4AP6A

Crystal structure of human pofut2 e54a mutant in complex with gdp- fucose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
389
structure length
389
Chain Sequence
b'SRRRYLLYDVNPPAGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKITY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-FUCOSE PROTEIN O-FUCOSYLTRANSFERASE 2
publication title Structure of Human Pofut2: Insights Into Thrombospondin Type 1 Repeat Fold and O-Fucosylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 131
structure length 389
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.221: Peptide-O-fucosyltransferase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10250 O-FucT GDP-fucose protein O-fucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11340 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap6A01
3.40.50.11350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap6A02
2HHCA 3ZY4A 4AP6A 2HLHA 3ZY3A 4AP5A 3ZY2A 3ZY5A 2DE0X 3SIXA 3ZY6A 2OCXA 3SIWA
chains in the Genus database with same CATH superfamily
3RSCA 2AQIA 2QOEA 1XKTA 4U2DA 1N5MA 4LTMA 2DJ5A 3HI6A 3TKYA 1NMXA 4IDPA 4JEHA 4I36A 3ZDZB 3PKJA 2RAUA 4R1LA 5E8RA 5H80A 3ELDA 2PGNA 1J9GA 2JNWA 4H59A 1IQ0A 3WGGA 3VYRB 3JZDA 3GLGA 1GTG1 4IJUA 2H2WA 3JQ8A 4OQLA 4R5HA 2PGXA 4RPGA 5E6UA 2GNPA 1XD8A 3TXYA 5EJFA 1Y81A 3P5BA 5IEBA 1D6SA 3OFNA 3PJDA 5BSFA 2DLNA 1XCMA 4HN2A 3QEMA 2RKOA 4E11A 1X1CA 3FNEA 2VPXA 2LVBA 1HH4A 4LZNA 2J3MA 4OP1A 5JH7F 2DLCX 4TLLB 1Z3IX 4LC9A 1ORWA 2XMGA 4DBVO 4FPXA 4UBLA 1Z0IA 1PQWA 4UASA 4YCAA 3DFZA 3LBFA 4WOCA 3FSRA 5LQKA 3FOBA 5CCXA 1ZN8A 3DHEA 3GMTA 3L1HA 5I8ZA 1CUDA 3F1LA 1BVUA 5IUKC 4D6XA 3EEOA 5IF3A 3QNUA 2PMWB 4MW2A 1UT8A 3Q15C 4C6SA 3L7LA 2EGHA 2QI9C 3OSUA 1RZRA 2V97A 4O1HA 1H94A 1PV4A 1LNQA 2G5PA 3BMOA 4N54A 1PSZA 1GOTA 4RK5A 2QT0A 3GFTA 3M4YA 2R44A 4GPD1 3G2MA 4TMFA 1M1NA 1U3TA 4RXMA 2AMLA 2CV1A 2QGZA 1KO5A 4DV7B 1EQUA 2P27A 4G1UC 2B94A 1VIDA 1YU9A 4JQCA 5A5EA 4EZIA 3EC2A 1IZYA 4ZV4A 1FS6A 1VXOA 3VKHA 2FWNA 2ZPTX 3EOAI 3R9IA 5CIWA 3GFVA 5HEKA 1HEUA 3Q12A 3TLXA 2Q6IA 2W2LA 1BE0A 2NYAA 3UBMA 1SXJD 2XPCA 1MCZA 4L4UA 3WYBA 3ZJYA 1OBFO 2QTWB 3O90A 4KK3A 4IJ5A 2KW5A 2ZT6A 5ALUA 3NLLA 5SY4A 4ARAA 3QMWA 1AIPA 2J45A 1E92A 2QN3A 1QKIA 1BXGB 1E1MA 2Q1TA 3HFRA 2BELA 4M46A 5EKTA 3T9DA 3FRIA 1Z0ZA 3PQDA 3L0PA 2VXCA 4KDCA 4K88A 4ND6A 3B1VA 2YFQA 4L02A 4UEWA 1ABEA 2XWPA 2X0FA 2ODAA 3I8OA 1FFWA 1MZVA 2HIAA 4JJ6A 2Q3DA 5CPFA 4LJ7A 3W5IA 4E33A 2R87A 3NHWA 4HAUA 4UM7A 5F3DA 3SN6A 4DDVA 2XCSB 2VH5R 3Q72A 1BE1A 2QJTA 4DCUA 2YXDA 4BKPA 3WICA 3BERA 3DM9B 2RHWA 2RK3A 3IB6A 1MG5A 2QX6A 5SY6A 4QJ3A 3V5NA 5KIAA 3KHKA 1OSNA 3AY7A 2YX1A 1K0UA 2SCUA 2XXBA 3JQGB 2GILA 4A0GA 4DA4A 2P6RA 5AJXA 2FPLA 3AF2A 2PUHA 4RD6A 2BE7A 3DT9A 1FEZA 5EE9A 3L9XA 3GRKA 3WYEA 3KPYA 3KT3A 4K0RA 1PYDA 1E3WA 1LQ2A 3MFQA 4HAWA 3EDCA 3EAGA 4M60A 2JC3A 2QW1A 3NX4A 3TAHA 3DZCA 2YXPX 1SU4A 2BGUA 4GD3Q 3GVHA 4RKEA 4AMGA 4BMXA 4RQTA 4Y9SA 4EDFA 2GDJA 3IHTA 4NAHA 3HDJA 4JP3A 2P7HA 2QJRA 1WPXA 3RABA 4CLEA 5ICSA 2CL5A 1I2BA 2PZMA 4WVLA 4D79A 5HP4A 4EB6A 4UFOA 1D5WA 1ID1A 1GSIA 2BONA 2VHCA 1EM6A 3EGVA 4KN5A 2EC5A 3RBVA 4E51A 1XMQB 1ZIXA 2XNDD 5T6BA 2WFZA 3AI1A 2A14A 1ZH0A 2H00A 3WQHA 4P3NA 4ZIRB 3HI4A 1Z83A 3B3GA 3DPUA 4U7GA 5EQTA 1WKBA 4HZUA 4K6OA 4Y0VA 1ZQ9A 3HCBA 2BGWA 3WNDA 1RLTA 4IIJF 4WESB 2X77A 4BFLA 3IDQA 4WFJA 4DCMA 4MEBA 3AIIA 1KEEA 1U1GA 4V38A 5K0LA 3RD5A 5CA1B 1OH8A 4IRMA 1IPHA 3E9CA 3TSOA 3ILXA 1DS6A 1GCOA 3CLUC 2XB2A 4NZNA 1KMMA 1NU8A 4E5MA 1QNFA 2BM8A 2HA7A 4PO1A 3HWX1 2H52A 2JGLA 3D3QA 3R0VA 1T9GR 4G24A 2PLNA 3AEKA 3FZGA 4N0MA 3G3EA 2EBUA 3E03A 3ZV7A 3A2MA 4JKYA 1K1EA 2EZ8A 4IHJA 4PIPA 1M7GA 2IX9A 4RA6B 2QBYB 4QSHA 5CB6A 2CJXA 1JNXX 1NDUA 4L5IA 5IN4A 5KWIA 3CNOA 2IHVA 4EA6A 5JMWA 1GR1A 4ZTUB 3P2KA 4RVOA 4DLTA 2AN4A 4DWWA 3QY9A 2RBEA 5LMCA 3CB4A 4NR0A 3RPEA 1MIHA 1HE1C 5ANRB 3NTLA 1DARA 2NZXA 5GZ1A 3ZE2B 3ZGXA 3E18A 1M6EX 4Q4HB 3H18A 2G08A 3TSAA 3F98A 3NXKA 2JD0A 5L3SB 1JU4A 4ZVNA 2WYHA 2D13A 3WSWA 1LI5A 1SY7A 1Q6YA 1RPTA 3V7WA 3V4LA 2Y76A 2Q21A 2WSBA 4FWIB 4UVGA 3VOTA 4I6JA 1Q12A 1XDDA 4YRMA 2X7HA 5LDDC 2VWPA 4DIUA 3RU9A 5TC4A 3EVBA 1VHLA 1QHHB 5SY9A 2DKOA 4X20A 4MNTA 2GHRA 2ASEA 4FZ5A 4B3BA 1A8UA 4QBIA 1EE2A 2A4MA 2Q5EA 4F91B 4V0LA 1L4YA 2GN4A 3ELUA 2EP5A 2YOFA 4JI1B 3WFIA 3WGYA 4RGBA 1N3IA 4MVYA 4O3FA 5KKCA 4E21A 5L40A 4GKKB 3ZCUA 3DULA 3IR7A 2OXFA 2EF0A 2V3CC 4DCJA 3DGEC 3UMBA 1JB1A 2PLFA 2G3YA 2YW9A 1EK1A 4GM4A 4FQ7A 3NFRA 1PJLA 4YMUA 4EB3A 3D6NB 2UZ1A 5EE3A 3FRJA 1DV1A 4V0MA 5HTKA 2PANA 1LKZA 2CCKA 2Q5QA 2QPTA 3S55A 3DLAA 3ZBUA 3KZOA 4HGOA 1MX5A 5ALXA 5C1IA 1SQ5A 4CLRB 2PFGA 1O08A 4Y2QA 4Z99A 2Z6AA 2PSJA 3DLIA 1JU9A 1JDUA 4EY3A 3DAPA 2HMSA 1TQDA 2OBNA 1E2KA 5L4NA 2TSYB 4MULA 1NXSA 4DS3A 4X5OA 2VUUA 4V1CA 2FWAA 2A5YB 4W1SA 5AWFC 1E2DA 4HAZA 3GUHA 3H1FA 3RTCA 5COAA 2QL6A 4FGJA 5GINE 2VN8A 4MS4A 4ZT4A 2NW6A 4ZQIA 4EG8A 3S8EA 3LNCA 1WLSA 2G1JA 1SUSA 1FNBA 2O1EA 2RKBA 3AEUA 4EGSA 1T3SA 1JR2A 3F0TA 2IBTA 3BTUA 1ZH6A 2VT7A 1P3Y1 2I4RA 3F5SA 3AR4A 3U7QA 3NVDA 1KMQA 3GIDA 3HEBA 4IHQA 2JGDB 3CGWA 3KAKA 1JQ5A 3SC6A 2OG1A 2DUWA 4P5PA 1KI6B 2D6FA 4O2AA 3ZU2A 2W22A 1EFHA 3RWMB 4M0MA 1FP4A 2Q2WA 2HCFA 1SVOA 3USES 1E9EA 1BMFD 5BN3B 2WSMA 4KACA 5KVVA 1YJBA 3AK4A 2EFYA 3WRVA 1CDDA 3V8RA 1IZZA 2MINB 2FEKA 3BXFA 3GWGA 1HYQA 3FCCA 4LBZA 3FYUB 2IU0A 4EAAA 4DF3A 4Y2TA 1G66A 2O5RA 3UV3A 4E6PA 1CX9B 1SBQA 1VSBA 4LRXA 1Z4IA 4TS9A 3FCYA 3SLKA 3SVZA 1LB1B 3ZS9A 4K0KB 1YB6A 1W25A 2QN9A 3N2NA 4Q48A 4OJTA 1UF9A 3R0ZA 2FZKA 3LD9A 4KN6A 3FMPB 1ATIA 5J2UF 1G8PA 3AUSA 2OD2A 4TYWA 2YIVX 4R40A 3WHIA 5JATA 2QGFA 2WP8J 3L7OA 4UTNA 2YFYA 3CW2A 4YJFA 4ZYYA 2JA2A 2PQ0A 4IGEA 4J6FA 1TJ3A 2ORIA 3IE2A 5HIAA 4Y1RB 3MQ4A 3G5AA 3C70A 4CHGA 1A9ZA 4X3PA 5KYGA 2DRIA 3SXUA 4RHFA 4AKSA 5HOEA 1NBWB 2DETA 2WAYA 3OKAA 2QVZX 4FX5A 1SA0A 4P08A 3WMGA 2EJWA 3ICPA 1SU8A 2QR5A 3P0EA 4LG1A 3BZWA 2XT9A 3WB0A 2VQFB 4MQEB 4C4RA 4MPRA 5FBKA 2FN7A 3QUTA 1EDEA 2XT0A 1HRDA 1DTSA 4FGUA 3WE7A 4QLBA 4EVSA 2BUCA 1OFHA 1EA5A 4OM8A 5H3CA 4KR9A 2DFLA 4GQBA 1LSOA 4YAJA 3MWEA 3U6KA 3MILA 5I4KA 4A73A 2CGEA 3WIUA 3KOWA 4H7FA 2O2ZA 1O8CA 4QUDA 1G3RA 2FXVA 2I71A 1VIMA 4KB5A 1QYWA 5JC8A 3WMWA 3K0HA 3C6BA 4R2HA 4YRCA 4ZPJA 5BR4A 4G4IA 3DMPA 1JDPA 5GTDA 5ALZA 1T5LA 1NBMA 3KQWA 1JHDA 4FGWA 1R5BA 1ZUHA 3L1UA 3M89A 5CBPA 4M9ZA 4O2RA 1SZPA 1K9SA 4DWOA 2SBTA 3ESDA 2C4TA 5AI4A 5C5DA 1DRUA 5FUBA 4WX2B 2EFDB 4YUVA 3WGJA 2XGOA 3RAPR 3I8XA 2EJBA 3KSDO 4YAWA 2DY1A 2LTAA 5FUXA 4HUTA 3HB0A 1PEYA 4ZA2A 4WL0A 2F3QA 3DEAA 1RQXA 2X0DA 1GTSA 2V1UA 4L5JA 1KAHA 1TW3A 5HFNA 3COSA 2HLHA 1PGOA 4H2DA 1KEWA 3DLHA 3ZGVA 4D8YA 3EWAA 3MYRA 3JAMA 4QFDA 1EFRA 3VOBA 1Y48E 1C0LA 1ESCA 1F0KA 1P4SA 4OQEA 1A76A 1UEXC 1LJUA 1W8DA 3MXOA 4ZCMA 5FAXA 4J0KA 4Q4JB 2HYDA 2H06A 1LPBB 2AUMA 1OILA 4FFWA 4U8GA 3DHVA 4OYLA 4E2ZA 4F56A 4PR0A 2IHNA 1J0AA 2WJVA 3M6UA 3AKZA 4HDKA 2G88A 2Q50A 1D1SA 1V0JA 1AB5A 3M9LA 4G67A 3SR4A 3GP8A 1JMYA 5JNWA 5EP2A 4Y9UA 4FIZA 2BH2A 3FPLA 5LYYA 3VPSA 2FPPA 2G9ZA 1CZLA 1GTJ1 1GN8A 1MLDA 2HFJA 2J0VA 3H9BA 4QREA 4BNWA 3THXA 1DLJA 2GD0A 1K5GA 1KGDA 3MLEA 5JSZA 1CUEA 1Z4NA 4ZXFA 1PWZA 1P29A 4CF5A 1U02A 1XZIA 1MBZA 1U0NA 5JANA 1XEXB 4IIEA 1F2TA 4YRGA 4YO8A 5FEMA 1Q1GA 3E53A 4YRSA 4CKZA 1UJ5A 3ZI0A 2V3VA 1UMBB 2H2AA 3I2JA 1PIWA 4G37A 4DILA 1NONA 5JFOA 1DX6A 1QJCA 4HNUA 3O26A 1VXRA 1AOXA 1GPDG 1XTSA 4KVFA 2I4TA 4BP9A 5JI2E 1RXVA 3QU4A 3PQ2A 2V7EA 3ND7A 1PUXA 2XXJA 3CIOA 4LHVA 3PWSA 4EY4A 1KY2A 3LLMA 3W8NA 3R8FA 4Q3DA 3PHCA 4QPDA 4XVHA 3T41A 1DAEA 5C32A 2YYAA 1P0QA 4QO7A 3K1AB 2CL6X 1AUVA 4NAVA 3LO8A 4RA9A 2HM7A 2Q3FA 5G1OA 4ZZ2A 2EFGA 4UQOA 4S2UA 3OEEA 2H18A 3P4XA 5IZCA 4IYRA 4IDCA 4QOHA 1FUIA 3QWHA 2RHMA 2GSDA 3ZY2A 3AF6A 4V1CI 4JFAA 1DRKA 2B35A 5G0WA 3LT4A 1IUKA 3JR3A 1IZ9A 4QFMA 2DPMA 1OFGA 2QTHA 4OIMA 5SYMA 5KYUB 4D42A 4DLRA 4UJ3A 4GM0A 3OUZA 3NCTA 1UXOA 2WDPA 2ZWMA 4Y67A 3OTWA 1EXDA 2A8YA 1IXSB 2E7ZA 4JB8A 2BOVA 3V3TA 3VR2A 5ABPA 5LDHA 4ZYVA 4PC3A 1K7XB 4YY3B 5TQ0A 2PMBA 5AUNB 2JKYA 4CGZA 1JDNA 1ATZA 2QE7D 3LX4A 4OV6B 3MUNA 4JC5A 2R62A 1GTVA 2ZYTX 5FLXA 3H05A 1FE8A 5JJLA 1YDMA 3IAFA 1HYEA 4LWQA 4RW0A 3L7IA 1I7NA 3QI7A 4BNGA 3JQBA 3NDPA 4G5YA 3BHJA 3R0QA 3CEHA 1DEXA 1U4OA 1T8YA 3DE6X 3TSCA 2CF6A 1UK6A 3AETB 2HSJA 4RFVA 4FFLA 4MGKR 3FHLA 2ZVPX 3A14A 3IAM1 5C7OO 2A0UA 1FSPA 3ZLVA 1HKHA 2EF1A 1Y6GA 2XF2A 4RHEA 4YREA 5JAZA 1HLDA 3L0DA 3OCCA 1DL5A 1B2RA 4KFSA 4FNMA 4Q6BA 1WZEA 2RH9B 1D2MA 3K0AA 2VJQA 1LBTA 1JSCA 5KSZA 3WDLA 2AKEA 3K32A 3WLKX 5HUJA 4O1MA 1WUHS 1MO3A 2CDNA 3B13B 3E5HA 5K4AA 1F0YA 2JLVA 1WV1A 1E2MA 4C3OB 4JLOA 3T94A 4YAUA 1XNQB 4ZXPA 4PRLA 4AM8A 3CZ4A 5KB3A 2F8LA 1C1XB 1TK2A 5EQDA 1AV6A 1PR5A 4NBTA 1ZM2A 3EUAA 1Y98A 3IRVA 3BBLA 5DO9A 3RUEA 1OYYA 1PFWA 4R69A 1D4OA 2HMTA 2XHEA 3NHLA 4KIWA 4PZAA 3GVCA 3L8YA 1UMKA 4YI3A 4KZPA 5TJ9A 2IV7A 2JJ2A 4X54A 5JWHA 5AI8A 1R0RE 1CVIA 2VO1A 1G17A 3A1NA 1JIUA 2P5UA 1NI4B 1SHKA 1T2AA 3AERA 3N2GA 1SCUA 4L5YA 4C0SA 5KSPA 1S9DA 4CLHA 2E9SA 3FE2A 8ADHA 4EKIA 3TTSA 1I1QB 4WLOA 2PX4A 4IMPA 3IS3A 3RVPA 3WGKA 1J97A 4O6VA 2QYTA 2V65A 1K89A 1G21A 1ZDMA 2ZBVA 2FSVA 1V4VA 3ZJ5A 1Q0HA 2GKSA 3MTQA 4RMJA 4ABYA 5DSZA 4UOZA 2E1RA 4K86A 2OHJA 5CT5A 3W9UA 4IW3B 3RSGA 4M87A 4B2IA 3CNQS 3TW4A 2W0SA 1EX1A 3IFSA 1HFWA 4Q9NA 1XQWA 2OZVA 4GYYA 2X8WA 4MWGA 2WFLB 1FDTA 4I4CA 4M0LA 4XYBA 3EIOA 4Y2GA 3RRYA 3EPPA 1ZM7A 3KOZA 4OLHA 2ZPUA 5CT9A 1T1RA 4I1UA 2H4JA 4EITA 3GT3A 2HA0A 4KLCA 3QE0A 1WCIA 1ST3A 4L57A 3WXMA 3L0YA 4M36A 4NC9A 3ZHQA 1DKQA 5CW1A 5J4LA 2O3TA 1H65A 3VR6D 3TUIC 4BJ1A 3GV0A 3K15A 2ZSBA 3W6NA 3BEOA 2JASA 1RAFA 3GPLA 4QHSA 3W2FA 4J0DA 1ABFA 1Z6PA 3RU7A 1R4ZA 2RFLA 1Q7CA 2YJNA 2IW3A 1IJKA 3O38A 3SDSA 4JEUA 2WPDD 2XCQA 2KI5A 1TUBA 3HKEB 2FMXA 2C94A 2OXEA 4BMOB 5DHPA 1CQIA 1F8UA 4M8LA 4OFZA 3VR4H 5EUMA 1VE5A 3FB1A 2WTAA 4ZAWA 4KQIA 1ZFNA 2X22A 3RREA 5TGDA 5FULA 1GDHA 1K7EB 2CVPA 2HGSA 5ALNA 4JR1A 1OH5A 1EU1A 1G0NA 1KTVA 1UADA 2I6TA 3JR7A 3O1HB 3QKSB 1Y3DE 4YVFA 5D1NA 3U3XA 4N5NA 5DTMA 1KQ3A 3MWDB 4FKMA 4RPHA 5EHXA 3PDCA 3ZWPA 4ON9A 4UVEA 2YIMA 1NT4A 1DAHA 2PAAA 2ZXEA 5B1IA 2WAOA 5CFPA 5KNLA 1RLOA 1UK9A 2GZMA 3MFYA 3WL3A 4JP2A 4FD3A 3VU3A 5A7GA 1TD9A 1DXOA 1QKKA 1JHQA 4WRRA 2C7PA 3HKBA 4LGMA 5KDDA 5IZCC 1GAXA 4ZAGA 5KMGB 1UMCA 1RYDA 4ZQCB 1AH2A 1DUVG 1YAJA 3PC7A 1FXWF 1U5AA 4X6XA 1E1KA 3L02A 3D3EA 3VNSA 1BQEA 2Q29A 3MBOA 5CXSA 3GDGA 3VPHA 3L7DA 1BXRB 1M8FA 4FS8A 2J3KA 1YQ9A 3ZHCA 2ZVQX 4LJSA 2IOYA 1FTSA 2Q49A 1KOLA 1U9IC 2ONJA 1GGVA 1HWYA 2PUBA 5ALHA 3B6KA 4D8XA 3SU8A 3RUHA 4RLQA 4XI9A 3DWIA 2A7QA 3AEQA 5TPWA 5TY0A 1RRFA 3H1PA 1DLIA 4MO2A 2XUKA 2NUBA 3A4VA 3Q0IA 4UDYX 5DWDA 4JOCA 4HV4A 4BLOA 1P2UA 3VU1A 4YJ3A 5DI3A 4AW9A 1UJBA 1Z74A 3L43A 4MWOA 4MVJG 4RANA 2ACWA 3PWZA 3W1VA 4J3FA 4IIJA 4B8WA 2KM1A 5FUWA 1IAVA 3N70A 5CTJA 4QEKA 1N7IA 1X8KA 4B7ZA 4I9FA 1O97D 2R66A 2QN1A 2HPZA 3I2IA 4MW7A 1VP9A 5PGMA 2IWHA 5I3CA 4WK4B 4F85A 1FDRA 5LN1A 1GZHB 3ZIAD 4XYGA 5TJHA 5CT8A 5J3JA 4R2XA 2JLBA 4LSGA 2E89A 1RYMA 1WS6A 1WVGA 1NVKA 2P6OA 1CS4C 3F8WA 2OUKA 3HRHA 3B82A 3I04M 2B2XA 3OCJA 1HQKA 4HS4A 4YPFA 2NUAB 3ZV6A 1DJMA 2IDMA 2DUMA 5IK2D 2ZRKA 4J0GA 4W1PA 3CZQA 1CY0A 3QP9A 2G4CA 1YV9A 3IEXA 4EUEA 3CO0S 5LLSA 3HK2A 4Q15A 3SZLA 1NN0A 1C29B 1ZBDA 4X1YA 4ZYTA 3A9RA 2VHXA 1P9RA 2OVFA 5DN6D 1ZH2A 1ZJZA 3C16C 4W5WA 1RWBA 4WZAE 2GK7A 1DKRA 1RC1A 2V6JA 2GXQA 1IG3A 2D74A 4LHWA 5P8WA 1NXOA 1PUJA 3W6ZA 1OBCA 3IODA 3HDGA 3LCJA 4D9NA 3BE6A 2ZQ5A 5E4YA 4R8RA 1THZA 1V7ZA 3NHBA 3RJZA 4FW8A 1CVRA 4IDGA 3ETDA 4KYTA 2ZJ7A 2JARA 4Q39A 4C2TA 4XJXA 4YFYA 5IH3A 1KOGA 1FZTA 3CQ9A 4U7FA 3ZWBA 3GG2A 1ZOOA 4MICA 3S5UA 4H0NA 1IVYA 1DAKA 4ROTA 5IAOA 1GQ2A 2H7YA 1K7YA 3PITA 1U9JA 3UAOA 3O8CA 2G9QA 3K35A 2E4ZA 4FYIA 2XMSA 2ZK7A 5LXTB 4B3RB 1K2WA 3OQBA 4GZLA 2DC1A 2PO5A 4PY2A 5ICFA 5BVHA 4HKTA 2VDUE 4L95C 4GBJA 1PHRA 4BV2A 3MGGA 3TLGB 3KDSE 1W85B 4MQMA 4FBMA 2PS3A 1MNAA 4GGPA 4ICIA 5B64A 4GHWA 1JQEA 1SXJA 2P69A 1EE1A 2G9VA 2XGGA 4XJTA 3SCZA 4AUEA 1XRNA 2FZ4A 2FOXA 2R7KA 3DKIA 4KMSA 4LRYA 4G0VA 3H6GA 1GNLA 2O7VA 2X1HA 4CT0A 1C2YA 5BSGA 2C5FA 3OJ0A 1KDYA 3LU1A 4FFVA 5CCBA 3PNOA 3QIVA 1MX3A 3WWZA 4TLBA 3NKVA 3BCRA 5IULC 1ZA2A 4HSGA 3RTGA 5J4KA 4UHDA 4BVAA 4WERA 3SZMA 1HDXA 4TQAA 1GRQA 2E6KA 3I6ZA 5BWNA 1U0OC 2X6RA 5KWJA 2BFWA 2FR0A 2G8LA 2YS7A 4N6GA 5DEIA 1JTVA 4BO4A 4PW0A 1KO8A 4NBSA 1QHXA 3R9KA 3WI7A 2XA2A 3E7XA 4Q9HA 2EBHX 4M55A 2YOGA 3OJFA 2P3SA 1CQXA 2A9RA 4K2HA 5ES3A 3TFWA 3EAFA 4CV2A 2Y1WA 3Q3HA 4JOSA 3E9DA 4FTWA 2CEKA 2IOFK 2VK2A 3DTYA 3UMFA 2B25A 8LDHA 3AY0A 1QM5A 2I22A 2CNNA 3C1TA 5AVJA 2CLKB 3PPWA 1QO7A 1KXZA 2Y1CA 3JAWB 5K8JB 1W29A 4PAMA 3KJGA 1EVLA 4FFPA 3SNHA 3ROZA 1QS0A 1H2XA 1MIOB 1TQ8A 4DNPA 2PZAA 1P2GA 2BV3A 1RBZA 1QFXA 4EEXA 1X8LA 4HEQA 4AXBA 5HA5A 4XLTA 4N7BA 4C01A 4EOGA 2Q0QA 2V45A 2FPWA 4TGLA 4WOJA 5DTEA 4BEJA 3QNMA 1E2IA 3L84A 1C9JA 3VPBA 4MW1A 4AJPA 3SXJA 2B92A 4MPTA 4P4SB 1MGOA 1UPFA 4R2LA 3SHVA 4FGZA 1UPCA 2FDCA 1YDHA 3F4LA 5LZ4A 1QOZA 1RXUA 1QTQA 2F1HA 2P7IA 4M7OA 1SVIA 1RFLA 4RD3A 1UOOA 4NKRA 2IHKA 3DR3A 1XCBA 2IWRA 1VLVA 5H0IA 4DA8A 4ZJYA 2BBWA 4G0UA 3ZZMA 5TMBA 3FUWA 1UQTA 1A5TA 2WIKA 3E22A 4PRYA 3TS1A 4Q3OA 1QVZA 5B4VA 2YZNA 2BP7A 2WF6A 5HQ3B 1DC6A 1NW3A 4FUTA 1PG5A 1K2VN 1NW6A 3DGFC 3DS8A 2V7WA 3L7NA 4QIHA 3W5VA 4EI9A 3LC7O 3PEUA 4U3JB 3B70A 3B6IA 3BN3A 3BRQA 1T13A 2Y1LA 4RZHA 2AG8A 4TMKA 5K3FB 4HF7A 2IE8A 3D4NA 1IDN1 5LDGA 3TL6A 1X80B 3SYTA 4ZOLF 5FBLB 1HBJA 3O7WA 5FNZA 1YBMA 4PCAA 3ZY6A 1UBFA 1UEIA 4HDCA 4XW2A 4IRUB 4G0QA 3EFHA 2FMTA 2Q6LA 4YROA 4W8HA 3FI0A 3EMKA 2GZ3A 1CBUA 1T2FA 4V02A 1PTKA 1U0HC 4G3XA 3N7UA 1HF3A 2F9FA 3D3WA 3PQ4A 4DJTA 3IVRA 3AB7A 1QAOA 3IEPA 4QOIA 4QUHA 1NF9A 4UBMA 1CJKC 1C5KA 3K5HA 4C6TA 1DEOA 1X94A 3OE5A 1KQNA 3JYOA 1W0KA 2HDWA 4GPZA 4MZXA 3RV4A 2VNSA 4DQXA 4CF3A 1QIMA 2C9OA 4NS4A 2AEJA 1N9KA 3I9FA 3GAFA 4E3ZA 3FUVA 3CEAA 5BV7A 5BXYA 3WBKA 2RGAA 4OGLA 4B2LA 1Z88A 3H6KA 1C3VA 1XNRB 1LPNA 4UREA 1YRHA 3PLAE 4QNNA 1FUYB 2PWAA 1XLTA 2Q5CA 3NBKA 2PYIA 1VI6A 3FJ1A 1X9GA 3GZTB 3SQWA 3CR7A 4HN4B 3SDBA 1SQGA 2Y0EA 1ZM3A 3MJEA 4TUYF 2VTKA 4OHPA 3AXTA 2XMQA 1OR8A 1T3TA 3HR8A 3PC8C 4UXJA 4ARBA 3AF5A 3I9LA 3HXOA 4TZ0A 3UOGA 3A6LA 4HDMB 4HFNA 3TD9A 4BO3A 5IAJA 1B0AA 3VJRA 3STUA 1L7VC 3W06A 2CJYA 5A04A 3B3QA 3GZ4A 3UWPA 5HSGA 5FWYB 1NVUQ 1X2EA 1VE6A 1GU0A 5L95A 1S1MA 3MA0A 5JXWA 4JROA 4R16A 1I3MA 1SXJC 4Z4EA 1KY5A 1YDWA 3A06A 4J1SA 2Y05A 3WNBA 3TEJA 3C3PA 3NEJA 4MWSA 4ZGGA 5ADUS 5JBNA 1DBSA 2X3UA 2R6DA 5ALTA 3TSYA 1NUQA 2QVBA 3EG5A 3R3JA 3ZH2A 4EB8A 2J1LA 1QIJA 3IAS6 1TIPA 3QTLA 3NO4A 2PUFA 1PQYA 4L4SA 2BFOA 1D07A 1NYLA 1PLJA 2LDXA 1UBGA 4AZ3B 4DY4A 1V2HE 2Z5VA 1RM5A 2JGMA 2WICA 2Y1FA 3VSBA 1KQOA 2B36A 9LDBA 4X85A 4X65B 4A2WA 3JYQA 4FHZA 4AL4A 4G81A 2V9PA 2ATVA 4JLUA 2TYSB 3O31A 2QM3A 2CCGA 2YWBA 1WLYA 4PC1A 4HATA 4R2KA 3SZUA 3V8PA 5L4SA 3DUWA 4O8CA 4PZ0A 1ZI8A 1GPBA 1XD9A 4OOFA 3N7TA 4G85A 3DE2X 3PJRA 4QTTB 2DR0A 2HSEA 4C29A 4YQZA 4HQRA 4CKEB 2H5EA 4RV4A 1TRKA 1YTLA 2Q2QA 1VJGA 2ZFUA 5MGNA 3PUHA 1LPSA 1Y6JA 3Q5EA 3Q3EA 1V3UA 2AFVA 4C3ZA 2G06A 2K2WA 5TB5A 3IAM6 3ET4A 3OPMA 1KKLA 3LUDA 3UAYA 3BH0A 2Y0PA 3TM4A 4QKQA 1BMFA 3LX6A 2Z2ZA 1XT6A 3TG8A 3GEHA 5AYVA 2JPDA 3WKCA 5E3IA 1ZOSA 1ANKA 2MTBA 4UCFA 5HDQA 1V7QA 2QRHA 4KAFA 4PS1A 3A4NA 4Q9LA 1YQWA 4XRGA 1SXGA 2F59A 1CRLA 1LBQA 2QD4A 5A3RA 2QUJA 4MUXA 1L7AA 5H9VA 5T4HA 4G8CA 4JV5B 3HG7A 1YAHA 2CZGA 4HADA 2O0KA 4GWKA 3IEVA 2DQSA 4Y6OA 4URZR 3T5GA 1AGXA 3W5BA 1XZKA 5HILA 2ZR9A 4P9NA 1IHYA 2W2PA 4ZHQF 2DT8A 1I33A 2VUHB 3AL2A 1MQ9A 3WL6A 3FLAA 4B82A 3H13A 4OHVA 1I01A 4YAGA 2YWXA 3O0TA 2X0EA 1VQ1A 3MPOA 3ISTA 1CRWG 1N4AA 1K7CA 1CRQA 2WTUA 2HN9A 3LUJA 2ZU6A 3BJZA 3OM8A 4HZGA 2H29A 3S44A 4EO9A 4YAKA 2AG5A 5I4IA 1P1IA 1KC1A 3KE9A 1YFJA 1SG6A 1F8FA 5L3ZA 5EHZA 2VYNA 1J49A 5KREA 2O54A 1E0DA 2B0CA 1U8XX 2CZCA 1DAPA 3AWDA 4NEQA 5AW3A 3G2QA 3O8NA 1XJCA 3C2QA 4EJ0A 1SJ9A 2QMQA 4Y6RA 3GGDA 1FXUA 3P9QA 2AHOA 4Q5IA 2O2SA 3K9GA 3PUJA 3EX7C 1P2BA 2OZPA 1YO6A 3EYWA 4JBIA 1U3GA 2WMNB 1XLWA 2GEFA 5JPDA 2BGTA 4JR0A 2OD9A 3SF8B 2I6FA 1QANA 5DNVA 5AHKA 1N1EA 5TMPA 4KXVA 4PPNA 1ZBQA 2ECFA 2CLCX 3L4SO 3NM5A 1XN4A 4L6CA 5J59A 3FVRA 1CUCA 2P4EA 3ENKA 4S2EA 1B7GO 1OLUA 5AK3A 4LDNA 4LISA 2HMAA 5B37A 4I2NA 1WR8A 1NLZA 2BLNA 2QT1A 3GXOA 4EY6A 1K4KA 3WJAA 1P8JA 2DCUA 4TXNA 4U5QA 2FPGA 1Z0JA 1HNZB 1O4WA 4IILA 4Y2SA 2I33A 2TMKA 2H8KA 4OY3A 2JCGA 1UFVA 4LHXA 1GYRA 1VE7A 3I76A 1U7OA 1XLTC 2EVWX 3COYA 3T15A 3U7HB 2JL1A 3FGNA 5AOVA 2IDJA 5HKBA 3TZKA 4GX0A 4WLVA 2WHRA 2FE4A 1I4EB 2SKCA 3OX4A 3UWKA 4OFXA 2ZR0A 2YY5A 3NWBA 1NG1A 4LI3X 2B7BA 4JS0A 4BZXA 4IVPA 1N92A 1TUGA 2QQGA 2V58A 2YQ5A 3IC5A 4O2BF 2C7BA 3AW9A 4P93A 4V0KA 4Q9JA 4B32A 2C2OA 3IIJA 3D4BA 4HY3A 4JELA 3O82A 3QEBZ 4NBUA 1Z63A 4QXQA 1VRCA 2P2GA 2DY0A 5SZKB 2YUIA 3SDZA 3O4FA 4BVJA 3AW8A 1Q7BA 4OQZA 2R5FA 2X41A 2HDOA 4BFUA 4RYDA 5EY5B 5CDFA 4INJA 4RGVA 2RB4A 3BFXA 3WAGA 1K97A 2GJSA 4MS1A 2WM8A 3I61A 3DEFA 3GIWA 3NTVA 2PO7A 4PO9A 1HRKA 2E37A 2OO7A 1MAUA 3GQBB 3HY4A 4LZWA 3UJHA 3VH3A 2OY0A 3OFSA 4KUGA 2D1RA 2ZYWX 4MMYB 1JWAB 3TZ6A 4F6LA 4ER6A 2EP8A 4NQRA 5A4IS 3UWSA 1QTRA 3K2IA 2Q5FA 1E4VA 2HXGA 2OZLA 4QTZA 3LT5A 2P1DA 1RWQA 3HR4A 2XMDA 4IMIB 2HW8A 2NO7A 1FNNA 3UKOA 1JXMA 4HQKA 4I3GA 1OBVA 2GLXA 4LYAA 3JQRA 3AFOA 3PPIA 1C7RA 2D0PB 3QU9A 4C7MA 5A03A 4HVLA 3IA2A 1RJDA 1RQNA 2QV0A 2NTVA 5I9IA 1MO2A 2VDVE 4RIGA 1RTTA 1R6XA 4RPIA 1BMTA 1UP6A 2CSUA 4GR5A 2H4ZA 1GTL1 1J7KA 4OHRA 1HXHA 1MJGA 3M81A 2HQRA 2VK1A 4MQFB 2Q6VA 4S1VA 4RXUA 1NKVA 4JI2B 3I9JA 3JYHA 1GM5A 4BHTA 3TTVA 3U3ZA 4DA0A 3B12A 5F35A 4YRZA 3D5QA 5CLHA 1U7DA 5DNEA 3GJ6A 4OA5A 4OAOA 3RVJA 3KE8A 4J0HA 1S3IA 4OBWA 2E4VA 4LN1A 3BGSA 3R9WA 1MDBA 2QS9A 2RGUA 1Q0LA 3UHPA 3WGUA 5LQCA 3CM0A 3VR1A 1PJBA 2VBGA 4EG5A 1LX6A 5ESDA 3X2SA 5J40A 5BN4A 2Z3VA 1NA5A 3C7AA 2Q3CA 5IDVA 3EGIA 2QE7A 1HLFA 3KQOA 3Q7IA 3UGTA 2WTEA 5DSTA 1NZDA 3ZDAA 4TXJA 4XA8A 3AR6A 1PK7A 2WINI 3OH8A 3J7TA 4L1KA 5AI0A 3HGTA 2VL7A 2IXBA 4MVJI 3X44A 4JI8B 2XUAA 3OT1A 3MAAC 4G65A 4N39A 2VP9A 2PMKA 3L93A 4RJ2A 4LECA 3WC4A 4PYIA 1OYOA 1ZOPA 4I50F 3TJMA 3EDQA 2TMGA 3DVAA 1VBKA 3CCBA 4GWLA 4ETMA 4W5TA 2MSDB 3EH1A 3FBWA 2GR9A 5ICCA 3IPYA 2H2FA 2J32A 4GU5A 5DCUA 2C4WA 621PA 5EL0A 3LKVA 1UC8A 2W00A 3RKRA 4MV0A 1Z62A 4D4JA 1YI8A 5ER9A 2CHEA 3QM1A 4OQNA 3DCJA 2D2XA 2FSGA 3ZY3A 2VRCD 2ZIEA 4BAUA 2GVZC 4G26A 1GPYA 2O7NA 1E59A 3AP1A 1Q22A 1UKVY 3GMIA 1IN1A 1ZD5A 2JAWA 3N07A 3QWIA 3VPCA 4JI0B 4MVJH 3R7WB 3ZNNA 2AF3C 1TNDA 3KG2A 2MYTA 3T9AA 2IRWA 3FYTA 5ENZA 3L92A 1DIHA 3FMFA 1F60A 4CLDA 1JIIA 3BXOA 4HLCA 3RUFA 1ZOIA 1MA3A 3I39X 2P2SA 4QFCA 2YQ4A 4NI5A 1NR5A 2PGJA 1KJ9A 3IBYA 4GI5A 4H7KA 1ZK4A 1B16A 2KPOA 4O4JF 3LP5A 3AV0B 1F2VA 4RIFA 5A2QA 2PYZA 1JKJB 5FQOA 1VG8A 1YZUA 4I66A 3ZE6A 2NZ2A 2C4VA 4MJ3A 4YIKA 5G02A 5ILGA 1N5JA 4KXLA 2A84A 5AW1A 3TCXB 1Y1SA 4X60A 2QTGA 1N5LA 2R8YA 1E7RA 1T1IA 2J9RA 1KO7A 1ZD1A 1EFVB 2AGVA 2WOJA 1JHUA 3N2ZB 3TH5A 3T3GA 2CXUA 5DYNA 1VHDA 2GRUA 3R7DA 5IF9A 3DFMA 4OMDA 1F2DA 4Q02A 5IJXA 4BVLA 1K08A 1AO3A 1SUCA 2XUIA 2ZUWA 3IKVA 4FILA 4KHZA 4RJKA 1I9CA 1N0VC 1KP9A 5KDOA 3LP6A 4H6WA 3ZD9A 3QKUA 1D0SA 2HEIA 2JI7A 2CKDA 2ZI5A 3IGFA 2JGIA 2GZ2A 4G0MA 2ZIWB 5B58T 4HZUB 1FDSA 3O84A 3VR6A 3TOSA 3U0BA 1SC3A 4DC9A 4CXMA 3WGIA 1WXIA 4RD2A 2EKBA 1X7YB 3X2FA 2FGKA 3X43A 2UZ4A 4FEYA 3OX2A 1LW7A 3W77A 3QLTA 4XE5A 1RE0A 2VZ9A 3NOVA 4N49A 4RORA 4B3GA 3IMKA 4U2GA 2WTNA 5KSOA 4NX2A 2WPDA 3SEZA 4RFSA 3K8OE 3WVNA 1T5BA 3SSNA 1YDFA 3W05A 5K0NA 3IMFA 1ORTA 4MROA 3M34A 4ZKEA 2Z6VA 1EJ0A 2JAUA 2DR2A 3EZFA 3MJTA 2HWXA 3W9YA 2K7ZA 1ZJ4A 2NTEA 3N8IA 4OQQA 3T9CA 3WHPA 3TW8B 4JJIA 1TB4A 3PUWA 4S3MA 4DB4A 3H2YA 1ZHOA 4MUJA 1A0OA 1JEDA 1P0FA 1ZJ5A 1FDOA 1H8EA 2HXSA 1MF7A 2I55A 3M4XA 3NNSA 5DYGA 1WG8A 3U37A 4D9MA 1NULA 2QENA 3SP1A 2UYGA 4D3DA 2GRAA 3I34X 1DQSA 1MB0A 2V03A 2XZPA 3PXDA 2NUTA 3P9YA 1IVNA 2R3SA 1MMFB 3FSEA 3N7AA 5CFLA 3OIVA 5ITVA 2YHIB 3C7DB 3LLUA 4CKBA 4D7AA 3ZTTA 1V6AA 1D8AA 3N0WA 4EBFA 4YCLA 3AC0A 4TTTS 5IXSA 3KQMA 1RP7A 3CVJA 1KIMA 4RBNA 3UAGA 3V6LA 3U7FB 3L0CA 4WDQA 5CDYA 5K51A 4CYMA 3L41A 4EPYA 3GCWA 2Z5LA 3AI2A 2L17A 4F92B 2D0OB 1VL5A 1A4UA 4YCBA 1XGKA 3C3WA 3KLPX 5JTUA 1XKQA 3X1MA 1G3UA 1T8TA 4H0FA 1QH9A 3OIUA 1IBRA 4EKNB 5JPCA 1NBEA 2AZDA 1SQSA 1UBOS 1EXWA 2BR4A 4N47A 2Y67A 3G8BA 1EVEA 3ZDFA 2CXSA 4FKZA 4BTVA 1E7YA 3GLFB 4JXJA 2R1TB 1I9GA 3ZDYB 1F2UA 4R5MA 1FDVA 2XYRA 5EWMB 1IMOA 1KPIA 2OGUA 3TCKA 4E0BA 5C8YF 1CB7A 2X42A 4JBXA 4RTLA 3OCYA 1XZAA 3VC7A 1DIAA 1VIAA 3FYDA 3OP4A 1XTJA 1TQ2A 3FNFA 4Z9AA 3ZIAA 1E5TA 1VYUA 2FN4A 3AINA 4NYIR 1D2CA 4F71A 2BM0A 3DW3X 2ZRLA 1NLMA 3V97A 4DLNA 2O8BB 2ZE8A 3U48A 3AU9A 1N2SA 2OORA 2UZ1B 3LHFA 1T91A 5DCLA 2PSSA 4DM7A 5KCZA 5IK2A 1P5RA 4ZOLA 2EEPA 4NK4A 4EYKA 3SM3A 4UM8B 4CQLA 3WYAA 4AZTA 3AJ8A 2GTPA 3ASZA 4NARA 1XJ5A 4MXDA 2I8AA 1JJ7A 3AEZA 3WBJA 3RF6A 1F9AA 2JLSA 2R4TA 1M74A 2C00A 2VEOA 3HCOA 4BDSA 1FP6A 3CTPA 1V1JA 2GJAA 2HA4A 1G8GA 1DBRA 4LK2A 4RACA 3O5AA 3ZZNA 4E31A 3CZ5A 4H1TA 4MVJA 1TJPB 2PKEA 4XRRA 5I7AA 5H9WA 5KQLA 1AXEA 3BJEA 1VP3A 5EC8A 3ZY4A 5JQGF 2GJ4A 2ZWPA 1E5VA 1VHTA 1G2QA 1ZGJA 4QDKA 4LRTB 3AJAA 2H1WA 3E2PA 4K87A 4EF4A 2VTBB 1YMUA 1HDRA 2QG6A 3GT7A 3K73O 1Y8RA 4DMRA 4HPXB 5EZQA 5DBGA 1XO1A 2RGGA 5T8KA 3MC1A 3AOEA 2X0IA 4CM1A 1AB6A 2YNMD 2YWFA 2VWQA 2XKKA 1TRHA 4GH5A 2BGKA 5LU8A 4IZHA 2ZBQA 2ZYRA 3DDZX 1LQTA 4MKFA 4KO2S 4MAAA 5AJZA 2OFOA 1DIRA 2RCYA 1W5EA 2YCBA 3CW8X 4NMHA 3HUDA 3OAAD 3R0JA 4PIMA 4TYPA 4JI7B 2K5UA 1WCWA 4PLTA 1MO4A 3QPAA 4TUYA 4JBYA 1GG9A 3O4RA 5D6OA 2GMWA 2P9ZA 1L1RA 1R9JA 1EUCB 1PVOA 3HHEA 2H9IA 3NTXA 3B2EA 1XA4A 4KMMA 4ZCLA 2FPSA 3DL0A 3K9LA 1EINA 1YB7A 5CVDA 5A9RA 2WVHA 1Z6TA 2E0IA 5LD2B 3FVQA 1RRCA 1NYQA 2WTMA 2AB0A 1THTA 1LI7A 4ZVTA 1U7XA 3A9TA 1YK1A 3WB1A 3FSJX 1ODJA 1TK9A 4ATNA 2YVQA 3TG2A 4YK7A 5E1MA 1QXSA 1EFPB 3VR5H 2YJ6A 4B79A 4FYJA 1ZZEA 3WJ7A 3L4BA 3WYNA 4EHKA 2W6ID 3VAAA 3ROXA 1DX4A 2G63A 3UV7A 1SOMA 4ME6A 4XWTA 3LK6A 4LGCA 3ONFA 3CY6A 2REOA 1KI3A 4HLNA 4RDHA 3CKLA 1OVMA 1JW9B 1U3DA 1ZINA 3CRQA 3NHRA 1FMLA 2JJ8A 4FDLA 2BTEA 3TVDA 3ADCA 1Q0ZA 4I8DA 3BXGA 4L15A 4EJSA 1SA0B 3F71A 4K9OA 4ENPA 4WACA 3UJAA 1IY1A 2XVYA 1ICEA 2FHPA 1V5IA 3OWHA 3PK0A 4IYJA 2R86A 1C3LA 1JQDA 1Q0SA 3COZA 3EH2A 3I3OA 3PRJA 4ZEOA 3SNKA 2IC5A 1M2VB 1UXIA 3QPCA 1F3OA 1FSGA 2C3OA 2V6BA 3PGA1 2EKQA 3PNKA 1M34A 4LRWA 1DU4A 2I4MA 3FPAA 1A4XA 1CR6A 2YMQA 1EFCA 2IW1A 1UL1X 1ZJ6A 2PU5A 5EP4A 2DBVO 5TXGA 2W58A 3RANA 4C9BA 4E1AA 2JIBA 2HJVA 3A6EA 4KFTA 2OBLA 4LDZA 4F11A 4I08A 3Q9NA 1KHTA 1ZUWA 2ZWOA 2UU9B 4BYMA 2VUTA 3IBFA 4MRVA 3A1CA 5IBCA 3H8SA 5EMJA 1CSEE 4J0IA 4J8PA 2Q9UA 5J4HA 3RYCA 3KL2A 1R0LA 4B8YA 5C2JB 4MYTA 3UF0A 3DDUA 3N2IA 4ZV7A 4F4DA 3HTXA 1FVFA 1HFEL 1YZVA 1XJ0A 3QV2A 4GRDA 4ER0A 1LD3A 1GGKA 3AHCA 4M7RA 1A8SA 1QFJA 2F3RA 2QP4A 1E2QA 1SAYA 5BT9A 3BG5A 1WJGA 2YRWA 4OHXA 4U39A 3FSGD 3BCSA 3KXPA 5JJIA 2Q27A 5AKIA 4MA4A 5KTTA 4YWJA 5DPMA 3E05A 1OIXA 3O1LA 4Q1BA 5ALYA 2QLBA 1W4ZA 2QVYX 1EWRA 4JBNA 3H2SA 2RHRA 4A0QA 1JH9A 3VAYA 2WAAA 1O97C 4D8UA 1VRVA 4C88A 3H3FA 1M2GA 1A04A 3D6UA 4AFNA 4F6RB 4BX2A 1PYGA 1QZUA 2PZJA 3RS7A 2C2KA 1E3DA 5CP8A 4DJAA 2I6GA 1Y9EA 1O96A 1OXSC 3QF7A 2QA5A 1I5EA 1VKOA 1XAGA 2PBRA 4CR7A 3N8HA 1N6HA 1LFDB 1RACA 2ZTMA 4A8TA 2IA5A 4PEVA 1W5BA 3D5TA 1X38A 3JALA 1YFKA 3N6RA 3OPYI 5GV7A 1H93A 2X3YA 4C5CA 3FMIA 5FO0A 4PCVA 2X7XA 4RS3A 2GZDA 4F8JA 4YJGB 5E6SB 4U7WA 1JQBA 1ZMXA 4DTCA 3DPSA 2GJKA 2X9GA 3VBCA 2QD1A 3W9SA 3S27A 4H0CA 3SZ3A 1F2TB 1E79A 3S28A 4DG9A 1NLUA 3BB1A 3ACBA 4RWZA 1OLOA 1JIQA 1JEEA 4D3SA 3LUBA 4YAFA 2Q5IA 1GAQA 1M7HA 4IMJB 4NE7A 3O8QA 2BFAA 3SY8A 1C3XA 1L7XA 1ZWKA 2BMAA 4TKUA 1BDMA 1FFXB 2AI3A 2CHQA 3SJZA 3TI7A 1RXIA 3CSDA 5IG2A 1G60A 4LHYA 1W4AA 3S1LA 4AO8A 4F2WA 2QTMA 2JBHA 3M3PA 4WECA 3QVTA 4PLVA 5T8KC 1NP3A 3AOEC 1VL2A 1BS9A 1G16A 4WI1A 3A6JA 1NMQA 4GMDA 3ZJVA 4YV7A 3DAHA 4LOJA 1JFSA 1P80A 5SYAA 5JMPA 4ED9A 1RYBA 2IZ1A 4MB0A 2QRZA 1OYVA 3TE6A 3DTTA 2O2XA 3HWSA 5FI5A 3C87A 3HVRA 1MEEA 4GO1A 6ADHA 3SHWA 5AW6A 3GD5A 5BSUA 4ZI5A 1H3FA 3ZU3A 4EENA 5I9SA 5FHQA 1OIWA 2I1WA 3T7SA 5JZVA 2A57A 1PR3A 1S2NA 3KJEA 1AA9A 1FYWA 1I4WA 3JTMA 4O2BA 1EKXA 1I2DA 1YBHA 3UCFA 3ZGNA 5ES4B 2ZDGA 1XE3A 521PA 2WSYB 1GRNA 3AXSA 3LHIA 2FEPA 1LBSA 2QL9A 1OD6A 4QDZA 3PDHA 3WLFA 4UBJA 3DJYA 4WNCA 5E1OA 1YR9A 2WJIA 2VJMA 2GN8A 3L4BC 4C21A 1QF9A 5FOUA 1VJDA 2JHCA 4CMIB 1A3CA 3UC9A 3HXLA 4GOXA 1L5RA 1IZ8A 3HA3A 5H59A 1K75A 2HH9A 4NHOA 2ZJ2A 3CC8A 3P2IA 4KFRA 2XR1A 1GQFA 3NP7A 3AHDA 3D3KA 5TE9A 2P91A 3A32A 1UIRA 1KOJA 2PL5A 2KHZA 4BNHA 1AM4D 4QUBA 3FPCA 1SM4A 4WNIA 3K0FA 4EJSC 8GPBA 1M83A 1G64A 2H7VA 1O5OA 2I1VB 2J87A 1WOMA 1YZFA 1RJGA 2PH1A 5ALVA 1P1KA 1EGVB 2V6GA 4OU4A 2G1PA 3MZ0A 3FHTA 3K0AB 2IS2A 1T29A 1T36B 4WA7A 4BAGA 3FWZA 3QYAA 3U3DA 3WYCA 2VJPA 2WKWA 1CETA 2LCQA 4NVRA 3M6XA 1DCMA 4M1OA 4ARZA 3U6BA 1GWNA 3O2JA 4REQB 3P26A 3OC6A 1HURA 4TKVA 1HTTA 2C58A 3PSHA 2XSZD 2FMIA 3AESA 4OFBA 1J2JA 3BHMA 3O6VA 2FG5A 2NYVA 4R81A 3TD2A 3O8RA 3G1TA 2LKCA 1HC7A 1NJSA 2V8BA 3KXIA 2OFFA 4BMPB 5BV2P 5K2OA 1C2TA 1N6NA 4LX8A 2PLAA 1PZNA 5DSXA 2GZRA 3A31A 4BUCA 3RK1A 5K3AA 2DWPA 1ZUD1 4HDAA 1EWTA 4QO8A 1M73E 1T9BA 2J5BA 5JJBA 1KSFX 3AERB 3F3YA 3RFUA 3Q6IA 5C31A 4ACAA 1MH9A 3VI4B 4XQCA 1GPUA 4MDFA 1ZGCA 1SNYA 1WSAA 1X15A 1PS8A 2PVPA 3TLYA 1LK7A 1KJYA 1WZNA 3IHKA 4EPTA 5DGDA 3O8BA 5A06A 4QGFA 3HDQA 5DBEX 5LYJF 2QF7A 3MT7A 5EHNA 5CURA 2DSTA 1YIDA 3E4DA 5TQ2B 3J80A 2GZ1A 1THMA 3L5KA 1EFTA 1WW8A 4A2QA 1YCGA 4WZBB 1BGXT 1S7GA 2IYWA 2Q2OA 2PQMA 5AFSA 3WKEA 2RHOA 1Z5OA 1JV2B 3DB1A 4UVHA 3ST7A 1QVAA 2VTDA 4XASA 2CMDA 1A1VA 5EP1A 5FUYA 4IICA 3IEUA 4PYOA 2XYVA 1UWVA 5DGTA 1RAGA 4I50A 4K6CA 1UDBA 3HVUA 2J9YB 3R40A 4RKQA 2GXSA 5AICA 1TYAE 5B1HA 5LBUA 5BWCA 1LCIA 5EIBD 4F1JA 4ZKDA 4E4TA 3RGWS 3CEMA 2VT6A 2BEJA 5GZ6A 1HNXB 5C8ZA 3RRXA 4J29A 2EJCA 1EP1B 4NICA 4F5WA 2H2DA 3HBMA 4WDRA 1J0XO 3VKUA 2ZJ1A 5E1DA 3KPJA 4I8IA 2C4MA 1T1JA 1TT5A 3EFEA 4R01A 1EZ4A 1CY1A 1GT6A 1CHDA 1OA0A 1U2QA 1A5ZA 4GMKA 1YKFA 1ELOA 1PEKE 2FSUA 4H4EA 2IXAA 2XUFA 4I4TF 1G1AA 1RPZA 4OIFA 9MHTA 4X3CA 1E69A 3T6KA 1MAVA 4DPKA 3K5IA 1CQIB 1OB2A 4A8JA 1VPDA 3NR2A 4MI9A 2REXB 1XZEA 5DNWA 1OXVA 3DKPA 3WB9A 3EWSA 1F06A 3ZW9A 1ML4A 4XD2A 3AVQA 2G1KA 3P0HA 2FEWB 4G2TA 1U6IA 4JZKA 4KE7A 3LDUA 4JJZA 4IMRA 2R5WA 5T5QA 3RKUA 2WDZA 4Z54A 1BW9B 3QVUA 4PZ9A 3OPYA 4LF7B 3DZKA 1MT0A 4E15A 1QAQA 5LIPA 4G1MB 4O4JA 3LC2O 4ITVA 3DDSA 4HNVA 4B4WA 3SVLA 4DLYA 1UMCB 4PGAA 1CLUA 1SZDA 3KL4A 3KVYA 3KZKA 3LT0A 5CR9A 1Y34E 4H16A 2G07A 2IEAA 4FB4A 1ULAA 3TLAA 4CG1A 1SRRA 4U7JA 2NLOA 2WM3A 3DE5X 3ENNA 5DX1A 3OVMA 4FMDF 3HKCB 3N0TA 2GYWA 3EXHA 3PL1A 3UEOA 1XK6A 4XDZA 2Z83A 3LY9A 5D5PA 1D6JA 2IJGX 3PCRB 1D6MA 2GN2A 4LMPA 3HHPA 1DKLA 3AEQB 2AC7A 2OAEA 1SBIA 1W75A 2E48A 2P5TB 3KFXA 3PQFA 3Q9LA 3FWKA 4DY6A 1U1EA 4BLPA 1TMKA 4FYMA 4G89A 3RC3A 4CIAA 3AP3A 2I3ZA 4YJ3B 3VHXB 4P5DA 2DAPA 1OZ0A 2ADMA 2KQUA 1MO6A 4D5EA 2C9CA 4MTCA 4EY5A 3A36A 2OG2A 1OU4A 1WXHA 3H04A 3QHAA 4MUNA 4ZCQA 3RQSA 4B3JA 1B41A 4CCAA 3IPXA 4V1CB 1E0SA 3HUUA 2LKDA 2UYCA 3ZIUA 1M5UA 3NIFB 2YYZA 2EW8A 2H1LA 4KP7A 4P4GA 3VDMA 2HCTA 4Q00A 4NPAA 2HY7A 2HQBA 3UXHA 3W2IA 2WWWA 3ROGA 4IGIA 5AKGA 5HKKD 2VEDA 1I7PA 3I0MA 2DFVA 4B0OA 3S2ZA 3ZXSA 3IJEB 1RCUA 4OUKX 2PR7A 3LQ4A 1UBHS 2Y77A 2ZUSA 4RHTA 3SAJA 3V7FA 4G8BA 4S35A 4WMLA 4YFVA 2NXEA 2R6GA 1XEWY 3IDFA 2HJRA 1PJ4A 2WWYA 3MD0A 3E58A 3O1IC 4CMCA 4KR6A 3TQSA 1ACJA 2XW6A 3OZGA 2E87A 1J22A 1SK8A 1BD3A 4Q3LA 4CM7A 5CYGA 2D7DA 1RNLA 1MEJA 2C59A 4HYEA 3WWPA 3D4LA 3KOMA 4MPJA 4DMLA 3E3NA 3SR0A 1E32A 4QXOA 4YH1A 1MPTA 2ODQA 1QK3A 5BR7A 2VSFA 1KQPA 3ZVMA 2C9YA 2O5VA 3UO8B 2X2FA 4OVKA 3WDKA 1J0EA 3ZE8A 5BQXA 1HUQA 2H4HA 2JIZA 4DLUA 4CM5A 5JVDA 3DLBA 1RKXA 2YWRA 4R9SA 5CGQB 1E2FA 3DBRB 3HO1A 1KDZA 1JSZA 5G3ZA 3G2IA 3R5JA 3WQQA 4WBNB 2GF0A 5C1DA 4BWGA 3HXQA 1JQAA 1NG9A 4CU5A 2YVKA 1F7VA 2VDWB 1H6CA 3B1XA 3DFUA 3RNOA 1L8AA 3HB7A 3I64A 2HJGA 3MINB 4K6FA 4WADA 1W49A 4Q9AA 3L0BA 3OQ6A 4GLJA 4PANA 5HIJA 5HKOA 1JEYA 1CPYA 3ZPXA 1E6MA 3KBOA 5C8YA 3VISA 2CD9A 1M66A 2V96A 4CKXA 2CW5A 1DT3A 3BDAA 5H70A 1M67A 2KJQA 1RE1A 1STOA 4U9UA 2JKVA 5DYWA 1FK8A 2G7ZA 3KZ1E 2GETA 1BC5A 1LF5A 1KS9A 4FU0A 5IYZB 1XPRA 5K4GA 1MEOA 2VRCA 3HYTA 1U0JA 4DLXA 3K70B 2AT1A 4DG8A 1Y8ZA 4Q7JB 4DIKA 4YCCA 1SC1A 1OIVA 3QX3A 2R6JA 2MSCB 3CKMA 2Q4EA 3L8MA 4DCTA 5DNYB 4X61A 3KRTA 2VNHA 4FE4A 4IZIA 3O2QB 4J4TA 3L7YA 2XT6A 3S7ZA 1O0BA 4XAQA 3AEYA 4UOEA 3KQUA 3DOEA 3EIQA 4QELA 2J59A 1E1YA 2Q8QA 4PBRA 4OP3A 4A8JC 4LEIA 4GE3A 4DUPA 1B14A 5K8TA 2H65A 3M5WA 2F62A 5AOAA 2BKUA 1W5TA 2UVPA 2JFOA 4TTRA 3RVOA 4QAJA 1F5SA 5JQGA 4CWAA 1SKYB 2J4FA 3BWCA 3DYIA 2XJ4A 2JAXA 4OHFA 3TTTA 1ECJA 3F3KA 3QLUA 3FBTA 1V26A 4A91A 4EL5A 1C1YA 3V8NA 3I9MA 4TKLA 3PGVA 3PQ3A 3L8HA 2JAQA 1KH2A 1A9YA 3G23A 3WMFA 1IWBB 2YWHA 3I4FA 3ZWYA 4GICA 1A7UA 3NV7A 1RFGE 4ZEWA 1MUUA 3V33A 3FNQA 3SE0A 1Z35A 2J8ZA 3ZWAA 3KDPA 3G0IA 4HLUA 5AOBA 5FNVF 4K9LA 1EE9A 1I0LA 1Z75A 3FMVA 3KLNA 4JSYA 5B5SA 5EIAA 1ZVVA 3LWZA 1QKJA 5C52B 3WXBA 3EXHC 4UTOA 3OE1A 1GNPA 3SQOA 3C5HA 3D7NA 3DWFA 3WWEA 1XMJA 1Z7EA 2D5IA 5HJ5A 2QEQA 4UM5A 1ADBA 4QRIA 2IPLA 3GJ8A 2EFJA 4W5HA 3ZS8A 4RTPA 4HRAA 3E22B 1QZTA 1GQSA 4HWOA 4DDMA 1SH7A 2R6FA 1RM3A 3BD7A 4IJWA 1RSZA 3R7FA 4MVWA 3Q9UA 3TWOA 4LF5B 3KZCA 1ZAKA 5JDIA 1U8AA 3HS3A 2ZI3A 1WHTA 3IE1A 1ODIA 4JLWA 2NU6B 3ORSA 4XH9B 1HDEA 2IT1A 2RHCA 4YEDA 3WZMA 5IMSA 3GJ3A 1CDEA 1F4PA 2EHJA 2HWWA 4DCCA 4WGFA 4EGFA 2F4NA 4BLRA 1GRRA 1YVRA 3N6VA 1RCFA 2E5FA 2IY7A 2YRXA 2PSDA 4J9UE 4MV8A 4K3VA 4UVDA 3RT7A 2P9YA 2FDXA 4BGIA 2N1BA 3N28A 1MA0A 2VRWA 2WJGA 3A27A 3AM1A 4KWEA 1H66A 1U2PA 3P45A 6ABPA 3ADOA 4DQVA 2WVGA 3MRXA 4TVSA 1C8LA 2HHCA 2P4QA 3GNLA 4QEZA 1L1QA 3GPBA 4K9DA 3OCXA 2GAJA 3BWYA 4C6TB 3ABOB 2ZWAA 4E32A 4EGJA 1UKBA 3WX0A 4J3NA 3BL5A 4LKRA 2QVLA 2BMDA 5EIXA 1UFKA 4K5QA 2PD3A 2C9DA 1QIIA 4NYMQ 1OFIA 3WSTA 2X4GA 2Y71A 3EXG1 2RBKA 1A82A 1V3TA 3KWMA 2ZITA 2PUTA 2WBLC 2BKXA 2D2FA 2F00A 1DB3A 3BIOA 2HUPA 5HM8A 4WEOA 1X1SA 2AEFA 1AK1A 4R4JA 1GY8A 2QG9A 5K8VA 1FQJA 2PV7A 4KVAA 4FOPA 5SZHB 2FX3A 4RK0A 4L22A 5DV9A 1BX0A 2XNJA 3H7IA 4TS3A 2YKGA 3PE6A 1YI0A 3AV3A 5CA1F 1HL3A 1PJTA 1TCVA 2VJYA 2MU1A 3IAXA 1IHOA 3JD2A 3QZUA 1SIWA 4TZKA 1TM4E 4Z9YA 3W3AH 4F06A 1Y1KE 2WG0A 2GBIA 5BXQC 4M8SA 5GONB 4JFRA 1DVRA 4UM9B 4ZZ1A 2VCEA 4H6PA 1RVDA 3NNDA 3IR6A 1XKXA 1AGPA 4JX9A 1N2OA 5K3SA 1ZGAA 4UTPA 2NTYC 1U2EA 4JNKA 4ZO7A 5DHQA 3RYIB 5INTA 1ZK3A 3WO0A 3DO8A 2RD2A 1NTOA 1NKTA 1L7DA 1Z5UA 2CXHA 2I62A 4X93A 4W9RA 4GEGA 2XB4A 1L1FA 1N1GA 4FGLA 1AKNA 4B6FA 4DWJA 4CL2A 3A2NA 1CUHA 1OPXA 1FBNA 3D9QX 3G79A 1HYHA 4KJXA 4WNYA 4UMEA 4G1EB 3MRTA 5F51A 2Y2VA 4AJ1A 2ON6A 3JYLA 3KUKA 2ZAGA 1F6BA 3SLRA 2EFCB 3CG4A 5JSHA 5FX2A 4Z4FA 1Q1QA 3PS9A 1OWPA 2IQIA 2WV7A 3FFXA 2DG2A 3BXZA 4CEJA 5AK0A 3PC3A 2WQ6A 2WVJA 1JIVA 2LNDA 2INGX 2NAFA 1GT91 4WN9A 5ALRA 4F96A 1N57A 1KNQA 1DC5A 3HP1A 2ZRFA 3CRW1 4YQFA 1E3LA 2HNAA 4X95A 3IPCA 2W2MA 1DKOA 3PGKA 2HHHB 1A72A 2BBTA 2HKIA 2RGNA 1DG1G 2GK3A 3WLPA 1G5RA 2FW0A 4H3HB 1IQUA 1R6VA 1N2XA 3CYFA 3EXFA 2DYKA 5IM4A 5KYWA 4ZHSA 3WGQA 3C3YA 3I6MA 1VJ1A 1WPQA 4Q37A 1PG2A 1U7WA 4NTZA 3QLUC 1YE3A 1VMKA 4JIGA 2E18A 3JQAB 4OLAA 2QPLA 4Z51A 2IHZA 3KSZO 3GHHA 5EWJA 5E9QA 1OX5A 3D7KA 4LDAA 3OAAA 3J81k 4LKOA 5JD6A 3JQ6A 1CT9A 2HK6A 1MG0A 3NALA 4P3XA 4B74A 3Q4GA 2WU3A 1A77A 2HWKA 4HLUC 4F4JA 3GCGA 4C30A 3NGMA 1DQYA 3JWGA 4PLWA 5B55A 2ZBUA 4P80A 1T35A 1GTZA 4UULA 4YT5A 2EGUA 2ZBDA 4KE6A 4B44A 4I55A 3QEKA 5CX4A 2VR1A 5P21A 1F1JA 2H17A 3UB3A 1HE8B 1X14A 4WKCA 4E6EA 2I3BA 3B8HA 3EG9B 3LSYA 1L5LA 1LLUA 1AKRA 4DR7B 4TL7A 1JMVA 3C3AA 3FAKA 4GP6A 3GUCA 1W2HA 2W6IA 5KPDA 4YP0A 1AQLA 4IKPA 1SB8A 2AWOA 4LE2A 5JDIC 1SGWA 3SZRA 2UZIR 2VT2A 1KKUA 2KWIA 2YJTD 4P4TA 2QAGB 1X7GA 2W6OA 3V42A 1W1IA 4NY1A 4AWXA 4GF5A 1GZ3A 4OAPA 5IUNC 1CJCA 3OD1A 2WQ7A 3CFYA 3HH8A 1QG4A 3HNPA 4FYKA 4I9GA 3HJBA 4EZEA 1T0HB 3DMHA 7YASA 1H4VB 2EKZA 4B46A 1E1CA 3HYSA 4V0NA 4BO1A 4MGEA 3H5IA 4EFDA 1ECBA 1KYIA 5GV8A 5GJWC 1PTJC 4JJ4A 3ABSB 2QRUA 3EVZA 4QM7A 3U44B 2CHUA 3VQTA 2NV2B 2LR0A 2ZVJA 3F6BX 2BEWA 2E85A 1R5NA 4FZ3A 1CJMA 4RVUA 5T3UA 1C14A 3H1AA 5FTNA 5TT0A 1JBEA 4C20A 4F3CA 1QUFA 1H85A 2AFHE 3DDCA 4C0BA 5CD9A 2JLUA 2GYYA 4OXXA 4IFTA 2NXNA 4ENWA 3E9MA 4Q1AA 2QX8A 4YMVA 4ZYZA 4FOTA 3CLRC 3U4QB 1N2CA 3AVVA 3KOXA 3P9IA 5HJ7A 1BCSA 4MLZA 4EW1A 3RGGA 5CU7A 3VNBA 4D3XA 4EEKA 1N32B 1ZW6A 5E0OA 4PSKA 3UK1A 1R9MA 2WWHA 4KQ6A 4EUFA 3TQTA 1AN9A 4IDHA 5A02A 1K3UB 2DE0X 4BX8A 4XLLA 2GEKA 2Q0HA 2HCJB 3S1AA 4CE6A 4YMGA 2R25B 1JHXA 2IYNA 3PKZA 1Z7GA 1X8JA 1W96A 4IDNA 4J75A 4WZ6A 5KYYA 3EDRA 4DLKA 3UGJA 1CP2A 5KJCA 1SK9A 5JS8A 3UKDA 3VDRA 2R6ZA 1QV9A 3VSDA 5DM4A 1ZI9A 1I5OA 5DT2A 4M6WB 3HUEA 1AJEA 3SSMA 2BFBA 4DRYA 1JG2A 3HACA 2XDQB 1YK0A 3QELB 1MVLA 1WDMA 3ENZA 1ESDA 1UJCA 1MW8X 4CL3A 2BJHA 2UUBB 1P6QA 4TL9A 2YWGA 2WJWA 1GPLA 4Q7LA 3UGKA 2Q7XA 4KGDA 1IRXA 3RROA 3W6OA 4B09A 3NONA 7ADHA 5K9ZA 1I6WA 2PXCA 1WXQA 4B8ZA 1F6DA 2XZTA 3GEEA 3HSYA 4HUJA 4JYPA 1VI5A 3G02A 3QXSA 2OR3A 1XALA 3VX3A 4UXIA 4EKDA 4MS1B 5LOVB 1J24A 2OILA 4MLCA 1ADYA 2Y27A 1I4TD 2NO5A 1S3GA 1NUSA 3B8EA 4G5FA 4PN3A 5K6TA 5BNWA 3U0VA 2ZJZA 4B47A 1AMUA 3LVFO 2EZTA 3OZVA 1BDHA 4N48A 5CH5A 1QGED 2IF0A 3B6ZA 1KO1A 2ZI7A 4N8EA 4PLYA 5DM1A 1XRPA 4ALJA 4GXRA 1JZQA 1TEVA 3ZDRA 2Z1NA 4W8OA 2WWXA 5LZ9A 3IX7A 1XAJA 3QVSA 5ALPA 2PXXA 5GY7A 1PQ4A 4AULA 5JLJA 2JF0A 3SHQA 1J25A 3QG1A 4YJ2B 2Z30A 3NCHA 2R11A 4PHTA 2XUPA 3IKMB 3UPUA 4GSYA 3P9NA 1AHHA 2ZCVA 5REQA 3Q11A 4JA2A 2ZDHA 5EE1A 1CRPA 1XNJA 1TX4B 4JVMA 1Z36A 3KOOA 1EQAA 4C4YA 1E2LA 4I4LA 1T2EA 1BX1A 5FOTA 4Z0PA 1JFTA 3ZK7A 1SHTX 5IJ9B 3H11A 3VA7A 2IL1A 1BRMA 3O4GA 4WAUA 5HYVA 1RWMA 3AGQA 4DBLE 1XR3A 1OT5A 2WU4A 4GIBA 3KKOA 3CLSD 3AFGA 4X8HA 3G49A 5FADA 3VC3A 2HF2A 4C07A 2O8EB 1SKAA 1I4DD 2CYAA 2PZGA 3ZY5A 3S2EA 4CMHA 1SBNE 1LX7A 3OPVA 4JI5B 5CGZA 4KR3A 2YBDA 3R6WA 2CDAA 4MYDA 2E4WA 2BFDA 4PQRA 4QVGA 4FK8A 2AD1A 1J2EA 1DPGA 2QZPA 3OWXA 3S99A 2DSNA 3WWYA 4EPVA 3MTEA 4S12A 2PE5A 1J5XA 3LPCA 3GBSA 5DX8A 1RZVA 2IEDA 1A7JA 3K5WA 1XTUA 4ITUA 1P7PA 1R1DA 2P77A 1B6SA 2OM6A 2IQ5A 2GSWA 3DEYX 1VE1A 2XCOA 3NFYA 3NZEA 4EA8A 5AIBA 1QF6A 3OCZA 2D2IA 1OTXA 2DWCA 2OQVA 2WNSA 2CYCA 2WHPB 5HZHA 5HE8A 4KREA 3OF5A 3C4VA 3EUEA 2FXIA 2QM0A 2CNOA 4O63O 4Q3KA 4D57A 1QCZA 3VHLB 3G0BA 1DWPA 4JGIA 3UXEA 4CJXA 2O3RA 2WZQA 3DL4A 3VVCA 4MKRA 2EOAA 4C7JA 4GKJB 4X90A 1S3SA 2PM8A 2ZCUA 4MI1A 3G9TA 4NHEA 4UPVA 3T1VA 4BO2A 4BX9A 4ZQGA 4DMUB 2W6JD 1Y7IA 1FMFA 1BJRE 5CVJA 5DLYA 1GKLA 4W99A 4HGYA 1JMKC 1N9ZA 4K05A 1A50B 2BKLA 4UNIA 2BI4A 2GK6A 2J6CA 5BW5A 5B3LA 1NMEA 4P0QB 3RC1A 3UIEA 1W35A 4Y6SA 3EIHA 2Q62A 4IIHA 5ALDA 4PAOA 2XSZA 4NCBA 2P8SA 4TLAA 2HOQA 3U4MA 4HMOA 1COZA 1EX9A 2YV2A 1P0PA 1ZYUA 1BU5A 3JQDA 2IDZA 4BZPA 1FVXA 1UPAA 3MB8A 4EHBA 1V11B 4TMTA 4XXHA 1DCTA 1DQNA 2DHEA 4PPFA 5BORA 2P3QA 3UJ9A 1KZ7B 1GUDA 3PD7A 5CYPA 3SYLA 1KZ6A 1UAGA 2GM5A 4GXQA 4JLBA 3NVMB 5ECWA 5L7WA 3FDZB 1J99A 2QM7A 3EY9A 3N5CA 3HU1A 1PBTA 4P98A 5DHFA 1WU7A 5F2KA 4HZIA 3RFXA 3BPSA 1MQ8B 3EF1A 4ZOCA 1IN8A 4DIEA 2HIMA 2Y4OA 4MRRA 4KXNA 5U4QA 4L27A 5DOVA 4JUDX 4W63A 2XVAA 4R2WA 4L9RA 4MPDA 2YINC 2HRDA 2I7XA 1HZZA 3LUHA 4PX5A 2NG1A 1Z4JA 4J3JA 1PFQA 3BD9A 1XQ9A 4HFJA 4RENA 1EUQA 3AL0C 1TF5A 3K5PA 3H2ZA 4DIOA 1NRWA 4E1BA 1SC9A 1F1BA 2GNOA 1AMOA 5JASA 4NMMA 3HA5A 4TSFD 2CXNA 2Z6UA 1E5LA 1G6HA 1JNYA 2OOSA 5AD1A 3OM1A 3T35A 4CETA 1IJFA 4D99A 3LCMA 5KO2A 3THWB 3KHUA 3ZXXA 5BSVA 4OYRA 1H2EA 4UOQA 3DL7A 1Q1AA 4J4BA 4HYTA 3CGGA 1D9ZA 3FN4A 4EMSA 3NBFA 3Q7TA 4Q3NA 1PJSA 1HG0A 2PL9A 1HDYA 2XZOA 3HPRA 1U2SA 2GTHA 4EG3A 1XQ6A 1JG3A 1PU2A 1ETHA 2VDJA 3KD2A 4JSRA 4UEKA 2GO7A 4D9CA 1QP7A 2QX9A 3BAFA 3ZE7A 1GSOA 3L7KA 5BT8A 2FRDA 1BS2A 4X92A 5JXGA 2ZGVA 5IWCA 2QXYA 3KT8A 2NXCA 4A82A 1F20A 4F3KA 4ZAXA 5BWOA 4WD3A 3L46A 4XLZA 2JRLA 4A03A 1AHIA 1DRVA 2DULA 1PX0A 2ZRDA 4NWIA 3BDIA 3VGPA 5T67A 3SHOA 3FTFA 3FF4A 4MQ6A 4U00A 5CA0B 3IEKA 1W87A 1U80A 2R7AA 3F6RA 1LFAA 4BDTA 2PH5A 3LQRA 4C0JA 1VCMA 2FUG1 2XD9A 5K8UA 2HX1A 3EPRA 1Q1EA 2MIIA 2WWFA 3DL2A 4BNLA 4GOMD 4UDOA 5NULA 2PZ8A 4FINA 4KAAA 4LXXA 3LIIA 1WBDA 2AG0A 3RUCA 2DBZA 2NUTB 3CH7A 1F3LA 1GZUA 3D5EA 2MYPA 1YFZA 1YZ3A 1LBEA 4RIHA 5JTTA 3PI6A 4ETIA 3A9SA 1JHRA 1T4GA 2DQZA 3U60B 1J21A 1O5IA 5JNUA 5IC5A 1ZRNA 4D0GA 1PNQA 4AWAA 3BYZA 1PNVA 3MJVA 2R8XA 3OBBA 3G0GA 3ZVRA 2FP4B 3R5XA 4HGQA 9ABPA 3NEAA 4K9RA 4FLEA 4JP1A 1XFDA 4IGAA 1H6DA 2B83A 3W9BA 3RVQA 4YXWD 5HGXA 3W1WA 1P7ZA 2AMFA 3KUUA 4M38A 5KSWB 1XZPA 2NWQA 3OEHD 1LDNA 3PFIA 4FFBA 1WY7A 3CLHA 5A5DA 2X8BA 4P33A 5D3MA 1N6KA 4QDJA 1DTWA 3ZWMA 4DV1B 2O19A 2ZRIA 4LWZA 2GWRA 2VNIA 2C77A 1BXGA 1KYWA 4TL6A 1WMDA 1PV1A 1F2UB 4HRVA 4LWOA 5I7SA 5ERGB 2CT8A 3I9NA 3OLWA 4FBGA 5C53B 4NJOA 1ONOA 5F78A 1YA8A 2CDRA 1UZMA 2CLHB 2UAGA 3B7PA 4YONB 3QVOA 4NK5A 5DIFA 3SQLA 3QPDA 2I76A 2P65A 3BF7A 1Z2OX 5EEGA 4KQHA 3ON5A 5JCJD 2Q7OE 3DEIA 4A0SA 2ZQYA 1RPAA 2H9AA 5HKKA 3V2HA 1IUPA 1QHFA 1SURA 4BZWA 4L78A 1CEEA 1KJWA 3AI7A 1YRQA 1BJTA 3RVRA 4CQLB 2NZ8A 4WZZA 2ZG6A 2VPYA 3NETA 3OOSA 3F6PA 1ESEA 4CW7A 1JR4A 4WY8A 3HP4A 3B1ZA 1OWNA 1KAOA 4AJ2A 3R6GA 3HN7A 1R5OA 1CQPA 3QBEA 4UEOA 2MJLA 2P2LA 4YP5A 3A0RB 1WZ2A 3OCUA 1QFMA 1USIA 2KB0A 3H2HA 3MN1A 2ORYA 2C3MA 2B37A 2QUIA 3C15C 1KGSA 1D1PA 3M4NA 4XQGA 4CDMA 3D7SA 1IOLA 5JISA 4HDSB 2VAPA 3D64A 4QQNA 5COQA 1J5PA 3M0EA 4OMCA 2R97A 3CJQA 1Z38A 3H5NA 4JJ7A 4PSAA 4WT7A 2WUDA 3H86A 2F9MA 3WS7A 4C04A 2F3SA 3CLTD 1VJ5A 1Z4PX 1NXTA 2HK7A 3W7BA 5DBOA 2QP9X 5JS7A 1H2YA 2IYLD 3IP3A 4TVBA 1JHZA 1BTOA 4Q66C 5K2MA 4ZIRA 2ZJAA 3PUXA 2UZ0A 4Z7JA 5KWVA 5DASA 5BWLA 3SG0A 4WESA 3FWPA 1I6MA 1HZZC 3COJA 1QIKA 1GNVA 3A3OA 1FSSA 1L7NA 2QRLA 1AQYA 5CA1A 3A4IA 3EZ9A 4DHEA 1YFLA 2GEBA 2JLQA 4BZZA 3I6QA 2H9YA 2NSYA 1QZZA 3T3NA 3G9XA 4GPAA 1ZRHA 2J3JA 4MUEA 5LA6B 1ADGA 3NHSA 5AKJA 3RVNA 1RLIA 4HSEA 4HNHA 3VOAA 2NSDA 1XXLA 1QV7A 3QVJA 1IUNA 4R6XA 1CF4A 2DTXA 1FYXA 2LXNA 2WIJA 4NCHA 4AMYA 4X8MA 2VQEB 3OY2A 1UQUA 2BEUB 1PT8A 1R6DA 2IZ7A 3BJRA 3B9BA 2IIPA 4HQOA 5H16A 3SBXA 4RA6A 4BL5A 2QTCA 3ETHA 3KPWA 3MJRA 5EESA 4UTRA 4MOWA 5KYTA 1APBA 3AFMA 3F49S 1D03A 3TIVA 2HIHA 4TX1A 1BO6A 3DQQA 4LE0A 3M9XA 2H63A 4R3WA 4ZAFA 4JUIA 2XRZA 2FRDC 3GUZA 4L08A 5CDHA 3SJ7A 4BQSA 1T9KA 3Q3IA 4PC6A 5DLDA 2ONKA 3I9KA 5IXJA 3TRFA 3NUZA 2ZIXB 1FS4A 2BM9A 3MUFA 5K0EA 3KPVA 3Q7PA 1T5TA 5EJGA 2WMDA 4IDFA 4F4FA 4CMGA 1RAAA 1X1TA 4RLFA 4C0XA 1JG4A 1UT5A 2EV9A 3IPRA 3L6UA 3TX6A 3RAGA 2FLVA 3EQZA 3M82A 4NNPA 5CEJA 2NV0A 1GFIA 1V3VA 1WETA 4LVUA 4E1VA 2B98A 2GPTA 3WGNA 4HTFA 3L7MA 3LTEA 4IQ8A 4KMRA 3ZNQA 5AW5A 1QHHA 4YB8A 1P3JA 3LGSA 3BQMB 5LXTF 3UTDA 2A0WA 2QK4A 2JIPA 3SIPA 2V7PA 3MERA 2BPOA 1DMSA 2JGFA 3HM9A 1TC1A 4W8GA 2QAJA 3N8KA 3NWOA 3F4KA 4B71A 4D4MA 4H3SA 3IUEA 5HZKA 2AYYA 1O9HA 1SU7A 3GNTA 2A5FA 2JBWA 1QG2A 2NQ8A 3BRWA 5B57C 2XA9A 3TL3A 2QRPA 3TQIA 2IHYA 2O52A 4ZVVA 2JGJA 3KVOA 3DXYA 2NU9B 5DK6A 1IL0A 3F6CA 1I7LA 3L4EA 4AJNA 3GAZA 1E7SA 3KTDA 5DB4A 3HSKA 1V3QE 2GLTA 3LX5A 2B8WA 2YZGA 3NBMA 1FMCA 1P4GA 3A1DA 2J6IA 2P4HX 5TF0A 4FR5A 3DOJA 4ZU1X 3GFGA 2ORVA 1X9IA 3IMCA 2VNKA 3QBJA 1BD4A 1FA9A 2ZT8A 4TTVA 3LOQA 4KXFB 4OI4A 4BN4A 2IHUA 4YUZA 2C1ZA 3P52A 1JALA 3ECAA 1BWSA 1TCBA 4OL9A 3ROEA 2IOHA 1QIHA 3WLIA 3E2IA 4RZ2A 4FB5A 1YU6A 2B1GA 3F2IA 4HG2A 2QGNA 4KC0A 2A4KA 4PHGA 3EZLA 1JLLB 4FS3A 1W46A 5KYKA 3MMXA 3B1WA 3JALB 3BMNB 4IV8A 2J3QA 3P0RA 2JGDA 2AXQA 3PL5A 4ONEA 3KB2A 4ZRDA 2CXPA 2PKWA 4HEA1 3IT0A 2Q5OA 4FLFA 5FUVA 3RADC 2QRMA 4D9KA 3EZYA 4I1SA 2CWDA 2XE4A 5BN3A 1YUNA 1TAQA 3JX9A 3PE4A 4H15A 4F97A 4LOHA 1DRJA 4V0RA 2C5GA 3D4PA 1SVLA 3O8QB 3KUXA 4QXPA 3GLSA 1YONA 2NO6A 3FYUA 4TKUB 3TGWA 2IU3A 4X8LA 4UAUA 1QYXA 2A6PA 2VA9A 4ND1A 4YJKA 1QCCA 2VJLA 5G0SA 4TSKA 4JJKA 3QFSA 4ZFNA 2I3AA 3G2HA 4BVKA 5JWRA 4A6PA 1AGNA 1TZKA 2XDAA 3H16A 3HJCA 5DK4A 5EXEA 1RADA 4J49A 4XWAA 4LBYA 2OMKA 4OGKA 5G0TA 1OGYA 5JW6A 3TQRA 2PIDA 3G2PA 2IYAA 1J5EB 3KQLA 3PUIA 3THYA 2WU1A 1KZYC 2YXEA 4RKRA 3JSAA 3K8QA 3AQ4A 4I7EA 5DW0A 2O8FB 3OLQA 2PJRA 2VUIB 3A6KA 1Y3CE 3DYBA 3IQFA 4TWZA 4BIIA 1FXSA 2AOVA 2XIQA 1L6IA 4WA8A 3D6JA 3MLAA 1JP7A 5A3JA 1QR6A 3W7AA 1MV5A 1USUA 1L4EA 3KTOA 3SK0A 1ZY2A 2G40A 2NT3A 3CU5A 3W8EA 3A58B 5HRCA 2JEZA 2RK4A 1NV9A 2C9ZA 1HT1E 3REFA 5JHGB 3BIJA 4PYKA 1WHSB 1ST2A 4ZDKA 2XBMA 1ECGA 4KGZA 3IAAA 1NGSA 3GJYA 5BSEA 1U1FA 4K8RB 3SXPA 5AT1A 2BGLA 5E4JA 3TI9A 1Z25A 2IEGA 2O07A 3MRVA 4NU0A 4AMUA 3DZJA 3MQ2A 1OVGA 2Q1UA 1YDEA 1JDSA 2YHAA 3AB8A 4Z9FA 2WAXA 3BIWA 5K6AA 5ALMA 2ZT5A 2ZJ3A 4LJ5A 3T9BA 4B6RA 1LZLA 3WMRA 1H2ZA 1UAYA 2AKYA 3K0FB 4NDAA 1I30A 3CJRA 2N46A 3SI7A 4PRKA 4Y1GA 1E3JA 5AK6A 2BR3A 3RAEC 1Y80A 3PDIB 5TPZD 3CX3A 3KD3A 2Z1MA 3ET5A 4QJ4A 4JBGA 2IH5A 5PNTA 4L8VA 2YJ5A 3VVMA 3OFJA 1ZSNA 4CKCB 5K0SA 3IVCA 4HL6A 1KVUA 2ZUCA 4FQ5A 1B4DA 4TKVB 4FX2A 1IXYA 4C7OA 2XQIA 3RRBA 1TYEB 2ID4A 5FAKA 3JQFC 3TUZC 1Y37A 2C3YA 3RC7A 4F93B 2WVAA 2ZE7A 3GLUA 4YP9A 2PEYA 1E5XA 1US8A 4XCXA 1BA2A 5LQMA 2D06A 3EEFA 3NG1A 4TKZA 3H1GA 5FPPA 3RIYA 1QYCA 2QWXA 4UMDA 5L6MB 1UBCA 5A4FS 3TD6A 5I9MA 5B53A 4R1QA 4Q4CA 3HJNA 4KLAA 4YRJA 2GRJA 3HB9A 4C6HA 5CYFA 1W8IA 1H23A 1YRBA 3A1WA 5BRNA 3GBPA 4NV0A 1K5DA 1J06A 3U17A 2WIDA 5JZMA 2CBXA 1EB8A 4RO0A 1I1HA 4F1KA 1EEHA 1GGJA 4NIMA 2IY8A 4UJ5A 1LWNA 3AY6A 5B36A 1FIUA 2QL7A 3FLMA 2D59A 1MKYA 2XADA 5LQUA 1NVVQ 3BXHA 4YJDA 2WILA 1W1WA 2GFQA 1VSQA 1KXJA 1M3SA 4AECA 2G77B 3CLUD 3V2UA