4AOJA

Human trka in complex with the inhibitor az-23
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
260
Chain Sequence
ACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of Disubstituted Imidazo[4,5-B]Pyridines and Purines as Potent Trka Inhibitors
pubmed doi rcsb
molecule keywords HIGH AFFINITY NERVE GROWTH FACTOR RECEPTOR
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 260
sequence length 290
chains with identical sequence B, C
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aojA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aojA01
2ZDUA 1UU3A 3BGPA 3D7TA 5EYDA 4A07A 4CG8A 1PXLA 5M09A 4ARKA 3CXWA 2BVAA 4G16A 5D7AA 4BZDA 3OT8A 4CZUA 5IZFA 5M4IA 3NW5A 4FIFA 4I23A 4NSTA 2B0QA 4QMQA 4IX4A 4Q9ZA 3I4BA 4FKUA 5CY3A 4K77A 2XNMA 3KRWA 2IN6A 4I20A 3BEAA 3FMEA 4BKJA 3TKUA 5BVOA 3ZRLA 3KULA 3UIUA 1KOAA 5JN2A 3HMPA 4YZBA 3DFCB 4Q5EA 4ZSLA 4CT2A 4EK3A 3QKKA 4AGWA 3E8DA 3QTIA 4K6ZA 1Y91A 4P2KA 4RIYB 2PZYA 3PP0A 4EBVA 1WBVA 5E1EA 1MRUA 3ZLSA 4IX6A 2C0OA 2QC6A 4PDOA 3ZDUA 3QZHA 4L01A 3VRZA 2XCKA 3PA4A 3MSSA 2ZMDA 4QMTA 3ZTXA 3NDMA 4ALWA 5HBJA 4O6EA 2VTTA 3CY2A 5L8LA 1A48A 1QPDA 2ZM1A 3IPHA 4D2PA 1BL7A 5CEQA 4LMUA 3NCZA 3MV5A 4AFJA 4ZJVA 3DXQA 2J0IA 4L52A 2C47A 5M56A 1ATPE 3THBA 4DEBA 3Q9YA 4FZAB 4RX7A 4DLJA 1LPUA 3TV4A 2R64A 3W32A 3BWJA 3WBLA 3OXTA 3ZOSA 3G51A 1QCFA 4C61A 3R2YA 2YA9A 3TZMA 4D5HA 1ND4A 4UMRA 4BTJA 4H05A 4MX9A 5DT4A 4ITHA 3R2BA 2YIYA 4FTMA 1Y8GA 2Z8CA 5L4QA 4YJRA 4O22A 4F0IA 1PMNA 3KN5A 4Z7GA 2RF9A 3E8CA 4JAJA 1UWHA 3EQFA 2YLEA 1YXUA 2OKRA 2YHVA 2YERA 4FT3A 3DT1A 3R73A 4XH6A 4BCMA 4M12A 2KTYA 4FSTA 1BL6A 3UQFA 4FNXA 1VYZA 4FKTA 5AR5A 3QQKA 5A4LA 3PY3A 2GDOA 3FEGA 3F3VA 4S2ZA 4YC3A 4HVDA 4S34A 3MDYA 3OG7A 4QMZA 4YHJA 3B2WA 3Q4ZA 4GU9A 2Z7LA 4ZZOA 5DRBA 3FI2A 4MBJA 2A19B 2ZYBA 3DKOA 3QD3A 1JQHA 3QHWA 1KE5A 4MAOA 4E8AA 2BZKB 2XM8A 3MWUA 2C5NA 3GU4A 4KIQA 4QYHA 4O38A 2Q0NA 1R0PA 2XJ1A 5CZHA 3P5KA 5FBNC 3VBXA 5AUTA 4RLKA 3E93A 5LARA 5AP6A 3ORKA 3CEKA 4W8DA 2EVAA 2W7XA 2OH0E 3LFCA 3NAXA 4K9YA 4ZJIA 2CNVA 3EQDA 2NRYA 2WU7A 3A7JA 1K2PA 4FIGA 3BWFA 2VO3A 4I5PA 1PMVA 4WNKA 2GSFA 2Z7RA 4PDPA 2IG7A 3GU7A 3NWWA 4LL0A 4K11A 5EH0A 2WKMA 4UYNA 1PKDA 4D1ZA 4F63A 2W1GA 3RZBA 4LUDA 4ZS4A 4RG0A 5EW3A 5AUUA 2E9OA 4Y73A 5A4TA 3ZUTA 5A4EA 5KMLA 4TYHB 4I6QA 4CKRA 4L43A 3VHEA 2W96B 2OF4A 2XIYA 4AGDA 5I9WA 3BU6A 5LXMA 2WZJA 3PJ2A 4II5A 3QALE 4Y95A 1AGWA 4EOLA 4U81A 1V1KA 3MH2A 4N70A 4C3RA 4EZ7A 3AOXA 4MEDA 3ACJA 3NYXA 2JIUA 4NEUA 4PTEA 2VRXA 3EHAA 3MFUA 2HOGA 3TV7A 2WIPA 3MVHA 5FLFA 3TNHA 2WQMA 2ZAZA 5BX0A 2UVZA 4FTCA 2JKMA 3QTSA 4DLIA 3QAME 3LLAA 4EH3A 4R6VA 4ZMFA 4W4YA 3O17A 3KL8A 3G5DA 4EKKA 5M4FA 2XH5A 4HGEA 1YI6A 4QTEA 2WEIA 5E8WA 4DTAA 4KRDA 4ZLZA 2I40A 4WNPA 5CI6A 1M7NA 4FR4A 3D14A 2WTDA 3DKCA 2ETMA 4ZAUA 5CSXA 3N4UA 2YJSA 3I1AA 3QQFA 3W2PA 2VTJA 3PDTA 2PVLA 5AUVA 4TWOA 4AOTA 3KCFA 5AM6A 4AX8A 2JAMA 3KA0A 2XIXA 2ONLA 1F3MC 3O71A 5HLNA 4G9CA 3IW4A 3UZPA 1JVPP 3BV2A 3ERKA 3GC8A 4ZSGA 3HZTA 3NSZA 1H07A 5DG5A 4MK0A 4JBOA 4NUSA 1NVRA 2A0CX 3BLQA 3C1XA 4YJVA 3F6XA 3Q32A 5E8SA 3ZFXA 3ZM4A 4IM2A 4CTCA 4J95A 3MA6A 1QPCA 3JR1A 4U79A 4J98A 3V3VA 4JT3A 4CXAA 2ETKA 2GS7A 3UOJA 5HIEA 2WOUA 2FA2A 1MRYA 3LLTA 4X3FA 3A7IA 3MJ1A 5D7VA 2O5KA 3C7QA 3QRJA 5B7VA 2ZJWA 3EQHA 4HW7A 5JKGA 3FC1X 3KF4A 4FG9A 2UZOA 3V01A 3WF6A 5IA2A 4AP7A 2JBOA 3FV8A 1FVVA 2CKPA 3FUPA 4PTCA 3UMXA 1DM2A 2FGIA 4FE2A 2EWAA 3IDCA 4OBPA 3VN9A 3S1HA 4B0GA 3NGAA 2G15A 3KN6A 5HD4A 4U44A 4FZ7A 2X2LA 3F3WA 4GJ3A 3EQBA 5D10A 3VAPA 4KUJA 2OJIA 4RFMA 2AC3A 3PJ8A 3SDJA 4PL5A 2OWBA 5DMZA 1XBAA 2VWXA 3KF7A 4ENYA 2YABA 3DGKA 2BTSA 4X2NA 4ZEGA 2JKOA 3AT2A 1APME 4KIOA 4PMMA 5IH5A 4QPMA 3M2WA 3CE3A 3NNUA 4G34A 4M68A 2X8DA 3C4FA 4FBXA 5EW8A 5ITAA 1TQPA 4KWPA 2CCHA 4QP7A 2VWZA 5LVOA 2I7QA 4EEVA 4FUXA 3EYHA 4R3CA 5J5TA 4YPSA 5FTQA 2VTLA 3LMHA 1YDTE 3HV4A 3JVRA 5AP7A 2X8IA 2FSMX 4CMOA 1XJDA 2A2AA 2G2FA 1QPEA 4I6FA 3ZSIA 1NVSA 4U41A 4MNFA 3UQGA 5A9UA 3KVXA 3R9RA 4CQGA 4EKLA 2UW8A 4M3QA 4IAIA 1LUFA 4ZTQA 3VJNA 4A9TA 3SG8A 3SXFA 2BROA 1MRVA 4NZWB 1W0XC 3VVHA 3ZFYA 1OVEA 4RLLA 2YDIA 2PUIA 4NW6A 2W1CA 3H0YA 4O7YA 5JGDA 3IO7A 1PY5A 2HZ0A 3JS2A 3GENA 1YW2A 1XKKA 4FIEA 3AC5A 2PZRA 1XBCA 2ITYA 3OEFX 4LRJA 4AW5A 3V5WA 2YCRA 3RNYA 3EB0A 1OMWA 4UMQA 4BDGA 3EH9A 1HCKA 3DKFA 4AACA 2ZDTA 5HKMA 3DJ6A 4A9SA 2UV2A 5HICA 5L3AA 3KXXA 4HCTA 5GIPE 3TJDA 3VBVA 2NP8A 1XH6A 2VX3A 4MQ1A 3AMBA 1ZY4A 4XBUA 5AP1A 4FTAA 5I0BA 5M57A 5FXSA 1YOJA 4CVAA 3NIEA 5HQ0A 4WG4A 5AUWA 4LV8A 4F0GA 1W84A 4UMPA 5BQ0A 2G1TA 1PXPA 1WBPA 2IVVA 2JDVA 5HLPA 4KBCA 3RKBA 4DFYA 2WMAA 2YCFA 5DT0A 3LIJA 5F4NA 5A54A 5I9XA 2YLFA 3K3IA 2CDZA 5CU0A 4EZ3A 1Z57A 4GK4A 2JDSA 4GVAA 3OC1A 4E6CA 3O23A 4QMYA 4AS0A 4RIYA 2ZV7A 4BGHA 4F64A 4UZDA 4FEUA 3U51A 4FSZA 4FKGA 1WMKA 3R7VA 3QWJA 4ANNA 3PJ1A 4PTGA 2AYPA 4I22A 3H9OA 4FSYA 1GZ8A 3TCPA 3WE4A 1SMHA 3BI6A 4JBPA 3A7HA 2UW3A 4RGJA 5H3QA 4KD1A 4PRJA 2VX1A 5BVNA 4FEXA 1JSVA 1VZOA 2I0HA 5AUZA 4YTIA 4R77A 4B4LA 3RI1A 4IQ6A 4XG2A 3AXWA 4S32A 2IWIA 2VO0A 1P4OA 2R3JA 4E7WA 4DGOA 2FSTX 3MY0A 3TDWA 1VYWA 4XS2A 2X7GA 3AD4A 4FTOA 3OS3A 2VWWA 1PYXA 4QP9A 3FZTA 4EH5A 5J9YA 2F7EE 2B9FA 1UWJA 5AV3A 1OUYA 3BGZA 3Q6WA 4H58A 5BVFA 2CNUA 5FM3A 3BGQA 3OOGA 4TT7A 5HHWA 3SC1A 2GQSA 5GJDA 2QLQA 4DG3E 4AN9A 5EFQA 4HPUE 4CYIA 1U4DA 1ZYCA 3BHUA 3R9HA 5IUGA 2Z02A 4O7TA 4B99A 4FV7A 3MH3A 3E3PA 4C33A 4U40A 5BVDA 1RJBA 4AUAA 5HZNA 1Q3WA 3FBVA 4PQNA 2A27A 2EB2A 3LFQA 5GHVA 4GVJA 3GOKA 3Q4UA 2W05A 2GQGA 3K3JA 4BDDA 3P86A 3R1SA 2ZV2A 3FYJX 3AG9A 3RWPA 5CASA 3E63A 1UV5A 3R02A 4GW8A 4R8QA 3MB6A 3VUKA 3AC3A 1Q41A 1CDKA 2BRMA 4FV5A 3UIMA 2UZEA 4NJDA 2H34A 4DA5A 1YQJA 4XV1A 2XCHA 2QOLA 3H3CA 4FTIA 3VUDA 1E1VA 4DEIA 2PHKA 2WNTA 5ANOA 5HE0A 2X0GA 5D11A 2GPHA 1ZY5A 4H3QA 4AZSA 2O65A 2UVXA 4DFLA 5IG1A 3C4ZA 4DH1A 5ACKA 3WF9A 2OZAA 4GIIA 2C6LA 3UNKA 4R3RA 5CNOA 4AT4A 2YM5A 3VNTA 3QXPA 1S9JA 1STCE 5A6OA 4ZMEA 4RQKA 2O2UA 5AR2A 3FLZA 3FSFA 3R7OA 2VAGA 4FIIA 5J95A 3ELJA 3KGAA 2PZ5A 2R3QA 4IX5A 3R9DA 4TYHA 4BDCA 5EM8A 4WRSA 5ANKA 4D9TA 3NR9A 3DJ7A 3LHJA 3IK3A 4IZAA 4P90A 5A4CA 1J7LA 3TKHA 4M15A 4JRVA 4A7CA 3GVUA 4LQMA 1RE8A 2PMLX 4ERWA 3F5XA 1Z5MA 3UGCA 4K1BA 4E4MA 2VWYA 3TTIA 2Y4IC 4XEYA 3R83A 5TOZA 5IF1A 5CEMA 3CC6A 3W2OA 4I0SA 3UVQA 4XV2A 3JY0A 5F1ZA 4BL1A 2OH4A 4BI1A 2ZOQA 4EJ7A 1YKRA 3CQUA 5HNIX 2OU7A 3UOKA 1O6YA 4ZTLA 3CGOA 3IGGA 5EYKA 4FKPA 4DH7A 3QLFA 3WE8A 2QO9A 4D2SA 4M13A 2CLXA 4EH8A 2WMVA 3LXKA 5A6NA 3VS1A 5LCJA 4DYMA 4ZY5A 5IDNA 5ETAA 4O0YA 2XEYA 5F95A 2AUHA 2XKCA 4NM5A 4HOKA 3R71A 5IUHA 4O83A 3BZ3A 5AJQA 1TQMA 5KBRA 3NRMA 3RAHA 3ZH8A 4D2TA 2QR7A 4AG8A 4MWIA 3LOKA 4XP2A 5JK3A 1IA8A 5CSPA 3QGYA 3ZO4A 3I0QA 2J90A 2RFEA 4DHFA 3FI3A 2C5XA 1ZOEA 2O8YA 3OD6X 4RIWB 3MFRA 4IFGA 2WU6A 3NMUF 1BMKA 5DR6A 1U59A 4EORA 5C9CA 1YHSA 4GT5A 2UW7A 2WOTA 4NTSA 1H26A 1J3HA 3KY2A 3DB6A 4G9RA 3R7GA 4DH5A 1FVRA 5K0KA 4YUQA 2JFMA 3UOHA 2BIYA 3C0IA 4YNOA 2W4JA 4EK4A 3WF8A 5EM7A 3QA0A 3UC3A 4ACHA 4CT1A 3MS9A 5HTBA 3DTCA 5L6PA 3ZXTA 3FY2A 3NIZA 4QOXA 4BDKA 5F20A 3Q3BA 2IW9A 4V05A 4BFMA 1ZMWA 2VNYA 2BDWA 4HNFA 4BCFA 4FL3A 4BCKA 4O86A 1T45A 5JFWA 4LGHA 1NVQA 4IZ5A 4IWPA 4XG3A 3EN4A 1PRYA 3V8WA 3OCTA 3TIZA 4IVDA 4N57A 1ZYJA 2BRGA 2O64A 3ORPA 4FSMA 5DI1A 4D0XA 5AR8A 2GS2A 5DWRA 5E8TA 4IADA 1ZRZA 4Q2AA 4IDVA 4ZTMA 2PK9A 5JRQA 3SXRA 3U55A 5CU6A 5C8NA 4ASXA 3ZLXA 3FYKX 2C69A 2QVSE 3P08A 4BRXA 4D9UA 4L7FA 3CP9A 5DR9A 4BDJA 4M97A 2JDOA 3QFVA 4WG5A 4TY1A 4ZZMA 4QTDA 2YDKA 4CRLA 1W82A 4DGLC 2IPXA 2GTNA 3DBFA 5CLPA 4RC4A 5KMJA 4D4YA 3MFSA 3SGCA 1FGKA 1Q8UA 2BDJA 3BYMA 3Q5ZA 3QUPA 1Y6BA 4XNEA 3ZYAA 4YZNA 4PL4A 4PY1A 5M4CA 4JBQA 4FKOA 4IZ7A 4O84A 3R21A 2Z7QA 1AD5A 1PHKA 1PW2A 1YWVA 3MBLA 3PPZA 3Q5IA 4FOCA 4FMQA 4TRLA 4DC2A 5KMMA 2CKEA 4HVGA 4FGBA 2X2KA 4IX3A 3PXRA 2BTRA 2J50A 4I5MA 3PG1A 5ANIA 3EZVA 3LCDA 1MP8A 4V0GB 3F3UA 3U8WA 3PFQA 4WKQA 3DBDA 1LEZA 4MD8E 5H8BA 5FGKA 3QLGA 2RSVA 4QQTA 5KHXA 3PG3A 5CT7A 1I09A 4D1SA 2FYSA 4UEUA 2J0MB 3EOCA 5FTOA 4BDIA 3PVUA 3A61A 4YJTA 2O0UA 1REKA 3BLRA 4FT9A 4O0WA 3HNGA 4CGAA 3FL4A 3UYSA 3LCTA 3AC4A 3CD8A 4KNBA 4N0SA 3O50A 4CFVA 4CMTA 4ZTNA 3EZRA 5EOBA 2OFUA 4XCUA 3FL5A 4KS7A 3P7AA 3RK7A 5KO1A 3TUDA 3G90X 3I6WA 4X2GA 3DDPA 2JLDA 3UG1A 4FTJA 3UDBA 3DV3A 4QMVA 5FBOA 4L46A 3AT4A 2R3MA 4BBMA 4U8ZA 3HL7A 5GJGA 5M51A 4PMPA 3CQEA 3MIYA 2WTCA 4FTRA 1JSUA 2QURA 3Q6UA 4YSJA 3PLAE 2WQOA 2BILB 3VUMA 2ITPA 3HA6A 3AGMA 3L8VA 2GNJA 4EH4A 3F7ZA 4YO4A 5CXZA 2C1BA 3E64A 3NPCA 4ALUA 2V55A 4TXCA 4FZ6A 5FEQA 1ZAOA 2Y0AA 4ANLA 2IO6A 5ACBC 3EFLA 3QTXA 3U54A 3QL8A 4FTTA 4C4IA 1FGIA 4JX7A 5IQGA 4XLIA 1H1QA 3DS6A 4CMUA 4B6LA 5AMNA 1OIYA 1URCA 2WMTA 4CV9A 5LCKA 3TZ7A 1VR2A 2XZSA 4D2VA 5CENA 3QQGA 4BKZA 5AV0A 4MD9E 3AC8A 4TWCA 5L2IA 3LMIA 1XQZA 3I81A 4DN5A 3ORLA 3UZTA 3VRYA 5AP2A 4YTFA 4RWJA 4I4FA 3VS7A 4CFXA 3JY9A 5KHWA 1SVGA 1OPJA 4PV0A 4CYJA 4PP9A 1ZARA 2WMQA 3RINA 5AV2A 2YIXA 3QQHA 1H1WA 4HNIA 4FEWA 2QODA 3D2KA 3B8QA 3OTVA 4D4RA 1JKTA 1KV2A 5IQFA 3FAAA 3OY1A 5F94A 1KE7A 3EMGA 3Q60A 3PXYA 2IZTA 1UU8A 1NW1A 3LPBA 4BWKA 4PDYA 4HZSA 2OLCA 2Y8OA 2XNGA 4DF3A 3BBWA 3F88A 2X4FA 4K33A 4W4VA 4DCEA 2W5AA 4D1XA 2W9FB 3RGFA 4YMJA 4G3CA 5M44A 1OUKA 1UKIA 3G0FA 1CMKE 3PA5A 3SAYA 4BVUA 4PUZA 4D2WA 3C4EA 2QONA 3NVMB 4L67A 4QQJA 4O7WA 2F2UA 4GJ2A 4BCPA 5A46A 4TWPA 2UW0A 4I6HA 2WELA 2WTJA 3ZM9A 4YNEA 5CWZA 2ITWA 2R3HA 3L9MA 3QUEA 5BMMA 2PVFA 4CFWA 4F0FA 5KNJA 2PUPA 1OKZA 2ITZA 3D15A 5LOHA 5IQHA 4CRSA 4Z9LA 3T3VA 2ACXA 1PXKA 3KKVA 4QYFA 3KXMA 5FP5A 1FPUA 3HMNA 2CN5A 3T9TA 3ENMA 3V5PA 4BZNA 2P2IA 4C0TA 4QTBA 5E4HA 2OJ9A 5BUEA 4DE4A 4E6DA 2CKOA 2EB3A 3K2LA 5J9ZA 4IFCA 1Q8WA 5CQUA 5EQEA 5AAGA 4XJ0A 3QKMA 3E92A 4FKRA 4UZHA 4WUNA 2QOHA 2CGUA 5AIRA 3UIXA 2W1EA 4IEBA 3DK3A 5TKDA 3UNJA 3I60A 3R8PA 1PMEA 4GH2A 3MGYA 3CQWA 5CANA 4EL9A 4R7IA 2ZMCA 3P7BA 2BZHB 4HYHA 1OPKA 4XG9A 3P9JA 3COKA 3WZEA 5HVJA 1U54B 4UV0A 2Y6OA 5ANEA 4IC7A 3W2SA 3OT3A 3Q9XA 2XB7A 3JVSA 2F7XE 3KXNA 4MXOA 2EXMA 2VO7A 3ZZWA 2I1MA 2VTNA 1DAYA 4IAKA 4OBQA 5E8YA 3GU6A 3O7LB 1MQBA 2WMWA 2XJ2A 2B4SB 3AC1A 4IHPA 2YN8A 3VS2A 2ZB1A 4E3CA 1GIIA 5K9IA 1ZMUA 3NCGA 3PIZA 2BFXA 2ITXA 3BX5A 4R1YA 3MVMA 1YRPA 1DI9A 3OWLA 1OECA 2OICA 2WO6A 2ITUA 4QYGA 1H0VA 5CNNA 5EHOA 4AE9A 4C4EA 4USEA 4PMTA 3R8MA 3ALNA 3HRFA 4RIWA 4YJUA 3MH1A 4HZRA 1CKJA 3DLZA 5CEIA 4GKHA 2J0LA 4LYNA 3NUXA 4U5JA 3U4UA 4KIPA 3DKGA 3GCPA 4F1MA 3SOCA 5DYJA 3PSBA 4XRLA 5E8UA 3C13A 5EDRA 3I5ZA 5H2UA 3ORZA 3GNIB 1W83A 1V0OA 2X9FA 3FLSA 3KQ7A 3LZBA 2YEXA 5EM6A 3HDNA 3EWHA 3QRKA 4WD5A 5DHJA 2XKFA 4RQVA 5C26A 2PL0A 4YJQA 3HLLA 4DEHA 2PYWA 4HPTE 2OW3A 2ITTA 3DNDA 1M17A 4CFFA 4LI5A 2BFYA 3LCSA 3NYVA 2G2IA 2XNPA 4C4FA 4HVSA 2XP2A 4M7IA 2ZB0A 1UU9A 3I79A 4QQ5A 3SW4A 3IGOA 4LL5A 2BALA 5DRDA 4DEDA 1KOBA 5AAFA 2Y4IB 3KRXA 2RGPA 3A4OX 1R1WA 3FKOA 4ASEA 3O8UA 5EHLA 3ENHA 5LMKC 3BPRA 4M0ZA 4F9AA 2HWOA 5KKRB 4OTRA 3VJOA 5AR3A 4FX3A 4JOAA 3DNEA 4PPAA 2H9VA 3OUNB 5A4QA 4A4LA 5GIOE 4B8MA 4GUEA 2XBAA 3K54A 5IPJA 3FLQA 4O7VA 3VF9A 1BI7A 3WIGA 2ITVA 4JR7A 2QR8A 2VZ6A 2OF2A 3UMWA 4AA5A 1KUTA 4YC8A 4B7TA 4RWKA 2C3IB 3WZJA 4X2KA 2BDFA 2VTQA 4KBAA 2P55A 4O21A 4RJ8A 3WARA 3NYOA 2J0KA 5FM2A 5J5SA 3Q2JA 2CPKE 4FTLA 1SM2A 5EI6A 1OIRA 1SVEA 3QQLA 2FB8A 1FINA 4OLIA 5H8GA 3NAYA 4DITA 4R5SA 5HG7A 3QTZA 4J53A 4BCHA 4ZLOA 4GS6A 4ID7A 3EN9A 4EJNA 3FSKA 2RFNA 1FOTA 3OCGA 5DGZA 3HRBA 3KVWA 2PZPA 2VTPA 4FKJA 4YLJA 3TN8A 3W16A 4A4OA 1Q61A 3AGLA 2UZBA 4EK5A 4MXCA 4AZWA 4YBJA 3COIA 4QMMA 4BZOA 4FK3A 2GNGA 4FT0A 3O51A 5FWKK 3ZEPA 2WPAA 4O81A 3QTWA 3CPCA 3DB8A 4QMSA 5EI8A 2B54A 1ZLTA 4V0GA 5HIDA 3WYYA 4MVFA 3SX9A 4OW8A 3IQ7A 1JKLA 1UKHA 4IM0A 5I9VA 3HVCA 1GIHA 5ANDA 5CF6A 5CF8A 4ORKA 3DBCA 3E7VA 3SRVB 2QOKA 3COMA 5E91A 5HE1A 3W10A 5J9LA 5AA9A 1JLUE 2WIHA 2YITA 3R63A 2G2HA 3PRFA 4PMSA 4NT4A 2ZM3A 3KK8A 4IAAA 2JDRA 4S31A 4QTCA 2P33A 3PY0A 4AA4A 4BCGA 4P5QA 3OMVA 2R0IA 3B2TA 3SOAA 4UXLA 1REJA 4JDJA 4LGGA 2YDJA 4W9XA 1IASA 2C6DA 4AZTA 5J1VA 2IW6A 4XG7A 3S3IA 2IZSA 4RX5A 4FZFB 1FMKA 4ZXTA 4C2VA 4O7LA 4RVTA 5LQFA 3UNZA 1JKSA 3EN7A 5CEOA 3RCJA 2VTRA 2PUUA 3PLSA 4GG7A 3QYZA 4J8MA 1OL7A 1JKKA 4FVRA 4UWCA 1CM8A 5IH6A 2UW9A 2HWPA 3V5TA 3V8SA 5IQCA 3VWAA 3ZSGA 4QMPA 3D0EA 4QMOA 4ANBA 3EJ1A 1M7QA 3KMWA 3HYHA 3OFMA 3HV5A 5CSWA 4BCQA 2VU3A 2C0IA 4D58A 3MESA 4NYEA 4AXAA 4YO6A 2X39A 3LQ5A 4BI2A 3F69A 4IACA 4C35A 3ORTA 3LXNA 3P4KA 3P7CA 5H8EA 4I24A 5CT0A 3Q96A 5ETIA 2W5BA 3H10A 4NJ3A 3R8ZA 4QD6A 3QZIA 3ZRMA 3KREA 1W98A 5LVPA 4YGAA 2HXQA 5EHYA 3SV0A 1H24A 3NEWA 2VTOA 2PSQA 4GFOA 3RK5A 2Z7SA 3LFDA 4RZVA 3R9NA 4RIXB 4EBWA 4F4PA 3D5VA 3JXWA 1H0WA 3HA8A 3ORMA 4P7EA 1GY3A 5DA3A 2X9EA 3DDQA 5CF5A 3I7BA 4MBIA 3FJQE 3QCXA 2GCDA 3QHRA 2IJMA 2HZ4A 1KE6A 3VHKA 3HAVA 5CF4A 4BDFA 2PMIA 5FQDC 3JYAA 2P4IA 3E5AA 2DQ7X 1T46A 1P4FA 3HV7A 3VS3A 4OUCA 4YJNA 3R28A 3LFEA 5DPVA 1BUHA 3LVPA 4JRNA 1YXVA 4AT5A 3CKWA 3UVPA 1JAMA 5IU2A 4F9YA 4FKQA 4Y46A 2WMXA 2G9XA 4EC9A 5IMXA 4RFYA 3BYSA 2CLQA 3Q52A 3OWJA 4C8BA 4E93A 3M11A 4FVPA 4FUYA 4XP3A 3BBTB 4NIFB 4BIBA 3CKXA 3DTWA 2XJ0A 5L2SA 2VNWA 3D9VA 1O9UA 2F49A 2H6DA 2PPQA 4I6BA 3QD0A 3G9NA 2YM7A 2VD5A 5I3OA 4ANQA 3RAWA 4FV9A 4HGSA 1H00A 4AAAA 4C7TA 4OTIA 3HDMA 4RPVA 2XKEA 4MWHA 4F7SA 4QPSA 3DJ5A 1VJYA 3C5IA 4AF3A 4XOZA 2XUUA 4R3PA 4ZIMA 3BEGA 4Z7HA 4FKIA 1Q8YA 3VIDA 4TTHB 5HI2A 4R5YA 4MXYA 4YU2A 5K4IA 4FYOA 3LMGA 4NM3A 4E4NA 3P78A 5HU3A 1URWA 5C01A 4OTDA 3UIBA 4EYJA 4ZZNA 4WO5A 4JVGA 5HO8A 4ZSAA 3ATTA 3NUAA 3R9OA 3FMLA 5BVKA 4I41A 4X2FA 4QT1A 2QHNA 2GHLA 4N6ZA 4RT7A 3V5JA 4BC6A 3IDPA 3MTLA 3R7YA 3DZQA 4JDIA 2QCSA 4AWIA 4F6WA 2B7AA 4BF2A 5L6WL 5HLWA 4B8LA 3BHTA 4U6RA 1VEBA 4AT3A 2PY3A 4RJ7A 2UVYA 4QMUA 3PWDA 2HYYA 3GT8A 4CKIA 1U5RA 3GC7A 4QP8A 5I3RA 2IW8A 2I6LA 1ZYLA 5HCZA 3Q4TA 4TKSA 4O2PA 3IOKA 3ID6C 2BZJA 3E8EA 3F66A 5CAOA 1J1BA 4FV1A 5LMBA 4JS8A 4J71A 4D5KA 4DG2E 2CNQA 4LV5A 3PXKA 4V04A 4UMUA 2X4ZA 3ZS5A 4GFMA 3PZHA 4EOPA 1Z9XA 3QD4A 1FQ1B 2WB8A 4WNOA 3D5XA 5IQBA 3L9LA 5DN3A 1OL1A 5E90A 4YP8A 4UB7A 5D1JA 3T8OA 2UZNA 4I92A 4XOYA 5GZ8A 4TL0A 1W7HA 2JC6A 5HG9A 1HOWA 4F65A 1G8AA 4JQ8A 5CTPA 3ZUUA 4IE9A 1MUOA 4FSWA 2GHGA 2WFYA 3NW7A 4FT7A 3W18A 3DAJA 3KEXA 5HCXA 4C4HA 2UZWE 3O2MA 3EFKA 3LCOA 4IDTA 4ZTHA 4GUBA 2DS1A 3QXOA 4MHAA 1TQIA 4PWNA 3EFWA 4KS8A 3ZXZA 4EUTA 4YPDA 5FP6A 4CD0A 5IQDA 3DAKA 4NCTC 3C4XA 5I5ZA 2VWBA 1F5QA 2P3GX 4HYSA 4BIEA 5FRIA 2SRCA 3NNXA 4QYYA 1JWHA 4BCJA 1DS5A 3FQSA 3UG2A 4C62A 3LJ0A 4FG8A 3ZSHA 2JDTA 1OL6A 3OTUA 4O0SA 2FO0A 4HCUA 4F6SA 3UZRA 4K0YA 3AMYA 4L7SA 3SD0A 2R9SA 5AV4A 3MW1A 2A1AB 3P1AA 2PMNX 3TL8A 2WD1A 4QNYA 4YJOA 5E8VA 5B0XA 3PA3A 4FV6A 1WBOA 3F7WA 3L8XA 2J5FA 4JQ7A 4DT9A 5CU4A 4X7QA 3LCKA 4O91A 1CKIA 5CYIA 2GU8A 1KE8A 4O1PA 3FXWA 4GYGA 5KX8A 1S9IA 2UW6A 2E9UA 3PY1A 5JQ8A 3ZMMA 1Y8YA 1P14A 3AQVA 3OXZA 4ERKA 5KKRC 3A99A 3MH0A 2JD5A 5BMSA 3OBGA 2PE2A 3OY3A 3MPTA 5KMIA 2J9MA 5IQAA 1OKVA 3QQUA 3VS0A 5J1WA 2DWBA 5AAEA 3PWYA 5DFPA 2X1NA 3C51A 1FVTA 3KRRA 2WHBA 2R3NA 5F9EA 1ZWSA 3VS6A 3CPBA 4NM0A 4ZTRA 1M52A 1SNUA 4DEAA 3RCDA 3KXHA 2RFSA 1YWRA 3PIYA 4NK9A 4C34A 5CU3A 4KKEA 3TNPC 2BHHA 4AGCA 4C37A 4IM3A 4BHNA 3C4WA 1Q8TA 2XIKA 5A3XA 1AQ1A 2ETRA 4XRJA 1QPJA 3FWQA 2HENA 1OB3A 2YM4A 3GI3A 4FEQA 4FTUA 4ACCA 4WSQA 4O7SA 4J8NA 2QD9A 2QU5A 3QD2B 4W8EA 4XP0A 4C58A 3VULA 1WVWA 4G6OA 4IAFA 4WOVA 4OAUC 4YTCA 1BKXA 4OTWA 5HIBA 1G5SA 4R7HA 2UZLA 3MVJA 5DIAA 4JIAA 3ZLWA 4LFIA 2VTSA 1GAGA 3FHRA 4AW1A 5B2LA 1FBNA 3TDVA 4UBAA 5DBXA 5CZIA 4BN1A 2PZIA 4GFGA 3FLYA 3F5PA 4BBFA 4DFUA 1W8CA 2OO8X 4JDKA 4V01A 2XF0A 2WQBA 4RFZA 5CVHA 3ANRA 5E7RA 5FG8A 5BUJA 1A06A 2WGJA 4IIRA 4HJOA 3TJCA 4I93A 3RPOA 3ULIA 2HW6A 2XEZA 3EN6A 3SRVA 5BYLA 5HD7A 3CSVA 2XM9A 5CEKA 4EH9A 3ETAA 1Q5KA 3E87A 3OVVA 2QO7A 5IUIA 4IB5A 4XUFA 3QF9A 2WMUA 4GIHA 4HCVA 3V6RA 5EW9A 4IAYA 2E2BA 4EOKA 3E3BX 2RKUA 3NX8A 1OM1A 4IW0A 5DT3A 4AW2A 1OBGA 1OKWA 2BAQA 3FKNA 3O8TA 2XMYA 4J97A 3DXNA 3LFFA 4TYIA 2R5TA 3R7IA 3R04A 2C68A 2XNBA 3ZRKA 3QX4A 3CTHA 4O7RA 2HIWA 4XG4A 1GNGA 3ORIA 3R0TA 4O1OA 4Y83A 1WAKA 3CIKA 3UPXA 1BLXA 1V0PA 3C0HA 3HX4A 3NVKI 1Q62A 2B9IA 2Y4PA 3ALOA 3UQCA 3N4TA 5GZAA 4EHVA 4JNWA 3CD3A 3H9RA 3Q2MA 4GT4A 3W33A 3MY1A 4X6RA 4EOJA 4CTBA 4EOOA 1WVXA 3GEQA 4JQEA 3LFBA 3DZOA 3F2AA 4AZVA 1IR3A 5C4LA 4BBEA 3H4JA 3N4VA 2EUFB 5CEPA 4DBXA 4DGGA 3W8QA 3G15A 1H1RA 1J91A 5IEXA 2GQRA 2C1AA 1KWPA 1PKGA 5AM7A 5KMKA 4ZS0A 2PTKA 2R0UA 2ZV8A 1CKPA 3F3TA 3KMMA 3VO3A 3POOA 3BV3A 5IA5A 2F57A 4O0XA 5IEVA 4FV2A 4KRCA 5HO7A 4FZDB 5JT2A 5M53A 2HZNA 3BIZA 3V5QA 4IZYA 4G2FA 4M84A 4KSQA 3KRJA 2QOCA 2XK7A 3EQCA 4GU6A 4IC8A 4RIXA 1YDSE 4U3ZA 5G6VA 5LMAA 3GFWA 2QOFA 5HTIA 2C4GA 3G33A 3RP9A 5FEDA 4H39A 3NUNA 5HE3A 3U9NA 4WG3A 1ZOHA 2E9PA 2XIRA 3MTFA 5FEEA 3QKLA 4CLJA 3TM0A 3GP0A 5I9ZA 2J4ZA 5CSVA 3QUDA 4Z55A 4W9WA 5HVKA 4C36A 3QQJA 1Y6AA 4H3PA 4DH8A 4K18A 2W0JA 3HGKA 3JUHA 3ZO3A 4RMZA 2IVTA 4A9UA 5KCVA 3HMMA 4XV9A 5DE2A 4AGUA 1PXOA 4WHZA 2OXXA 4MQ2A 3DXPA 3BCEA 4YBKA 5EDPA 2CGVA 5AR7A 3FMMA 3W2CA 3H0ZA 4CFUA 4Y72A 3L1SA 4GT3A 3VUIA 3NNWA 4M14A 5CU2A 5AP0A 1Q24A 4XMOA 1R39A 3CR0A 4JAIA 2GTMA 3GXLA 4OTQA 4A9RA 5JSMA 5LWNA 4G17A 4NIFA 4TNBA 4H3BA 4FTKA 4G3DA 4FKSA 5FD2A 5JEBA 2VUWA 4FVQA 2CJMA 2CSNA 5EI2A 4APPA 2REIA 4CCUA 2YIWA 1XO2B 3UP7A 2W1HA 4UALA 4JXFA 3KXGA 5ANJA 3NW6A 5HG8A 4DH3A 4Z16A 5CAUA 5FXRA 4YZDA 3QRIA 1K9AA 3VBQA 4NKSA 3A8WA 5M4UA 3R8UA 3UP2A 5DLSA 4AE6A 2C6MA 1DAWA 3OW3A 3PYYA 3QA8A 2EXEA 4IBMA 4FIJA 3QRUA 3TXOA 3PJ3A 3VQHA 2KULA 5C03A 2PE0A 3ODZX 3TACA 4F7JA 2Z60A 1F0QA 4BI0A 2P0CA 4LM5A 1HCLA 2Z2WA 4ALVA 3QTUA 2V7OA 4L53A 1XBBA 5EM5A 3RM6A 3W1FA 1ZOGA 2I0YA 3WF5A 5DEWA 4EOIA 4AW0A 4G6LA 4MCVA 1J7IA 4GG5A 5CALA 4USFA 2XVDA 2BZIB 3QRTA 4EH2A 1OIUA 4CSVA 2ITQA 5HX6A 2GHMA 1XR1A 4HYIA 4WUAA 4YC6A 2Q83A 3W8LA 4QP6A 1JOWB 3O8PA 3ZU7A 3A7GA 4EOMA 4Z3VA 2JGZA 4HYUA 2ITNA 4F9CA 4P4CA 2YCQA 3DQXA 3V6SA 4IWQA 2Y9QA 4UX9A 1UU7A 2R7IA 5BPYA 3M42A 4RA5A 5AIKA 5ANGA 1U46A 5CAQA 5HG5A 4ZJJA 2YM8A 3VS4A 4R78A 2GMXA 5E92A 4OTGA 5E1SA 1IAJA 2QOQA 3JPVA 4PPBA 3D4QA 1UVRA 2C3JA 4TYGA 4TZRA 3RZFA 2YWVA 4C4JA 5I4NA 5ICPA 3HUCA 5D12A 4TW9A 2WQNA 4KSPA 3PSCA 4XLVA 4WT6A 5AADA 3FC2A 2ERZE 4M66A 4IB0A 1OPLA 4IB1A 5E9EA 4C4GA 1UA2A 4UN0C 4MBLA 3DK6A 1CTPE 2GNFA 4J7BA 4S30A 3FXZA 5J7BA 3TZ8A 1ZYDA 3MYGA 4L44A 4OAVB 1PYEA 3II5A 4OBOA 3ZO1A 5HTCA 1KV1A 3KK9A 2OK1A 3TEIA 3G9LX 4M69B 1NT2A 4K8AA 3PTGA 3NUYA 3T3UA 5DEYA 4FODA 3FMHA 3FMJA 3MPMA 2QOBA 2R3GA 4WRGA 3MA3A 2WTIA 4I5CA 4FKVA 1GJOA 3HMOA 1QMZA 2XK4A 3P0MA 3PRIA 3FLWA 1YWNA 3PIXA 3HP2A 5GZ9A 5C4KA 1A9UA 1GZOA 2W06A 4MH7A 3EL7A 4D2RA 4ACDA 3VS5A 4NL0A 4BDBA 4KINA 4N4SA 3ZC6A 1YDRE 2BIKB 4JL9A 2YM6A 5E8XA 1XHAA 5K0XA 4MNEB 3W55A 2RIOA 4AZFA 4GMYA 4J52A 4DFXE 2ZM4A 5M06A 3PXZA 1H4LA 2OZOA 3ZLYA 4F7NA 3GQIA 4G3GA 2XYUA 4AN2A 4XV3A 1PMUA 5HESA 4WA9A 1SNXA 1YOMA 3DBQA 5DR2A 4ACGA 5TR6A 2LAVA 3BELA 4WIHA 4RWIA 4F1TA 5LVMA 4GK3A 3FZ1A 4H1MA 3BYVA 5HOAA 4CQEA 2B9HA 3BHHA 2CMWA 3Q53A 1H25A 4G5JA 2EXCX 5AX3A 3S00A 5LVLA 2XKDA 1OITA 3OOMA 1LEWA 3FPMA 3WZUA 4G1WA 3UYTA 3TV6A 5K5NA 3UVRA 4CCBA 5EKOA 4U0IA 4FL1A 3D94A 4RVKA 4UWYA 3NLBA 4MYGA 4LG4A 4U9AA 3EFJA 3WYXA 1GZNA 4EUUA 3ITZA 3IDBA 4O0VA 4YJSA 4IJ9A 2PU8A 2UZTA 4CV8A 4BB4A 2X81A 4CFMA 5AP4A 2VO6A 3BHVA 4FSRA 4I1ZA 2R7BA 2VTIA 4BDAA 4BHZA 1LR4A 1BI8A 2C5OA 2EU9A 4BDEA 4EHEA 4O0RA 4HVHA 4YZ9A 2XNNA 1LP4A 1Q8ZA 4D4VA 2JFLA 2C6KA 2VX0A 4QO9A 4FEVA 2XRWA 2DUVA 3E7OA 4XBRA 4NU1A 4AZEA 3F5GA 3OP5A 2OI4X 3G6GA 1PXJA 3F3ZA 3S4QA 1YOLA 5JRSA 4DTKA 4O6LA 3FMNA 4QYEA 5AUYA 4E5BA 4EWQA 4M0YA 4DGMA 5LJJA 2WMBA 2UW5A 4JLCA 4MXAA 1TVOA 2DYLA 3L9NA 4PNIA 3R7UA 3V5LA 1CSNA 2YISA 4XHKB 4MKCA 5I9UA 2YWPA 3UO4A 5HORA 4K2RA 4WNMA 2R3RA 4X3JA 2WAJA 2XBJA 5C8MA 2BKZA 2OZAB 4OT6A 4J99A 3QTQA 5HX8A 3HECA 5DH3A 4F09A 5T3QA 4FF8A 2NRUA 2UUEA 4ZLYA 4E6QA 3L9PA 1PF8A 4USDA 3RJCA 3ORNA 4JI9A 2Q0BA 5HNBA 4GRBA 4ASDA 4DINA 5JQ5A 2PVNA 3EQPA 2OFVA 4IXPA 5LMKA 2PUNA 1NY3A 4FT5A 3DBEA 4LOQA 4MF1A 3GFEA 2WXVA 4TYJA 2G01A 1R78A 5IDPA 3TI1A 4RJ5A 3LKMA 3LJ2A 3NUPA 3S0OA 2YFXA 5EOLA 2OJGA 5AR4A 1Q97A 2XS0A 5JH6A 4RZWA 4L3JA 3Q9ZA 3SLSA 4QMLA 4TN6A 1FMOE 1XH9A 3K5VA 1UNHA 3RM7A 4E26A 4BCIA 5K5XA 4CZTA 3LJ1A 1H01A 1YHWA 3ANQA 3IW7A 2PE1A 3U9CA 2FUMA 2JKQA 2HXLA 3LW0A 4F70A 4ZY4A 4YLKA 3ZEWA 3FQHA 4APCA 3MFTA 2VWIA 3U6JA 4KAOA 4YZCA 4LUEA 3KMUA 4IANA 4FV8A 4LRKA 5IMEA 4Y85A 4UY9A 3G0EA 3QTRA 3UBDA 5JZNA 3W2RA 4I5HA 4O0TA 3I5NA 3QC4A 4FKWA 2OIQA 3U4WA 3QCQA 5M07A 4S33A 2WTWA 4ZSJA 3EKKA 5BUIA 4NH1A 4W4XA 3GU5A 5AUXA 1R3CA 1TKIA 3ET7A 5E8ZA 2ONLC 3ROCA 2PULA 5J79A 5FDPA 2LGCA 3HV6A 4FSQA 4QP2A 4EOSA 4EH7A 2B9JA 4JJRA 5KUPA 4YHTA 4HGTA 4C3FA 1OZ1A 1YXSA 3AD6A 2F9GA 2UZDA 3U87A 4RRVA 4G31A 3PXQA 4IVCA 5CVFA 4MF0A 3UJGA 4BGQA 4CNHA 4GKIA 2QQ7A 4ONAA 5KE0A 2R3PA 2YM3A 2BRBA 3D7ZA 3R1NA 1R0EA 4PPCA 4X3FC 4L6QA 2XK6A 4GYIA 3BHYA 3VF8A 3SG9A 3TUCA 4KB8A 5IA0A 3GOPA 1WFCA 1M2RA 2HK5A 2J6MA 5EG3A 3RBWA 4D0WA 2QKRA 2QOIA 4JDHA 3MY5A 4NM7A 4U7ZA 2PWLA 3BQCA 4WSYA 3BYUA 3C5UA 4BTMA 3DK7A 3F9NA 5CSHA 2J0JA 4AU8A 1XH4A 5FXQA 1OL2A 3LFAA 1ZZLA 5EQYA 2RG6A 3ULZA 3CS9A 4EH6A 4FL2A 2FSOX 3WOWA 2F7ZE 3POZA 5CX9A 4TPTA 3TNQB 3OWKA 4JBVA 3TUBA 2C6IA 2OIDA 3FDNA 2R2PA 2F4JA 3OZ6A 3WIKA 4FKLA 3HRCA 5G1XA 1J7UA 5M08A 2ZV9A 3MI9A 4E5WA 1GIJA 1NXKA 5TF9A 3QCSA 2YCSA 1Q99A 4KIKB 3DLSA 3R1QA 3ZFMA 3BYOA 4XX9A 5IA1A 5K3YA 2HELA 2QG5A 3OBJA 1RQQA 4H1JA 3PVWA 4KKGA 4ZSEA 3R22A 4FK6A 4GCJA 3EN5A 5EYCA 3VW8A 5AA8A 4ITJA 1BX6A 4DGNA 2PVKA 3LQ8A 2XA4A 4Y5HA 1B38A 1MQ4A 1UNLA 1M2QA 3DPKA 2PMOX 3H30A 3NUSA 4EK8A 3OUKA 3QZFA 3MB7A 4I0RA 2ESMA 3ATSA 3FXXA 2YIQA 4GK2A 2WQEA 4O7NA 4J1RA 2BHEA 5TO8A 5FUTA 4C38A 3PPKA 3IOPA 3TT0A 4C59A 2R3LA 4QMXA 3CTJA 4A9YA 4EWHA 4KBKA 2VTAA 3GQLA 4DEEA 5L6OA 3CGFA 4BY9E 4E5AX 3VBYA 4CLIA 2J5EA 4U97A 4D4SA 4UXQA 4I21A 3RAIA 2NPQA 5FDXA 3VUGA 5KMNA 1QL6A 3LXPA 5B2KA 3MVLA 1E1XA 2B1PA 2QI8A 2WTVA 3HV3A 3A60A 3GC9A 2YIRA 3ACKA 3IG7A 4FI1A 3T9IA 4AN3A 4BR3A 5EK7A 1H1SA 1YI4A 2PVYA 3K5UA 2W99B 3PJCA 1ZZ2A 2OG8A 1XH5A 2H96A 3RPRA 1YXTA 4GSBA 5LWMA 4HVIA 2JITA 4MXZA 4O96A 4RA4A 3TNWA 4X21A 3OWPA 2GFSA 4LOOA 4RJ3A 2YAAA 4IVBA 4FNZA 5DNRA 2W17A 2Y7JA 2XNOA 4JG6A 3C50A 2XRUA 4MD7E 2XK3A 3PE1A 3QWKA 3RMFA 2J51A 2JEDA 2C5VA 3RALA 5IKWA 3ZDIA 4EOQA 3U6IA 4EQMA 1RDQE 2VTMA 3A4PA 2OSCA 3EQRA 3FI4A 3NZ0A 4LGDA 5ETFA 1GOLA 2QNJA 4M69A 2X7FA 4QQCA 2W1IA 4Y5QA 3ZZEA 3EIDA 3EYGA 4QP3A 3PUPA 4YHFA 4L42A 3KU2A 2HY81 1YVJA 3GCSA 4PX6A 5IQEA 3CCNA 3F61A 4C3PA 3MJ2A 4E6AA 4ZK5A 4E73A 1B39A 3G6HA 2C3KA 1WZYA 2E9VA 4G5PA 2R4BA 4BDHA 2W1ZA 5AP3A 5DVRA 3D5UA 3R01A 5TT7A 1PJKA 3IKAA 3LXLA 3PVGA 5IISA 4G3EA 3TIYA 4E20A 3LAUA 4FC0A 5GINE 1ZXEA 3RNIA 4FICA 4MNEA 4L68A 3OROA 3IONA 3CLYA 2QHMA 1IEPA 2IZUA 2RL5A 1H27A 3AMAA 1U54A 2JIVA 3D5WA 3D83A 2JKKA 5HBHA 4I0TA 1H8FA 2XNEA 5D41A 4F08A 3VC4A 2OIBA 4RC2A 2OXYA 2IVSA 2YAKA 3I7CA 1P2AA 4NWMA 4AQCA 3FMDA 4FSNA 3PSDA 4BCNA 1OL5A 5L2WA 3CTQA 3SVVA 3KCKA 5JFSA 2YJRA 4EONA 4FYNA 5H9BA 4PF4A 4QPAA 4RX8A 4ZY6A 3EQIA 4IAZA 3ZO2A 4CEGA 4PNKA 2NO3A 3GUBA 4WBOA 3ZUVA 4U45A 3KFAA 3A2CA 4Y8DA 5HEZA 2BRNA 5JFXA 4F6UA 3GCQA 4C02A 3GGFA 3NUUA 4TWNA 4DT8A 5HE2A 2WTKB 1RW8A 3TKIA 1M2PA 4Q9SA 4IJPA 4ZP5A 2W4OA 3D7TB 3M1SA 4KABA 2X6EA 3R30A 3C0GA 4OTHA 1GZKA 4RJ6A 3RVGA 3SA0A 4YJPA 4U80A 3L8PA 4IB3A 1K3AA 4BWPA 5GJFA 1PXMA 1EH4A 4MTAA 4YZMA 2HW7A 2P2HA 4AFEA 1ZYSA 5JZJA 3ROYA 4RX9A 4FNWA 4P5ZA 3KULB 5CVGA 4DEGA 3LE6A 3QGWA 2BAJA 4NCTA 3RAKA 3BLHA 5HU9A 4EQUA 3ZC5A 3F5UA 1IRKA 5J7HA 4NFNA 2E9NA 3RHKA 2PVHA 2W1FA 1JPAA 4TYEA 4RVLA 3LM0A 4A4XA 4FV4A 3LM5A 3PE2A 4RSSA 3I0OA 4NTTA 2XYNA 3TTJA 4FTQA 4IWOA 3UOLA 3UPZA 2JAVA 2V22A 3G2FA 3OF0A 4UMTA 5C1QB 4ANOA 3NYNA 2YZAA 3ZONA 3S2PA 2CGWA 3D2IA 5GNKA 5IA3A 2O63A 4CG9A 3IW5A 3QYWA 3RHXA 5C8KA 3KRLA 3LFSA 4KKHA 4RBLA 3R7EA 4F9WA 4IVAA 3R8VA 3AD5A 5L2QA 4DFZE 2V0DA 2A4LA 2PVMA 4UWBA 5D9HA 3RPYA 3VBTA 4DAWA 5IQIA 4L8MA 2I0EA 3F82A 4I94A 3OCSA 3EKNA 5KBQA 4DCAA 3TWJA 4O82A 1NA7A 4J96A 1Y57A 3SQQA 3VW6A 3RWQA 3FI8A 2QKWB 2FH9A 2RFDA 4EHZA 2C6TA 4FGRA 4H36A 1L3RE 5CXHA 2O3PA 4BTFA 5BYZA 3FLNC 5JMSA 4QRCA 4WBBB 4AOIA 3BKBA 4EZ5A 3VUTA 1KSWA 2BR1A 3Q4CA 4QP1A 4X2JA 5CI7A 5AWMA 4F9BA 3O96A 2C30A 2WEVA 2C6OA 3E8NA 2UZUE 2XIZA 4L3LA 3H9FA 3BQRA 5BNJA 1IA9A 2C6EA 1Q3DA 2XK9A 3SKCA 3TZ9A 3OCBA 2VN9A 2JBPA 3R1YA 2W1DA 3A8XA 3AC2A 3DAEA 4QTAA 4D28A 4IH8A 3QBNA 3V04A 4NW5A 5KMOA 2OJJA 3UTOA 4D55A 4YURA 3O7LD 1BYGA 4OR5A 3BE9A 3ZBFA 3FPQA 3QU0A 4YR8A 3PZEA 2V5QA 2HY0A 5FTGA 2ERKA 2B53A 1SYKA 3R00A 4BTKA 4FA2A 5CAPA 3A7FA 1X8BA 4L00A 3FQEA 4L3PA 1G3NA 5T68A 5HGIA 2R3IA 4U3YA 2QO2A 4XYFA 4GEOA 3HUBA 4BWXA 2YZLA 2AC5A 1B6CB 3F2NA 5KZ0A 3QX2A 5IA4A 5B2MA 4U42A 3U6HA 4E4LA 3IW6A 1PXNA 2PVRA 4OTPA 2BMCA 5EKNA 1H1PA 3FHIA 2B55A 5J87A 4BYJA 1H28A 1DI8A 1O6KA 2W9ZB 1OIQA 3ZHPC 2BKKA 3GBZA 4YTHA 3TG1A 3VQUA 1V0BA 3CY3A 1H08A 3W2QA 4DFBA 3MIAA 3QCYA 3TNIA 4IWDA 1WCCA 4JX3A 4I3ZA 5HVYA 3ORXA 3F2RA 4ITIA 1IG1A 3RPVA 3Q9WA 4FIHA 1XWSA 4FOBA 3BU3A 4NFMA 3I6UA 1G8SA 4ZTSA 3RTPA 1E9HA 2X8EA 3IS5A 5HNGA 3KB7A 3B8RA 5AX9A 3REPA 3ZBXA 3DU8A 3IECA 2CKQA 3DCVA 3DQWA 1KE9A 2XK8A 1OKYA 2BPMA 1YHVA 2GFCA 2QOOA 4OTFA 5IEYA 1OI9A 5HCYA 5L8KA 3SW7A 4R7BA 5AEPA 2BRHA 2W4KA 3DY7A 3EL8A 5LVNA 1WBTA 2V7AA 3FZOA 4JR3A 2X6DA 3SXSA 2HCKA 1WVYA 2RG5A 4YSMA 4F1OA 3VBWA 3HMIA 4C57A 1M14A 1XH7A 3C9WA 3SHEA 4BYIA 4G6NA 2GNIA 4DBNA 4EC8A 1UNGA 3QC9A 4RWLA 4R1VA 3BRBA 4KIKA 1OBDA 4CFNA 3FY0A 2WMSA 3L8SA 3HP5A 3P79A 5A14A 4CZYB 3Q04A 5C27A 4U43A 1YI3A 3GB2A 5I9YA 2IZRA 3R6XA 4I4EA 2NNWB 4DTBA 1Q4LA 4QP4A 2B52A 4FSUA 3MPAA 4QMWA 3CJFA 2WMRA 3UO6A 4O27B 5T6KA 3HAMA 2VV9A 3PP1A 2BUJA 3V8TA 5L2TA 4LOPA 4JG7A 1OGUA 2VWUA 4BICA 2CHLA 4W4WA 5TE0A 1JBPE 2GNHA 4OT5A 3WF7A 5CAVA 5K4JA 4A06A 4L45A 4DFNA 4F99A 4EI4A 2VGPA 5DOSA 3KXZA 4GL9A 4O7ZA 3UO5A 5HO6A 4E4XA 3GCVA 4OGRA 2UZVA 1IAHA 2BCJA 5HBEA 4X3FB 4TNDA 4X0MA 5EQPA 2X7OA 4FV0A 4YLLA 1I44A 2I0VA 2F2CB 2J2IB 2VWVA 3BE2A 2HAKA 3DFAA 4FV3A 4BGGA 2R3OA 3S95A 4BIDA 4RJ4A 3WILA 4ANSA 4PP7A 3QZGA 2PVJA 3LQ3A 4UYAA 2QG7A 3GU8A 3HEGA 4ACMA 4HGLA 2BAKA 5M55A 4C2WA 4EYMA 5JFVA 4QNAA 2OXDA 3LFNA 3N9XA 4XG8A 1ZMVA 4FG7A 3AT3A 4ENXA 1YXXA 4M8TA 5IH4A 5EYMA 5J8IA 3WZDA 1U5QA 2HZIA 2X2MA 3PPJA 2W5HA 4FNYA 3P23A 2ZVAA 5KZIA 4EQCA 1ERKA 2OBJA 3BU5A 3FE3A 2QU6A 2UW4A 4EK6A 4F7LA 5BVEA 3CJGA 2R3FA 2FSLX 4E1ZA 4RVMA 3COHA 3FZPA 3IW8A 4XG6A 3UE4A 4AOJA 1JSTA 3O0GA 2CN8A 4JG8A 1PXIA 3GC0A 5JGBA 2Y6MA 1XH8A 4DG0E 3EQGA 3HKOA 3V51A 3E88A 2GNLA 4PL3A 1O6LA 2OGVA 3WI6A 4ANMA 4LRMA 4ASZA 3UODA 1SZMA 4N6YA 3UC4A 2IVUA 3NS9A 1JNKA 4CKJA 5L8JA 3N51A 3FZRA 4B9DA 4QMNA 1P5EA 3A62A 2FVDA 2J7TA 4NKAA 2C3LA 3OHTA 4X6QC 5BVWA 5BYYA 2V62A 4M67A 2ITOA 3MN3A 3FKLA 2OJFE 4BKYA 1SVHA 2C0TA 5JGAA 3RK9A 3VUHA 3OXIA 3FZSA 3ZCLA 3CBLA 4GV1A 4FTNA 3OEZA 3C4CA 2R3KA 1WBSA 3ODYX 4KA3A 2VTHA 1WBNA 3WZKA 3R8LA 4BCOA 2CCIA 4RC3A 5AV1A 2QLUA 3NNVA 4JIKA 4O0UA 3E62A 3DOGA 3GCUA 3RPSA 1WBWA 4IMYA 5ETCA 2GS6A 5AP5A 3PVBA 4O2ZA 4AA0A 5CQWA 4ZOGA 2JIIA 4Q5HA 4RIOA 5CS6A 3FMKA 3PXFA 4LMNA 1L8TA 2WTKC 3OW4A 3DA6A 2YACA 4MXXA 1J1CA 4G3FA 2CGXA 5AFVA 2C5YA 2H8HA 5EDQA 4PDSA 3KC3A 4L9IA 4EHGA 2VGOA
chains in the Genus database with same CATH superfamily
2ZDUA 1UU3A 3BGPA 3D7TA 5EYDA 4A07A 4CG8A 1PXLA 5M09A 4ARKA 2NYAA 3CXWA 2BVAA 4G16A 5D7AA 4BZDA 3OT8A 4CZUA 5IZFA 5M4IA 3NW5A 4FIFA 4I23A 1XMLA 4NSTA 2B0QA 4QMQA 4IX4A 4Q9ZA 3I4BA 4FKUA 5CY3A 4K77A 2XNMA 3KRWA 2IN6A 4I20A 1XMMA 3BEAA 3FMEA 4BKJA 3TKUA 5BVOA 3ZRLA 3KULA 3UIUA 1KOAA 5JN2A 3HMPA 4YZBA 3DFCB 4Q5EA 4ZSLA 4CT2A 4EK3A 3QKKA 4AGWA 3E8DA 3QTIA 4K6ZA 1Y91A 4P2KA 4RIYB 2PZYA 3PP0A 4EBVA 1WBVA 5E1EA 1MRUA 3ZLSA 4IX6A 2C0OA 2QC6A 4PDOA 3ZDUA 3QZHA 4L01A 3VRZA 2XCKA 3PA4A 3MSSA 2ZMDA 4QMTA 3ZTXA 3NDMA 4ALWA 5HBJA 4O6EA 2VTTA 3CY2A 5L8LA 1A48A 1QPDA 2ZM1A 3IPHA 4D2PA 1BL7A 5CEQA 1G8JA 4LMUA 3NCZA 3MV5A 4AFJA 4ZJVA 3DXQA 2J0IA 4L52A 2C47A 5M56A 1ATPE 3THBA 4DEBA 3Q9YA 4FZAB 4RX7A 4DLJA 1LPUA 3TV4A 2R64A 3W32A 3BWJA 3WBLA 3OXTA 3ZOSA 3G51A 1QCFA 4C61A 3R2YA 2YA9A 3TZMA 4D5HA 1ND4A 4UMRA 4BTJA 3BL7A 4H05A 4MX9A 5DT4A 4ITHA 3R2BA 2YIYA 4FTMA 1Y8GA 2Z8CA 5L4QA 4YJRA 4O22A 4F0IA 1PMNA 3KN5A 4Z7GA 2RF9A 3E8CA 4JAJA 1UWHA 3EQFA 2YLEA 1YXUA 2OKRA 2YHVA 3VONA 2YERA 4FT3A 3DT1A 3R73A 4XH6A 4BCMA 4M12A 2KTYA 4FSTA 1BL6A 3UQFA 4FNXA 1VYZA 4FKTA 5AR5A 3QQKA 5A4LA 3PY3A 2GDOA 3FEGA 3F3VA 4S2ZA 4YC3A 4HVDA 4S34A 3MDYA 3OG7A 4QMZA 4YHJA 3B2WA 3Q4ZA 4GU9A 2Z7LA 4ZZOA 5DRBA 3FI2A 4MBJA 2A19B 2ZYBA 3DKOA 3QD3A 1JQHA 3QHWA 1KE5A 4MAOA 4E8AA 2BZKB 2XM8A 3MWUA 2C5NA 3GU4A 4KIQA 4QYHA 4O38A 2Q0NA 1R0PA 2XJ1A 5CZHA 3P5KA 5FBNC 3VBXA 5AUTA 4RLKA 3E93A 5LARA 5AP6A 4AQKA 3ORKA 3CEKA 4W8DA 2EVAA 2W7XA 2OH0E 3LFCA 3NAXA 4K9YA 4ZJIA 2CNVA 3EQDA 2NRYA 2WU7A 3A7JA 1K2PA 4FIGA 3BWFA 2VO3A 4I5PA 1PMVA 4WNKA 2GSFA 2Z7RA 4PDPA 2IG7A 3GU7A 3NWWA 4LL0A 4K11A 5EH0A 2WKMA 4UYNA 1PKDA 4D1ZA 4F63A 2W1GA 3RZBA 4LUDA 4ZS4A 4RG0A 5EW3A 5AUUA 2E9OA 4Y73A 5A4TA 3ZUTA 5A4EA 5KMLA 4TYHB 4I6QA 4CKRA 4L43A 3VHEA 2W96B 2OF4A 2XIYA 4AGDA 5I9WA 3BU6A 5LXMA 2WZJA 3PJ2A 4II5A 3QALE 4Y95A 1AGWA 4EOLA 4U81A 1V1KA 3MH2A 4N70A 4C3RA 4EZ7A 3AOXA 4MEDA 3ACJA 3NYXA 2JIUA 4NEUA 4PTEA 2VRXA 3EHAA 3MFUA 2HOGA 4O4CA 3TV7A 2WIPA 3MVHA 5FLFA 3TNHA 2WQMA 2ZAZA 5BX0A 2UVZA 4FTCA 2JKMA 3QTSA 4DLIA 3QAME 3LLAA 4EH3A 4R6VA 4ZMFA 4W4YA 3O17A 3KL8A 3G5DA 4EKKA 5M4FA 2XH5A 4HGEA 1YI6A 4QTEA 4AXDA 2WEIA 5E8WA 4DTAA 4KRDA 4ZLZA 2I40A 4WNPA 3PFYA 5CI6A 1M7NA 4FR4A 3D14A 2WTDA 3DKCA 2ETMA 4ZAUA 5CSXA 3N4UA 2YJSA 3I1AA 3QQFA 3W2PA 2VTJA 3PDTA 2PVLA 5AUVA 4TWOA 4AOTA 3KCFA 5AM6A 4AX8A 2JAMA 3KA0A 2XIXA 2ONLA 1F3MC 3O71A 5HLNA 4G9CA 3IW4A 3UZPA 1JVPP 3BV2A 3ERKA 3GC8A 4ZSGA 3HZTA 3NSZA 1H07A 5DG5A 4MK0A 4JBOA 4NUSA 1NVRA 2A0CX 3BLQA 3C1XA 4YJVA 3F6XA 3Q32A 5E8SA 3ZFXA 3ZM4A 4IM2A 4CTCA 4J95A 3MA6A 1QPCA 3JR1A 4U79A 4J98A 3V3VA 4JT3A 4CXAA 2ETKA 2GS7A 3UOJA 5HIEA 2WOUA 2FA2A 1MRYA 3LLTA 4X3FA 3A7IA 3MJ1A 5D7VA 2O5KA 3C7QA 3QRJA 5B7VA 2ZJWA 3EQHA 4HW7A 5JKGA 3FC1X 3KF4A 4FG9A 2UZOA 3V01A 3WF6A 5IA2A 4AP7A 2JBOA 3FV8A 1FVVA 2CKPA 3FUPA 4PTCA 3UMXA 1DM2A 2FGIA 4FE2A 2EWAA 3IDCA 4OBPA 3VN9A 3S1HA 4B0GA 3NGAA 2G15A 3KN6A 5HD4A 4U44A 4FZ7A 2X2LA 3F3WA 4GJ3A 3EQBA 5D10A 3VAPA 4KUJA 4AXCA 2OJIA 4RFMA 2AC3A 3PJ8A 3SDJA 4PL5A 2OWBA 5DMZA 1XBAA 2VWXA 3KF7A 4ENYA 2YABA 3DGKA 2BTSA 4X2NA 4ZEGA 2JKOA 3AT2A 1APME 4KIOA 4PMMA 5IH5A 2XAOA 4QPMA 3M2WA 3CE3A 3NNUA 4G34A 4M68A 2X8DA 3C4FA 4FBXA 5EW8A 5ITAA 3AKJA 1TQPA 4KWPA 2CCHA 4QP7A 2VWZA 5LVOA 2I7QA 4EEVA 4FUXA 3EYHA 4R3CA 5J5TA 4YPSA 5FTQA 4DHIB 2VTLA 3LMHA 1YDTE 3HV4A 3JVRA 5AP7A 2X8IA 2FSMX 4CMOA 1XJDA 2A2AA 2G2FA 1QPEA 4I6FA 3ZSIA 1NVSA 4U41A 4MNFA 3UQGA 5A9UA 3KVXA 3R9RA 4CQGA 4EKLA 2UW8A 4M3QA 4IAIA 1LUFA 4ZTQA 3VJNA 4A9TA 3SG8A 3SXFA 2AQXA 2BROA 1MRVA 4NZWB 1W0XC 3VVHA 3ZFYA 1OVEA 4RLLA 2YDIA 2PUIA 4NW6A 2W1CA 3H0YA 4O7YA 5JGDA 3IO7A 1PY5A 2HZ0A 3JS2A 3GENA 3W0NA 1YW2A 1XKKA 4FIEA 3AC5A 2PZRA 1XBCA 2ITYA 3OEFX 4LRJA 4AW5A 3V5WA 2YCRA 3RNYA 3EB0A 1OMWA 4UMQA 4BDGA 3EH9A 1HCKA 3DKFA 4AACA 2XANA 2ZDTA 5HKMA 3DJ6A 4A9SA 2UV2A 5HICA 5L3AA 3KXXA 4HCTA 5GIPE 3TJDA 3VBVA 2NP8A 1XH6A 2VX3A 4MQ1A 3AMBA 1ZY4A 4XBUA 5AP1A 4FTAA 5I0BA 5M57A 5FXSA 1YOJA 4CVAA 3NIEA 5HQ0A 4WG4A 5AUWA 4LV8A 4F0GA 1W84A 4UMPA 5BQ0A 2G1TA 1PXPA 1WBPA 2IVVA 2JDVA 5HLPA 4KBCA 3RKBA 4DFYA 2WMAA 2YCFA 5DT0A 3LIJA 5F4NA 5A54A 5I9XA 2YLFA 3K3IA 2CDZA 5CU0A 4EZ3A 1Z57A 4GK4A 2JDSA 4GVAA 3OC1A 4E6CA 3O23A 4QMYA 4AS0A 4RIYA 2ZV7A 4BGHA 4F64A 4UZDA 4FEUA 3U51A 4FSZA 4FKGA 1WMKA 3R7VA 3QWJA 4ANNA 3PJ1A 4PTGA 2AYPA 4I22A 3H9OA 4FSYA 1GZ8A 3TCPA 3WE4A 1SMHA 3BI6A 4JBPA 3A7HA 2UW3A 4RGJA 5H3QA 4KD1A 4PRJA 2VX1A 5BVNA 4FEXA 1JSVA 1VZOA 2I0HA 5AUZA 4YTIA 4R77A 4B4LA 3RI1A 4IQ6A 4XG2A 3AXWA 4S32A 2IWIA 2VO0A 1P4OA 2R3JA 4E7WA 4DGOA 2FSTX 3MY0A 3TDWA 1VYWA 4XS2A 2X7GA 3AD4A 4FTOA 3OS3A 2VWWA 1PYXA 4QP9A 3FZTA 4EH5A 5J9YA 2F7EE 2B9FA 1UWJA 5AV3A 1OUYA 3BGZA 3Q6WA 4H58A 5BVFA 2CNUA 5FM3A 3BGQA 3OOGA 4TT7A 5HHWA 3SC1A 2GQSA 5GJDA 2QLQA 4DG3E 4AXFA 4AN9A 5EFQA 4HPUE 4CYIA 1U4DA 1ZYCA 3BHUA 3R9HA 5IUGA 2Z02A 1ST0A 4O7TA 4B99A 4FV7A 3MH3A 3E3PA 4C33A 4U40A 5BVDA 1RJBA 4AUAA 5HZNA 1Q3WA 3FBVA 4PQNA 2A27A 2EB2A 3LFQA 5GHVA 4GVJA 3GOKA 3Q4UA 2W05A 2GQGA 3K3JA 4BDDA 3P86A 3R1SA 2ZV2A 3FYJX 3AG9A 3RWPA 5CASA 3E63A 1UV5A 3R02A 4GW8A 4R8QA 3MB6A 3VUKA 3AC3A 1Q41A 1CDKA 2BRMA 4FV5A 3UIMA 2UZEA 4NJDA 2H34A 4DA5A 1YQJA 4XV1A 2XCHA 2QOLA 3H3CA 4FTIA 3VUDA 1E1VA 4DEIA 2PHKA 2WNTA 5ANOA 5HE0A 2X0GA 5D11A 2GPHA 1ZY5A 4H3QA 4AZSA 2O65A 2UVXA 4DFLA 4BJJB 5IG1A 3C4ZA 4DH1A 5ACKA 3WF9A 2OZAA 4GIIA 2C6LA 3UNKA 4R3RA 5CNOA 4AT4A 2YM5A 3VNTA 3QXPA 1S9JA 1STCE 5A6OA 4ZMEA 4RQKA 2O2UA 5AR2A 3FLZA 3FSFA 3R7OA 2VAGA 4FIIA 5J95A 3ELJA 3KGAA 2PZ5A 2R3QA 4IX5A 3R9DA 4TYHA 4BDCA 5EM8A 4WRSA 5ANKA 4D9TA 3NR9A 3DJ7A 3LHJA 3IK3A 4IZAA 4P90A 5A4CA 1J7LA 3TKHA 4M15A 4JRVA 4A7CA 3GVUA 4LQMA 1RE8A 2PMLX 4DE4A 4ERWA 3F5XA 1Z5MA 3UGCA 4K1BA 4E4MA 2VWYA 3TTIA 2Y4IC 4XEYA 3R83A 5TOZA 5IF1A 5CEMA 3CC6A 3W2OA 4I0SA 3UVQA 4XV2A 3JY0A 5F1ZA 4BL1A 2OH4A 4BI1A 2ZOQA 4EJ7A 1YKRA 3CQUA 5HNIX 2OU7A 3UOKA 1O6YA 4ZTLA 3CGOA 3IGGA 5EYKA 4FKPA 4DH7A 3QLFA 3WE8A 2QO9A 4D2SA 4M13A 2CLXA 4EH8A 2WMVA 3LXKA 5A6NA 3VS1A 5LCJA 4DYMA 4ZY5A 5IDNA 5ETAA 4O0YA 2XEYA 5F95A 2AUHA 2XKCA 4NM5A 4HOKA 3R71A 5IUHA 4O83A 3BZ3A 5AJQA 1TQMA 5KBRA 3NRMA 3RAHA 3ZH8A 4D2TA 2QR7A 4AG8A 4MWIA 3LOKA 4XP2A 5JK3A 1IA8A 5CSPA 3QGYA 3ZO4A 3I0QA 2J90A 2RFEA 4DHFA 3FI3A 2C5XA 1ZOEA 2O8YA 3OD6X 4RIWB 3MFRA 4IFGA 2WU6A 3NMUF 1BMKA 5DR6A 1U59A 4EORA 5C9CA 1YHSA 4GT5A 2UW7A 2WOTA 4NTSA 1H26A 1J3HA 3KY2A 3DB6A 4G9RA 3R7GA 4DH5A 1FVRA 5K0KA 4YUQA 2JFMA 3UOHA 2BIYA 3C0IA 4YNOA 2W4JA 4EK4A 3WF8A 5EM7A 3QA0A 3UC3A 4ACHA 4CT1A 3MS9A 5HTBA 3DTCA 5L6PA 3ZXTA 3FY2A 3NIZA 4QOXA 4BDKA 5F20A 3Q3BA 2IW9A 4FJVA 4V05A 4BFMA 1ZMWA 2VNYA 2BDWA 4HNFA 4BCFA 4FL3A 4BCKA 4O86A 1T45A 5JFWA 4LGHA 1NVQA 4IZ5A 4IWPA 4XG3A 3EN4A 1PRYA 3V8WA 3OCTA 3TIZA 4IVDA 4N57A 1ZYJA 2BRGA 2O64A 3ORPA 4FSMA 5DI1A 4D0XA 5AR8A 2GS2A 5DWRA 1OGYA 5E8TA 4IADA 1ZRZA 4Q2AA 4IDVA 4ZTMA 2PK9A 5JRQA 3SXRA 3U55A 5CU6A 5C8NA 4ASXA 3ZLXA 3FYKX 3ML1A 2C69A 2QVSE 2XAMA 3P08A 4BRXA 4D9UA 4L7FA 3CP9A 5DR9A 4BDJA 4M97A 2JDOA 3QFVA 4WG5A 4TY1A 4ZZMA 4QTDA 2YDKA 4CRLA 1W82A 4DGLC 2IPXA 2GTNA 3DBFA 5CLPA 4RC4A 5KMJA 4D4YA 3MFSA 3SGCA 1FGKA 1Q8UA 2BDJA 3BYMA 3Q5ZA 3QUPA 1Y6BA 4XNEA 3ZYAA 4YZNA 4PL4A 4PY1A 5M4CA 4JBQA 4FKOA 4IZ7A 4O84A 3R21A 2Z7QA 1AD5A 1PHKA 1PW2A 1YWVA 3MBLA 3PPZA 3Q5IA 4FOCA 4FMQA 4TRLA 4DC2A 5KMMA 2CKEA 4HVGA 4FGBA 2X2KA 4IX3A 3PXRA 3BL9A 2BTRA 2J50A 4I5MA 3PG1A 5ANIA 3EZVA 3LCDA 1MP8A 4V0GB 3F3UA 3U8WA 3PFQA 4WKQA 3DBDA 1LEZA 4MD8E 5H8BA 5FGKA 3QLGA 2RSVA 4QQTA 5KHXA 3PG3A 5CT7A 1I09A 4D1SA 2FYSA 4UEUA 2J0MB 3EOCA 5FTOA 4BDIA 3PVUA 3A61A 4YJTA 2O0UA 1REKA 3BLRA 4FT9A 4O0WA 3HNGA 4CGAA 3FL4A 3UYSA 3LCTA 3AC4A 3CD8A 4KNBA 4N0SA 3O50A 4CFVA 4CMTA 4ZTNA 3EZRA 5EOBA 2OFUA 4XCUA 3FL5A 4KS7A 3P7AA 3RK7A 5KO1A 3TUDA 3G90X 3I6WA 4X2GA 3DDPA 2JLDA 3UG1A 4FTJA 3UDBA 3DV3A 3W0OA 4QMVA 5FBOA 4L46A 3AT4A 2R3MA 4BBMA 4U8ZA 3HL7A 5GJGA 5M51A 4PMPA 3CQEA 3MIYA 2WTCA 4FTRA 1JSUA 2QURA 3Q6UA 4YSJA 3PLAE 2WQOA 2BILB 3VUMA 2ITPA 3HA6A 3AGMA 3L8VA 2GNJA 4EH4A 3F7ZA 4YO4A 5CXZA 2C1BA 3E64A 3NPCA 4ALUA 2V55A 4TXCA 4FZ6A 5FEQA 1ZAOA 2Y0AA 4ANLA 2IO6A 5ACBC 3EFLA 3QTXA 3U54A 3QL8A 4FTTA 4C4IA 1FGIA 4JX7A 5IQGA 4XLIA 1H1QA 3DS6A 4CMUA 4B6LA 5AMNA 1OIYA 1URCA 2WMTA 4CV9A 5LCKA 3TZ7A 1VR2A 2XZSA 4D2VA 5CENA 3QQGA 4BKZA 5AV0A 4MD9E 3AC8A 4TWCA 5L2IA 3LMIA 1XQZA 3I81A 4DN5A 3ORLA 3UZTA 3VRYA 5AP2A 4YTFA 4RWJA 4I4FA 3VS7A 4CFXA 3JY9A 5KHWA 1SVGA 1OPJA 4PV0A 4CYJA 4PP9A 1ZARA 2WMQA 3RINA 5AV2A 2YIXA 3QQHA 1H1WA 4HNIA 4FEWA 2QODA 3D2KA 3B8QA 3OTVA 4D4RA 1JKTA 1KV2A 5IQFA 3FAAA 3OY1A 5F94A 1KE7A 3EMGA 3Q60A 3PXYA 2IZTA 1UU8A 1NW1A 3LPBA 4BWKA 4PDYA 4HZSA 2OLCA 2Y8OA 2XNGA 4DF3A 3BBWA 3F88A 2X4FA 4K33A 4W4VA 4DCEA 2W5AA 4D1XA 2W9FB 3RGFA 4YMJA 4G3CA 5M44A 1OUKA 1UKIA 3G0FA 1CMKE 3PA5A 3SAYA 4BVUA 4PUZA 4D2WA 3C4EA 2QONA 3NVMB 4L67A 4QQJA 4O7WA 2F2UA 4GJ2A 4BCPA 5A46A 4TWPA 2UW0A 4I6HA 2WELA 2WTJA 3ZM9A 4YNEA 5CWZA 2ITWA 2R3HA 3L9MA 3QUEA 5BMMA 2PVFA 4CFWA 4F0FA 5KNJA 2PUPA 4AAYA 1OKZA 2ITZA 3D15A 5LOHA 5IQHA 4CRSA 4Z9LA 3T3VA 2ACXA 1PXKA 3KKVA 4QYFA 3KXMA 5FP5A 1FPUA 3HMNA 2CN5A 3T9TA 3ENMA 3V5PA 4BZNA 2P2IA 4C0TA 4QTBA 5E4HA 2OJ9A 5BUEA 4BJJA 4E6DA 2CKOA 2EB3A 3K2LA 5J9ZA 4IFCA 1Q8WA 5CQUA 5EQEA 5AAGA 4XJ0A 3QKMA 3E92A 4FKRA 4UZHA 4WUNA 2QOHA 2CGUA 5AIRA 3UIXA 2W1EA 4IEBA 3DK3A 5TKDA 3UNJA 3I60A 3R8PA 1PMEA 4GH2A 3MGYA 3CQWA 5CANA 4EL9A 4R7IA 2ZMCA 3P7BA 2BZHB 4HYHA 1OPKA 4XG9A 3P9JA 3COKA 3WZEA 4O4EA 1U54B 4UV0A 5HVJA 2Y6OA 5ANEA 4IC7A 3W2SA 3OT3A 3Q9XA 2XB7A 3JVSA 2F7XE 3KXNA 4MXOA 2EXMA 2VO7A 3ZZWA 2I1MA 2VTNA 1DAYA 4IAKA 4OBQA 5E8YA 3W0MA 3GU6A 3O7LB 1MQBA 3KIOC 2WMWA 2XJ2A 2B4SB 3AC1A 4IHPA 2YN8A 3VS2A 2ZB1A 4E3CA 1GIIA 5K9IA 1ZMUA 3NCGA 3PIZA 2BFXA 2ITXA 3BX5A 4R1YA 3MVMA 1YRPA 1DI9A 3OWLA 1OECA 2OICA 2WO6A 2ITUA 4QYGA 1H0VA 5CNNA 5EHOA 4AE9A 4C4EA 4USEA 1VLRA 4PMTA 3R8MA 3ALNA 3HRFA 4RIWA 4YJUA 3MH1A 4HZRA 1CKJA 3DLZA 5CEIA 4GKHA 2J0LA 4LYNA 2X0QA 3NUXA 4U5JA 4KIPA 3DKGA 3GCPA 3U4UA 4F1MA 3SOCA 5DYJA 3PSBA 4XRLA 5E8UA 3C13A 5EDRA 3I5ZA 5H2UA 3ORZA 3GNIB 1W83A 1V0OA 2X9FA 3FLSA 3KQ7A 3LZBA 2YEXA 5EM6A 3HDNA 3EWHA 3QRKA 4WD5A 5DHJA 2XKFA 4RQVA 5C26A 2PL0A 4YJQA 3HLLA 4DEHA 2PYWA 4HPTE 2OW3A 2ITTA 3DNDA 1M17A 4CFFA 4LI5A 2BFYA 3LCSA 3NYVA 2G2IA 2XNPA 4C4FA 4HVSA 2XP2A 4M7IA 3O5AA 2ZB0A 1UU9A 3I79A 4QQ5A 3SW4A 3IGOA 4LL5A 2BALA 5DRDA 4DEDA 1KOBA 5AAFA 2Y4IB 3KRXA 2RGPA 3A4OX 1R1WA 3FKOA 4ASEA 3O8UA 5EHLA 3ENHA 5LMKC 3BPRA 4M0ZA 4F9AA 2HWOA 5KKRB 4OTRA 3VJOA 5AR3A 4FX3A 4JOAA 3DNEA 4PPAA 2H9VA 3OUNB 5A4QA 4A4LA 5GIOE 4B8MA 4GUEA 2XBAA 3K54A 5IPJA 3FLQA 4O7VA 3VF9A 1BI7A 3WIGA 2ITVA 4JR7A 2QR8A 2VZ6A 2OF2A 3UMWA 4AA5A 1KUTA 4YC8A 4B7TA 4RWKA 2C3IB 3WZJA 4X2KA 2BDFA 2VTQA 4KBAA 2P55A 4O21A 4RJ8A 3WARA 3NYOA 2J0KA 5FM2A 5J5SA 3Q2JA 2CPKE 4FTLA 1SM2A 5EI6A 1OIRA 1SVEA 3QQLA 2FB8A 1FINA 4OLIA 5H8GA 3NAYA 4DITA 4R5SA 5HG7A 3QTZA 4J53A 4BCHA 4ZLOA 4GS6A 4ID7A 3EN9A 4EJNA 3FSKA 2RFNA 1FOTA 3OCGA 5DGZA 3HRBA 3KVWA 2PZPA 2VTPA 4FKJA 4YLJA 3TN8A 3W16A 4A4OA 1Q61A 3AGLA 2UZBA 4EK5A 4MXCA 4AZWA 4FRFA 4YBJA 3COIA 4QMMA 4BZOA 4FK3A 2GNGA 4FT0A 3O51A 5FWKK 3ZEPA 2WPAA 4O81A 3QTWA 3CPCA 3DB8A 4QMSA 5EI8A 2B54A 1ZLTA 4V0GA 5HIDA 3WYYA 4MVFA 3SX9A 4OW8A 3IQ7A 1JKLA 1UKHA 4IM0A 5I9VA 3HVCA 1GIHA 5ANDA 5CF6A 5CF8A 4ORKA 3DBCA 3E7VA 3SRVB 2QOKA 3COMA 5E91A 5HE1A 3W10A 5J9LA 5AA9A 1JLUE 2WIHA 2YITA 3R63A 2G2HA 3PRFA 4PMSA 4NT4A 2ZM3A 3KK8A 4IAAA 2JDRA 4S31A 4QTCA 2P33A 3PY0A 4AA4A 4BCGA 4P5QA 3OMVA 2R0IA 3B2TA 3SOAA 4UXLA 1REJA 4JDJA 4LGGA 2YDJA 4W9XA 1IASA 2C6DA 4AZTA 5J1VA 2IW6A 4XG7A 3S3IA 2IZSA 4RX5A 4FZFB 1FMKA 4ZXTA 4C2VA 4O7LA 4O4DA 4RVTA 5LQFA 3UNZA 1JKSA 3EN7A 5CEOA 3RCJA 2VTRA 2PUUA 3PLSA 4GG7A 3QYZA 4JMQA 4J8MA 1OL7A 1JKKA 4FVRA 4UWCA 1CM8A 5IH6A 2UW9A 2HWPA 3V5TA 3V8SA 5IQCA 3VWAA 3ZSGA 4QMPA 3D0EA 4QMOA 4ANBA 3EJ1A 1M7QA 3KMWA 3HYHA 3OFMA 3HV5A 5CSWA 4BCQA 2VU3A 2C0IA 4D58A 3MESA 4NYEA 4AXAA 4YO6A 2X39A 3LQ5A 4BI2A 3F69A 4IACA 4C35A 3ORTA 3LXNA 3P4KA 3P7CA 5H8EA 4I24A 5CT0A 3Q96A 5ETIA 2W5BA 3H10A 4NJ3A 3R8ZA 4QD6A 3QZIA 3ZRMA 3KREA 1W98A 5LVPA 4YGAA 2HXQA 5EHYA 3SV0A 1H24A 3NEWA 2VTOA 2PSQA 4GFOA 3RK5A 2Z7SA 3LFDA 4RZVA 3R9NA 4RIXB 4EBWA 4F4PA 3D5VA 3JXWA 1H0WA 3HA8A 3ORMA 4P7EA 1GY3A 5DA3A 2X9EA 3DDQA 5CF5A 3I7BA 4MBIA 3FJQE 3QCXA 2GCDA 3QHRA 2IJMA 2HZ4A 1KE6A 3VHKA 3HAVA 5CF4A 4BDFA 2PMIA 5FQDC 3JYAA 2P4IA 3E5AA 2DQ7X 1T46A 1P4FA 3HV7A 3VS3A 4OUCA 4YJNA 3R28A 3LFEA 5DPVA 1BUHA 3LVPA 4JRNA 1YXVA 4AT5A 3CKWA 3UVPA 1JAMA 5IU2A 4F9YA 4FKQA 4Y46A 2WMXA 2G9XA 4EC9A 5IMXA 4RFYA 2ZFYA 3BYSA 2CLQA 3Q52A 3OWJA 4C8BA 4E93A 3M11A 4FVPA 4FUYA 4XP3A 3BBTB 4NIFB 4BIBA 3CKXA 3DTWA 2XJ0A 5L2SA 2VNWA 3D9VA 1O9UA 2F49A 2H6DA 2PPQA 4I6BA 3QD0A 3G9NA 2YM7A 2VD5A 5I3OA 4ANQA 3UDSA 3RAWA 4FV9A 4HGSA 1H00A 4AAAA 4C7TA 4OTIA 3HDMA 4RPVA 2XKEA 4MWHA 4F7SA 4QPSA 3DJ5A 1VJYA 3C5IA 4AF3A 4XOZA 2XUUA 4R3PA 4ZIMA 3BEGA 4Z7HA 4FKIA 1Q8YA 3VIDA 4TTHB 5HI2A 4R5YA 4MXYA 4YU2A 5K4IA 4FYOA 3LMGA 3NFGB 4NM3A 4E4NA 3P78A 5HU3A 1URWA 5C01A 4OTDA 4MUQA 3UIBA 4EYJA 4ZZNA 4WO5A 4JVGA 5HO8A 4ZSAA 3ATTA 3NUAA 3R9OA 3FMLA 5BVKA 4DHZA 4I41A 4X2FA 4QT1A 2QHNA 2GHLA 4N6ZA 4RT7A 3V5JA 4BC6A 3IDPA 3MTLA 3R7YA 3DZQA 4JDIA 2QCSA 4AWIA 4F6WA 2B7AA 4BF2A 5L6WL 5HLWA 4B8LA 3BHTA 4U6RA 1VEBA 4AT3A 2PY3A 4RJ7A 2UVYA 4QMUA 3PWDA 2HYYA 3GT8A 4CKIA 1U5RA 3GC7A 4QP8A 5I3RA 2IW8A 2I6LA 1ZYLA 5HCZA 3Q4TA 4TKSA 4O2PA 3IOKA 3ID6C 2BZJA 3E8EA 3F66A 5CAOA 1J1BA 4FV1A 5LMBA 4JS8A 4J71A 4D5KA 4DG2E 2CNQA 4LV5A 3PXKA 4V04A 4UMUA 2X4ZA 3ZS5A 4GFMA 3PZHA 4EOPA 1Z9XA 3QD4A 1FQ1B 2WB8A 4WNOA 3D5XA 5IQBA 3L9LA 5DN3A 1OL1A 5E90A 4YP8A 4UB7A 5D1JA 3T8OA 2UZNA 4I92A 4XOYA 5GZ8A 4TL0A 1W7HA 2JC6A 5HG9A 1HOWA 4F65A 1G8AA 4JQ8A 5CTPA 3ZUUA 4IE9A 1MUOA 4FSWA 2GHGA 2WFYA 3NW7A 4FT7A 3W18A 3DAJA 3KEXA 5HCXA 4C4HA 2UZWE