4AP6A

Crystal structure of human pofut2 e54a mutant in complex with gdp- fucose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
389
structure length
389
Chain Sequence
SRRRYLLYDVNPPAGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKITY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Pofut2: Insights Into Thrombospondin Type 1 Repeat Fold and O-Fucosylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords GDP-FUCOSE PROTEIN O-FUCOSYLTRANSFERASE 2
total genus 131
structure length 389
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.221: Peptide-O-fucosyltransferase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10250 O-FucT GDP-fucose protein O-fucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11340 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap6A01
3.40.50.11350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap6A02
4AP6A 3ZY2A 2HHCA 4AP5A 3SIXA 2OCXA 3SIWA 2HLHA 2DE0X 3ZY3A 3ZY5A 3ZY6A 3ZY4A
chains in the Genus database with same CATH superfamily
1YA4A 1OXUA 1OIVA 1Q2XA 2LCFA 3DBVO 4DS3A 3NKLA 5AK0A 4PZLA 3R7BA 1JIIA 2JHPA 1TZCA 3C5WP 3LT1A 3M6AA 2A9KA 4MW9A 4RH3A 3AFOA 3E7XA 4YCAA 2FWAA 5AM1A 3D6VA 4C7XA 5TF0A 4KFSA 1PDOA 1CQPA 1F0YA 1G3QA 1FL9A 2C9OA 2YBEA 4X3CA 1CLUA 4YO8A 2EFDB 5JH7B 4PO3X 2F1RA 1FFWA 3FWHA 5FUXA 1LB1B 4BEWA 5L45A 4Q01A 2PYIA 4DIEA 2G4CA 2HRBA 5ALVA 2MR5A 2Q4EA 1RBQA 3BPSA 1HYGA 2JFQA 2Q3CA 4WXEA 2QRVB 3IT3A 4X8MA 1E2KA 4O3MA 2PK3A 2CXNA 4GOJA 1JG1A 2X1LA 1TT7A 2BEVA 2WIAA 4HOYA 2J4DA 2IUTA 3E9QA 4MVJF 4RD0A 2JCBA 3FCSB 3RTDA 3AGPA 1ANKA 2R68A 3BILA 4MV9A 5ALSA 4IJKA 2PUVA 5EQTA 5F7XA 6ABPA 2FJPA 1IY8A 2CVOA 3WAGA 1ZAYA 1U5BB 1R0YA 2PRIA 4JLDA 2I4NA 1DAMA 3EVBA 5F9MA 3JALB 2CYAA 4CNBA 2XGOA 4FBGA 2PEYA 1FDRA 1OFVA 1WMEA 1XCOA 3OTIA 3O31A 1P3JA 2CFCA 4OXRA 5JPIA 3V6LA 5HYVA 4V0MA 2XRZA 3C5VA 3N8IA 3NBUA 1B1CA 1W87A 4DLYA 5HF6A 2VAWA 4FWIB 5LQSA 1FTWA 4HEA1 1J8YF 5LQNA 2FOIA 2HA2A 3IULA 4BECA 1PDVA 1PS0A 4XYLA 4LDAA 1O9BA 1SC9A 4FEYA 3T3GA 3O3CA 3VR3D 4CKCB 3KEGA 1IY9A 2OP0A 1T4MA 2PFGA 3LXXA 5TT0A 2ZAYA 2HYDA 5HS6A 2IKQA 4CT4B 3SY8A 2H1OA 3V7NA 2C3PA 4CETA 1E6CA 3OM0A 1PUIA 5EG5A 1GGNA 1WEKA 3BWMA 5EQDA 2FN8A 2OAGA 1UKAA 1RI1A 2QX4A 4MV4A 2OLEA 3HDJA 2OP1A 3KO8A 4IWNA 4B3FX 2GJKA 5CD1A 5KWJA 3OJCA 1J1IA 3NDPA 4JBLA 3KEFA 4QO8A 1B73A 5AJWA 3RIMA 4KPYA 1WZEA 3FDZA 1BRMA 2AEEA 2BGKA 4IL5A 4MR8A 3A6GA 4CTKA 4PNZA 4R81A 3HEAA 1MPTA 3TDMA 3TE6A 1TC1A 1FBNA 2XF8A 4ZCLA 2NXWA 2NUTA 1FQJA 4EI2A 1O3YA 3LDFA 4G2NA 5G0UA 2P1ZA 1GZHB 2FPGA 4IWYA 3N75A 3TM4A 1F48A 3ZD6A 1NBOA 1Y80A 4GKAA 5G2OA 4AKHA 4MUBA 3WGOA 4BQQA 3RBAA 4CZ2A 3ZVKA 4B4WA 1WNFA 1WXQA 1IBKB 1NW3A 1UIRA 1VECA 3V3TA 4EMSA 2W0MA 1H5NA 4F7WA 3ANYB 2O57A 3B70A 1XZMA 3MCTA 4YFVA 4PG8A 3MW8A 4YJFA 2PBRA 1GXSB 4LQDA 3K1AB 4DNQA 1DBPA 4UAVA 2HLNA 1RCUA 3OTQA 4MR9A 5EEHA 4CR6A 4EKEA 9ATCA 1H2XA 3MWFA 1RCFA 1U4SA 2FEXA 5G1OA 4B9EA 1PQWA 5K0LA 2HMVA 2D1QA 3NQ41 3WQSB 1G16A 4GR9A 4IJUA 4X90A 4D3DA 4HJRA 2CXPA 3Q8KA 2LGJA 2OY0A 4QL3A 2HB6A 1HFEL 1USUA 3E82A 1SR8A 1JXOA 2PGXA 3Q3HA 1K6MA 2VYFA 1ZM3A 2JEYA 2PRJA 4YAIA 5KTRA 2XDWA 5ELMA 2O8FA 4A2QA 1JV2B 2M6SA 2XJ4A 3C8DA 2I29A 3ABQB 2EHDA 4QTUB 4RSMA 5D5QA 2W6PA 4CQMA 1WOYA 4LQLA 5E8RA 2BM9A 1DUIA 3HYSA 4NENB 4GZ3A 4Y6QA 3P32A 5A3SA 3U37A 3GRFA 1WE2A 2Z2KA 1EFHA 1E3SA 2IP4A 2KYRA 1T3SA 1ZEJA 3GYBA 4G24A 1T35A 1XUOA 1MMFB 4OQPA 2XCRB 1SXJB 3E7DA 3AJ8A 1Y8CA 3JQBC 1VJGA 3KUCA 1ZOLA 1LS6A 2PBLA 3KBBA 2J07A 3EXHC 2AG1A 2RBKA 3VX4A 1FNCA 2G6TA 1L4FA 3HKEB 3G17A 1EK0A 1WY7A 1KOJA 2GNAA 4UPVA 1W4BA 2VI5A 4W82A 1L0BA 1TTPB 4F92B 3RC1A 4NU6A 4ZYTA 1X7XB 3Q6IA 1CR2A 5IJAA 3ETCA 3LY7A 2PS3A 3OM8A 3Q12A 2UZ1B 3QE4A 4FGSA 4BNXA 4EJ6A 2VF8A 3UNXA 3H4IA 1XZNA 1OFUA 1P5RA 2IL1A 3BDVA 1E58A 3FMGA 2ZU6A 3CF2A 4MZDA 4DNXA 4EY7A 5TQ0A 2WVHA 4OM7A 4EEKA 4EKIA 2W43A 3AERA 1Z26A 1TQ2A 2QTVB 3JWEA 5IARA 1QXSA 4CKEB 1IXKA 1P0QA 2C7OA 1Z07A 4FX2A 1NXSA 1Y1QA 1WTCA 3DOOA 1EVIA 4I5GA 1MB0A 3H1GA 1ZRSA 3WE7A 1YJAA 1ZD3A 5DT9A 3NIDB 4HFRA 1HM5A 4P3PA 4CYMA 5J1TB 1YZKA 3V2IA 3KYBA 3UK2A 5K2OA 1Z63A 2Q2QA 5ALKA 2IOQA 4MH0R 4RKEA 4ECEA 1NURA 3NGXA 5C5DA 2QRZA 1V2HE 1WG8A 1E1DA 4LBZA 1C9YA 1G20B 3GUHA 1A04A 3CLHA 5HZHA 5CPBA 4HWSA 1PTJA 1VI5A 5IM5A 4E5KA 5HKKD 3I37X 1KGDA 1VDMA 2V7PA 4HGOA 1AV6A 1VLHA 5IZCC 3E35A 2NU7B 1XN4A 2B35A 2I2AA 3A6HA 2HA6A 3NBAA 5LD2B 2FQWA 1DSSG 4CRWB 3L4SO 1XHEA 4ARVA 1LSJA 4B2IA 4CQMD 3MINA 1WZNA 2W6JD 1BTOA 1OZHA 4NYMR 3QKRB 2FEAA 5IF3A 1KO8A 2VIIA 2PVSA 2BOVA 2CKDA 3R5TA 1CHDA 3OPYB 1N5OX 2QMZA 3HCNA 3WIOA 5JROA 4N39A 3QX9A 2VDJA 4A8HA 5FNVF 1YI1A 3LWZA 2OUKA 1OGYA 1E66A 1YZTA 2EHJA 4PBSA 5AJTA 3DC7A 1O6GA 5THQA 2HBRA 4R2MA 1BDMA 1B2LA 2WOJA 3LX5A 4JDUA 4EFKA 3VSBA 3GLGB 1AMNA 1RZVA 4PQYA 2DBVO 1A5BB 3DD5A 1E5QA 3PC4A 4U9HS 2B1IA 3P94A 4IOJA 3OQMA 1VHQA 2AOWA 3L43A 5CIQA 5HR5A 4QDXA 4RVUA 1AQUA 4Y9RA 1JLKA 4LQCA 1P7WA 3EEIA 4DUYB 3W6UA 1ADCA 4GVPA 3U81A 5BR4A 1TPYA 1Z2CA 5JYDA 1NY5A 4AP5A 3I9FA 1NXVA 2Q62A 1GADO 3WLTA 3R9WA 2OZVA 3TD6A 4HN4B 5F5LA 2R6CA 2Y71A 3DXYA 4RK5A 5CDYA 5HUJA 1QLHA 4JXXA 3BH7A 1WB4A 4MV7A 1Q1QA 2QM3A 5BNFA 1JDPA 4NPAA 3RVJA 4DCMA 2GAFA 4IM7A 4HYTA 2GEUA 1QHHB 3ESYA 2XZTA 1LI7A 5TGZA 2YYYA 4INAA 2RCYA 3IP1A 2V6MA 1R4NA 3OBBA 1A9OA 1USKA 4BQPA 1J5EB 2QJRA 3T9FA 2XUOA 1SBCA 4TMYA 1SA0A 2F2TA 2VXYA 3AUJB 2RAFA 3L06A 3QEOA 5GONA 5T8KA 1EQAA 1G291 5CM8B 5B1EA 1RWBA 1XD2B 4EEXA 1RI3A 1JXAA 3FFXA 3IHWA 4EOGA 4LA4A 3VYTB 2I2BA 4PE5B 3VOTA 1N5IA 3C1AA 2WZBA 3NW9A 4WXRA 4C0AC 1W34A 2ECOA 3KPJA 2CDBA 1IBCA 3MD9A 1G7TA 4LHYA 3ELWA 4LYDA 4RJLA 3HE3A 1R6DA 3UQYS 4G41A 1QZTA 4FCWA 4GGMX 1P44A 5CDSA 2WEKA 2OMEA 2D4HA 2X5OA 3P4XA 1QPZA 4HEA6 3H16A 5JS7A 2UVPB 4JB2A 3PX7A 1M5UA 4K03A 3GRCA 3GG9A 4RQBA 3RSFA 1IWBB 3OOEA 4Y2GA 4ZVUA 1SQ5A 2QGFA 3N86A 1N2OA 5EHXA 4M54A 1ZNZA 1EWTA 3IE0A 3IIJA 1FTGA 4BFLA 3FW1A 5J43A 2IXAA 3E2IA 5LMNB 1ISHA 1SKQA 2E4ZA 1A9PA 1HZZC 2BAGA 5J9FA 5LOVB 3SJ7A 1W36C 4QGSA 1YS6A 1XZEA 2EQ5A 2ZUDA 4MKFA 1U0LA 2VNAA 3G59A 4NK5A 1MAHA 2C3YA 2ILVA 1E0AA 1Z4JA 2BRUC 1IBRA 5JD3A 3D6TB 2Q9UA 3CNHA 1EM6A 2LNDA 2MINA 1KI8A 1KEEB 2VRCA 3KQWA 3Q3CA 4RVNA 5CLHA 1UP6A 4RW0A 4OHCA 1ZL2A 1K7CA 4GF5A 4HPJB 1NJSA 1SOAA 2IWRA 3J81k 5I9LA 2C0QA 5ITVA 2H0RA 3CSUA 3G5LA 5LOVF 2R8XA 1OA1A 1CYEA 1YFKA 4ZT5A 4GQBA 1W0KD 1GKYA 1WDMA 4L50A 3WRXC 4TYWA 4JZKA 3LIIA 3TLJA 1RXVA 1GPUA 2WUEA 2DG2A 4FQ7A 1YKSA 5DHPA 2Z56A 5F3DA 3RTGA 5D01A 4M0KA 2TRSB 2ZUTA 4WXMA 1WLSA 3L0ZA 3MWEB 1OJ7A 3WXBA 3RVLA 2G07A 1UDWA 3BD6A 4M8KA 4MQEA 3B1XA 4PG7A 3K9GA 4MPTA 4RKRA 3CH4B 1R64A 3I2JA 3B8HA 3INNA 5I4CA 4KXUA 4CKZA 1QGZA 3BN3A 4X61A 5GZ3A 2OUIA 1RLJA 3ZU2A 4BTLA 4HR7A 2NU6A 5BV8A 4K26A 3BHMA 4EFDA 4BAUA 3R8FA 1LDNA 1O94D 3DMDA 4ZTBA 3E0XA 3HVRA 3GNQA 2QAGA 1ZDMA 2HDOA 3KIPA 1A1SA 2J46A 1G9XA 2YINC 4Q93A 4X6YA 3SC6A 2PN1A 4L0CA 4FEGA 1U7TA 2ASEA 5KTMA 2VF2A 4M7RA 4N5DA 3KTDA 3ZNOA 2DVMA 2B0JA 5UKDA 5ES4B 4EUEA 1M6YA 2QORA 4C03A 1FNDA 3TJRA 4DMMA 1E2JA 1EFRA 1OLSB 2VYVD 5E9QA 5JLAA 3GEGA 4YMHA 1KJWA 2B8TA 2VF5X 3AJEA 1LBIA 4K86A 1Z5VA 1J6UA 3KKKA 1L9KA 3AP3A 1BE1A 1TJ3A 2QL5A 1KFCB 1QF9A 4EF6A 3BRSA 4LJRA 2HSGA 5T57A 4DBVO 2E18A 4X1YB 3IBFA 3RGWS 3UFXA 4P7BA 1H22A 3C7DB 3TRIA 2PIDA 3VR5D 2QYHA 2V5UA 3CTPA 3WGZA 3M5WA 5AMXA 3SX4A 3TDNA 2VUIB 1OZGA 3L1VA 3C0KA 3GRRA 3I0ZA 1EYZA 1X74A 2XNCA 3T7RA 1K1EA 1TM4E 4XX0B 3SJBA 1U2GA 5EXXA 3S2ZA 2QIPA 1V35A 2BMVA 5HUHA 3NTQA 2CV2A 3SVZA 2NXCA 2VT3A 1PJ3A 4BQNA 3JASA 1BMQA 3O4RA 4Z0HO 2ZRMA 4B4KA 4GKJB 3TOXA 3IESA 3ZXUB 2XGMA 1A8IA 1XZ8A 1G5QA 1ZHOA 2RGBA 2BM8A 1K0FA 1M2OB 2E4WA 3HJBA 4RA6A 3QUBA 2A9QA 5EMLA 4ILKA 2BV3A 3L49A 2XKAA 3QFHA 5BN5B 3GMIA 2BDEA 4AJIA 2ZRHA 2W2QA 4G56A 2CFIA 3A6DA 3EPHA 1NQVA 2A7QA 1GAEO 1NZDA 3MBKA 4IEFB 4LI3X 2XZPA 3T3PB 3BWEA 2OCLA 4U4AA 2DQYA 1HZJA 5DTMA 4B5KA 5K1ZA 4ZOLA 3CNEA 5IC4A 3ZCUA 3B38A 1WSDA 1G8SA 1COWA 5E4YA 3OLWA 4N12A 2WE8A 5TQ2A 1GPLA 2B25A 3EXHB 3TIIA 3WSWA 3NNSA 4PWZA 1AQ6A 3B7PA 7ADHA 3CLSC 1QQ6A 1FFXA 1Y9ZA 2PL1A 3NHJA 5K3DA 5FTLA 2EBFX 3BWVA 2C29D 4AJ2A 2AS0A 2NYUA 1T5DX 3BXEA 4TMWA 3AETB 4J7AA 3USZA 3OOJA 2B78A 4MI6A 3VV2A 2R1TB 3ZCSA 4RJIA 3OEHD 4S1NA 2BIFA 1Y6FA 4NABA 2H07A 3RUPA 2ASVA 2JF0A 4ZT6A 1B8UA 3DVLA 1X77A 1XTVA 3AF2A 1XCGB 3I2KA 4HYEA 5FV7A 3LNCA 1P7PA 1XZFA 1DZ3A 2C42A 2HFJA 2FZEA 2P9QA 3KKPA 3O9VA 4HQOA 1MQSA 4MIEA 1LJ8A 2A58A 3LUDA 4L5YA 4OA5A 3CCBA 1PJSA 5D7BA 1I33A 3R41A 1VE6A 3EGDA 3UFBA 3ZY3A 4BVHA 3KJXA 2ISSD 1U5AA 4CF5A 4DR6B 1FNSA 4M9XA 4KN6A 4F4FA 1JQJC 4FQ8A 5CITA 1N32B 4F84A 1B16A 2WKQA 5FTWA 1E92A 3MT0A 1Z7WA 2OEPA 3EXEB 4LK3A 1YCHA 1GTZA 4RKWA 3TXYA 2OBMA 3H3XA 3PVCA 4H31A 5EIFA 3X1JA 1UK8A 1R5OA 2IUYA 2JW5A 1I1HA 3B85A 4MKIA 5EP4A 5ESWA 3T12A 3TAUA 2CMHA 5FADA 2ZSAA 4GMFA 5H80A 4YPVA 1NAHA 4LGMA 2NO0A 1ZW1A 4KNVA 3KVNA 4HYYA 5I4BA 5L40A 3PFGA 4F3CA 2AJDA 2PUGA 1SBYA 3E18A 3PFCA 4OBBA 3FI9A 2R65A 1XDGA 4N4AA 5H16A 2M6KA 4KV7A 1YA6A 2X9GA 4B3MB 1AKNA 4H7IA 4J0HA 1YDWA 2CLEB 5AXBA 2HHLA 3KLNA 3FOEC 2I1LA 4FLMA 1RRPA 3JTEA 3RWMB 2J3JA 4RK0A 3PR1A 3H5RA 1CUDA 3E7WA 4KK3A 1NXTA 1JSRA 2QMEA 3FR7A 4FFVA 4TT3A 1PV4A 1YVUA 2YTZA 1KIAA 3JQAB 1FYFA 5IHXA 4NWIA 3C7CB 2P6MA 3DE5X 4L6AA 2DSNA 3MJSA 1HC7A 3OPQA 1LV8A 2IELA 3RT1A 1LH0A 2GPAA 2AVDA 5DCUA 3M9LA 1I3OA 5F51A 2PMFA 3IBGA 4CE6A 2I7CA 3Q2IA 1XMIA 4ZICA 1JFVA 4R31A 5H0IA 3I9NA 5CVEA 3UZUA 3AV3A 2FMKA 2CFSA 3CQ9A 4GYYA 1ADJA 3PD0A 4RDCA 2G5CA 5KZMB 2NO7A 2XWBF 5HQ3B 3QLVA 5SY4A 3OMXA 4R0VA 2ZREA 1X1QA 1HE4A 3VYUB 4PZCA 5DP1A 3ZV6A 4UU7A 3UJPA 3A7EA 3G82C 4FFDA 1XTSA 1ORTA 1K6XA 1YONA 3DTVD 3JD2A 4MICA 2ZEJA 1AD2A 2PUDA 1P3Y1 1NP3A 2GK4A 4TMZA 1J23A 4PXAA 1NSTA 2BEUB 3CVOA 1RHJA 4RWEA 4Q7JB 3Q15C 4HF7A 2O8NA 1FLNA 1C9KA 1K4MA 3IAUA 5KDLA 1GAXA 3ZXSA 4B46A 5AVXA 1A98A 1XYVA 3I62A 3KV1A 5SYMA 3EF1A 1GNVA 3GFOA 1U98A 3IIEA 4MUEA 3G2HA 2A0WA 3N28A 2WPNA 4LJ5A 2V3CC 1D1QA 1MT3A 1EP3B 2I1VB 3A1EA 1EDDA 1EBUA 3EEQA 3F8TA 4FDAA 4CLOA 1KSHA 4BO5A 3AL0C 1Y1SA 1BJTA 1PGQA 1TE2A 2DT5A 1G1AA 1MC5A 1WD7A 1YBFA 3FPGA 4H27A 3UMSA 1OBCA 4KRGA 1ZKDA 4ZMRA 2AB0A 5C8YB 2VP5A 3QU5A 5HIMA 3QF4B 4P5PA 2ARKA 4GOLD 1Z0AA 4CFYA 2VDUE 4Y3UA 2I3AA 4BB9A 5IT4A 3BJEA 4RDHA 2RAPA 1N2CB 3NM6B 1FZTA 4B6OA 4PPGA 3DTNA 3GAAA 3MTJA 3KSMA 5B3KA 3C3BA 5K03A 4P38A 3BH0A 3TCKA 2XIJA 4MQEB 3ZHCA 3DB2A 1P2VA 1JH9A 2H9YA 1X7XA 4X0EA 4ER7A 2AC4A 3RYCB 1QIHA 5EFZA 4KYIB 4KBGA 2HMWA 2BR3A 3M1YA 2DHCA 4MS1A 2ATIA 1K5DA 1YZFA 3N8GA 5CM9C 3PYXA 2V7QD 2OORC 5KWSA 1U8YA 2AFHA 5DSTA 1E2IA 3R3UA 3SLKA 3V2HA 3C3XA 1SXJA 3WQRA 1YMUA 4TXJA 1Z8NA 2E49A 2IE0A 4AB1A 3B1JA 5D51S 3DA8A 5CA1F 4M0LA 3D6UA 2ZM6B 1VKNA 3H84A 4RADA 4I36A 3HVHA 3I0MA 3OTHA 3Q0IA 3ZV4A 1KZ9A 4AX4A 3FCCA 3MHPA 2HPHA 1E63A 1JDSA 3DYIA 3JQEA 3DAGA 4HH0A 5KOYA 4LMRA 2QKYA 2VPXA 5EVJA 5IUKC 4S12A 2FR8C 2ODWA 5CVVA 3T95A 5KNDD 3DNPA 2YXNA 3NAZA 3V8NA 2X8WA 2XLBA 3DOFA 3NATA 2XB4A 4MV6A 1DIRA 2YHIB 3E81A 1SXPA 3KX2A 3E03A 2PSHA 5CAEB 5LYYA 3NTUA 4XQ9A 2GARA 4AF8A 4REQA 2MDTA 3K5WA 3JAKA 2PR2A 3NYRA 5CHEA 3VNRA 5JS8A 2OFOA 5H02A 1E2PA 3PU6A 1Y4DE 3HRHA 4B5LA 1K3TA 2H2WA 2O2YA 2LP4Y 5JYEA 1PYOA 2R7MA 4LRSB 3L8ZA 1DT3A 3RS8A 5BN3B 5FDFA 4B3XA 3ERCA 2EP5A 3A9RA 3VGJA 1QGDA 2O0KA 2XOKD 1VSTA 3RW9A 4XWYA 3QVXA 2JG3A 1Y7IA 2AA3A 2ID9A 2ZIXA 3NH9A 1JLRA 1BA3A 1ZGGA 1PG2A 4Q3AA 4ZDWA 2ZWVA 2BSAA 2IYRA 2PH7A 3VKWA 5KHLB 2O2EA 3RVQA 2P2LA 3AHCA 2ZYRA 4NX2A 1HETA 4UMDA 2PWYA 4OD0A 3N0WA 3JYLA 5KI6A 1OAOA 4A2CA 3A4TA 3OLYA 2DQ4A 2FDCA 3ZDRA 1SG9A 1VLJA 2GK7A 2VRNA 3I04M 2IF2A 4M1KA 5CCDA 1DOAA 3W77A 1FSFA 2NZYA 3CUVA 2P68A 3IDZA 4DG9A 1GNRA 2IZ6A 4TS1A 5AJZA 5L3QB 1H2WA 3O6VA 4DQXA 2XOKA 2XWPA 2Z8ZA 3F78A 3KUKA 1B6TA 1HH4A 1MH1A 3NDJA 2AZMA 4HX5A 3UV3A 2AMVA 3DBHB 3ELBA 2YUIA 3MN1A 2JLBA 2A6PA 1GSAA 2G4LA 3SE7A 3RROA 2RH4A 3DPSA 2AFVA 3P20A 5FWAA 1SKAA 5SYNA 4I2VA 1LD3A 1RIFA 2GF9A 4MYSA 4RCZA 4XZ3A 1XELA 2OL4A 1SUAA 4FKMA 4ENSA 3D6FA 4PINA 3V4SA 4DIBA 4F6RA 3O4GA 3VR4D 2PGNA 3F0TA 1DTSA 3LCVB 4CR7A 4CVNA 2AJLI 2H1FA 3FDFA 1J8DA 1CRQA 4EGJA 4PAWA 4F6LA 4Q1AA 2H1CA 1FJHA 1N2ZA 2ATXA 3GROA 3FNIA 4UE6A 4DKXA 5I7SA 3JQFC 4J4TA 3JQQA 4ZQGA 1Y5NA 4IIJA 2JKZA 1UDBA 2DLDA 4IP0A 5HDQA 1SUCA 4C30A 1UJBA 3TLGA 1WU7A 1EZ1A 1NMZA 2IYUA 5T3UA 2Q5HA 1J22A 1NU8A 3KB2A 3TR6A 1C7JA 3LA6A 4DR7B 3DE0X 3SBDA 3MOSA 5CURA 2VP0A 3S2FA 3R24A 4EUFA 1QVAA 2AQ8A 4C6RA 1ZMBA 4MQ6A 5DBGA 3RAPR 1LPNA 2ZTSA 1HDXA 4XPIB 2R6ZA 3VC1A 2W6OA 1GUZA 3CG4A 2BEVB 3HYLA 4OHKA 4RH0A 1ZK3A 3Q10A 1G7CA 2P1RA 4F71A 3QKRA 3A0UA 4CHGA 4R9NA 2QRVA 3QEKA 1PHRA 1GPDG 3D7NA 4PLWA 4UNSA 4UUMA 3PLAE 4BGIA 3KKOA 5D5PA 4ZVQA 4G9GA 3S7TA 1DWUA 3FNRA 3Q5DA 3S3TA 3O95A 8GPBA 2GFIA 3G5TA 2VAMA 1F2UA 5REQA 3CEJA 5KOJB 4MUXA 3O0TA 2BR5A 2HLDA 2NW6A 3LVRE 1NNEA 3BJRA 1Z18A 4RA9A 5LPNA 3BM5A 1VXRA 4PS1A 4MYHA 2WU1A 3BJIC 4UU8A 4F8JA 4UOEA 1ZU5A 1FRQA 1GUFA 1VL2A 4ZK2A 3RC7A 1SQ6A 1UKVY 2A1TR 2H4FA 2Z4RA 3IXLA 4HGYA 4X1IA 5EJ5A 1GA6A 4E70A 1NW7A 1XKTA 2HADA 3FLMA 5IVKA 1OWPA 4FUQA 1QHNA 4EYSA 1I5RA 2LIPA 1FS5A 4EGCB 4L6CA 1KQPA 2AC2A 3JZFA 1TEXA 3KETA 4IVNA 1T5SA 1ZNYA 2HGZA 1N6RA 2I6GA 1JEAA 1N34B 4B3BA 5FWXA 4YRPA 5TQ0B 5HHTA 4G0UA 3K0EA 4X95A 4QQNA 3TQCA 3UXEA 1PR5A 5TPWA 3H5VA 2OK8A 4RVGA 5AOCA 3ABOB 3K2IA 3SD7A 3W5JA 5AM0A 4W5JA 2VA9A 5A1TA 2NPFA 1ESZA 2XUJA 2GAIA 4NU8X 2COKA 1Q19A 2B21A 3I73A 2QL7A 3QIAA 3OI7A 3KYJB 2CJWB 1YTUA 3KSBC 4ECAA 3AW9A 1G8FA 1GITA 4J4HA 1V8PA 3TPCA 3TZEA 2YC2C 3C6MA 3N5KA 2ZRGA 1TIKA 4JSTA 3VNSA 4ARZA 3DAPA 2ZRJA 5KYYB 4KXXA 3P5BA 1U9JA 3REOA 3VXKA 3UEOA 3GHYA 3PXEA 4WQMA 3AXTA 4OH7A 1JKFA 1S4QA 4NI5A 1CUFA 1RAHA 1ODTC 3P0RA 1QK3A 2AN4A 3NAMA 1LU9A 1MTOA 2ID4A 5CB8A 2X9QA 3PGXA 1DJLA 4E13A 1XMQB 3OOWA 3ACDA 2QZPA 1EUYA 3ZZ1A 4G25A 3DVSX 4I6JA 4U0JA 1K27A 2OQIA 2X76A 2PL9A 2YVKA 3EFEA 4HPXB 1KU6A 1KKMA 3AY3A 1XXHE 3CSDA 3DCIA 3HPQA 4LDPA 3WQHA 4BMSA 4ZYWA 4JI8B 2QLJA 5E1DA 3ZQJA 2DCUA 2YRXA 3CKKA 2OC4A 3I1FA 2XSZA 4LVCA 3TMYA 3DJYA 1S8AA 3H6GA 4O4IF 3L4BC 3X2SA 4DV2B 1Q91A 2IYWA 3DBHA 1DC8A 2WJHA 3MERA 2C4TA 4AP9A 2MJLA 3LLCA 4P36A 4PYMA 3ILVA 1O57A 4FMDF 2OXFA 1QMPA 2QXTA 2ZDHA 3E0QA 1Z13A 3F4KA 5TEWA 3UOAB 3LQ1A 3ZWCA 2CWWA 5E6SB 1REQB 1BKDR 3JQ9A 2HW8A 4CGZA 1ORIA 5BWNA 5JISA 1PQ4A 1NUHA 2NZWA 3IODA 3L79A 3R5HA 4URYR 5DNDA 5B4TA 4HTAA 2IZ7A 5EJ4A 2CHUA 1JJFA 1GUBA 1H94A 1XKLA 3H3FA 4HGRA 3WRWA 4E88A 1FUKA 1VRVA 1TD9A 4Y7DA 3V1TC 5LZ4A 1UANA 2BW0A 1CB0A 5HRCA 5I47A 4MKZA 1WB9A 4G97A 3WJ1A 4G85A 2IF0A 1TU3A 2CVZA 5K51A 3T15A 3SZRA 4EG7A 5C53B 3UYKA 1PW7A 1XNJA 3D2LA 4JYPA 4C3ZA 4ADSG 2P6OA 2Z9CA 4ISCA 3GT7A 2Q3LA 2NNWB 2J4FA 1XU7A 2PEZA 4NCNA 2X8JA 4Q24A 3H1EA 4ZREA 4LF7B 2V9PA 1EXNA 1R6TA 2J3KA 2YFKA 3P96A 4Z4FA 2CLCX 5KVCA 2BBOA 5DTJA 4B7UA 4R1NA 4EO4A 1QANA 2VTEA 2O52A 3Q1LA 3K70C 2XA9A 3RK0A 1JEQB 2V8BA 4NMMA 4CLEA 4M3NA 2NZ8A 2REXB 1FFEA 3PC8C 2ZJ4A 5DGCA 4I7EA 2FQ1A 2J0SA 2X23A 1ODSA 4JWTA 2J32A 5EHNA 2V1XA 1JWLA 2W8BA 2FP4B 3MWLA 2I80A 4G5FA 2OQRA 3AINA 2JIZA 3C3EA 3L8MA 3FVTA 4PXSA 4QQRA 1HT2E 1X7ZA 3V7WA 4RPGA 5AJUA 4JC4A 1VC2A 4YECA 3N2IA 2WD7B 2WNIA 1C50A 4P86A 2FFAA 2QUHA 2HCJB 3ZHSA 1U0BB 1I3KA 1UMDA 4E6EA 4QFBA 1VKRA 2G0NA 2F55A 4PRLA 3ASZA 3HZZA 3UG7A 1M2NA 1QO7A 1U3VA 1U5BA 2HA0A 1EUQA 1XRLA 1FNNA 1CY2A 4ZVNA 4TRRA 1PJRA 1RS0A 2H5JA 1SD5A 2VPQA 3IAXA 3OU7A 3I8OA 3RYCA 2JGKA 2WSBA 1YC2A 4N9QA 5BR1A 2XE8A 4HDOB 3GDWA 4OIFA 1JG6A 1JHUA 1PNTA 1QTIA 4EJMA 5EKSA 3ETEA 2PGJA 1ST3A 2HA7A 1JN0A 3OSZA 3GB9A 1WZIA 3G1TA 2QUJA 3ZCTA 2ZSBA 5FD8A 4BVJA 1G21E 1WMBA 5DSZA 1X7YA 4CCWA 4G5XA 3WWEA 1T4DA 2J0QA 4D57A 2B4AA 3WK4A 1PE0A 4O33A 1SIUA 1Z6GA 4AG6A 4YP6A 4AQYB 4NP6A 2B99A 1C3XA 5EHZA 5JI2E 1A9TA 5ICSA 5K0EA 4RD2A 4HYQA 4QM6A 1BXRA 4IJ5A 2B4QA 4JUCA 1ZBDA 3U13A 3TG2A 2YC4C 2YIJA 4KIUA 1P62B 3IMEA 2JIBA 3Q5EA 5DGDA 4K6GA 2RB4A 4PWYA 4P58A 1XN1A 3VTZA 3K70D 3FNQA 2ADFA 5CLLA 3TQQA 1PI3A 3U4IA 4JCCA 2ONYA 2OV4A 3AI3A 1GG8A 2V4MA 2X6RA 4JWKA 4KXYA 3FIUA 1JA9A 3BEDA 5IUJC 1EK6A 4GPZA 5AW4A 1A50B 3L4EA 3R7AA 1BU8A 3WMFA 3VR4H 1E2QA 5AFSA 3FPJA 3H83A 4TN1A 4HS9A 3WLEA 5C80A 1JDBC 1D07A 1RYYA 1YZGA 2CJFA 3F6EX 4LRUA 4NTZA 4RV5A 1RQPA 1IY1A 4RPCA 4RVFA 5AP9A 5H68A 5HQ3A 3TQRA 4C2UA 1W1IA 2WICA 2LPMA 1NZFA 3CS3A 1BH2A 4G63A 2K87A 4DLLA 1J9ZA 4DQ0A 3L6BA 1Z4MA 3V7YA 4CCSA 4DHWA 1QRTA 3A1TA 2YXDA 1FJXA 4IFIA 1QIDA 4A0FA 1IK6A 1ORDA 3QH4A 4H7PA 3KPWA 1PR4A 3TTWA 4E4YA 4CIVA 4M7OA 5F3WB 1CZUA 3M6MD 4IJVA 1DEOA 2QRMA 1NF9A 3L6RA 4ZVPA 4JFRA 4XWOA 4Z6KA 2MR6A 5FO0A 2CXUA 2CE7A 1EFTA 1EFKA 2XUZA 4OGGA 1UBEA 1Z5WA 2CNKA 2P6UA 4J0KA 4WUTA 4E2XA 2Q07A 1ECFA 1KZGB 4CEHA 1OB2A 3WLSA 4WK4B 2BR4A 1P4GA 3HUEA 2O0LA 3BCHA 3C3WA 3CRMA 1X1TA 4JC5A 1RJDA 4QQFA 5TS3A 2IDKA 1OKKD 1NUPA 3SKYA 3EFOA 3B5EA 4QJ5A 4Y6PA 2FK7A 4LJ6A 3IVCA 5AK4A 4WAUA 3PHGA 4MV5A 5AKZA 5EP3A 3FF1A 3QE3A 3OZSA 3QY9A 3VOAA 2QLMA 4A26A 4QVKA 2BBTA 1UFQA 3F9CA 2FPRA 5IBRA 4FN4A 4AYXA 3IP6A 4JJFA 4XE5A 4UFPA 3EE6A 1SCNE 3M5DA 2IEGA 1L8AA 4DOMA 4DZTA 1QH8A 3FUWA 5B2ZA 1QIJA 3OA0A 4P7GA 4OI2A 2RI0A 3ZDYB 4AJEA 4Z3OA 4PGAA 3VHXA 4GICA 5F2EA 1NQ5A 5A6SB 3VNBA 1GTSA 1E3LA 4B3SB 5JZOA 4V38A 2WHPB 4IHJA 2PU7A 1SH7A 2ST1A 3KU1A 4AN0A 4I4IA 4DUPA 5IH3A 4BATA 3SR4A 3GMTA 2VK2A 3NETA 2J9GA 1KSJA 2GN9A 5IAJA 1FDIA 3KFLA 1IMOA 5EI5A 1N6OA 2OBLA 4X7PA 2WTBA 2YS6A 1HGXA 4Q3BA 2PUHA 1D0SA 2IPAB 1TVMA 3CUWA 4BZXA 2YNMC 3HU3A 5CDFA 5A02A 3K31A 4GXQA 1GA4A 1SK8A 2D2XA 1QHXA 3Q7EA 4FLFA 3A4IA 4C7BA 7MDHA 2F90A 4G67A 2WMYA 3B5JA 3OZIA 3S28A 2Q5FA 3PEWA 3I12A 3GFRA 1TZMA 2QTCA 4ETIA 4ZIRA 3QG1A 1UM8A 1U2RA 1ULUA 2GDZA 4F3KA 5JZSA 2PUCA 3OPNA 4YI3A 5E7QA 1WHSB 1ZUNB 1W59A 3FDIA 3EMVA 4JK3A 4PQGA 1N9GA 3A1SA 1E1NA 4QUJA 3UTCA 3D5EA 4H59A 4EI8A 2W6QA 4L5IA 5LKRA 1SC6A 1YJCA 4ANFA 3V3KA 2A35A 5F5NA 1MJNA 1ZM2A 1N2BA 4IIEA 4BVAA 1RLMA 2QPTA 2NT4A 1Q11A 2ZOSA 1BAPA 3A6KA 4LF9B 2E5FA 3EA5A 3OFVA 1B26A 5EHQA 1DQYA 1NRJB 2OBBA 3CTMA 2GAOA 3VZRA 3HR7A 4ZI7B 2AIRA 5BW4A 2RHRA 5DXFA 4BX0A 5B1YA 1BHO1 1R0LA 3OEEA 3R9IA 4F38A 1NHGA 2OGSA 1L1RA 1PP4A 1WABA 3K9LA 4N47A 4FM9A 1FVOA 2Q0SA 4RF3A 2MSDB 5EZ6B 3ADOA 5JADA 1Y4ZA 1CZNA 3F46A 2FFQA 1UINA 1KZ7B 1DARA 3O1HB 2QX9A 5FNVB 2MYTA 1V6SA 3GF4A 1F9AA 4GH5A 4J9VA 2C4MA 3CU5A 3PQ7A 4D9FA 1V6AA 4RHFA 1D0IA 1MAVA 4PZAA 5FBKA 2HMTA 4DILA 3QOXA 1EWKA 4CU5A 2PXHA 1J8MF 1G20E 4PLZA 2Y1LA 3WA6A 4DA9A 2XZOA 3P9NA 1L7BA 1O87A 2H57A 3JYQA 3VSCA 1SCJA 3TSAA 4CMHA 3SXPA 1ZO8A 4D8UA 4JOQA 1C3VA 3O8QA 4EZBA 1HTWA 1KK1A 3D1JA 1C7FA 1MO2A 3TZBA 3PWKA 4NE7A 3QBVA 2E55A 3VJMA 2ZSKA 2NYAA 4ZI2A 3L8HA 5K0ZA 5KS2A 1L4MA 3T1QA 1H1LA 3CC8A 1E4VA 1QBGA 1V5FA 3I1YA 3GZNB 4KW7A 4F86A 1UPTA 5KB3A 1KMCA 4UASA 2G71A 4EJSC 1V3UA 3SC2B 1LDMA 4TKVA 4NYIQ 1GHTA 3BXGA 1VJRA 3GK3A 4KIJA 1IXZA 1YOVA 4C05A 1D4FA 1XB2A 4A15A 1S9HA 1HLPA 4EHBA 3D8NA 2D5IA 4OHFA 4RK1A 1H42A 1CQXA 4NCIA 2EWMA 1ZA2A 3O92A 3B8EA 4Z49A 3G0HA 4YJ3A 4GC5A 3H04A 4N6OA 4HLDA 3OEYA 1XVAA 4J7XA 4OGKA 5JQGA 4R7TA 1Q0LA 2CMGA 1N0IA 3MUOA 2J6BA 5J5CA 4LTNA 1J8VA 1YJBA 2NQ8A 2QAIA 4MDHA 1Z16A 3G88A 3OZEA 4KE6A 4NG5A 2DTDA 3WYEA 5K8IA 2XXAA 3L0IB 4L2IB 2DQKA 2QVZX 3QJ5A 3QLTA 4HXFB 3W2FA 4BO4A 3K9WA 4BNUA 3H9GA 1KO7A 2NO9A 3BTVA 5GOTA 1L5WA 2FFBA 2D2FA 3M7IA 1G8JA 1X1CA 3C1UA 3V97A 4RMGA 2BT4A 4DG5A 3UMBA 4EMTA 3V2GA 3D3WB 1UXHA 1SUSA 1DJNA 2ZYVX 4MP8A 4U9UA 2I91A 3GQBA 1J5XA 1ZCJA 4MGIR 2I71A 4OYRA 2EKLA 4MP3A 4PFSA 4DYVA 5HJ7A 1Z2OX 1PO7A 3V00A 2CVQA 4H3HB 1JHVA 4W5WA 1E5VA 2W48A 4HLNA 5CVCA 5M7EA 3A1DA 3I92A 3GR6A 1F0KA 2MINB 1KJZA 4KWHA 3SHTA 3VZQA 4Q15A 2Z1DA 2WU3A 3L5OA 1C3OB 2J8ZA 3EHEA 3IEUA 1YHYA 2XWQA 4GBMA 4X41A 3GW8A 4JDPA 1DVRA 3G2IA 2ACKA 1E9FA 2F9MA 2UVQA 3BWYA 4II2A 5JPCA 4EDFA 4GSKA 4PYOA 3MPUA 3E8SA 5CDGA 1C1DA 3NYWA 5JY1A 4PHTA 4YWJA 1NVAA 2WG0A 4B17A 2ZUWA 4R2KA 1U8TA 3MS4A 3WKEA 1IN1A 3TR0A 1RKUA 4UVGA 4OXKA 4KRFA 5BN1A 4GWKA 4DSOA 4BMZA 3GAFA 4F91B 4CMIB 2VHQA 3TOZA 4WY2A 3HO8A 3EA4A 4NDNE 4IVPA 2WIGA 1IY2A 1N92A 4ARBA 1SC4A 2PANA 1E1RD 4R6XA 5BQ5A 4A7PA 4W5OA 4JQOA 4P4LA 3WIVA 5ECDA 3QE0A 5EZYB 4RY9A 1ODIA 3WBBA 4JP1A 4ZPJA 3WGVA 3E84A 1GM5A 3BAZA 1J8FA 4OYYA 2L2QA 2VVTA 4PLTA 1ICEA 3ROTA 2RH9B 1Z4NA 2OD9A 3P26A 3K6JA 1U3WA 1V47A 4KUHA 1QGED 4FYYA 2BSXA 3PVZA 4HHEA 4I4TB 4XDGA 1K86A 4B4DA 3MS7A 4BNHA 1JQAA 3ED5A 3C4JA 3SFZA 1VL0A 5M04A 1JS1X 3LUHA 1Z0SA 2CZCA 2OHXA 2R47A 3C14C 4WNCA 2ECFA 2GPYA 2TMDA 4XIIA 4DZRA 4EABA 4R2IA 4B2YA 4R3NA 1WQ4A 2GN8A 1I30A 3LQRA 5ED0A 3F2VA 1E61A 4AMZA 3VKHA 4CR8A 3SP1A 4FMPA 4FINA 3M9WA 1Z4QA 1LY1A 4FBMA 2IGTA 1XLTC 5BN4B 4EB3A 2E48A 1Z2PX 2ZRDA 2LBPA 2WD7A 5F2KA 2WMOB 4RANA 3T1HB 1PZEA 2F43B 2WWXA 3CVYA 2Y1XA 3V55A 3QKSB 4OHYA 1WX1A 4PBTA 2O2ZA 2PL3A 5DCYA 1E5XA 2G82A 2FXVA 2PT5A 2R6GA 1A2OA 3WC4A 2DFPA 3U7QA 3JV7A 4UUOA 4QZVA 3QLEA 4P82A 3VR5H 3TEJA 1CB7A 2PUFA 1DB3A 3TZLA 2ZBUA 1IPHA 1NOKA 2HDHA 3JRWA 4TWIA 3SXUA 3VMMA 4CHTA 4XWWA 1Y6QA 2CHGA 4GXNA 5LA6F 5HJEA 3SC3A 3U6BA 2IOFA 4OX9Y 1SRQA 4ETWA 1QE3A 2KPOA 2WTEA 4BB0A 1EFPA 4AWXA 3TPFA 4LV5B 3ZCRA 3ZU6A 4EA6A 1YS2X 4X3OA 1U2ZA 2VHTA 2ZS8A 3UHFA 1BFKA 4QM7A 1W75A 2X8JB 2ZSEA 2EF1A 4J0DA 1D8TA 4O4HB 1H65A 3OLXA 4P34A 1GTRA 4Z4EA 2RGEA 3M1AA 1M2FA 3MJTA 4M1SA 1W1WA 1GPH1 3AIKA 4OHWA 4RF4A 5DYTA 4DMCA 3CVUA 3HB7A 4YCDA 4R3UC 1LDYA 2H54A 3ZWBA 4EJSA 1YE8A 2BLNA 1H8EA 2X3UA 2JAQA 1ZUIA 4P92A 4A3SA 1UZAA 1G38A 4GI7A 3ANNA 2MMCA 4EA8A 4HN9A 5K0NA 2GRUA 4UE2A 4EY6A 1NU6A 3A2LA 3H2KA 2EKZA 3DZDA 3IRVA 4ZOLF 3ZGXA 2J9ZB 4PRYA 1IUNA 4TKMA 3BHNA 5DNCA 3N5CA 1E3MA 5BSFA 1JDZA 1XQXA 2GZ1A 3G1WA 3HUUA 2GUGA 3MBOA 1T8SA 4V2UA 3OAAD 4ZT3A 5FA8A 2QYTA 4YREA 2DZDA 1M2JA 4UD2A 4JA0A 3ZNQA 4HY3A 1RXIA 4MINA 1C9JA 1V8FA 2ZPUA 3R5KA 2M1ZA 2B20A 3Q87B 1X8LA 2CXQA 1OX6A 4WY5A 3IAFA 3TLKA 2R7KA 4WOBA 3QVJA 2Q4RA 4MYTA 2GSWA 1HXHA 3N6RA 3TSWA 4EFLA 2V45A 1N0VC 1FUYB 2OA0A 1O03A 3IAS1 3K0BA 4COOA 3HB5X 5EGNA 1N4AA 2X15A 1HA3A 1K66A 3EA0A 3QMPA 4U2DA 3W2IA 1JJBA 3ZX5A 3ZVRA 4B35A 4D81A 1B23P 1HE3A 1EXVA 4QUDA 2PH3A 1LSSA 1XEXA 1UQRA 3MAAC 2C04A 1GQRA 1JDTA 4DV0B 3KKQA 2Z2IA 1E2HA 2I2DA 1X0VA 5TRTA 1KDTA 1TUBB 2IEIA 4JLPA 3V8EA 2J3LA 1SQ0A 1NHWA 3ILHA 4QPDA 2P8JA 1EFCA 3QPDA 5HDBB 3VO2A 4C4RA 4YMLA 1Q20A 4FS3A 3CVVA 2X8AA 3GVIA 3CT6A 3LECA 5KOIA 5U9CA 1T13A 1NFFA 3CURA 1BGWA 2GBIA 2MSEB 3M6UA 1JRLA 1Z74A 2FE1A 4NU5A 3KQLA 5J3JA 1PD1A 2ZE8A 5A04A 721PA 5JOQA 2IVZA 1GAJA 1GWNA 4KWCA 6LDHA 5I3ZA 1DU4A 1CUZA 4QC2A 3ZHVA 4KWIA 4ITVA 4I55B 4CF7A 4D9IA 3QNWA 3GP8A 1KY2A 1BCSB 1Q7CA 2YZ2A 1KZHA 3HM9A 1AXEA 3JY6A 2NT3A 2OHFA 1FDUA 5FFFA 4D99A 3L8FA 1WPGA 4YJKA 3B2QA 1RRGA 1UP4A 1NMEA 4XB6B 4ZXPA 4EKDA 4ENUA 3IPAA 1LS1A 1WB6A 1Z4LA 2ZSIA 3WMXA 4BVGA 5HKKA 3O73A 2G06A 3E4CA 2R5WA 4GC9A 3IEVA 2QE6A 3C8ZA 3PC6A 1BH6A 3MLEA 5BQOA 1L5MA 3D0RA 2ZAGA 1KWKA 3A05A 2VFAA 3KQPA 1M67A 4MPDA 5JVDB 2AOTA 3QXSA 4FOPA 1C41A 4R9VA 5JAUA 3D7SA 2H0AA 3WA7A 5EHGA 2IQ5A 2GS9A 1O2DA 4Z54A 1T4CA 2X5NA 4C29A 2D7DA 5DJ5A 1RYEA 5BW8A 2WWYA 2JLSA 4TQGA 1EQ2A 1I3CA 3DKRA 1U5CA 3GX1A 5HQTA 3LWDA 4FWBA 2F6RA 1GFIA 5KTOA 3SF8A 4DQDA 3R0ZA 2J1LA 4N6GA 4WWHA 4O08A 4P5DA 3H13A 1XAIA 2FA9A 3BQNB 5JU6A 1DKLA 3TXXA 3GY0A 3IDFA 3NBFA 3FLBA 2ZB4A 2ZJBA 3DLCA 1YASA 1QGUA 4RVHA 3Q8WA 4BLUA 2AX3A 4CM9A 5FQNA 1T6XA 2BTOA 4UDOA 2YN2A 1S7CA 3JZMA 4WKPA 1WBDA 1RKQA 2UXBB 1R9JA 3ECSA 4CV1A 3AOEC 3GLHE 2PS1A 3HVKA 3K6KA 5NULA 3RB8A 2CNNA 1SUIA 4YIKA 5ENDA 1MJGM 1UBHS 4UU0A 4EW3A 4G84A 1LV7A 5K3FB 4URVR 4DIFA 5LQRA 3B6MA 3AHGA 3KKZA 3T7KA 2WM2A 4U7HA 2FMIA 4O4HA 2R84A 3GEHA 3CZQA 4Q19A 1PL8A 3DDHA 4F4CA 4OQEA 1NVEA 1S89A 2JAUA 3EPRA 5EUQB 3WLFA 1EFPB 1WR8A 2O7QA 1NBME 5LD2C 1SXQA 3LFHA 1GGMA 2C54A 3L01A 3OC6A 1B2RA 1KDPA 1Q2UA 2NTEA 2OGWA 3H0KA 1FUUA 2GO7A 4WN3A 2Z83A 1ABBA 4OXIA 3C6BA 2PRZA 3ORRA 4PSCA 5K09A 1J2UA 1G8MA 1TF2A 2GHRA 5DGTA 1X7WA 3GQVA 4TTAA 1EB8A 1JWBB 2X6TA 5FBLB 2ZU0C 3Q8XB 4L4UA 4TVKA 1AA6A 3WGGA 1PQUA 1Z7EA 3LO5A 5E4FA 5EWJA 3R77A 4OQXA 4RIEA 3Q1KA 3QKSA 1V9CA 2UYCA 3B51X 1OV6A 1CZHA 3G0CA 2DBRA 3I6MA 5B64A 1KIMA 3ZTWA 2Y6VA 5AUQA 1AXGA 2HIMA 2B1JA 5BSTA 2OSBA 1W5AA 1OREA 3ZNNA 1QV9A 2AFHE 4QOGA 4A03A 3ZWMA 3FVWA 2CDCA 2DH5A 2BUAA 1V41E 3SZMA 4FK8A 3CE6A 1GTMA 3KAPA 5A0VA 1P7VA 2Q28A 1ZOIA 1FW8A 3GLFA 4BNIA 1U1FA 2X0NA 2C4NA 4KACA 2FH5B 2HF2A 5C4MA 3EAQA 4MW1A 3EVDA 4YUWA 5KWIA 4ZU1X 2DHRA 4PYQA 2SKDA 2WJAA 3NHWA 3O21A 4TXMA 5KJFA 3DO8A 5K0BA 5MN6A 2QSZA 1EA7A 2H1IA 5JZ9A 1TX4B 1DC6A 2LWIA 4LXXA 1KJQA 1DIAA 1XRNA 5ALZA 4X84A 4RIHA 1E3DA 2VRCD 3HKDB 3J7AC 5EWMA 4YV2A 4KQEA 5DCLA 1FIUA 4R4JA 3VYVA 4B7ZA 3ETDA 3MSXA 5I4KA 3T0GA 2JGAA 1IOZA 1HF3A 1LPBB 1UEJA 2IHKA 3FVVA 1VBKA 2IGBA 2XNDD 1U28A 1KEZA 2OYRA 3S8EA 4UTZA 3D3KA 3NVDA 4L5BA 5H3HA 2W2KB 2YY7A 4QUIA 2DBZA 2I6XA 3UCFA 2WRZA 2C82A 4HAWA 4IDNA 2VTKA 3JWJA 1YR6A 4RGVA 1L8LA 1XZIA 2AR9A 3D8RA 4FI3F 3OF3A 2BFFA 1VXOA 5HPYB 3A6FA 1RPZA 1RADA 4I8DA 3R0VA 4XQ0A 1I4EB 2CCKA 3ZDBA 1V9SA 1IEXA 1P19A 1WSAA 1XWWA 1ZX1A 4UTOA 5GJCA 4DM3A 1Z3IX 1EFVA 4QFDA 5BP7A 1H5UA 2ZJOA 5L8VA 4HRAA 1Q77A 2ECQA 3QBEA 4E94A 3PTAA 4DR3B 1GYRA 2XHZA 3FTPA 3HYTA 1RM4A 1TQ6A 2YJ6A 4X7BA 3BKWA 3NP7A 2FEWB 3G9TA 1N2XA 4XR9A 1VRCA 1EAMA 1EINA 1X80B 3FZGA 3T41A 3RQSA 1I7NA 3H86A 4NH0A 5DYGA 4V02A 1AKYA 4EDHA 4KIFA 4HADA 1D2AA 3K96A 2WM8A 4OU4A 4ZANA 1KP3A 3RS5A 3MCWA 4B4OA 3JWGA 3DHVA 3FMIA 5L95A 4PU0A 1ZN7A 3OZCA 4E5DA 1IOVA 2EZTA 4WH0A 1P2BA 2Q2OA 2RB5A 4MI1A 3BMXA 4NY1A 4UD6A 3P2JA 4M0MA 5BWLA 4Q02A 2F1JA 3R5JA 4O02B 1P29A 1OD6A 4NESA 4N65A 4JR2A 1XTKA 3DEKA 2WSSD 4OB7A 3G6WA 1NI4A 3EYAA 5DX1A 2DEUA 2ZAIA 2AZ4A 2QR2A 1KR2A 1W5FA 1Z4IA 4FFBA 3ELDA 4R68A 4DSAA 4QE3A 1O0CA 4WINA 2Q50A 2QN7A 1Z5GA 1SQFA 3KXKA 1NUQA 3PPVA 4TQ9A 2A0YA 2P5YA 5HQJA 3UMVA 3B1YA 4G1BA 3GZNA 1LF0A 2ZRFA 3F6CA 1WUTA 4CKBA 4U2BA 3IPLA 5BMVA 5KVVA 4R2LA 1DLIA 3GRYA 1QRDA 1KKUA 4UAGA 3ADDA 3GLGE 3EIFA 1E1YA 3HCDA 4QJIA 4D79A 3EQZA 1E9AA 2PZLA 4C0LA 1NR7A 2MWMA 1JXMA 1WPXA 2B5VA 2NSDA 4YUXA 1RWNA 4RKQA 1HTBA 4RNDB 3SYMA 4G1UC 3GFFA 4RTLA 1SQGA 1CUIA 3PFIA 2W37A 4EF4A 3PXUA 1GR1A 4BAZA 2CSUA 4UHKA 5A0TA 2RHHA 3EBPA 2QQFA 1E2EA 3RLFA 2ZJ5A 3L40A 3SM9A 1VB5A 4Q4HA 1BD4A 3Q6NA 4G5OA 4OJKA 1JDNA 1RKVA 5FOXA 4F97A 4Z1OA 5IRCD 3AVVA 4JL5A 4KTVE 4I81A 5CHYA 3EXFB 1T43A 1V4NA 2EDAA 2XVXA 3PWZA 4HRVA 3L46A 1D2MA 3H11B 3QPUA 4MUYA 2JGJA 5T4FA 4AIIA 5IANA 1JSCA 4DJDC 2JA2A 1GZ5A 1Y4SA 3NAGA 3ONWA 1HRKA 1Y3BE 2BHLA 3ZR4B 4LOKA 5B55A 4FEEA 4M55A 2VHUA 1AOXA 5D3KA 4A92A 1NDUA 3SEQA 1O6FA 1DLJA 1RC0A 2VHYA 2XJ9A 4HAXA 2IXEA 1N6NA 2HY7A 2K6GA 3UICA 5E4TA 3C5EA 2O19A 2GJAA 5JAIA 2AG0A 2VT6A 3G0IA 3K8QA 4CIDA 4M0CA 1B4DA 2IDJA 2WA1A 5GTDA 3MS2A 4N5NA 1L4KA 5JJ5A 3HN2A 2FZ5A 3QSGA 3OJXA 4IYRA 2IHNA 1TM3E 2Z98A 3EZ2A 1SXJD 1Z35A 3DKVA 3Q7PA 2EJCA 4TN5A 3WDLA 1DT5A 2P2DA 5CB4A 3HV2A 4JIMA 2XMZA 3OECA 1INLA 1IEQA 3DEFA 5F21A 3K6SB 1ZVVA 1H5QA 5IABA 1Y9JA 1TA0A 2W8ZA 2DWUA 3A4YA 9LDTA 1XHFA 2PXCA 4CEJB 4KBYA 4P4NA 3BG5A 3KVRA 5LA6B 2XBLA 1FUIA 2VUUA 4A23A 2JLZA 4IUCS 5LB4A 8ATCA 3R7DA 1RJGA 2D8AA 1Q7EA 1TK9A 3AUYA 1AT1A 3DW1X 1GTL1 1JU9A 3EDQA 4QNNA 1UFKA 4YMUA 4M1ZA 1CJKC 4M88A 4BWGA 4OHZA 1QTNA 4KVFA 2X6QA 5EQJB 3VFDA 3C6YA 3OCWA 1D5WA 2B98A 2HRDA 3GI1A 3JWIA 1N2IA 4C89A 5T3YA 4P5EA 4UE3S 3LLVA 5COQA 3L4KA 1V45E 1KJ9A 5BMVF 4LKRA 3BRCA 3E8XA 1NBMA 5AM2A 1QQ7A 2DE0X 3U7FB 1N25A 2R8RA 3BQ9A 4KLZA 4WCFC 5GY7A 4CN8A 4ZU3A 5TQJA 4WNIA 3SS9X 2IUUA 2AN3A 3RRMA 1L8XA 5CYOA 3HDHA 4KR3A 2H2IA 2W98A 1TO2E 3LKBA 4NMLA 1ECBA 3M4XA 1H2HA 1S2GA 3P2YA 4JELA 4Y6GB 3SKXA 5JBQA 4GMXA 2B9VA 1MOSA 1D2HA 2RHDA 1VB3A 2VA8A 2ZUVA 3FWKA 1RVDA 4K2HA 4OHRA 4Y7CA 3H8JA 2ZJ3A 4B6JA 4YB8A 3BTSA 2MSLA 3UHAA 1HYEA 3QITA 3ZI4A 2CL7X 3ZLBA 1RJEA 2XX3A 1JILA 2YBDA 4AX8A 3UK0A 1HE5A 3R3VA 4G0XA 1TF5A 1C30B 1T8RA 1PT8A 2WU0A 1TVKA 1YB6A 2HPZA 5E6UB 2J30A 3S0JA 4YDQA 4NZOA 2ZULA 3DPIA 4U7FA 1F9EA 1NY6A 4ZARA 4UCXA 3S5JA 4EG0A 2ZRQA 1Z6ZA 2LDBA 1PR6A 2RGCA 1M83A 3EOZA 3ZWOA 1FSSA 4HDSB 1FMFA 3K0SA 1FDSA 1K5PA 3G2PA 2QPLA 5INTA 2KBFA 5C7LO 2A92A 4RORA 1A7AA 4MQLA 1YCGA 3B7WA 1CUUA 1Z5OA 2RGDA 4IMIB 4RPKA 1R4AA 4KHZA 2IPMA 4Q48A 3KCQA 2XCOA 2ZFUA 1N3IA 4M8SA 4CMBA 1T2EA 3PK0A 1XKXA 2YDXA 2WAMA 4UBKA 1YF3A 4OQNA 1QAMA 4KQHA 1UBOS 1P1CA 5AKHA 3T99A 5JQGF 1HYQA 2IYPA 4JJ4A 4LRYA 4OQDA 2L19A 4Q9LA 3AJ9A 4JASB 1KI4A 2EARA 3K0KA 3R6TA 4MJ3A 1LF5A 3H4MA 4U7JA 4AKEA 1NJ8A 3PXCX 5FPQA 1Z73A 3DBLA 3TD9A 3PYMA 2J6CA 3EUEA 4DNOA 5FBQB 2G28A 1TLLA 4ND6A 2GBLA 4TRJA 4QYSA 2D5LA 4DCTA 2HAEA 1XWIA 1H2BA 2L17A 4O4LA 3QNUA 1EFRD 5JJBA 2WWHA 3UFXB 3S6JA 4H1TA 2P8SA 4FD3A 5FBRB 1G8AA 2VG8A 1IZ0A 5H9VA 4QODA 3X1MA 3GLIB 1HMYA 4V03A 1NVDA 1SXIA 3AILA 2BHNA 2VJBA 4Q00A 4DT1B 4L4SA 4OXNA 5IHPA 4LJLA 2FX5A 2Q6OA 3H19A 2WAOA 3IVGA 4JT8A 4Q9DA 5CT4A 5JASA 2IS6A 4PYIA 4G0ZA 2H63A 3CE9A 5LZ2A 3E9CA 2BFCB 3ZOKA 5C8XA 3DDUA 3EIQA 4WVFA 3V4VB 4BEBA 3ITNA 1ENZA 2XAUA 4BO1A 4BDTA 3MFQA 1SXJC 3NHYA 2NU6B 1BYIA 3IKVA 3RJZA 5AOBA 1IVSA 4TT8A 4C4OA 1VLLA 1M8GA 2Q4DA 5LP1A 1QHEA 1V8OA 4IMRA 5T4BA 1K5GA 2Z6AA 2R6JA 5TJHA 4BIIA 5IWAB 3CONA 3N0RA 1ZJ5A 4RFSA 3A9TA 2V96A 5A5DA 4I2NA 5KVQA 5DN6A 2PYZA 1ISFA 5DNVA 1A5SB 4P3YA 2ZGVA 2JI6A 1W94A 2BFWA 1YUMA 1ZMXA 2XE4A 5FTMA 1XJ5A 3WLRA 4YIHA 2XODA 3A7DA 5DEOA 4O59O 4KQ6A 3P71T 1H85A 1Y8QA 3VISA 3DMTA 4JC8A 1V8BA 1BMDA 1ZP6A 4WA8A 5B4UA 2I3DA 4LXYA 3C15C 1P5JA 3LCRA 5HRUA 2OHIA 1XBTA 4G23A 3VR0A 4JYMA 1VE7A 3SIXA 1ZZEA 2G9QA 1LDEA 5BSHA 3PFFA 2CKMA 5NLLA 4DF3A 5JMWA 1E0DA 2IZ0A 1B6RA 2HCFA 2VQ6A 3W9BA 1QP7A 4N8EA 4HX2A 2FETA 2W11A 4J0IA 1JB1A 5JSZB 4H7FA 3ZJYA 3AM1A 2AWNA 1X1DA 4MVJD 4QXPA 2BBWA 3ZWQA 4FNMA 3RBVA 4OIMA 4TMVA 4YONB 1OYOA 1BFUA 3ETGA 2Z3WA 4WBNF 1C2YA 2XNHA 4PBRA 4GYJA 4BQIA 4JSRA 1YA8A 5FTNA 3W7AA 1EHCA 3VX3A 1GCUA 4CMGA 1HE2A 1U3GA 2ZB2A 4DLSA 5IFLA 5HNKA 4OL9A 2ZR0A 1X70A 5AK6A 1E3TA 1G1MA 3E27A 4HWTA 2YDYA 2EW2A 1XQ6A 2FN3A 2ZSUA 3N8HA 4P08A 3RRNA 4LMBA 2E6KA 2P0AA 3ZE6A 2YHSA 5B7NA 5F23A 5ICCA 5KQPA 1UT8A 2OV3A 1E79A 3QHAA 1K4YA 1L7NA 2AXPA 3N2YA 3WGTA 2FW6A 1SU8A 1NRIA 1YZUA 1TECE 2Q1TA 2KS6A 3DUFB 3H9QA 3FOWA 2WYOA 4WZAA 3SXJA 4GS5A 1L3CA 4BJ6A 2VDMB 2YNMA 2PX8A 1T0BA 4UTXA 1LJLA 2NUPA 3QEBZ 2I03A 5F64A 1EBBA 2QSUA 4EJ2A 3MELA 2O07A 1OA0A 4QPNA 3JSXA 4KI7A 4YCJA 16PKA 2VAPA 1VGRA 4BP1A 2J08A 4DFDA 4CTOA 5BSGA 3RR2A 5AW1A 2K2WA 1EESA 3L0BA 1XMOB 1JEDA 2VP3A 4FI3C 4I4NA 1HKHA 1NFRA 2M1XA 2WV7A 4LQ4A 1H4VB 3PC7A 2DPMA 4YQYA 4YAKA 4QG7A 1ZD5A 4DEVA 3TGPA 1VIMA 3QXXA 4X85A 5T8KC 1LW6E 3UGQA 5GADl 2GEFA 4TV9A 2JJ2D 4AF6A 1R3DA 2Q1WA 4NAHA 2BTEA 4L08A 4K5QA 1Z17A 4O2RA 5TARA 1CJUC 4LNUB 3STWA 3TLEA 3EOAI 4QQ8A 3LXUX 3KCNA 2O8CB 1ZA1A 3WDMA 1J9GA 2HA5A 3L7OA 3Q9NA 5AXAA 2NZXA 4D3SA 3O93A 2P67A 4KV9A 4XLLA 3PGKA 4E1VA 5AUOB 4KP7A 3R9XB 3H2GA 3IVRA 2MMGA 3V7UA 4K6FA 4MIKA 3CLRC 1MAAA 1YO6A 4QYXA 4JGIA 4P84A 5EJ6A 4M9SA 4O1HA 5JXIA 2CLOB 4RDIA 4ZQHA 1ZITA 2XW6A 3GFPA 1OT3A 1Q0ZA 1UT5A 2OWDA 2QR3A 2BFDB 3CEPB 4RIGA 5ALDA 2Q8PA 4MA5A 2A7XA 3OY2A 4P33A 4MYRA 1JIXA 1RYFA 3BF7A 3OE5A 5EL0A 4KI0A 4XJSA 1SM4A 4MB0A 1R18A 4BVFA 2OCAA 4IRUB 4MKHA 4Q4AB 1GSHA 1RPNA 3UJ6A 2HHJA 3N2NA 1CC1S 1NX6A 1UJNA 2JDID 3B20A 3TVYA 3HU1A 5KJ6A 4QDOA 3GJYA 4HX9A 3SBOA 3X44A 3RS9A 1Y7HA 2GKGA 3V1MA 2JGMA 2P41A 2OV2A 1VMIA 3G0GA 4K6HA 1ACJA 4BLSA 4F1JA 1L5VA 1U8XX 2WKRA 3GGOA 1HBJA 4UUAA 4IIBA 4XM1A 4R41A 4J0JA 5FBZA 1PJZA 1NQOA 4Q1VA 4XSGA 1B0PA 2RI1A 4BGUA 3HBLA 3MWKA 2BMAA 4Z4QA 1KMMA 1P1HA 5FLYA 4KX3A 2ZSHA 3AHFA 3D6HA 1M1NB 3QYPA 2RGGA 2X22A 3AEYA 3F5QA 3WNQA 1OH8A 4IDCA 4JKOA 3THSA 5KHOC 3RKUA 3IUNA 5K8LA 1T29A 2ZJ7A 4DR2B 4J6FA 3UUWA 1VFPA 4EF5A 3RF7A 2P7IA 1MO5A 2WMDA 4CM8B 1GZ3A 4IUBS 4QRDA 3TTTA 4BP3A 3WKDA 3QFSA 1A69A 1W4RA 3OQ6A 5EXDA 1EVEA 5KYWA 3PGJA 2WPDA 2GI4A 4C4ZA 4EPYA 1CUJA 5DISB 2PBZA 1WF3A 3TI7A 4CU2A 4JYBA 3HCCA 4HVLA 1KK0A 1NN3A 2ZK7A 3MCUA 3JQ8B 4CBVA 5IVHA 4A8JB 1HNWB 1YV9A 3MGCA 5HTOA 4J1TC 3RKSA 1SO8A 2H7CA 4FD2A 3DT8A 4AN1A 3ZHRA 3ZE8A 1YC5A 2Y1WA 2Z6UA 3FOCA 3NHKA 2HZ7A 3UUEA 5B2EA 1NXQA 4EY4A 1JAZA 2XKKA 2OCBA 1U99A 2A1TS 2JCXA 2A5JA 9LDBA 2OCYC 1QUEA 4TMFA 5FUVA 2UZ1A 3DLPX 3DONA 1D3AA 3AV0B 3FZEA 4YJ2B 3W5IA 4EQ6B 2I2XB 1PL0A 3CIOA 1F60A 5JCJA 4C3UA 3IUQA 1JT2A 2REQA 3NFYA 3HKEA 4DVGA 4BMXA 3COSA 1Q15A 3WL3A 3DV0A 3OUTA 3E05A 2CL5A 3TCXB 1KETA 1CFZA 5LZ5A 4OKIA 3RC3A 4EMBA 5JBNA 3QSYA 1A5ZA 3EGXA 5CGQB 5IN4A 5LU9A 3LL7A 1XPUA 2WHXA 4WTOA 1HMPA 1XSEA 5ELLA 4S0XA 5CEJA 4PLCA 3WP0A 5BQPA 4GM4A 4GZLA 2RHJA 1YDHA 1FLAA 2K4MA 4WESB 1YL7A 4CQMB 1WBBA 4IH1A 2B7BA 2IYAA 2Q3BA 1GNSA 3D5QA 4PIPA 3ZWKA 2A3NA 1JPNA 1YRLA 2Q3HA 4FN5A 4JP8A 4RD3A 4GYWA 1BGVA 2NXEA 3ZVMA 4DLXA 1CJMA 1X38A 4RIIA 3N76A 4ZAFA 1GGFA 3NWJA 4AO6A 1EKXA 4EFMA 4B3CA 2AFIE 2HRCA 3OZAA 1N3BA 4OLHA 5PNTA 4DJEC 4C3VA 2PZGA 3QVGA 4OHMA 4E2ZA 1C0PA 1P33A 2VDNB 4X6LA 4EGFA 3LDGA 2POCA 3K09C 1J06A 3I6BA 1XRRA 1U90A 1VG0B 2VYVA 1JPUA 1ONOA 4DLUA 4K46A 5ERGB 2ZS7A 4MQ4A 3HJHA 2QRUA 4QUGA 3Q8MA 1MHTA 1I3LA 1R74A 5LUBA 5DFAA 1ULZA 3FYDA 3LE8A 5JSYA 1VZ3A 1R0CA 3B3GA 1JQLB 4IDAA 3MEQA 4JVOA 3ENNA 1F8XA 3B2EA 2B83A 4GWGA 4HXYA 4HVTA 4JD5A 5H81A 1NJGA 4M2LA 4X3PA 4WXPA 3F71A 3ZV3A 1V8ZA 2B3TA 2CXHA 1CDDA 2O7SA 4MO9A 1LVHA 4TL6A 3IURA 5DTRA 1CQIB 2A9FA 4FDLA 4FTWA 3HUTA 2I6UA 4PTYA 3X1XA 4MV8A 4G1CA 4D82A 5ED4A 3OQNA 1YNSA 1BJKA 3VU9A 3DT9A 2ZJFA 3CY6A 4FDVA 4E51A 1MJHA 1TQDA 3P2IA 2ENWA 5FLXA 10MHA 3PE6A 2C8KA 2NM0A 3FNEA 3NOOA 2WZCA 4JLBA 4O4JB 1OW3B 1TB4A 5EIWA 3NTLA 4U2FA 1KOFA 4ZI5A 1JEYA 2AK2A 1FLDA 4BYMA 2GEVA 2KM1A 4LDJA 3R6DA 4WGGA 4ONEA 2J5KA 1FPQA 3L82B 4FKZA 3HCPA 4FDTA 2PG3A 3FM9A 4KVGA 4WN9B 1CP3A 3RS2A 3VKGA 1JR6A 1RXSA 1K6IA 3EDRA 3P52A 4LXIA 4CKCA 1ZIPA 4NMHA 3CRRA 2EVWX 3K9FC 2QMYA 1KMHA 2VNJA 2JARA 2XVMA 4NMXB 4X20A 1AN0A 3HBJA 3QOWA 5CYPA 1UAYA 2HO4A 2JATA 4MW4A 2QY6A 5AHRA 5FCDA 3WNZA 3WV5A 5CVUA 4RD1A 4R8RA 2BRUA 2C5AA 1ZK4A 3TF5A 1JQEA 3FFAA 4H18A 1MB4A 1XALA 2AF4C 2J67A 3TEMA 4HCJA 5IKPA 1SKBA 4AKGA 1FFGA 1TQ8A 4BFWA 2WC1A 1ZWLA 2F3SA 3H5TA 5G0TA 4AUNA 1JXQA 3J7TA 4HZUA 1L8OA 3STYA 4JJZA 4WKOA 4QWWA 2R86A 3QPAA 1QCDA 3WBKA 4PRKA 1ZJ4A 1CWUA 1W0JD 1R8JA 3FUTA 2TMYA 5HG0A 2TS1A 3P0IA 4DNFA 2OBFA 3GCZA 4QGFA 1JE1A 4OQLA 3M6XA 5JS6A 5FOWA 3UUFA 4KREA 5KHAA 3AONB 5K4HA 4G0OA 5ALLA 3Q2OA 4JLJA 3BXHA 4DDHA 1CF4A 2A5GA 1A97A 1BSVA 2G08A 3IV9A 4JAVC 2ZBFA 4UHCA 3LT5A 4O5AA 1LDBA 2R1UA 1G19A 3CV3A 1PR9A 2CF6A 3W8NA 2AXEA 2OAP1 3ONEA 1D7OA 3OT1B 4J2TA 4OGFA 3WKCA 5JDIA 3LD9A 3K5HA 2ZIGA 3TTSA 2GBGA 3FVRA 4Q16A 2C7QA 1AGYA 1RRMA 3G79A 3DHYA 3LQFA 3UWPA 1MUUA 4B09A 5FWNA 4EHIA 3E3LA 5K6TA 2HLHA 3EZ6A 1ZSVA 3A6LA 3X1ZA 3FNFA 5KCZA 3I0NA 2AR7A 4RAOA 4WNAB 5JHHB 4YAEA 1UKYA 1VSBA 2DPXA 2MCFA 4AKTA 1OWOA 2PKQO 4O1IA 2HSZA 4DC1A 2FSVC 4OLBA 4X65B 1R3UA 3UYLA 2IX9A 1WSWA 1WS6A 2J0EA 2J9YB 1JI0A 1VCOA 1AN9A 2XOXA 2YYAA 4HDCA 3SQNA 4B84A 1CIPA 4I9UA 3WK5A 1TU0A 4B79A 5KX5B 1T9KA 1YQGA 2ENUA 3DZGA 4OB6A 1LLDA 1XTPA 4Y6OA 3WV4A 1QGOA 1EM8B 3MJRA 3WJ2A 3RYHB 3DCYA 4NFSA 4HDMB 1AF7A 4A0RA 2IZ5A 5EUMA 2NUBA 1E7SA 3BULA 1KGSA 3DBOB 1FZQA 4YACA 5IMBA 4BMDA 3BDAA 1ZCBA 2I6SA 3I3OA 3KXLA 3UB4A 4PZEA 3QA3E 2JFWA 3KJGA 2W5UA 3HLKA 3V8BA 4TLMB 1R6AA 1U0GA 2A4KA 5EE0A 2KI5A 4K9DA 4ZOQI 3BD8A 4EB6B 2PMBA 4QUKA 1B3RA 4BO7A 4KMOA 3AF0A 5BW6B 3U19A 1A96A 1K2VN 1U2EA 4JC0A 4LXGA 1FFAA 4RAQA 4BO0A 4B76A 5IKXA 4YUYA 2FY8A 3N53A 4PCLA 1QFXA 1TYBE 2I66A 3D8UA 4PSVA 4WI1A 3D8BA 4A1FA 2CL6X 3AEQA 1Z0ZA 4ESOA 1S01A 2ZATA 4UTVA 4LHSA 5E0OA 3AVUA 4Z1MA 2V7BA 1B8VA 4U7GA 1CJSA 3MT9A 3NJ8A 1UCFA 3MGGA 2H2HA 4WUVA 4OATA 5C7YA 2QZ9A 5LSAA 1UM9B 3DBIA 5BV7A 1UAGA 2QG9A 3O3NB 4ARUA 5H4GA 1W36B 1O95C 1P1KA 3MGKA 4H08A 3W9YA 4BFTA 1ACLA 3S2YA 2CL0X 3WB0A 1QHGA 1WZUA 1UBLS 5B37A 2OFPA 4IUDS 1URPA 1WUHS 2BZSA 2FMFA 1CW2B 2VRBA 1FRNA 3LC1O 4JUBA 4Y2SA 2HKIA 3WB2A 3K8OE 1CZRA 1W5TA 4HPWA 3Q7QA 3N7AA 5CXQA 5DM60 2JI4A 2OZEA 2IU0A 4DGSA 1GPJA 4BLVA 1AQLA 1JU4A 2IHJA 2O50A 4FC6A 1LA2A 1U0OC 1SCUB 4L7QA 3PGLA 3PPWA 2N9UA 2IFTA 4XRRA 4RK7A 4EB0A 1YHZA 2GCPA 1DAOA 3LFUA 2ADMA 2JZOA 2JGEA 1ISMA 1I6WA 1UOOA 3GG2A 4U0KA 3A3OA 5JO0A 3SIWA 3VDQA 1W2WB 3R3JA 2JI7A 2R8PA 4KKVA 1QOPB 3PI6A 4F72A 3AR7A 4DA7A 1TXGA 4YN3A 5IEJA 3EBOA 3R1IA 4YRRA 3PA8A 3SPXA 3K2BA 3WL4A 4BUCA 1YMQA 5IJ0B 1XWFA 1UKCA 2W2TA 4TLDA 1KA9H 2CBZA 3LCJA 1USVA 5J2UB 4OKNA 3BGWA 3PL1A 2BJVA 2E4YA 3ONNA 4LXQA 1QE0A 4M9ZA 5A7FA 4NIMA 3WWOA 4E2YA 1E59A 2QW8A 4TWRA 2C83A 4FHFA 1UAAA 2ANCA 1G4UR 1DKUA 3C3CA 1VJ0A 4EPVA 1E77A 5CVTA 3JD1A 5H8WA 1M6VA 4CFSA 2P4SA 3U4MA 2I6FA 1IOWA 1UH5A 2AW3A 4TV8A 3SMQA 4PN3A 1XTJA 3MK31 3HBFA 4BMCA 1RRCA 4FYKA 3M5CA 1KJYA 2WE7A 4RZIA 4ENVA 5BSWA 3IAM1 1LK0A 5T4HA 3U0BA 3LKDA 3F47A 3OG9A 4V2IA 5E2IA 3CUEF 3WHIA 1E6UA 2W2LD 3FPSA 4NBUA 5FUMA 3U4AA 2PNFA 4D3YA 3KQMA 4YCNA 4PLFA 3UWDA 1WWKA 1L1EA 2PJUA 1SCQA 3QLUA 2PGIA 3DOHA 3GCGA 3JZAA 4P3XA 5AOAA 5DWVA 3ADKA 3RRXA 3U4QA 3FD8A 4RMIA 1C8LA 2GNOA 4FE7A 5CVDA 2I2FA 4XX0A 3RD5A 1XV5A 4M4SA 3NBMA 3TIXB 4ZPXA 2NU8A 4YCMA 5LYJB 3KKEA 1P31A 1NNUA 4NAUA 3EEOA 3KHTA 3RFVA 4UZEA 3VJLA 1PFKA 1CSEE 1G4AE 3ODGA 4M0PA 3WL5A 3R3XA 4ZVOA 1IB6A 2VAVA 3NCHA 4D4GA 5I48A 4X1YA 3FOFC 1YZ3A 4LF6B 2G80A 4UBIA 3WLHA 1NE2A 3PJRA 2YV2A 3ORFA 2AJBA 1NUAA 1B93A 2DPYA 3GJ3A 1GUDA 4J0FA 4OBEA 5E1BA 3SYTA 4DLBA 1PWZA 3JARB 2P90A 3KALA 1QJCA 4XUEA 4CFZA 4F9EA 2BGJA 4NAVA 3Q98A 5K2MA 3RC8A 4BGDA 5HJ5A 3MTEA 4OHPA 4YRJA 1U6KA 1M8JA 2WBLC 3A10A 4F06A 1W4AA 5JXHA 3T5TA 5FJJA 1P5HA 4CLDA 2NQTA 2WIDA 4Z0NA 4YJDA 1GGEA 2DXIA 3ZLUA 4F2GA 4CMEC 4WESA 2QAGB 3AJAA 3QBTA 1X1BA 4XD2A 3DF9A 1C9DB 5LXTA 4M76B 5E1OA 2PUEA 3QXJA 2H7VA 3HWSA 3OF2A 4IIJF 3MUFA 4E46A 3AKEA 1GNLA 1KEVA 1Q84A 4EH1A 3OURA 4IIHA 5I45A 2QN2A 1V26A 1PU2A 4L6IA 4WLEA 5DB4A 4HVCA 3DL2A 2NVUB 5JV5A 2UYGA 1CY8A 4YP1A 1KQNA 5I7EA 4F8YA 1QV6A 2AFIA 2DCMA 1N0UA 1R0KA 3AEKB 3DQZA 4YVFA 4AMVA 4FIZA 1R10A 1O6BA 1YS9A 1G6KA 1MZVA 1HDGO 1QG2A 3PRKE 2KE5A 2YJZA 3PHJA 3T4PA 5HX7A 5AKIA 2RJ3A 3D4NA 5F35A 4MWDA 1XEFA 2JFZA 5LIRA 1M5RA 4D92A 1P72A 2C7BA 3I52A 4YMSA 5AKJA 1B3BA 1SEPA 4B47A 2Z1MA 3QWHA 3C70A 4UHEA 3E3OA 2GPWA 3LHIA 3MGBA 5AKGA 5K8VA 4ND1A 4O0LA 1P75A 4P81A 5AQEA 3DZBA 4CF6A 3FUXA 1AQIA 5KJCA 1G2IA 3CWCA 4MCHA 4MROA 5BV2P 2EYUA 2GZ2A 3DDWA 3H2JA 4KQIA 4MXDA 3QG5A 4OQMA 3RWBA 3VH4A 3VR1A 5M29A 2QVLA 2WB4A 3A1FA 2ZTLA 3VZSA 1YJXA 4RDXA 4B3DA 1QDLB 1HFKA 1T6ZA 1P8JA 2PKYX 4GOKA 2YXEA 4BLPA 4IWXA 4Z7QB 5I9IA 3A9SA 3HJRA 3HJCA 4TYPA 2Q8QA 3SF8B 3D7RA 4M0FA 4MWGA 4N9WA 3L7DA 3QRWA 5CPFA 5EJ8A 4TVBA 1NMYA 1RPAA 4YXWA 1PNVA 4QXOA 3F67A 1T4CB 2IJGX 1UPUA 2C5BA 4J0CA 2OFWA 4W7HA 1SCAA 4GQAA 1Y4UA 4DA0A 2AOTB 2QUZA 3DVQX 3NTVA 3DZJA 1F20A 2QHXA 3FNGA 3OX3A 4Y1GA 3TTUA 4PFJA 2OORA 1M76A 5TMDA 2C5EA 1T36A 3U56A 3RG8A 2IIPA 5H3CA 4M9CA 3L0OA 2CY0A 3BIWA 1IPEA 1N7GA 1K7FB 4NFLA 3TUIC 3UHPA 3MFYA 4DARA 3GJ6A 1IVNA 4F9TA 4RCYA 3T7DA 3UV7A 4GPIB 5L3VA 2Q1SA 2PXXA 2R5NA 2DP4E 1JEOA 2WT8A 3C41J 3ENWA 4IJMA 4QAJA 1FEZA 1HRDA 5DOVA 2VQ3A 3OQBA 3VH3A 1VE1A 1IVYA 1Z5ZA 1L3IA 2D1FA 3C3JA 3WLJA 2QENA 2XYRA 4CGYA 1E4OA 3K0CA 1L4YA 4WJKB 1RWOA 1XD2A 2VJMA 5EMJA 4DBZA 3IT2A 4CDGA 2WHEA 1V9LA 3LPMA 3FHOA 2IHYA 1XTRA 2C4HA 1DAHA 2VLBA 3T3IA 3WGNA 5GONF 1CR4A 1JYFA 4FGZA 4FYPA 4ROSA 3NOQA 1YRQA 3U4DA 5F9HA 4GP6A 4AY2A 3NGLA 2QM8A 3QMVA 1WEHA 2YASA 3M0EA 5AXDA 4PPFA 3GLQA 2HWWA 3LV8A 3TLYA 2RHBA 1QDEA 4QDTA 4L07A 2QN6A 1C7EA 4CQLB 1SJ9A 2CVHA 2JLYA 1TUBA 4TUYB 3HCOA 1GAWA 4MHOA 2RK6A 2X3FA 1P61B 1ZEMA 4HEQA 4RZHA 4WJZA 1O95D 1P1JA 1VPDA 4M1QA 3STXA 3MQ2A 1U9CA 3EXG1 3BFPA 4P35A 4WADA 4NXNB 4KN5A 4JJIA 1IONA 2QTBA 1D2GA 2VTBB 3WYBA 5IXYA 4OHXA 2H2FA 2V03A 4IX1A 5IKOA 4B3JA 2GTHA 5JJCA 3GPBA 1D0VA 3AT1A 4TV9B 3N70A 1KRHA 3A4NA 1IATA 4OP3A 4J7UA 3JQFA 2F59A 3AI1A 3MGAA 3ASUA 3LPLA 2DJ5A 2JFYA 1Z0IA 2ZIAA 2QTWB 1UJMA 3EXIB 4W7SA 1ZD4A 4GEKA 5KYNA 5G40A 4L8YA 1M10A 3EVGA 3PHHA 1PK9A 4M49A 1FS4A 5G1NA 4DQKA 3W78A 1S7GA 3E9NA 3FOBA 4MUAA 5H1YA 3UAYA 4A1OA 2DKFA 4QG3A 3UB3A 5KYUB 5KKCA 4Z9BA 5I9BA 2WIKA 2X4LA 4I9HA 4X97A 3U26A 1R9NA 3B3JA 5CCXA 4WZAB 2O8DA 2L18A 4NOLA 3PIRA 4IDOA 5D7NA 2GM9A 4JITA 5E38A 4NG4A 1JH8A 5A2GA 2Q21A 4O63O 5CLGA 3R6LA 1GJRA 4N49A 4XVHA 3KJNA 2XR1A 4QATA 4W99A 1F7UA 1X1SA 1NVFA 1WXXA 3LI2A 1IJFA 2QAGC 2NU7A 2FLVA 3HEMA 4HATA 4OGLA 2R6R1 3RC9A 3ZN2A 4KZPA 4ZYLA 4OF4A 2B8JA 1AK1A 4JVSB 3FAZA 3B12A 1IHPA 3T5GA 3MT8A 1X1RA 1GZDA 2WW8A 5DTIA 1EXDA 3W04A 1LPAB 1IC6A 1K68A 1WW2A 2C3UA 2B69A 2ODEA 1RQNA 4JXJA 2LCQA 3ER8A 3KHSA 3T5DA 5CYGA 1K7SN 4OOFA 5DMHA 5H3LA 2GHIA 5JSZA 3H99A 1ZLYA 2I1WA 5FI0B 4QJ3A 3AEZA 1MENA 3PC3A 1HTTA 2D06A 3P9KA 1LRLA 5C4GB 2VYCA 3AUFA 1KI6B 2GXUA 1T91A 3I5UA 3TW0A 3DO6A 3WFZA 1W5BA 2GCOB 1UJ2A 3AKDA 1TVEA 2JCSA 2AMYA 3CPHA 3IVMA 3M2TA 1E2UA 3R40A 3B1WA 4RF2A 3TPZA 1A8UA 2A5LA 2EWVA 4NJEA 4KR7A 4WKBA 1NZJA 3JYPA 4EL5A 3BMNA 3DOUA 3DWIA 3K4HA 2B3DA 5TE9A 1CEEA 1U8ZA 2FNAA 2BDUA 2XUHA 2WM3A 1NXOA 3MC1A 1KAOA 3OZDA 3PD1A 1ZKMA 2QL6A 3PNSA 3WGKA 2W6CX 1BHQ1 4WFJA 3ENZA 3P1JA 3CR7A 1Q50A 4UU1A 2VJMB 1V71A 2VHVA 5D1HA 4X66B 1OCEA 2P2ZA 1NVBA 1UBFA 2HT6A 2YN0A 4ZO9A 1P1FA 1XZLA 4P8RA 3SR0A 3CF4A 3L0CA 1RMYA 2V6JA 5L7TA 3ICEA 4L9AA 2DHQA 3KB1A 2D13A 4MWTA 5B1SA 2J85A 2H59A 1VI6A 1H9CA 4FOOA 4MRPA 2NU9A 3AR6A 3FFWA 4ZVRA 1VJ5A 1O6CA 4TPKA 1WMDA 3FOZA 4EW2A 2A9VA 4YPOA 1ZMRA 4FZVA 3OIGA 4M36A 4NEGA 2NLOA 1DEKA 1TJPB 3ZLVA 2GNPA 5JECA 2BFCA 3MVEA 4TKLA 3HCAA 5HIIA 5ELXA 2UZ3A 2A5FA 3SMVA 1UOPA 2N0SA