8A 4AW2A 1YOMA 3PIYA 4G3DA 3DXNA 4CFUA 3HX4A 4YTIA 4AOTA 4L42A 5AUVA 5C26A 2VWZA 3UC4A 5LXMA 3AD4A 2HK5A 2UZLA 4TNDA 3TEIA 2BIYA 4D2SA 4DGLC 3VO3A 4DFXE 3G0EA 1GY3A 2OICA 3CQEA 1NVSA 4IBMA 4LRMA 4MAOA 4BHNA 4DGMA 1YDRE 5J9ZA 3B8QA 3FMJA 3FZSA 1OIYA 3LPBA 5FM2A 3C50A 5HGIA 2VWYA 3I7CA 3SXFA 2WB8A 2W4JA 4APPA 5CEOA 1Q8TA 4QP9A 3VWAA 5DR2A 4IDVA 4XG2A 5JZJA 3Q04A 5HORA 3PZEA 3BPRA 1TQMA 5HIEA 3OZ6A 4J52A 1UKIA 2R2PA 3Q4UA 1FVTA 2YWVA 4C3RA 2YLFA 3VUDA 3V3VA 2B4SB 1CKIA 3R30A 4QMYA 4Y73A 2WU6A 4Y5HA 4YTHA 1V0PA 4XMOA 3ROYA 4Y46A 3OY1A 3VIDA 2FGIA 1O6YA 1OPJA 4FV1A 5C03A 4AFEA 4KS8A 3KQ7A 4FTKA 4CV9A 1ZOGA 2FB8A 4EZ3A 4ACHA 3N51A 3CY2A 4KABA 5FTQA 5GZ9A 3QCXA 4EK3A 4FEVA 4A9SA 4L67A 3EFKA 4II5A 4IDTA 5AUUA 5KCVA 4TWOA 1O6KA 5D1JA 3RK9A 2PY3A 2X7OA 4L00A 1Y8GA 4AZEA 1F0QA 5JT2A 4ALVA 5IQEA 3DCVA 1IRKA 3C9WA 5ICPA 4OT5A 4YC6A 2C6OA 5DR6A 2E9VA 4C4FA 2CHLA 3AMYA 5C01A 3IGOA 1DAWA 3OD6X 4BIDA 4B6LA 4R3RA 1WBSA 3BHTA 4K6ZA 5IA5A 4D28A 2XNGA 4MXAA 2ITYA 2PVRA 1U5RA 4O7RA 3UIXA 4QMNA 2XH5A 2C6IA 4GG7A 4FG8A 4EZ5A 5AV4A 3RVGA 2C6TA 3Q53A 3R2BA 5EYCA 4IFCA 4U8ZA 2PUIA 1M2QA 2RIOA 3VBVA 4KIKB 4O0UA 4EI4A 4FOCA 2EXCX 2WXVA 3D5XA 4C4EA 5B2LA 4X2JA 2R3RA 3ZZWA 4DC2A 4AZFA 4QTAA 4BDGA 4FEUA 5DG5A 1W8CA 2PVNA 4OTQA 3QHWA 4YJVA 3KXZA 5IDNA 2IVSA 5HLWA 3QD0A 3QTIA 4QPAA 4YJQA 4CKJA 5JGAA 3G2FA 5EM5A 2W1ZA 3PJ2A 3QXOA 4FKGA 4W9WA 1ZYJA 2VTJA 3KXHA 1YXUA 5M51A 2W1DA 2BAKA 2QOIA 5ACKA 3U9CA 4ZJVA 3GC0A 3ZFYA 1OL2A 3W32A 2EXEA 4ZZMA 3ZRLA 4YTCA 1JSUA 3QD2B 1H0WA 3U51A 2X8IA 4BI0A 3O8TA 1LR4A 1V1KA 4BTJA 3MPAA 2EXMA 4YU2A 4B4LA 3NR9A 4PPBA 4BN1A 2R5TA 5LCJA 4DEEA 1QPCA 4IZYA 3TCPA 3AT4A 4OTHA 2IVTA 5HX6A 3G33A 4DFZE 4RC3A 3PSDA 4AZVA 3FZOA 4EH2A 2EB2A 4F0IA 5A54A 2H34A 3F69A 3EOCA 2C6LA 1Q61A 5JFSA 3A7JA 2XIYA 3ZO4A 4PRJA 2YIQA 4PMSA 4O96A 5HCXA 5C8NA 3KC3A 2QLQA 3ZO1A 4W8EA 4BYIA 2PUPA 4Y83A 4DYMA 3IW7A 2ERKA 5TT7A 5IMXA 4UALA 3P23A 4R6VA 4BYJA 3ET7A 5K0KA 4EZ7A 3DA6A 2EUFB 4HCTA 4JDIA 2Y6OA 5CT0A 3R1NA 5EI6A 4ZTRA 4E93A 4FK3A 2A4LA 2HW6A 4CCUA 4DEAA 2ONLC 1PHKA 4GV1A 5F4NA 5LVLA 2O8YA 3CQWA 3ZYAA 5CTPA 3NYXA 2QOCA 2F7XE 5DN3A 4CEGA 2HY0A 5L8LA 5D41A 2PMIA 2QOBA 1XO2B 3HECA 2I40A 3FMKA 4EOQA 4YTFA 4JT3A 3FYJX 2ZM3A 2UZDA 1BUHA 4FC0A 4RIWA 3DJ5A 4AN3A 4ZY6A 2XNOA 2GNJA 3JVRA 5EYDA 5IDPA 3ZMMA 4WOVA 5KHXA 4MCVA 3ZHPC 5BVFA 4MK0A 4RMZA 3JVSA 4EONA 4ZMFA 3QCQA 4ZTNA 2B1PA 3UODA 3ZFXA 4FSNA 3PG3A 2AUHA 2X4ZA 3PJ3A 3MB7A 4BZOA 2W7XA 2UVYA 4I6QA 5CSHA 3UNJA 3BZ3A 1YWRA 3Q4ZA 4IC7A 4C57A 4E8AA 3GXLA 4KIPA 1GAGA 2ZM1A 3CTJA 4S2ZA 5DEWA 3E88A 2JIUA 1J7LA 4ZXTA 2VTOA 4J53A 2BDWA 5IF1A 4O83A 5IQHA 2O3PA 1WVYA 4NM7A 4D2VA 4C7TA 4QYEA 4LL5A 3U54A 4DTAA 4ZS4A 4DG3E 4NEUA 4IEBA 4F1MA 3RK7A 4UZDA 5AR7A 4ANOA 1F5QA 4C4HA 5EI2A 3L8SA 3C0GA 4UN0C 1FVRA 3BGPA 2R3OA 3E8EA 3MVJA 3PJCA 4FKRA 3ZEPA 4I5CA 1LUFA 3C4WA 5TOZA 3K2LA 1REKA 1UU8A 4OBQA 3TWJA 4YZDA 5HU3A 4JAJA 2B55A 2YA9A 4W4XA 1OBGA 1R0PA 5DA3A 5CANA 5IQFA 1ZYDA 3W16A 3A2CA 4M12A 2W9ZB 4H58A 3ZOSA 2XP2A 4M67A 3OWPA 4B8LA 5CF5A 4O7ZA 2OJIA 2PULA 3PPZA 2QONA 4O82A 2G01A 4PL4A 4UWYA 1XBAA 2ZVAA 2XK8A 4Z7GA 3R73A 2IO6A 4A4XA 5LMKC 3RINA 3R9HA 2OZAB 5IQIA 4FV7A 3PXYA 1FVVA 1PKDA 3CKXA 2F4JA 4PDYA 4AFJA 4IM0A 5CVGA 5CY3A 3UTOA 4G16A 2R3NA 3QZHA 3QGWA 5CNOA 4B7TA 1GZOA 2WMXA 4NW5A 4PTCA 3VS3A 5JEBA 2PU8A 4JOAA 2UUEA 1P14A 2PUUA 3NSZA 3MIYA 3P4KA 5DH3A 1YXSA 2VO6A 4ENXA 5KBRA 3S0OA 3VS4A 4DT9A 4KBAA 3ACKA 4BWKA 5KMIA 3SLSA 1ZAOA 3IG7A 3RNYA 4D2PA 2X39A 4XYFA 2I6LA 5FDPA 4NTSA 4PNIA 4CQEA 5J9YA 1PXMA 1YDTE 2V5QA 3OMVA 2PPQA 1YHSA 5CAUA 3GCPA 4L01A 4FUYA 3F5UA 4ZP5A 1Y8YA 4YMJA 5AUTA 4FKLA 3ZSIA 4AZSA 2J50A 3HMIA 2GTNA 3VS5A 5BUJA 5IH6A 3VUIA 2XKEA 3BCEA 2W9FB 5M55A 2HELA 4AW5A 3NYOA 1H1SA 3MFRA 3TV6A 4ZY5A 4MHAA 2YM6A 4I0RA 2RG6A 3K5UA 3V04A 4FSWA 4MEDA 1WBTA 4KSPA 4YJOA 4C37A 1H4LA 2WTIA 3FL4A 2C5YA 1A06A 3QC9A 2H8HA 3CE3A 2QOOA 4PP9A 4PPCA 3QTWA 4RJ5A 4I1ZA 4UXLA 3TI1A 4EOKA 4AGDA 4G6NA 2Z8CA 3PUPA 1GNGA 4RT7A 1UU7A 3E7OA 4BTMA 4CMTA 4RC2A 2OH4A 5C8KA 5JMSA 4KRCA 2PMNX 3FY0A 3R9DA 2W4KA 5EDPA 4OTIA 1PXIA 2GFCA 4YP8A 3R22A 4RIOA 4AE9A 4CZYB 4WHZA 3DKOA 3L9LA 3P1AA 4RJ6A 3H0ZA 3ORZA 5HHWA 5L8KA 5C8MA 2P3GX 5A9UA 4WO5A 4BCIA 1WMKA 4BCQA 4DH5A 3UO4A 4TL0A 1OVEA 2CN5A 3D83A 4HOKA 3JYAA 2J90A 3F9NA 4FSRA 3DOGA 4FKIA 3MIAA 5J1WA 4C35A 1PRYA 3RCDA 1OL5A 4GEOA 5CALA 4H1JA 5CU6A 5E8UA 3V51A 4DEIA 4ZOGA 4F9AA 4N70A 5CX9A 4C38A 5LVMA 3EL8A 3Q2MA 3B8RA 4KNBA 4AS0A 2BTSA 2WQMA 3PIZA 4FV6A 3AC4A 4UBAA 3FMHA 3KY2A 3QTZA 4GG5A 3VBWA 4E4LA 5IEYA 2Z7SA 3I1AA 5DLSA 3SDJA 3TV4A 1XH6A 4Z3VA 3W2QA 3H4JA 3ORPA 2CMWA 2QOFA 2BCJA 2QHMA 3WF6A 1CKJA 2AC3A 3E7VA 3EQFA 4FA2A 5BUIA 2OH0E 4G3FA 4FSTA 4OLIA 4QMSA 2JITA 4F70A 4Q9ZA 2UW0A 3DT1A 3F3WA 4GCJA 3R7IA 2GS2A 3H30A 3OVVA 2DWBA 4QMWA 3RPVA 3DKFA 3SX9A 3G5DA 3FQHA 3HP2A 3F3VA 4BF2A 1ZRZA 2NPQA 4G3CA 5EM6A 5CASA 4U7ZA 3O2MA 4I6HA 3F7WA 3F2NA 5EHLA 2W4OA 3C7QA 1P4FA 4M8TA 4BIBA 3HNGA 3EFJA 4AUAA 1H26A 2NO3A 3C0HA 5ANEA 5E8YA 3MFTA 3V6SA 4BGQA 2ITZA 4JG6A 5ETCA 4EORA 4HYUA 3I6WA 3BU5A 4M84A 2GHGA 2J4ZA 1PF8A 2WU7A 2XIZA 3QKMA 4QP6A 3EWHA 3HDMA 3M1SA 4TNBA 4CZTA 4DLIA 4RSSA 3UQGA 3A8WA 4FZAB 3ZXTA 3GC7A 2BFYA 5I5ZA 4PV0A 3NMUF 4F09A 1VYZA 1CKPA 2OW3A 5IMEA 3LMIA 3UDBA 4EBVA 2WMUA 3MI9A 3W8LA 3R7YA 4IAYA 4AOJA 3NWWA 3Q6UA 3EFWA 2R3QA 4MD8E 4EJNA 4IC8A 5JKGA 4BCFA 3QRKA 5FWKK 2OXXA 4P2KA 5K0XA 5KMOA 1QPJA 4O2PA 3RGFA 3RMFA 1M52A 4YNOA 1Q8ZA 4O0XA 4GW8A 2G2FA 4R1VA 5DT4A 4WNKA 1PXOA 3TL8A 3KRLA 4BDHA 1KE7A 3LJ1A 2YIWA 3REPA 3GUBA 2PK9A 2DYLA 3EB0A 5HBHA 5K3YA 2RGPA 3HRCA 4FIGA 2RG5A 1MQ4A 3HMMA 1YWNA 1Q5KA 4BGGA 3UPZA 4F65A 5AP5A 2FH9A 5CXZA 5FRIA 2ITPA 5AP6A 2A19B 5L8JA 1W82A 3FMDA 3SC1A 4G6LA 4HYSA 2ITNA 3QTUA 1YXVA 4IVDA 2QNJA 4DCEA 2ITQA 4EHEA 4MKCA 2O63A 5AUXA 3CCNA 3NUNA 2XYNA 5HTBA 2WMTA 1JPAA 5JK3A 2IVUA 3IKAA 1GIJA 4GU9A 3CEKA 4KKHA 3FV8A 3PY1A 4PDPA 1VEBA 2VN9A 1ZY5A 4L9IA 2QLUA 3BQRA 4FIHA 3PPKA 4P5ZA 4JBQA 4Y5QA 4RA4A 3LVPA 4IAAA 3AQVA 2W1IA 4MXCA 3PFQA 1Z9XA 2R3LA 4FKWA 3HV7A 4ZSEA 4HVSA 4GKIA 4IVBA 3WZJA 4YO6A 2PE0A 4FR4A 4BDEA 4GT4A 3MBLA 3NPCA 3UMWA 3PVWA 4PX6A 3FKOA 4RIXA 2VWUA 2WMSA 5HOAA 4ASEA 1YDSE 4L53A 5IEVA 3F88A 4FV2A 2VTLA 3KKVA 3VN9A 4EYJA 3NUXA 2XCHA 2VU3A 3O8UA 3H3CA 3KRXA 4IX6A 4I22A 4K0YA 3WF7A 4F7JA 4LUEA 2AYPA 4ZTMA 2YWPA 4C33A 1ERKA 3ENMA 2JLDA 4DG0E 1HCKA 3CJGA 1YQJA 4IH8A 4M7IA 3ZC5A 4IZ7A 3ZU7A 3PXZA 4QQJA 4RIYA 4FL1A 3VJNA 3ZTXA 3MESA 3UYTA 3FBVA 3LFDA 1FPUA 2XUUA 2YN8A 3NYVA 3Q9XA 1OBDA 2VV9A 2OFVA 5KMLA 3GI3A 4TWPA 5CEKA 4O7YA 4QMQA 3G15A 4WG3A 4IWOA 4WNPA 4MYGA 4K33A 3SG8A 3L9MA 3MH1A 4TXCA 3AT2A 4MBJA 5L4QA 4AZWA 1OIRA 4B9DA 3LHJA 5E1EA 4DHFA 5EI8A 4USFA 4LRJA 2BRBA 3DKCA 3CSVA 1SM2A 3COKA 3AGMA 4YURA 3BKBA 1XR1A 3EKKA 3DPKA 5FUTA 3ANQA 4LGHA 5AIRA 1F3MC 4ZLOA 3FI2A 3R8UA 3NZ0A 2CSNA 2GHMA 4G9CA 3W18A 4U9AA 4FT0A 3KEXA 1JBPE 2BKZA 5A4LA 2X81A 3MY1A 5BMSA 1QPDA 4ITIA 4ORKA 4I0TA 5CU3A 3F7ZA 3GC9A 4G17A 4EHGA 1ZZLA 1SVGA 3FUPA 4TTHB 3A8XA 4MQ1A 3N9XA 4CYIA 4XP0A 2YLEA 3ZDUA 2FO0A 3DNEA 2PVJA 4BCHA 4XG7A 3HUBA 4OW8A 4FT3A 5EM7A 3TACA 2ONLA 3ZLSA 1J1BA 5IU2A 4NIFA 3DJ7A 3IW8A 3TXOA 5KBQA 5J1VA 3HAMA 4R3PA 5C27A 2F9GA 3FI8A 2XB7A 4K1BA 3S00A 4CG9A 1KOBA 2CJMA 3PY3A 3IDPA 4HGLA 3UVRA 4C02A 4CRSA 5FXQA 4O7SA 3RJCA 1FGIA 3C5UA 4HPUE 4EOMA 1STCE 1R0EA 2EU9A 2OIQA 4C2VA 5EDRA 5AR4A 5F95A 4XG6A 2NRYA 4M15A 2OXDA 3IOPA 1M14A 4MD9E 4BL1A 2XBJA 2Y4IB 3MH2A 5D7AA 5HO8A 2GNFA 1ZXEA 4PNKA 3PVGA 2E2BA 4CLJA 5TKDA 2HY81 1PKGA 4YLKA 4FL2A 1XWSA 2XEZA 3M11A 5KO1A 3UO6A 2YZAA 3F5GA 5BYLA 3O51A 4X2NA 4B0GA 5EYMA 3LOKA 5D9HA 2J0KA 3BV2A 3MB6A 3VC4A 4AXAA 4J98A 3JY9A 2C0TA 4QMLA 4EK5A 1OIUA 5DNRA 4JJRA 3BV3A 3I79A 4CFXA 4FI1A 3OCGA 3U6HA 4N4SA 5LCKA 1XJDA 4TWCA 5EKNA 4ANBA 2X6EA 5L2TA 5DIAA 3DZQA 2Z7LA 2WMAA 3CLYA 4QTBA 2BAJA 2VO0A 4G5PA 3PXFA 4QP1A 3PVBA 5ANKA 3COMA 2VWBA 3LQ3A 4Q5HA 3NAYA 5H8GA 5BVDA 5H8EA 4I5HA 4JDKA 4RX8A 2Z2WA 3HKOA 2UW3A 3Q96A 2OXYA 4QT1A 1H8FA 3U6IA 3COIA 5LVPA 2QKWB 4RX9A 1V0BA 4IFGA 5CF4A 3DQWA 4YBJA 5KMKA 4BDBA 1YHVA 3KCFA 1XQZA 3D7TA 2VO3A 2C6MA 3PE2A 3ZCLA 4QMXA 2PVHA 3GC8A 3QRTA 3BRBA 4LMNA 3V5QA 4GUBA 2IW6A 4CFFA 3GCVA 4JG7A 4ZZOA 5LMKA 4OR5A 3LFEA 2XIKA 4F6UA 3FI3A 3SHEA 2WEIA 2WZJA 1CSNA 4O0WA 5M56A 1MRYA 4IB1A 2IVVA 2ZDTA 1OUKA 3I5ZA 1S9JA 3GOPA 3R9OA 4BDFA 4KUJA 3LMHA 4N57A 5EK7A 5EM8A 4AW1A 2BKKA 3WF5A 4LG4A 4DLJA 4RWLA 5BMMA 2VWWA 4FKUA 2Y0AA 4M68A 3FLQA 4FVPA 3LIJA 3PA4A 2FSOX 2ITWA 4FTCA 3GFEA 3R7GA 5CZHA 4FV5A 4DGOA 4DITA 2ZV7A 4DBNA 2W1GA 2W5HA 5CZIA 3G90X 3ATSA 4FTIA 3KCKA 4FEXA 2J0IA 4DN5A 1UWHA 2RSVA 4K18A 2YCSA 3O7LD 2BRMA 5EDQA 4EL9A 4BTFA 4FKOA 1B38A 2WMRA 5AR8A 5KX8A 4U41A 1PYEA 5ANDA 5LMAA 4A9RA 2V62A 3UIMA 4YSJA 4ASXA 2ZB1A 1YI4A 3DY7A 2VNYA 3P86A 3K3JA 5AAFA 2C69A 3FMLA 4AW0A 5GIOE 3V8SA 2QODA 3P79A 4AZTA 3E87A 3QQLA 2ESMA 5E90A 4NYEA 3EL7A 4TRLA 3RPRA 5CAPA 4C36A 2VGOA 5ETFA 4O7NA 3IW5A 3IQ7A 3SV0A 4BCPA 1JWHA 2YM8A 3SG9A 5AEPA 3FXZA 3KMUA 4F7SA 1WCCA 3MSSA 2EWAA 5AM7A 3RCJA 4EWQA 5BUEA 5M4CA 3RKBA 3VBQA 3UQFA 2GSFA 1W83A 4MXXA 4EC8A 4UY9A 4EOOA 5HTCA 3N4VA 3F2AA 2HWOA 3QXPA 2ZV8A 3CQUA 4RBLA 2J9MA 4O38A 1U4DA 4OTGA 4QOXA 5CVHA 3UZPA 4J96A 4D4SA 4HGTA 5CAOA 1NXKA 1PXJA 4ALUA 2ITXA 4BKJA 2QCSA 3A7HA 3GQIA 4J8NA 4DCAA 3AC8A 3GU5A 3HP5A 5IG1A 2YDIA 4E4NA 4U97A 2XK6A 4QTDA 3D94A 4YZCA 3SOCA 2JBOA 4D9TA 1E9HA 5K9IA 4U40A 3BWJA 2I1MA 3R1SA 3NIZA 5DFPA 3WYYA 1UWJA 1XH7A 4XBUA 2X9EA 3ZM4A 5IQBA 2VUWA 2Y4PA 2XM8A 5H3QA 2GMXA 2W06A 3LXNA 4X2GA 4YC8A 2A27A 3FEGA 3PDTA 3TKHA 1Q41A 2JDVA 3BGZA 3R8LA 1OZ1A 4ANMA 5BYZA 3DQXA 1UA2A 1YXXA 3MVHA 4C61A 3TNQB 3BU3A 5LWNA 3NNVA 1OI9A 3ORTA 3DXPA 3VS7A 3OTVA 1CDKA 2UZVA 3TDVA 4RFZA 1XKKA 3QAME 4UMPA 2XK9A 1BI8A 4RWKA 1OECA 4LM5A 5EHOA 3PSCA 4AN2A 3DAKA 4FZDB 3ZSGA 5E4HA 2Y6MA 3EQDA 3CKWA 1OKZA 3C5IA 2BRHA 3DNDA 4U80A 3EZVA 4A9UA 2JDSA 3C4CA 1TQIA 5AR2A 4ZAUA 1REJA 1ZMWA 5A46A 3HEGA 5HICA 2GNHA 5CVFA 2OIBA 4B99A 4FEWA 3E5AA 1OPLA 5L6PA 2C47A 4EOIA 4IMYA 2YM7A 3H9OA 3ZFMA 3CD8A 4FIIA 2AC5A 4OT6A 1ZLTA 4E7WA 3FC1X 4HCUA 3QUPA 4FICA 4CMOA 1OMWA 3JY0A 3MWUA 5CAVA 5J7BA 3FKNA 2OK1A 2WOTA 3SXRA 3S3IA 5CLPA 3HRBA 4L68A 2WTDA 4FG9A 2BHHA 4KIKA 4ZSGA 4CTBA 1LEZA 3V6RA 4UMRA 4FUXA 2BRGA 2BPMA 4DINA 3BLRA 3F66A 3WF9A 4XV3A 3DAJA 5HLNA 1GOLA 1SVHA 2FUMA 4UWBA 1PMUA 1W7HA 2BZKB 4LRKA 5CT7A 5IUGA 5K4JA 3U6JA 2KTYA 4JIKA 3IONA 4RGJA 3GOKA 4IWDA 2PSQA 5F20A 5GIPE 2OO8X 3ZEWA 2H6DA 2C3JA 3D0EA 4WRGA 4MTAA 1VR2A 3GBZA 4TPTA 2CKQA 1YOJA 2UV2A 4JDJA 3HZTA 2PE1A 3PZHA 2VZ6A 4G3EA 4O21A 4GK3A 3TKIA 3BBTB 3NDMA 5EOLA 3UG2A 4AF3A 3DDPA 3COHA 2OI4X 4IE9A 5KMJA 3IPHA 4AN9A 4WRSA 4I93A 2XKDA 1Y91A 5HQ0A 2B54A 4K77A 2Z02A 3DBDA 2FYSA 1YRPA 3DLZA 2JKQA 3O23A 4L43A 3ZUTA 4A9TA 4NW6A 2GU8A 1QMZA 3U8WA 1YKRA 4FGRA 4U81A 4ZTQA 1NA7A 2B9JA 4LGGA 4RWIA 3O96A 1KSWA 5AV2A 4IB5A 5HVJA 1J7IA 1K3AA 2HZIA 3LW0A 3CP9A 3EYHA 4KS7A 5JQ5A 2J2IB 4P4CA 2RKUA 5AWMA 3E64A 5GZAA 4FTUA 1XBCA 4XG4A 1ZMUA 5LOHA 4QYGA 4O0TA 4XUFA 3IK3A 4MBLA 3KB7A 2NP8A 4G6OA 4YJRA 5K5XA 3QYZA 4XP2A 5E91A 1UNHA 2I0VA 5FP5A 1WAKA 5JQ8A 2XS0A 2OJGA 2QOLA 2Q0NA 3EN5A 3LFSA 4NZWB 4FTNA 1GJOA 1SZMA 4RZWA 4W4YA 3VUTA 3ZRMA 4MNEB 4QP8A 4ANNA 3UE4A 4DFBA 2X7FA 3NW6A 5EQEA 3ZO3A 4ENYA 3PJ1A 2WD1A 4NM5A 4WUAA 2CGUA 2WEVA 4A06A 1TKIA 4RJ8A 3MJ2A 4YJUA 2OJFE 2VO7A 4CZUA 1AD5A 4LUDA 3OT3A 5CEIA 4IVAA 4PL3A 4J99A 4Q2AA 4FSQA 3WARA 3RBWA 3BHUA 4EEVA 2VTIA 5CSXA 3SGCA 4EUTA 2ZYBA 5HCYA 4IVCA 4KRDA 3D5WA 4LGDA 2C30A 2OIDA 4I94A 4OGRA 2Y4IC 3QBNA 4GIIA 4CCBA 4ITHA 5B0XA 2WMBA 1KUTA 2HXQA 4YPSA 2F57A 5GJGA 3RWPA 4N6ZA 3L9NA 2IPXA 1IAHA 4GT5A 2XNMA 4YC3A 3KU2A 4JQ8A 4L52A 5I9XA 3ANRA 3JXWA 4U3YA 1L3RE 3OBJA 2XVDA 3ZDIA 1M17A 2GS7A 3M42A 3FHIA 4JRVA 1JSTA 1GIHA 4K9YA 4QMVA 3LJ2A 3RPOA 3CTQA 5JN2A 2A2AA 3RAWA 3ZXZA 3DBCA 4YZ9A 4EKKA 3RM6A 2J6MA 2JKOA 2I0HA 1QCFA 4U5JA 2R3PA 3KULA 4FG7A 1HCLA 1DI8A 3NUUA 4PL5A 4AACA 5CEPA 3OWJA 1XH5A 2WQBA 2QURA 4APCA 3LZBA 4AU8A 2QR8A 2G9XA 3R71A 5TE0A 1GZ8A 4RVTA 2KULA 1Q4LA 3CIKA 4V01A 4R78A 1T45A 4RQKA 3UNZA 3AC1A 2XCKA 1ND4A 5EG3A 4XRJA 3R7UA 3RNIA 1IAJA 3LFFA 4O1PA 3P0MA 2C5NA 3O17A 4DE4A 4QQ5A 2F7ZE 4FVRA 4FX3A 5BQ0A 2HAKA 4YJSA 2GHLA 3MW1A 4I4FA 3BYUA 2VWXA 2VTTA 4RRVA 2G15A 4KIQA 3RHKA 3P5KA 3NNXA 4XG8A 1YOLA 2JEDA 4LQMA 2RL5A 3LCTA 1MUOA 3FY2A 4M66A 5F1ZA 5CSWA 5ACBC 3UZRA 4L3PA 1J1CA 4JNWA 3OXTA 4FNYA 3F3UA 2BZHB 5E8XA 3Q5ZA 5CENA 4FIEA 4G3GA 4FTQA 3BHVA 3DFAA 2YIRA 4OTWA 4I23A 3U9NA 3VVHA 3TUBA 5EHYA 1MRUA 2GNLA 4AQCA 3I0QA 3KVXA 4PPAA 3W2SA 4PP7A 2J5EA 3TUDA 4GMYA 4UB7A 4EQCA 3IO7A 4R1YA 4W4VA 5LQFA 3OWLA 2H9VA 4FTMA 5IKWA 5A4TA 3DXQA 3MA3A 4CXAA 2QO2A 1U5QA 3FI4A 2JIIA 3O7LB 4XRLA 2G1TA 3F3TA 4OTDA 4CSVA 3K54A 4D2WA 3CXWA 2W96B 1O6LA 4NU1A 4AGWA 4F9BA 4DFNA 3KA0A 3BU6A 4OTPA 4EH3A 1SYKA 4HVHA 4J1RA 5AAGA 2FSMX 2UZUE 3MTLA 3OF0A 5I0BA 2QO7A 4F63A 3BWFA 5AV0A 1H1QA 4PDOA 4YJNA 5C9CA 2OZOA 1OL1A 4XEYA 4MD7E 4GSBA 4I21A 5FEEA 5J7HA 2YM5A 4PTEA 3ZSHA 4MQ2A 1WVWA 1SVEA 2A0CX 4FSUA 4FTJA 3S95A 5AX9A 4BBFA 1RE8A 1Q3DA 1U59A 2EB3A 2O5KA 4QP2A 4RWJA 5DPVA 3R0TA 2CNUA 3LFNA 4RPVA 2CNVA 1K9AA 3ZLWA 3VW6A 4O0SA 1PMVA 2PVYA 3WE8A 3KN6A 4QMMA 3QWKA 2XJ2A 4ARKA 5J95A 5KHWA 4E20A 3KXMA 2VTSA 2XNBA 3QLGA 2UZOA 3FQEA 2WHBA 4MWHA 1WVXA 5BVOA 4FTTA 3F2RA 5L2QA 2W99B 3KXXA 3CS9A 3TZ7A 5AP2A 5I9ZA 5I9WA 4EH6A 5IA3A 3D5VA 5DBXA 3EN6A 1ZWSA 3BE9A 5E1SA 1ZOEA 2PE2A 2OBJA 4H3BA 3WBLA 5E8SA 3HGKA 3LXLA 4P7EA 3NS9A 2BDFA 3FZTA 4MXYA 4PQNA 4ZJIA 4D0WA 3W2PA 3Q6WA 3QA0A 2C5VA 4GK4A 1OKYA 3F82A 4S34A 3T3UA 4AT3A 5ETIA 2XMYA 4RLKA 3I5NA 4YLLA 4ZK5A 5LMBA 2YCQA 2HCKA 4S30A 2VTPA 2RF9A 2QD9A 3MV5A 3I60A 2Y9QA 3QF9A 4AA0A 3PXRA 2WGJA 2GS6A 5CEMA 3I81A 3NVKI 1H1RA 4PTGA 2PVFA 3EQPA 3IOKA 3Q52A 4J71A 4IW0A 3PRIA 4FYNA 3QX4A 4L3JA 5HVYA 3OS3A 3F61A 2XRWA 2YEXA 2Q0BA 1M7QA 4IHPA 2C6EA 4HNIA 5CXHA 3DAEA 3NCGA 2QU5A 5BVEA 4BKZA 2X2LA 4QNYA 3LFAA 3OOMA 3DKGA 4DH3A 1PXPA 2R0IA 3HL7A 2WO6A 3RTPA 1YI6A 2Z60A 3UIBA 5B7VA 4D4YA 1G8SA 2CCHA 4YO4A 3MPMA 3QKKA 5FBNC 4KB8A 2BR1A 4QP4A 3SRVB 2PYWA 4MBIA 4BICA 2IZTA 4IX5A 3DJ6A 3DTWA 1OM1A 3OTUA 4DTKA 4OAUC 4RVMA 1OGUA 3MYGA 3QU0A 4BDJA 4D4VA 4X3FB 2UZNA 2WOUA 3R1QA 2C68A 3R63A 3G51A 4EOLA 4YHTA 5JFVA 1A9UA 3AC5A 2WMWA 4QMUA 3W2RA 3U4UA 4L3LA 2JKMA 3KF7A 4NKAA 5I9VA 5J5TA 5AJQA 4KA3A 3N4UA 4FZ7A 1JNKA 1TVOA 3A4PA 4IADA 3BEAA 4BHZA 5J79A 1XHAA 3QTQA 3FWQA 3TUCA 2OLCA 3ERKA 2JIVA 1KE6A 3V5PA 4C8BA 2X8DA 3V5WA 3WF8A 5DT3A 4IACA 2OF2A 4CKIA 1APME 3M2WA 3R7EA 5JFXA 2ERZE 1RDQE 2W1EA 4O6EA 3E62A 4I0SA 3E8NA 4V0GA 3ZRKA 3SW7A 5AP3A 5IUHA 1OKVA 3QUEA 2V22A 4YPDA 2O64A 5E92A 4ERWA 4ID7A 2WFYA 2V7OA 2X1NA 3F6XA 4TY1A 3CR0A 2HENA 3LQ8A 4F7NA 2JAVA 4WKQA 5AM6A 2QKRA 5HBEA 5IH4A 3V8WA 3PVUA 1DAYA 4ZY4A 4G5JA 4WSQA 3ORLA 4TYHB 4D2RA 2ZM4A 4I20A 2QG5A 4QMZA 3BYSA 3H0YA 3NIEA 4BDAA 3LCDA 3Q2JA 2P4IA 4IAZA 1Q3WA 2W05A 3QZGA 4WNOA 3A7GA 3PLSA 3G0FA 4WG4A 4IM3A 4C4GA 3B2WA 1BX6A 3BGQA 3ORNA 3FMNA 4MX9A 4USDA 5F94A 2Z7RA 1ATPE 1S9IA 1Z5MA 2XJ0A 3LAUA 1U54B 4KWPA 2BUJA 4D0XA 1V0OA 2UW5A 3IS5A 4CQGA 2BZJA 4I41A 4LOQA 5DVRA 4DEGA 3FDNA 1W98A 4FV9A 5LJJA 2NRUA 2R3FA 2C0IA 3D7ZA 3T3VA 3MVMA 3ULZA 3HV3A 3PY0A 3ZZEA 1TQPA 4WT6A 4FV3A 2J0JA 4XG3A 4HVIA 1GIIA 4EUUA 4EYMA 4GFMA 4NUSA 3LFCA 2QHNA 1MQBA 2CGWA 3A7FA 3DB8A 3NEWA 1X8BA 4J7BA 5FQDC 3PJ8A 5IQCA 3FL5A 3Q9YA 4HYIA 5FLFA 5BX0A 2WPAA 3CGFA 5IA0A 2GQRA 4F9YA 4C3PA 4FTLA 2CKOA 3DB6A 5KKRB 4R5YA 2RFSA 4ZZNA 3ULIA 2ZDUA 3SQQA 2FSLX 4ACMA 4BDKA 3NVMB 1XH4A 4BIEA 4HZRA 1Y6AA 3R8VA 2VTNA 4L6QA 3FPQA 4MF0A 4IAFA 4X2KA 2CKEA 4X3JA 3OEFX 3THBA 5AMNA 4DAWA 4UMUA 3S4QA 2HYYA 4WBBB 2YM3A 3HV5A 4GVJA 4NH1A 4DGNA 4FTOA 2UZWE 5A6NA 3VW8A 4RLLA 3UIUA 3NW7A 2B0QA 2BFXA 4D5HA 3NUSA 2E9PA 2XRUA 3B2TA 2C3IB 2VX0A 4JBPA 4N6YA 4C4IA 2WTWA 3FLNC 1K2PA 2Y7JA 4FZFB 4QNAA 2YM4A 2R3IA 5CU0A 3FLWA 3POZA 4C59A 2ITVA 3CD3A 4A9YA 5J5SA 4NM0A 2UW6A 4FF8A 4UXQA 3TZMA 2UZBA 4DBXA 1LP4A 2P2HA 3PP1A 4BDDA 4Z7HA 1PMEA 4BDCA 3HMNA 2IWIA 3A62A 4GH2A 4S32A 3WYXA 3UYSA 4CFVA 5HX8A 2ZJWA 3KMMA 1U46A 3QWJA 4KBCA 3TIYA 4QQTA 3QRIA 4YZMA 2WTVA 4AWIA 2VX1A 5AP4A 4EH4A 3UNKA 1G8AA 5HZNA 1IEPA 3C13A 4EKLA 4NIFB 3UOKA 1P2AA 3MS9A 5DI1A 5ITAA 3HMPA 5BVWA 4CG8A 4ZLYA 4DFUA 5JFWA 2WELA 3GT8A 3NLBA 4HNFA 4AT4A 1XH8A 4CFMA 3TG1A 3TZ8A 3DK3A 2F2CB 3PE1A 2BZIB 4DEDA 4ZSJA 4UYAA 3OG7A 4JRNA 1PYXA 2PTKA 5C4KA 3TJDA 4EH9A 1OIQA 3CY3A 4USEA 1M2RA 2GTMA 2VWIA 2XBAA 2W5BA 4O7VA 5AUWA 2C6DA 3OOGA 4RZVA 4UMTA 3UJGA 4C0TA 4XCUA 4FODA 3TNHA 5B2MA 5EQPA 2GCDA 4RQVA 4B8MA 4KSQA 4XOZA 2QC6A 3FHRA 3GFWA 1M2PA 4H36A 4W8DA 3ODYX 3P78A 4D1XA 3KVWA 4DF3A 5ANGA 4FOBA 3P9JA 1E1XA 4F64A 2UZTA 2XKCA 5BVKA 3GQLA 3QCYA 3IDCA 3QKLA 3E93A 4IB0A 5CNNA 1Y6BA 2VAGA 5CSPA 3AGLA 3OY3A 3WIKA 5LARA 4JQEA 2IZUA 4BZNA 3MY5A 5CI7A 5J87A 4DT8A 4XP3A 2B53A 1VYWA 3LFBA 4QD6A 1NVRA 3OP5A 4JXFA 5H2UA 3W55A 3VRYA 5T3QA 4O81A 3R6XA 3KN5A 5T68A 3S1HA 4GK2A 4LI5A 3BHYA 5EOBA 1ZARA 5M44A 3LLTA 4CMUA 3HYHA 1H1PA 1WBOA 4JG8A 3EQRA 4P5QA 2VD5A 3VS2A 4QYYA 1SNUA 4BKYA 5AADA 3BYMA 2IW8A 2BTRA 1FGKA 3OCTA 4O6LA 3VF8A 4E5AX 5FEQA 1EH4A 3QYWA 4Q9SA 1O9UA 2CNQA 2YDJA 1FMOE 2J7TA 4XV9A 4O91A 2FA2A 4OTFA 4QO9A 4FK6A 1IG1A 4M97A 3RAHA 3FPMA 3MFSA 4OBPA 5HTIA 2GNGA
chains in the Genus database with same CATH superfamily
4FEQA 3EH9A 4DGGA 3KK9A 3UOLA 4WA9A 4M69B 3DBQA 3EN9A 3WZDA 5BVNA 2W1HA 1JSVA 4BCOA 1Q97A 3SAYA 5CU2A 5AUYA 5L2WA 2VTAA 3EKNA 3F3ZA 1CMKE 3LCSA 4EHZA 4DHJA 3V5LA 5HESA 3QFVA 4IXPA 4QPMA 4C62A 2J5FA 3MFUA 4JX7A 5HLPA 3V5TA 1KV2A 2REIA 3ALNA 3IECA 2XK3A 1Q8WA 4OBOA 4R3CA 4ZTLA 4GUEA 5IQAA 3R21A 1IR3A 5L2IA 4HCVA 2I7QA 2QU6A 3MVLA 3HDNA 5GNKA 5CQUA 4CT2A 3UOJA 1VJYA 3PWDA 3H9FA 4J8MA 2VTHA 3VHEA 3VRZA 3DTCA 4IM2A 3OEZA 2UW4A 4DDGA 4NJDA 4PMPA 1BKXA 3ID6C 2PZYA 3P5JC 3PFYA 4ZTSA 2B52A 4WNMA 4CRLA 3SD0A 4GL9A 1WFCA 5IQGA 3R7OA 4BVUA 1J91A 3UO5A 4O86A 5FXSA 5JGDA 4D1SA 4E6DA 2R9SA 4XS2A 2OF4A 5A4CA 2E9UA 3H10A 4I92A 4Q5EA 5KNJA 1PXNA 4BBEA 3QQUA 2CLXA 5DEYA 3Q4CA 2E9OA 3LKMA 3JR1A 3MDYA 4RC4A 4JLCA 4R8QA 4IQ6A 4PWNA 3EJ1A 5GJDA 3TJCA 1L8TA 4D55A 1NT2A 5HI2A 4FKVA 5JZNA 4F7LA 2G2HA 4M14A 5CF8A 4LYNA 3RK5A 4ZSLA 3ZLYA 2VNWA 5KMNA 4FKPA 1Q99A 3QUDA 3FSKA 3LFQA 4DG2E 4KKGA 2CPKE 1W0XC 4L46A 4J97A 5A4EA 2JAMA 4ITJA 2B9IA 3QL8A 4V05A 4F0GA 4FE2A 2CGXA 3VUMA 4LV8A 5HBJA 4ZTHA 4U3ZA 3MTFA 3W33A 4X3FC 4MH7A 3LE6A 1PW2A 5J9LA 5IA4A 1AQ1A 5HE1A 4HGSA 4PMTA 3U87A 5E9EA 4S33A 5A14A 4FT5A 3GU4A 4O0RA 2ETMA 4NCTC 3D14A 3POOA 4XV2A 2PZIA 3QALE 4GJ2A 4RVLA 3QA8A 4ZMEA 5D12A 5EKOA 3VQUA 3VS0A 3RAIA 4O7WA 5I4NA 4BZDA 1AGWA 3D2KA 4D5KA 2PHKA 4F6SA 4PF4A 4WG5A 5E8ZA 1M7NA 2O2UA 1UKHA 4K11A 4ALWA 4CYJA 3ZO2A 4JS8A 4NL0A 4HW7A 3D4QA 2DUVA 3EIDA 4YR8A 4C4JA 5HO7A 3BEGA 4CFNA 1BL6A 4EC9A 4RG0A 3QQGA 4EK4A 1G3NA 5HVKA 3LCKA 4LOPA 3UOHA 4IZ5A 2V55A 2Q83A 3SXSA 5HG8A 5AV3A 2QI8A 1OL7A 1WBWA 3MY0A 4UWCA 5HD4A 3QD3A 3TYKA 4Z55A 3N4TA 3FLSA 1KOAA 1RQQA 5CU4A 4YGAA 4ZIMA 5CS6A 4AAYA 1G8KA 4I5PA 3R04A 3TIZA 2CLQA 5DHJA 3LQ5A 3AC3A 4X6RA 4WIHA 3F5PA 1ZMVA 3ALOA 3GEQA 5DRDA 2XANA 4R7BA 4TYEA 5E7RA 5L6OA 5JGBA 4RJ4A 4I4EA 5M53A 3VF9A 2O0UA 5CAQA 4XX9A 1ZY4A 4AGUA 3VJOA 2FVDA 4QMTA 4ACCA 4D2TA 1H28A 4ACGA 5AA8A 3OFMA 3VAPA 1VZOA 3BLAA 3OROA 2GQGA 3LM5A 2HZ0A 3TTJA 4C3FA 2B9FA 1KE5A 3R8ZA 2CN8A 2F49A 2WTCA 5L2SA 2Y8OA 4V04A 3L8XA 4O4DA 2W5AA 3DLSA 1OL6A 3QTRA 3IDBA 2JC6A 2BRNA 4R5SA 1MRVA 5EW3A 5KKRC 3PXKA 4IX4A 1UU9A 5B2KA 1Q8YA 2RFDA 3HLLA 3BLHA 1Q8UA 2BALA 4QRCA 1GZNA 2XYUA 4RFYA 1UNGA 3AMAA 4GKHA 4G31A 3A7IA 4L44A 2WTJA 2YCFA 4UX9A 3UBDA 5A4QA 2ZFYA 3D15A 2QVSE 3EQHA 4QYHA 3KK8A 3AKJA 2W17A 1YHWA 4E4XA 4G34A 4X0MA 4XV1A 1WZYA 3DK6A 3IW4A 3S2PA 3HV6A 4O0YA 3VS1A 3KRWA 4N0SA 3G9LX 2I0EA 2ETKA 3BE2A 3I4BA 3ZC6A 2J51A 2XNEA 5AX3A 4IX3A 4BCJA 3QTXA 4U6RA 2GQSA 1QPEA 2PMLX 1H00A 4U44A 2JKKA 2R3GA 4I3ZA 4QEBA 1JKKA 1DM2A 3VBXA 4DTBA 2X0GA 3EZRA 3PPJA 3BBWA 4FIFA 2UW9A 3AMBA 4RIWB 1W2DA 5I3RA 5GINE 4GYIA 4F0FA 2YJSA 4FBXA 4BCNA 4IJ9A 5FBOA 2XZSA 4A4LA 1H01A 3NX8A 3F5XA 3SA0A 3C0IA 4YZBA 4TT7A 2BMCA 3OBGA 4CV8A 3JS2A 4TYIA 5AUZA 3GU6A 2JFLA 3C4XA 1ZYSA 3D5UA 4BCKA 1R78A 4FV8A 1B6CB 2HW7A 4JI9A 2UW8A 5K5NA 5EYKA 3IW6A 2WIPA 3UVPA 4EK8A 3ZUVA 1DI9A 4XLIA 3GGFA 3I6UA 3P08A 4LOOA 4MNFA 5FM3A 3TNWA 4ZLZA 3PLAE 3OXIA 4A4OA 4FV4A 5D10A 3MGYA 3EN7A 3KGAA 2P33A 4BWPA 4FSZA 4I6FA 4CLIA 4GS6A 4E26A 2UZEA 4H3QA 3C51A 1PY5A 2ZV9A 1YWVA 2O65A 4NFMA 3CJFA 1H08A 5C4LA 4U43A 4RX5A 3ACJA 4I6LA 1UU3A 4UYNA 1XH9A 3E8CA 4MWIA 4U79A 4UZHA 3RWQA 3TM0A 5ANJA 3G9NA 3QHRA 3V8TA 3HMOA 2P55A 4IWQA 1I44A 3SKCA 4FNZA 4AP7A 3LCOA 4MNEA 4NJ3A 1H07A 4TN6A 4X7QA 5M4FA 4O0VA 1URWA 4YLJA 2DQ7X 3NUPA 4ZS0A 4L7FA 3Q4TA 3G6HA 4OUCA 3JUHA 5JRQA 3KULB 4NK9A 5M08A 4OTRA 3EQGA 3Q9ZA 4O4EA 5JH6A 3JPVA 3WOWA 3O0GA 1R3CA 2PUNA 4JAIA 1OB3A 3RPYA 3W2OA 1H0VA 3I0OA 4E4MA 4D1ZA 4H1MA 4UEUA 4UMQA 4YNEA 3V01A 4TYGA 4CTCA 3KXNA 1MP8A 3EFLA 5HD7A 3KMWA 4CT1A 2R0UA 3BI6A 3WZUA 5A6OA 3TV7A 1FBNA 1PXLA 2W0JA 4BDIA 2R3MA 3BELA 3L8PA 2ITUA 2R3HA 4UV0A 2BAQA 3KFAA 3MH3A 5EW9A 3ZUUA 3Q5IA 5CI6A 4BRXA 2E9NA 4HZSA 4DEBA 4E6AA 3KXGA 2IZRA 3GU8A 2OSCA 5G1XA 5AP0A 5FXRA 4F08A 4FJVA 3AC2A 3DFCB 3D9VA 4BCMA 4Y8DA 4E73A 3QZIA 3W8QA 2CKPA 5IA2A 5H9BA 1JQHA 3RHXA 1WBVA 4QYFA 4O1OA 5LWMA 4NSTA 4L8MA 2VX3A 3R00A 5M57A 1KE8A 2DS1A 4YJPA 4YHJA 4DH7A 5M07A 2OZAA 3UC3A 4HJOA 3MPTA 3KRJA 5DE2A 5D7VA 3RPSA 4ANSA 3R7VA 4AXCA 5D11A 1KWPA 2OGVA 2XAMA 3T9IA 3U55A 3T8OA 2BVAA 1Z57A 2QOHA 3GP0A 4QPSA 4QMPA 3AXWA 5EFQA 4BY9E 2X2MA 5IPJA 4DDIA 1RW8A 4CNHA 3ZBFA 2A98A 3FZPA 2B9HA 5GHVA 2PVMA 2ZAZA 4RVKA 3DZOA 3BQCA 2ZMCA 2ZB0A 4YBKA 2QG7A 2YZLA 3OT8A 5IZFA 2F2UA 4AOIA 4EK6A 2ZV2A 2XIXA 1WBPA 3CTHA 3KREA 4E3CA 2HZ4A 5IH5A 4QQCA 5AFVA 5FP6A 3RZFA 1OGYA 4ONAA 3ORKA 1UVRA 2HWPA 2JBPA 4NWMA 5LVNA 2XJ1A 3HA6A 3WE4A 2VRXA 3GCSA 3ZBXA 4FKSA 5AIKA 5IEXA 3AD6A 3OXZA 3TKUA 4FIJA 4XNEA 2YERA 3MN3A 3VNTA 4KINA 4HVDA 5DMZA 4GU6A 4CVAA 4DHZA 1H24A 1OITA 4NM3A 3EMGA 5HG5A 2XEYA 3PIXA 3QLFA 4XG9A 2H96A 2SRCA 5C1QB 4S31A 4JBVA 1JLUE 1PXKA 3R02A 1H1WA 4IIRA 3ETAA 3T9TA 3OW3A 3R8MA 3NW5A 1H27A 2C0OA 4QMOA 4TZRA 2X2KA 2OU7A 4M0YA 2QQ7A 3TTIA 2VTRA 2YAAA 4J95A 3VQHA 3VULA 4E5WA 4G1WA 3OWKA 3DV3A 3Q3BA 4BC6A 4M13A 1FINA 3AG9A 3EN4A 4X6QC 2WQNA 3RI1A 4ANLA 5BYYA 4I24A 4L7SA 5IISA 3FMEA 5HIDA 4BBMA 4MVFA 2ZOQA 3AOXA 4XHKB 5CQWA 3ORMA 2YDKA 4X2FA 3HUCA 2BILB 4ANQA 1NW1A 4BJJB 2PZ5A 3QRUA 4QDEA 2CGVA 5ETAA 4BCGA 2A1AB 1BLXA 2IG7A 3CC6A 3OUKA 2OJJA 4KIOA 4EBWA 3ENHA 5ANIA 3NUYA 4PY1A 3VHKA 3DK7A 4HPTE 5GJFA 2WMQA 3OW4A 4FSMA 2IZSA 4HYHA 4ASDA 3RZBA 4GYGA 3NNWA 2UW7A 4FMQA 2G2IA 3K3IA 4JL9A 4K8AA 4PMMA 3W10A 3RP9A 4EH7A 5L3AA 4A7CA 5GZ8A 4LDTA 3ORIA 4FTRA 4LMUA 4BGHA 4O7LA 2HIWA 2YITA 3EQCA 3QQHA 4EHVA 1PJKA 4I5MA 4FGBA 1FQ1B 5JSMA 4JR3A 4G2FA 4DH1A 5J8IA 1G5SA 3QD4A 3FSFA 3FKLA 2WTKB 3A61A 5HE2A 1IA8A 4GRBA 4AE6A 3MH0A 3AD5A 2R3KA 4I6BA 2WAJA 3HA8A 2P0CA 2J0MB 2IN6A 1ZOHA 5I3OA 1IA9A 4EOSA 2W1FA 5TR6A 3QQFA 2NNWB 5FGKA 3ATTA 2XK7A 3FZRA 3SW4A 3U4WA 2OWBA 3OC1A 5DYJA 4YJTA 4DH8A 5HNGA 5HNIX 2F7EE 1H25A 3CPBA 5CSVA 3G6GA 4F4PA 3UQCA 2R7BA 3R01A 2V7AA 3L1SA 3NAXA 3RM7A 4BWXA 3EQIA 2JGZA 4TYJA 5FG8A 2WMVA 3II5A 1T46A 3TZ9A 5AAEA 2YHVA 4R7HA 5TO8A 4F9CA 4FSYA 3AKLA 2C6KA 3WZKA 1UV5A 3E3BX 2ITTA 3UZTA 5HEZA 3ODZX 1NVQA 3PP0A 2IW9A 3P7BA 4IB3A 3RAKA 4GFGA 3TNPC 5BV3A 1HOWA 4O22A 4IZAA 1OUYA 1FMKA 4CFWA 4NKSA 3SVVA 3Q32A 1UNLA 4V0GB 3SRVA 5H8BA 4CKRA 3BHHA 2BHEA 4O7TA 2OFUA 4XBRA 3FLZA 5M4IA 5HG7A 3VBYA 3PWYA 5E8TA 3HRFA 3EYGA 3R83A 5HE0A 4LFIA 4X3FA 5BNJA 5KZIA 2X4FA 1JKLA 2IJMA 2LGCA 3O71A 5AR5A 2YIYA 3NGAA 4JX3A 2BIKB 5I9UA 5IUIA 2PZPA 3FE3A 1DS5A 5HNBA 1NY3A 4M0ZA 3TDWA 5DRBA 5IQDA 5DWRA 4NCTA 1ZYLA 3TMOA 4BTKA 4QTEA 3HV4A 1W84A 4OAVB 3Q60A 1XBBA 3FAAA 1P5EA 2C3KA 4RX7A 4FT7A 3LXPA 4Y85A 3UMXA 3R9RA 2RFEA 3PA3A 4HGEA 3QC4A 5AR3A 5CWZA 4AT5A 3A99A 4C58A 4ACDA 3IGGA 4FNWA 3TT0A 4RIXB 3KF4A 3HVCA 4KAOA 5AP7A 5FD2A 3QRJA 3UVQA 4EQUA 5FDXA 2RFNA 3ZS5A 3PSBA 3FXWA 1Q62A 2R3JA 2UVXA 4NFNA 3WILA 1SMHA 2XF0A 3AT3A 3QQJA 4GT3A 3OCSA 2HZNA 5EH0A 4FL3A 4TYHA 4AGCA 4YZNA 3GVUA 3FYKX 3GU7A 3EHAA 4WSYA 4E5BA 4RIYB 2YAKA 2W1CA 2X8EA 4E1ZA 2R7IA 3BLQA 3FQSA 3V5JA 3WI6A 3LM0A 3DU8A 4BI1A 5F9EA 1Q24A 4AXDA 1OPKA 4FZ6A 3ZONA 2WIHA 4WD5A 3C1XA 4Z9LA 4EH5A 4LV5A 2PL0A 4GFOA 5E8WA 4Z16A 5JRSA 3R1YA 4AAAA 4IWPA 4F1OA 2QOKA 3PYYA 2BROA 1YW2A 1U54A 2XNPA 2C1BA 2YABA 4Y72A 1LPUA 3VBTA 5KMMA 4BFMA 3E92A 4KBKA 4FNXA 4ASZA 4EQMA 3BX5A 3UP7A 1WBNA 2QO9A 4AA5A 4E6QA 5AP1A 1URCA 2JD5A 4W4WA 5CEQA 3PTGA 3O8PA 4F9WA 4D58A 4JDHA 3PXQA 4DFYA 3WZEA 5M06A 4K2RA 2OJ9A 2V0DA 3FXXA 5L6WL 2FSTX 1R1WA 2VGPA 3BYOA 5T6KA 1ZZ2A 1GZKA 2HOGA 4TKSA 2X9FA 4MF1A 4ZEGA 4BI2A 4F1TA 5M4UA 4FKQA 4QP3A 2B7AA 2YISA 1ZYCA 3EQBA 1B39A 5CF6A 4L45A 3R8PA 3GCUA 2JDTA 1YXTA 5ANOA 3GCQA 5HIBA 3TNIA 3OHTA 3W2CA 4H39A 4D4RA 1JKTA 1JOWB 2UVZA 5AV1A 3TN8A 3VUHA 3DBFA 4YSMA 2ACXA 2JDOA 4LL0A 4X21A 4Y95A 4AXEA 5CYIA 1SNXA 4M3QA 4E6CA 2YJRA 1E1VA 2PVLA 2PZRA 1G8JA 1BYGA 1KE9A 2CDZA 1JKSA 2GPHA 2XM9A 3MA6A 2VTMA 5EW8A 3L8VA 4IAIA 4P90A 5LVOA 2X6DA 3FC2A 4JBOA 4PDSA 4F99A 4R77A 1BL7A 3QGYA 4A07A 2GFSA 2GNIA 3DDQA 5G6VA 1Y57A 5HO6A 3OUNB 3R28A 2C3LA 3E3PA 1CTPE 2JFMA 3LJ0A 3PG1A 4TW9A 5FEDA 3R9NA 2YIXA 3BIZA 3D2IA 3NUAA 4DEHA 2ETRA 4EJ7A 4WBOA 3A60A 1P4OA 3FMMA 2XA4A 4FTAA 4PUZA 5DOSA 4EOPA 1J3HA 2QR7A 5DGZA 3CPCA 3E63A 3PRFA 4D9UA 3CGOA 2BDJA 2WQOA 1JAMA 2C1AA 2X0OA 3P7CA 4IJPA 4FKJA 5TF9A 3L9PA 5K4IA 3ZM9A 4H3PA 4AG8A 1BMKA 1A48A 2R64A 2HXLA 4U0IA 5EQYA 3C4FA 3CBLA 3ELJA 4WUNA 4BR3A 4BB4A 1JVPP 2R4BA 1J7UA 2C5OA 5I9YA 5HCZA 3QQKA 4EWHA 1OKWA 4W9XA 2QOQA 1YI3A 4GVAA 3E8DA 4RFMA 5KZ0A 2XK4A 2YFXA 4FYOA 5KUPA 5FTOA 4DA5A 3BYVA 4XH6A 4JIAA 4KD1A 2VTQA 3FJQE 1KV1A 1IASA 2JDRA 2PVKA 3H9RA 4XOYA 3DGKA 2PWLA 3ROCA 4O2ZA 3I7BA 3UG1A 3VUGA 2CCIA 4JQ7A 1I09A 3OCBA 3ZH8A 4TWNA 5IA1A 5AA9A 3W1FA 3UGCA 2WQEA 4O27B 4MXZA 2VWVA 1BI7A 2WNTA 3ITZA 4NT4A 4O4BB 4QTCA 4U42A 3FLYA 4YUQA 3LXKA 4GIHA 3VONA 3VS6A 3GENA 5HKMA 3D7TB 3KRRA 4MXOA 4H05A 2ZMDA 1CM8A 2OG8A 3GB2A 4FKTA 4AX8A 4HVGA 1QL6A 3LMGA 4XLVA 3NRMA 2XIRA 3W0PA 5E8VA 2Z7QA 3HAVA 5HU9A 3FZ1A 4O84A 2X7GA 4JVGA 1LEWA 3P7AA 1PMNA 3R2YA 5M09A 4NTTA 1YVJA 4YHFA 3QCSA 3SOAA 2XARA 2P2IA 5BPYA 1FOTA 2EVAA 1RJBA 3A4OX 5DT0A 2XAOA 3C4EA 4CD0A 4R7IA 4FV0A 3C4ZA 2OKRA 5A3XA 3DS6A 4IANA 3MJ1A 3DBEA 3LLAA 4RA5A 4F6WA 4RJ7A 2C4GA 3UPXA 2XKFA 4C34A 3QX2A 4FT9A 3K5VA 4U45A 4XJ0A 3UP2A 4DFLA 3NNUA 3PA5A 2J0LA 3VUKA 1R39A 4ZSAA 3Q9WA 3QTSA 4RJ3A 4EH8A 2PMOX 2ITOA 5HG9A 3NCZA 4M69A 5DR9A 3ZLXA 2GDOA 2I0YA 2XNNA 4C2WA 3GNIB 3W0SA 4CGAA 2C5XA 5KE0A 2WKMA 3QZFA 2YCRA 3O50A 3WIGA 4GJ3A 2LAVA 3NYNA 4EOJA 4JR7A 3RALA 4LV7A 4QP7A 4FVQA 5HE3A 2YACA 4ERKA 3ORXA 5FTGA 4G9RA 4IAKA 4ZJJA 4AA4A 4KKEA 2WTKC 3KL8A 4AW2A 1YOMA 3PIYA 4G3DA 3DXNA 4CFUA 3HX4A 4YTIA 4AOTA 4L42A 3W0OA 5AUVA 5C26A 2VWZA 3UC4A 5LXMA 3AD4A 2HK5A 2UZLA 4TNDA 3TEIA 2BIYA 4D2SA 4DGLC 3VO3A 4DFXE 3G0EA 1GY3A 2OICA 3CQEA 1NVSA 4IBMA 4LRMA 4MAOA 4BHNA 4DGMA 1YDRE 5J9ZA 3B8QA 3FMJA 3FZSA 1OIYA 3LPBA 5FM2A 3C50A 5HGIA 2VWYA 3I7CA 3SXFA 2WB8A 2W4JA 4APPA 5CEOA 1Q8TA 4QP9A 3VWAA 5DR2A 4IDVA 4XG2A 5JZJA 3Q04A 5HORA 3PZEA 3BPRA 1TQMA 5HIEA 3OZ6A 4J52A 1UKIA 2R2PA 3Q4UA 1FVTA 2YWVA 4C3RA 2YLFA 3VUDA 3V3VA 2B4SB 1CKIA 3R30A 4QMYA 4Y73A 2WU6A 4Y5HA 4YTHA 1V0PA 4XMOA 3ROYA 4Y46A 3OY1A 3VIDA 2FGIA 1O6YA 1OPJA 4FV1A 5C03A 4AFEA 4KS8A 3KQ7A 4FTKA 4CV9A 1ZOGA 2FB8A 4EZ3A 4ACHA 3N51A 3CY2A 4KABA 5FTQA 5GZ9A 3QCXA 4EK3A 4FEVA 4A9SA 4L67A 3EFKA 4II5A 4IDTA 5AUUA 5KCVA 4TWOA 1O6KA 5D1JA 2X0QA 3RK9A 2PY3A 2X7OA 4L00A 1Y8GA 4AZEA 1F0QA 5JT2A 4ALVA 5IQEA 3DCVA 1IRKA 3C9WA 5ICPA 4OT5A 4YC6A 2C6OA 5DR6A 2E9VA 4C4FA 2CHLA 3AMYA 5C01A 3IGOA 1DAWA 3OD6X 4BIDA 4B6LA 4R3RA 1WBSA 3BHTA 4K6ZA 5IA5A 4D28A 2XNGA 4MXAA 2ITYA 2PVRA 1U5RA 4O7RA 3UIXA 4QMNA 2XH5A 2C6IA 4GG7A 4FG8A 4EZ5A 5AV4A 3RVGA 2C6TA 3Q53A 3R2BA 5EYCA 4IFCA 4U8ZA 2PUIA 1M2QA 2RIOA 3VBVA 4KIKB 4O0UA 4EI4A 4FOCA 2EXCX 2WXVA 3D5XA 4C4EA 5B2LA 4X2JA 2R3RA 3ZZWA 4DC2A 4AZFA 4QTAA 4BDGA 4FEUA 5DG5A 1W8CA 2PVNA 4OTQA 3QHWA 4YJVA 3KXZA 5IDNA 2IVSA 5HLWA 3QD0A 3QTIA 4QPAA 4YJQA 4CKJA 5JGAA 3G2FA 5EM5A 2W1ZA 3PJ2A 3QXOA 4FKGA 4W9WA 1ZYJA 2VTJA 3KXHA 1YXUA 5M51A 2W1DA 2BAKA 2QOIA 5ACKA 3U9CA 4ZJVA 3GC0A 3ZFYA 1OL2A 3W32A 2EXEA 4ZZMA 3ZRLA 4YTCA 1JSUA 3QD2B 1H0WA 3U51A 2X8IA 4BI0A 1XMLA 3O8TA 1LR4A 1V1KA 4BTJA 3MPAA 2EXMA 4YU2A 4B4LA 3NR9A 4PPBA 4BN1A 2R5TA 5LCJA 4DEEA 1QPCA 4IZYA 3TCPA 3AT4A 4OTHA 2IVTA 5HX6A 3G33A 4DFZE 4RC3A 3PSDA 4AZVA 3FZOA 4EH2A 2EB2A 4F0IA 5A54A 2H34A 3F69A 3EOCA 2C6LA 1Q61A 5JFSA 3A7JA 2XIYA 3ZO4A 4PRJA 2YIQA 4PMSA 4O96A 5HCXA 5C8NA 3KC3A 2QLQA 3ZO1A 4W8EA 4BYIA 2PUPA 4Y83A 4F78A 4DYMA 3IW7A 2ERKA 5TT7A 5IMXA 4UALA 3P23A 4R6VA 4BYJA 3ET7A 5K0KA 4EZ7A 3DA6A 2EUFB 4HCTA 4JDIA 2Y6OA 5CT0A 3R1NA 5EI6A 4ZTRA 4E93A 4FK3A 2A4LA 2HW6A 4CCUA 4DEAA 2ONLC 1PHKA 4GV1A 5F4NA 5LVLA 2O8YA 3CQWA 3ZYAA 5CTPA 3NYXA 2QOCA 2F7XE 5DN3A 4CEGA 2HY0A 5L8LA 5D41A 2PMIA 2QOBA 1XO2B 3HECA 2I40A 3FMKA 4EOQA 4YTFA 1W2FA 4JT3A 3FYJX 2ZM3A 2UZDA 1BUHA 4FC0A 4RIWA 3DJ5A 4AN3A 4ZY6A 2XNOA 2GNJA 3JVRA 5EYDA 5IDPA 3ZMMA 4WOVA 5KHXA 4MCVA 3ZHPC 5BVFA 4MK0A 4RMZA 3JVSA 4EONA 4ZMFA 3QCQA 4ZTNA 2B1PA 3UODA 3W0QA 3ZFXA 4FSNA 3PG3A 2AUHA 2X4ZA 3PJ3A 4DHIB 3MB7A 4BZOA 2W7XA 2UVYA 4I6QA 5CSHA 3UNJA 1ST4A 3BZ3A 1YWRA 3Q4ZA 4IC7A 4C57A 4E8AA 3GXLA 4KIPA 1GAGA 2ZM1A 3CTJA 4S2ZA 5DEWA 3E88A 2JIUA 1J7LA 4ZXTA 2VTOA 4J53A 2BDWA 5IF1A 4O83A 5IQHA 2O3PA 1WVYA 4NM7A 4D2VA 4C7TA 4QYEA 4LL5A 3U54A 4DTAA 4ZS4A 4DG3E 4NEUA 4IEBA 4F1MA 3RK7A 4UZDA 5AR7A 4ANOA 1F5QA 4C4HA 5EI2A 3L8SA 3C0GA 4UN0C 1FVRA 3BGPA 2R3OA 3E8EA 3MVJA 3PJCA 4FKRA 3ZEPA 4I5CA 1LUFA 3C4WA 5TOZA 3K2LA 1REKA 1UU8A 4OBQA 3TWJA 4YZDA 5HU3A 4JAJA 2IEWA 2B55A 2YA9A 4W4XA 1OBGA 1R0PA 5DA3A 5CANA 5IQFA 1ZYDA 3W16A 3A2CA 4M12A 2W9ZB 4H58A 3ZOSA 2XP2A 4M67A 3OWPA 4B8LA 5CF5A 4O7ZA 2OJIA 2PULA 3UDSA 3PPZA 2QONA 4O82A 2G01A 4PL4A 4UWYA 1XBAA 2ZVAA 2XK8A 4Z7GA 3R73A 2IO6A 4A4XA 5LMKC 3RINA 3R9HA 2OZAB 5IQIA 4FV7A 3PXYA 1FVVA 1PKDA 3CKXA 2F4JA 4PDYA 4AFJA 4IM0A 5CVGA 5CY3A 3UTOA 4G16A 2R3NA 3QZHA 3QGWA 5CNOA 4B7TA 1GZOA 2WMXA 4NW5A 4PTCA 3VS3A 5JEBA 2PU8A 4JOAA 2UUEA 1P14A 2PUUA 3NSZA 3MIYA 3P4KA 5DH3A 1YXSA 2VO6A 4ENXA 5KBRA 3S0OA 3VS4A 4DT9A 4KBAA 3ACKA 4BWKA 5KMIA 3SLSA 1ZAOA 3IG7A 3RNYA 4D2PA 2X39A 4XYFA 2I6LA 5FDPA 4NTSA 4PNIA 4CQEA 5J9YA 1PXMA 1YDTE 2V5QA 3OMVA 2PPQA 1YHSA 5CAUA 3GCPA 4L01A 4FUYA 3F5UA 4ZP5A 1Y8YA 4YMJA 5AUTA 4FKLA 3ZSIA 4AZSA 2J50A 3HMIA 2GTNA 3VS5A 5BUJA 5IH6A 3VUIA 2XKEA 3BCEA 2W9FB 5M55A 2HELA 4AW5A 3NYOA 1H1SA 3MFRA 3TV6A 4ZY5A 4MHAA 2X0PA 2YM6A 4I0RA 2RG6A 3K5UA 3V04A 4FSWA 4MEDA 1WBTA 4KSPA 4YJOA 4C37A 1H4LA 2WTIA 3FL4A 2C5YA 1A06A 3QC9A 2H8HA 3CE3A 2QOOA 4PP9A 4PPCA 3QTWA 4RJ5A 4I1ZA 4UXLA 3TI1A 4EOKA 4AGDA 4G6NA 2Z8CA 3PUPA 1GNGA 4RT7A 1UU7A 3E7OA 4BTMA 4CMTA 4RC2A 2OH4A 5C8KA 5JMSA 4KRCA 2PMNX 3FY0A 3R9DA 2W4KA 5EDPA 4OTIA 1PXIA 2GFCA 4YP8A 3R22A 4RIOA 4AE9A 4CZYB 4WHZA 3DKOA 3L9LA 3P1AA 4RJ6A 3H0ZA 3ORZA 5HHWA 5L8KA 5C8MA 2P3GX 5A9UA 4WO5A 4BCIA 1WMKA