4AP6A

Crystal structure of human pofut2 e54a mutant in complex with gdp- fucose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
389
structure length
389
Chain Sequence
SRRRYLLYDVNPPAGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKITY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Pofut2: Insights Into Thrombospondin Type 1 Repeat Fold and O-Fucosylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords GDP-FUCOSE PROTEIN O-FUCOSYLTRANSFERASE 2
total genus 131
structure length 389
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.221: Peptide-O-fucosyltransferase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10250 O-FucT GDP-fucose protein O-fucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11340 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap6A01
3.40.50.11350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap6A02
2DE0X 3SIXA 3ZY2A 2OCXA 3SIWA 3ZY5A 2HLHA 3ZY6A 4AP6A 3ZY3A 2HHCA 3ZY4A 4AP5A
chains in the Genus database with same CATH superfamily
1XZGA 1ZSYA 4MB6A 5JATA 1LZKA 5E7MA 2KW5A 2NACA 3K09A 2ZTVA 3HA7A 4XSHA 1Q7TA 5AKGA 3NRJA 1YHNA 4LYFA 4JQSA 1JV2B 1L7PA 2I8CA 4XB2A 1ZUWA 1JSZA 4ESEA 1UKBA 1WW8A 4FYJA 3RS0A 2AF4C 2VHXA 1CR0A 1UBRS 2CDCA 1Q0TA 4ZOLB 2Y2UA 5JJKA 4G0ZA 5SZIA 4LJ6A 1GQ2A 2QX4A 3SPXA 4CM9A 4I1PA 3PX2A 5DHQA 3G5UA 5CBPB 2FWRA 1C3EA 2W2LA 3NPMA 1PVDA 3DF9A 2N9UA 1RHMA 1YZYA 1X8LA 3K4PA 2D7CA 5DPMA 3RVJA 3UK0A 1SHUX 4IINA 2C29D 3QX3A 1QK4A 2EXXA 4NZYA 4KR2A 5HBGA 4P7GA 4EHDA 3NBYC 2BC9A 3PFBA 3TFOA 1I4WA 4S3MA 2Y1CA 1S3IA 1I7NA 4XGNA 3CTPA 3QQPA 4IQ8A 3KVNA 4L22A 2DUWA 3DO8A 1BXKA 1G5TA 1V7PC 2GPTA 2H1SA 2OBMA 3C74A 3FDXA 3QUCA 5E7JA 3CVUA 3DDSA 1RWWA 4MYUA 4RZHA 3D8TA 3IHTA 1JLMA 4L5AA 4XPZA 5GMOA 1ODCA 1VHDA 3A1SA 4Z4GA 1OFIA 2ZAGA 4MUEA 2R8XA 2Y1LA 2VOEA 3EUWA 3H8WA 3OWOA 1NP6A 2C03A 5HJ7A 3AP1A 1TK9A 2BT4A 3HU1A 5BRJA 3ITEA 5TMEA 3ZCSA 5ECYA 3RVLA 5FV4A 1YZNA 5T7BA 3DUFA 2IHYA 1Y1KE 2O7RA 4WK0B 1VMDA 4XYEA 5TGDA 1QCDA 3FPLA 3TLCA 3UHJA 4BTLA 4C0HA 3OIYA 4HZUB 5IJ9B 2N46A 2JIMA 5F9HA 1Q7RA 2P4SA 1BEZA 2JFVA 4C04A 4R31A 1WDTA 1JJBA 4Q3BA 5DN6D 3EIOA 1SOVA 3MGCA 3GUHA 3R3WA 1QHHB 1T8SA 4JGIA 3E2MA 4UZEA 5HJEA 1RAGA 4KK4A 1KK3A 2K7ZA 2PL9A 4KJXA 3R8FA 3UB4A 4OJMX 3NATA 3UFXB 1CRQA 3ND9A 1OCEA 3G0CA 1Y48E 2AQ8A 1L7EA 4U2CA 1ZUIA 3BH6A 1P4RA 2QUAA 2YRXA 5CX1A 2BLLA 2JFNA 1FTQA 1K89A 3M83A 4J6FA 4DC0A 4M7WA 4EW2A 3L0PA 1WXIA 3B48A 3GA5A 2JLXA 4MQLA 2HC9A 2DECA 3ZWDA 4BO3A 1WCIA 5B1SA 3EG9A 5BOSA 3T7AA 2OQIA 1PJ2A 4F60A 1KWKA 2PVSA 1GSOA 4KVAA 4QVGA 4BEVA 1D2EA 5K0ZA 4NCBA 3GW8A 1AS2A 5EJEA 1TAHA 3MB8A 1J2RA 2B8JA 4JJ6A 5LMZA 1XZ8A 2VHWA 4TMWA 3OTIA 3HABA 1KU6A 2AWNA 4P22A 4U63A 3W77A 4B6EA 3G2JA 3Q72A 3HYNA 4HUQB 1OT5A 3R3YA 4TX1A 2NU8B 3L1KA 2CLMB 2YYSA 2C2GA 1CJCA 1PR0A 1E9SA 1O1YA 3EZXA 4U3JB 3EH2A 1T6ZA 2ZVJA 1R0XA 3LL4A 4KLCA 4QA9A 4X5OA 4OHUA 4EJFA 1CQIA 2E4AA 4K05A 3KEQA 1PSZA 1ZZEA 3I4FA 3EJWA 4ND7A 5TPZD 3U13A 2V9PA 2OXRA 3FR7A 1NJ1A 1QGAA 4JYZA 1I9GA 1JEDA 2JGLA 2QRVB 5CIQA 4UXIA 5ETJA 3OM9A 2PLAA 3R5SA 3LPAA 4MKFA 4DZTA 2P77A 3Q3GE 4V0NA 2UXCB 3CVOA 1G5IA 3RREA 1N0IA 4PLYA 3AUJB 1LPAB 2DWPA 3FPHA 4JN6B 3KHSA 5D5QA 3SF8B 4MUBA 2UDPA 2RGNC 1KZ6A 2J9FA 1E1NA 3VZRA 1IHDA 1ISPA 3RUCA 3W2EA 2GAFA 3KXIA 3DW1X 2ASEA 4G0WA 5E6UA 1OAOA 4M0UA 5KJFA 4BV9A 3EBLA 1PO7A 1QZXA 1X1BA 5AK3A 4BV3A 4LKOA 2EJBA 4DLWA 2DT5A 4MYRA 3K5HA 4G5QA 3ECSA 1ZRMA 4DYHA 4G85A 3ZS8A 1ZMTA 1QVWA 4I1OA 4CE6A 3X1JA 2V4ZA 5JFOA 3HU5A 3IIMA 1DTSA 2WJWA 1K4YA 2XB6A 3ZNNA 1TAQA 4OX9Y 4Y0NA 1P9NA 4E6PA 4M9CA 5A4IS 4W9NA 1VKOA 1MC8A 4GPZA 4Q9AA 5FNZA 1X1QA 5EHNA 3I62A 1RJ9A 2ZAYA 2JGDB 2RGXA 4G3XA 4WN9B 4ZAGA 2JI9A 2PSDA 4O5AA 3VVCA 3E48A 2EKBA 3AJ8A 3H5AA 2XB9A 4K6KA 4M0EA 5AHXA 2XVMA 2VHQA 3A6JA 4NJEA 4OHWA 1C8VB 4CMEA 1DCFA 5CH8A 4I14A 1UUFA 3TLZA 4CQJA 4D9JA 2RGUA 3ASYA 1VBMA 2F62A 4PPGA 3JASA 1C9EA 4MV6A 2PXHA 2B7BA 2GJ4A 2HNBA 1GTZA 2NX2A 2PRJA 3W79A 4EY5A 5CD9A 1M2GA 4CJXA 4BGVA 1FNMA 1UADA 1ZCJA 4YRKA 1WMAA 3EEQA 1OLXB 4O4JB 5CEEA 6ADHA 4XWGA 2ZYHA 4KIUA 1RP1A 1QYDA 2Z0MA 3EMBA 1RE0A 1M1NB 1T1EA 1DKLA 2JAWA 1ST3A 1T6BY 2X22A 3JATA 5EQDA 3LBIA 1RYEA 1WQ4A 3HPQA 4A8JA 4AULA 4UEWA 3OWHA 1G8JA 3LXRA 3S5JA 4Y7DA 4LYGA 3SHQA 5LM3A 2R1TA 4NRDA 5D87A 4FUQA 5GM1A 1J09A 2IGBA 3CR8A 2QZZA 3FNRA 4Q48A 4Y30A 3ZR4B 8LDHA 2VUHB 2GN4A 4INJA 5BUCA 4MRMB 3PC8C 1UMDB 1XZNA 4QYIB 2FPRA 4V02A 2QD2A 4RORA 4WIAA 4CTNA 1MQ8B 4N7MA 4GECA 2W6QA 1HG1A 4BHTA 1S7GA 3CT4A 3U9LA 4Q03A 2EBUA 2PD3A 5IPFA 4R8MA 2C57A 1V3TA 3QEMA 1D6JA 3VR5A 4Q4JB 1TZ2A 1W9HA 1WCXA 3M1AA 2WEKA 2XB4A 1N6LA 3S2FA 2GWRA 1O9BA 1RMQA 3Q41A 4ND4A 4TLCA 5F98A 1CYEA 1ZU4A 1VJCA 2W5UA 4LX0A 1QQTA 1MOPA 2B8TA 3WYGA 1CG6A 1TJPB 2CUTA 3VO9A 2G8NA 5JWRA 2ZSJA 4HX9A 4WZAE 2DJIA 5CXXA 2I2AA 4DPMA 2XMPA 2JJQA 3ZDZB 3WKAA 3ILSA 3MRXA 1VBKA 1M2NA 4RA6A 5ICSA 1AA6A 2YV5A 2ZUTA 3GMIA 1XMJA 2PEZA 5IWAB 5JRDS 2VRWA 3E7DA 4RMIA 4DG5A 4CIXA 1SVOA 1XALA 1ZA2A 3I5UA 5BSHA 3I3SR 1K7XB 2DTXA 5JXHA 2ZSUA 1XWIA 2G88A 2XLBA 3WL6A 1I7LA 5IDWA 2DZDA 4NFSA 1M76A 1M5UA 1J2JA 1T9GS 2GBCA 4I4NA 4BATA 4UOZA 1M74A 2FSFA 2X5OA 1BIFA 5B3JC 1Z5NA 3U37A 2KX7A 3K6SA 3T3MB 3VA7A 4BVLA 2BWJA 3TJRA 2ZYSA 3KS9A 1JHRA 3SQWA 2RHRA 2FW0A 1LNZA 5IHXA 3W8FA 1A5BB 1TU3A 1U0TA 1TL7C 1Z62A 1PD1A 2I2WA 3W7VA 2QTRA 2C1ZA 2QT1A 2YJTD 3GFGA 4JROA 1SR8A 3IDFA 5J2UA 4QYXA 5FP0A 4JZKA 2CZGA 1KXZA 2J32A 2FF7A 3N2EA 1FYEA 3CIOA 3ETHA 1JALA 5HUJA 4HSGA 1RXWA 2OHOA 3HLYA 3HO6A 3INYA 2VNSA 2IFTA 4IX9A 1L7MA 1R9NA 3U6BA 2BH2A 5EWJA 2A0FA 1CERA 4LI3X 4IDQA 3FA2A 3DOOA 3FPJA 2OG1A 3IVXA 4MP8A 5CFQA 1RI4A 5FUBA 2YXBA 2MYTA 4YR9A 3WYNA 4DV6B 4G01B 4LBZA 1FFGA 1YCHA 3KSDO 4UVGA 1W1IA 4K40A 2HSDA 1WUKS 2QV7A 4BXOB 4W8HA 1VP3A 5CXSA 1SC9A 3O3CA 3PQCA 3RC3A 3L4JA 1IY0A 4P35A 5JI3E 2Q49A 2I0FA 3MUFA 2B25A 1CVRA 1MN6A 2C92A 2FPXA 3HBFA 3HMKA 4LOIA 5EFOA 1HE1C 4DNFA 4HNUA 2JHGA 3P0IA 2X6TA 1H2XA 2A9OA 2V65A 3JQRA 4AJHA 1E1MA 1OBHA 3PRHA 4JH0A 4F5DA 3O0TA 1A8QA 2EKDA 4TV9F 4ECEA 1YS4A 4B85A 5JIBA 3E3AA 1JIQA 1Q1GA 2A0WA 1GQQA 4MTLA 3LO5A 2XE4A 1C1HA 1JDJA 2ZIUB 2PFGA 4PAWA 2MOKA 3VYWA 5G3ZA 3L9XA 3GGOA 3PC7A 4I50B 4RSHA 4UE6A 3SJCA 1T2EA 4RD3A 3RR2A 3EQZA 4MRPA 3C3YA 5KWVA 1M5RA 5SYMA 3EIWA 2H4JA 1OPXA 5F73A 1XGKA 3IAXA 1GL6A 2OPBA 1F6WA 2ZUWA 4HXYA 2E18A 4WUVA 1PZEA 1BZYA 1WZEA 3V4SA 4BWFB 1MNAA 5AKYA 5K0EA 4FOSA 3FLAA 4GZLA 3MMPA 2WJHA 1AMNA 3CUWA 3O8OA 2H06A 3GOQA 2CMDA 3IEUA 1OGJA 1XMPA 3MLEA 1K92A 3QX8A 4OFWA 5P21A 3VHLB 2V7QD 4E1VA 5CXUA 1E3DA 2PH5A 4QOIA 3KZXA 5CA0F 1ETHA 3Q6NA 4UPEA 3G59A 4RV9A 3C5VA 3DM5A 4CGYA 5AVTA 5B7QA 2ZJAA 3IMEA 3TE6A 4ETMA 3AKCA 4CNQA 3VKVA 4LFAB 1OYOA 3ETNA 1CUEA 2WBLC 3OX3A 3ZJUA 3GUCA 1GG9A 3SXUA 3NBZC 5LPNA 1ORDA 5F7JA 3TPFA 4ALNA 1SXJE 2XH8A 2YBEA 3L1IA 4YGXB 1CF9A 2RH8A 5CHYA 2IBMA 4B40A 4UUAA 4YT2A 4HDSA 4GS5A 3RGGA 2FAXA 4I9HA 4TSKA 3INNA 3F6BX 4A8HA 2IS4A 1JL3A 1MGOA 4HDRB 4AO6A 1EZ1A 4P36A 2JBWA 3RSLA 4AROA 5ALPA 3ZY6A 2CHQA 4WERA 2P2LA 2PYDA 1DJPA 3QFHA 4R2IA 3ZTYA 2IL1A 4ND5A 1U0HC 3IE0A 4LX8A 1N8TA 3B20A 1DBIA 1QOQB 4HATA 3VR4H 3QITA 3RBXA 5L6LB 1F3OA 3EW9A 1I24A 3LY9A 4J7AA 4P32A 3EEYA 1GSAA 3IQWA 4HN4B 3WRYC 4FN4A 1AKEA 4KNYA 3U44B 2WKSA 4EQZA 1COWA 3FWNA 2BEVA 2GGSA 2HPZA 4N5DA 2FSVA 1G4HA 4KIGA 4DLUA 5F5XA 5CLFA 3LE8A 1P2DA 5EE9A 5JLJA 2H2DA 1VSQA 3KQPA 1HM5A 5ALGA 4C3OB 4JLBA 4WY5A 4ZXFA 1VA5A 1RYYA 1OOEA 2O06A 2COUA 2R8ZA 5F1PA 3F2VA 1PGPA 2GMWA 3R0XA 4LV5B 4RWEA 2GEVA 1G2IA 1TCBA 2KE5A 1MX5A 1WXGA 4JLPA 4CEIA 2JLVA 1MV8A 7MHTA 3F5SA 3Q2IA 1KJIA 4EH1A 2A0YA 2WSMA 3B89A 5FULA 4I8IA 3VHRA 4WZBB 1M0EA 3NUGA 5IVHA 4FYMA 1XD8A 5SZKB 4UHJA 2ADOA 1C8BA 1R00A 3NAQA 3N9IA 4CKBA 2IPNA 1B1CA 3SEFA 3X2FA 5K7SA 3L8HA 2VF8A 3O9VA 4GRDA 4L0DA 3SI7A 5A4DA 4GX0A 3V1LA 1I2ZA 2H3HA 4UUMA 4CETA 1II8A 3U31A 1G6HA 2ZRBA 2NQTA 4IDGA 2R6FA 1NF9A 2AMVA 4I8XA 3RC2A 2Q1XA 1TCUA 2B8NA 1PS0A 1A5TA 4W5WA 1N3YA 1N6KA 2IPOA 1O97C 3WDKA 3E4CA 3JQBC 1KYIA 2FSVC 2B1IA 3ASZA 4RMNA 2BGMA 2EF1A 2A4MA 4GPIB 4IMIB 1Y6QA 4D3FA 2EVWX 2WU8A 3VDNB 3NONA 5A05A 5AHWA 5DN9A 3GLIE 1V2HE 1VIAA 1H5NA 1MRZA 1U1GA 4GR4A 4IRUB 4PAMA 4X97A 1NJ6A 2YVUA 3O1JC 4NE7A 4QVKA 2IPLA 5ESXA 4FQ5A 1XEXB 1MDBA 2VDQB 1EBBA 1A9TA 4FDUA 1M1UA 3F4KA 4IOJA 2RK4A 3WLIA 3ER9A 1YK1A 2D62A 2J5XA 3DLIA 3DBHA 4Q1AA 1FB5A 2ONJA 5JH7F 1ZI6A 2IEYA 2X2OA 3ESZA 3U1TA 1Q95A 4FHFA 3GVCA 3O1HB 2FVXA 4B6JA 1PW7A 4ZYTA 3AHGA 3DLHA 4Q4HA 1GQFA 1VHJA 5JC1A 4RD6A 4JUBA 4YXWD 1H2BA 3O6VA 1VBNA 3DFFA 4ZRDA 2P0AA 3RU3A 1NRJB 4CM8B 3VR2D 3KZKA 2A5YB 4A91A 2BFDA 4Y2RA 1KY4A 4MKRA 5HGJA 4B4WA 1PV4A 3D4PA 2A78A 3L7MA 4Q1FA 4L8VA 4MV1A 5IBQA 4DJDC 2BGWA 2KWIA 3AXSA 1JH9A 1J1ZA 2VJQA 3VH2A 1YFKA 3PHIA 3CS3A 3QLTA 5A9TA 1TCAA 5B58C 5AW1A 3BD8A 5GOTA 2XIJA 3PSHA 3PQ8A 5E9AA 3H2IA 4PR0A 4JVNA 2H52A 4N47A 2QRPA 5HIKA 2QR3A 4CIYA 3L6CA 3AYXB 3GFQA 2FW1A 2J7PD 3ZLBA 4PN3A 821PA 2DHEA 1CEEA 3AEKB 5L45A 3R20A 4R6WA 4R8RA 1V9SA 2G08A 1B0PA 3K5WA 4JJEA 2GPWA 2MSNA 1JQBA 2WAYA 3C8MA 4OOFA 1YL6A 2JGNA 4PQRA 2IYVA 4MWTA 1IIRA 1KEUA 1KPIA 2FJUA 3SIWA 2GD0A 2OLJA 4FKBA 2AFIE 3F5FA 3L0OA 4XQCA 1A98A 4C9BA 5LYJF 4RYDA 5C8ZA 2FUG1 4KKXB 1IM2A 3ENVA 3VUEA 4F8YA 2QRKA 4J43A 1IN8A 2WWYA 2GEKA 3O8BA 4KYIB 1YVUA 3CNEA 3E1GA 1PRYA 4CIBA 4E4TA 3HKBA 1DJQA 4LNUA 3GZJA 3WWYA 1QANA 3FTCA 5A0VA 4XUCA 1J70A 3LQ4A 4OLBA 3V4LA 4Z1OA 2HDOA 4OAPA 2PNFA 3NGXA 4C4PA 3KQNA 2G6TA 2H9IA 1FFHA 3QKUA 1FQOA 2GAJA 3D7KA 2BHNA 3E1KA 1C81A 1RRPA 3B9QA 5DE3A 5FA6A 4B0PA 3F96A 1NX6A 3Q15C 1AQ6A 1Z18A 4ETNA 1SQ5A 4RTJA 4KQJA 3B70A 4OJTA 1GA1A 3WLRA 1G7SA 3E9CA 1N2EA 4D46A 4TM7A 3RYHA 2CYCA 3D7NA 3NHBA 4PGAA 1AD2A 5I47A 4A5SA 2BFFB 3ZD7A 4C0QC 1I94B 2L82A 5J4KA 1NZFA 3A0RB 4GLLA 1G2OA 1Y63A 3G2PA 2Q2VA 3LCJA 4X91A 2M6KA 3A3YA 4DMRA 2GEUA 2IU0A 1V95A 5FI5A 1TYBE 2WR8A 3GAMA 3CNBA 4UHBA 4L0CA 2FXVA 5EWMB 4PEVA 4E08A 2ZYAA 1Z6PA 4ZVRA 1NVWQ 4JUDX 1SUWA 4O4LB 4Q3EA 4F38A 5C8YB 1WV0A 1KYVA 1QYWA 5CDHA 2WNHA 4TS3A 4F86A 4HBGA 2P41A 1ZFNA 1M6VA 1XDUA 2GK6A 2GPYA 1XB2A 2QUBA 4TLAA 3SJZA 1NE7A 1QVAA 1TK2A 3RS4A 4B3GA 1RTKA 1YIOA 2O1EA 2JKZA 1TM4E 1QZ3A 3EAQA 2Z2IA 1EPUA 3QVMA 4PQEA 4XTCS 2XXAB 5CCBA 2MJLA 2JGEA 2B2NA 3AP3A 2WV7A 2Q9BA 5KIAA 2OO7A 1HTWA 1KYYA 1DP4A 1WUJS 2J3IA 4II7A 1X1SA 1H05A 3A1CA 4QWWA 4GZ5A 4B4UA 2QENA 2XYVA 2ATIA 1V4VA 3O4VA 2QMZA 1VM6A 3CCBA 5IUJC 4QGHA 5C53B 2V7PA 5FWXA 1ZK1A 3T9AA 1MEEA 3DZBA 3MVEA 3GCZA 3PWZA 4JLAA 1G21A 4M6WB 2QTBA 4EG0A 4ZYZA 1A9XA 5GQSA 1WEHA 4C14A 5JNUA 4D96A 2A59A 3C7AA 1ZYUA 2VBFA 4DKJA 1FMJA 4ZIRB 3DUWA 1AKYA 1L5MA 4BYGA 1E2KA 2XRMA 2DC1A 1RT9A 3IDOA 3W6ZA 4NULA 4QUHA 2CUNA 1XO1A 1YR9A 3BCRA 4YCCA 2QAGA 1WF6A 4KW7A 3W2HA 5FUVA 5BW5A 5MHTA 1PFYA 2C2ZA 2H08A 4BXOA 3L6RA 4BN5A 2AK2A 2VDOB 1QJCA 2RHLA 2Y1FA 1GPLA 2NV0A 3AFNA 3AEXA 3IP6A 4IQ0A 4L9AA 4RHTA 5KQSA 2XDWA 1KYQA 5I7UA 1R15A 1DWPA 1V6AA 4TYMA 1W6UA 4OREX 6Q21A 1AXEA 4M1YA 4GO1A 4BU0A 1Z2EA 1LQTA 4MUKA 3UK2A 5AXBA 1D1SA 1UZUA 4TTRA 4OGKA 1GZ4A 4PGMA 1QWOA 2ZVDA 3RUEA 4HS9A 2B3DA 4C20A 4DNOA 3IV7A 1V0JA 1C7RA 2HGZA 5JCOC 1WVMA 4CXMA 3C3JA 3G5MA 5H02A 4X85A 4ZREA 5ECDA 5M5BA 1OXBB 3GT0A 1QRRA 2IYQA 2Q7XA 4KH0A 1E3LA 1L4MA 4V38A 3AVTA 2XQVA 3D3KA 1IZ9A 4U7HA 1EX1A 3UAGA 4KGVA 4Z1MD 4D42A 4JYCA 4HEJA 1DG3A 5AJXA 4BC0A 2GZAA 5B1YA 1ZR4A 5H3HA 1JEQB 1FNDA 4PC3A 1XVTA 2YJ3A 2YV2A 4G8JA 4OF4A 1O0CA 1JZTA 1FNNA 3KVYA 1Z7WA 1EUCA 2Y3IA 3QWBA 5EKXA 2DTDA 6PFKA 3HKEB 3C6XA 4PS1A 3HLKA 4U2KA 1DAMA 1RADA 2CCKA 4N49A 4B7XA 4TZ6A 2HWYA 3O8QB 2HO4A 5IAJA 1F8XA 1MOZA 1HDGO 1SCKA 2BF4A 1YWGO 2QTAA 4CMIB 1I5OA 5KX5A 3UFXA 2D2EA 4AJLA 4MB2A 1G5RA 3IKVA 5KEIA 3SJBA 3L06A 1Y82A 3FRJA 3O92A 4JX8A 3DKIA 3VR0A 4CDGA 2GARA 1JQLB 4QE3A 4ZIRA 5KC8A 2V0NA 4B74A 5LXTA 3RRBA 2CWDA 1GNSA 3E9NA 4MR8A 4HH0A 2DCUA 4OQXA 2O8NA 1PCXA 5A3RA 4HF7A 2FETA 5CT9A 5C4GB 1NVVQ 2AN4A 5J2UB 4L4SA 4NHOA 3ROZA 5KOJA 3HGQA 3QEKA 5AI0A 4HUJA 1XEWX 5A1TA 3KEGA 2QE7A 2ZRGA 4PM4A 4F56A 1W0KD 2GA9A 2C3YA 3E0XA 3QBTA 5JHGB 2J9XB 1M34E 4COKA 2FMUA 4KOEC 1BH2A 2TS1A 3OZIA 4WKPA 5BSWA 2QKYA 5EP2A 4EKYA 1YOBA 3RJMA 3ZG6A 1FDRA 1K8ZB 4PHTA 4EBFA 3IP9A 4Y2YA 3CFYA 4AX8A 4CF7A 2H4ZA 1L5OA 1K7YA 3D0RA 5AI5A 1VTKA 1KI4A 1ZHOA 4Z7NB 4KN6A 5CG2A 4JI3B 3EXEB 4ZKDA 1JNYA 3SYRA 1IHPA 3A3PA 2X5NA 3LRXA 2FGJA 5FL3A 2R4QA 4JP1A 2NZXA 3FWYA 1HPLA 2BPOA 2NTJA 4M53A 1Y6RA 4RZ3A 2YV4A 3O1LA 4EA7A 5HZKA 2HSGA 3HJUA 1MFZA 2H8KA 5KTRA 4OQNA 2H63A 2QTWB 3VTZA 4CMGA 4MI3A 2FRDA 1JT9A 3DB1A 3RFUA 1FFXA 3I12A 4DNQA 1F5SA 5C3MA 3AFGA 2WF5A 3GQBB 5B1EA 4WEOA 3NTQA 1R4ZA 4Q7LA 3B1FA 4BASA 1PE0A 4D9KA 5LMUB 1QTIA 4WOPA 2II6A 5HRUA 2AJLI 3X2EA 4C4XA 4Q4DA 1NI4B 2OCDA 2PGJA 2CV1A 3HZOA 1AB6A 4MGYR 4MLDA 1T5BA 3WIEA 1P2BA 2RAUA 1QIMA 2WA1A 4HGQA 2EDAA 3TOVA 1F9AA 3NAZA 3F49S 4J9UE 5DO9A 1HV8A 1W5EA 2A1UA 2DR3A 1BE1A 3WIVA 2QTNA 4INPA 1OFHA 1TM5E 1TVEA 4OAQA 4YHHB 3NZEA 1NU8A 4GI2A 4GR9A 1RQGA 4V0SA 3NHRA 1L5HA 3KB8A 2YZMA 4YRFA 1L8LA 4DRXB 1GTRA 4M4SA 2Q99A 1DO0A 3DYVA 4CG2A 1H9AA 2J1LA 1OJ7A 3OZFA 2JHCA 1OWNA 3RAFC 4OIFA 2J3MA 1U4NA 2ZR8A 2R11A 4RHCA 4NU8X 2QSYA 3D8SA 2ID7A 1HBJA 2BEUA 2C3PA 3VYTB 1B16A 2J0QA 4HNRA 2TECE 4IDHA 2NT4A 1A4IA 2OGUA 3ZD9A 1DKQA 1GNLA 1KKMA 5E9JA 1Q16A 2QX7A 4FZJA 5LP6F 1U31A 5BN5B 1E4VA 1I5EA 3JPWA 1IY8A 2FSGA 2P35A 2WG2A 5CW2A 2P4EA 3KNZA 4HAWA 4OGGA 5KQRA 3K8ZA 5LLSA 5G1NA 1F8YA 2GZHA 5DBIA 3N1UA 4J9VA 4V24A 1N0VC 2CGEA 2AJCA 1UPTA 1UJCA 2H54A 2QVLA 2X9LA 3IEXA 2G63A 4NYIQ 4ZI7A 1DUSA 1S7CA 2CMHA 3U17A 5JARA 3PPXA 1ECJA 4H27A 4E5PA 1P6UA 1TUGA 3ZH2A 1JR3A 4DRYA 5AJYA 3KK0A 4HD8A 4MUAA 1M7GA 1OBCA 3QBEA 5ICGA 1FQKA 1P7CA 4C0BA 1EUYA 2R5NA 3L1JA 5IZ4A 4RY0A 2J0EA 3JZIA 4TRMA 3IURA 3L7CA 3M5DA 4EY6A 4C05A 3MFYA 3HVRA 1D1PA 3WQBA 2C5AA 4CKEB 2XKKA 1E9CA 4K6CA 2EEPA 1E3WA 5EMHA 3VNUA 3ICEA 4ZOLF 4EPVA 1P2SA 4WASA 4IYRA 4URYR 2YJZA 2YV3A 3LDHA 1UKAA 4DA4A 1EB9A 4ASUA 2G72A 1PX0A 5F23A 1BXGA 4REMA 1FRNA 2OESA 1Y6ZA 1VMIA 4MWDA 4DCSA 1GG8A 4CEIB 3GG2A 4FI3F 1YS9A 5CB4B 5L4LA 4FHZA 4WKBA 4H1HA 1WO8A 2Y93A 4AYTA 2Z3ZA 4QGFA 1D5CA 5DW3A 2UYYA 5MDHA 1NSFA 1NFQA 4CNBA 1DI0A 4I5GA 4N8SA 3LHKA 2FMXA 1KYWA 2O2EA 4U4AA 1SOUA 1V41E 4UU0A 1DV1A 2BEJA 5A7GA 2WLTA 4XQ9A 3OU2A 3FTNA 4MUIA 4J7XA 4QAQA 3ER8A 3OLWA 4RKFA 4UOEA 4GLOA 2FWIA 3FUXA 4DLVA 1GFZA 4IWYA 4QG7A 4Y2PA 4RD0A 2YJGA 1HQCA 1QR6A 4QYWA 1CIPA 1CIVA 2E6KA 1GR1A 2B1JA 4H17A 1P6QA 1JQ3A 2JIZA 1UXOA 3N2YA 4JBLA 1W4RA 3RFTA 2JCGA 3PUJA 1Z4MA 5CM8B 5K51A 1QYIA 1B26A 1WQ1R 4KXLA 4BEBA 2XKJE 4YPOA 5KQLA 3SEQA 4MW1A 3AO0B 4HG2A 3PXGA 1TMYA 3VNRA 4I5DA 4JXJA 4HLNA 1W5TA 1L3IA 2XW6A 3IUJA 2D13A 3IIKA 3M6FA 1IWPB 4JVLA 2UZ1A 4M9ZA 4X6UA 4BMYA 3RHFA 4BNKA 3AV3A 3BZWA 1XROA 3FI0A 5T8KC 1LJUA 4AU1A 3MIZA 4I08A 4AK9A 1Q3TA 1NA5A 4KYVA 3OQHA 1P73A 1LK5A 4BRUA 1QKJA 3A7EA 3G9XA 5BMVA 3DE2X 1JJIA 3KZMA 5IVIA 3S5UA 2G7ZA 1E2EA 4F1KA 2XVAA 1DJLA 1X3LA 3AOGA 5DLQC 4TLMB 1K8YB 2HD4A 1UK8A 4TV9B 1X19A 3PYXA 4LK3A 4XWYA 2Q9AA 1P9LA 3D8HA 3WLAA 4US1R 4B3MB 4IJWA 4TYPA 1NTRA 2EQBA 4YALA 1X2EA 1CNMA 4E4YA 1NP3A 3TPCA 3RAEC 4WOJA 3U4QB 2D3TA 3EQ8A 4IDPA 4R1SA 4AF8A 2OQRA 4CYMA 1ZK2A 5F77A 1SUIA 2PUHA 4NV1A 5EGNA 1KAQA 2FDXA 4D0NA 2OUIA 4H0FA 2RHGB 3JQAD 4GX2A 4I2NA 4L15A 2Y8EA 1Q0LA 1DT5A 4YX9A 4PXAA 5I48A 2AYYA 3AW8A 1UL1X 1KI8A 3LUPA 3ICCA 5KCZA 3U09A 1TJYA 1ZSNA 1W76A 4EHAA 3Q0IA 5IT5A 4XYMA 4WKOA 2FJPA 2OYSA 1Z45A 5DXAA 2BFFA 1EVJA 5LVAA 4YNBA 3T94A 1USVA 3LDGA 4G0PA 4RVFA 4YUAA 4REQB 5DM60 5JEEA 2C99A 3QYPA 4RYLA 3ZHRA 2RGWA 4IHJB 4TYYA 2BUAA 4FFSA 2GM4A 4FYHA 4PZYA 1QYRA 1E9EA 3N2KA 1BGVA 4LCBA 2R25B 3H4IA 1ZHFA 4RKYA 4Z7QB 1BS1A 1CQXA 3CLSC 4V0ME 1OXXK 3DJFA 1W581 2AOVA 1TK3A 3F1LA 2FOXA 1CR2A 1XRNA 1KMCA 2R00A 3AETB 3GGPA 3NJ8A 4H4DA 5AKZA 3TIVA 4F4HA 1GKYA 4G4SO 4LBVA 4PCUA 4RD1A 3KUUA 2WKRA 1SZDA 2QAIA 3OUZA 3DAYA 3I52A 1Q0HA 4QBGB 3L9WA 2HLDA 2QOEA 5FUMA 5FWYA 4U2EA 1GGFA 2EV9A 2FFJA 3FOFC 3N2ZB 1S02A 4B3SB 2HRRA 4QLAA 3USES 3WK4A 1NXXA 4RY2A 5JCJD 2WJAA 3DNMA 5AOBA 2R9VA 3DMTC 3PE4A 1QVVA 4PHFA 2JIOA 5ITSA 3C3CA 1NQUA 4Y2TA 1U8YA 2F9FA 4AP9A 2V59A 5L7TA 4F9TA 2NYUA 5ILGA 3DOJA 3E9RA 1C0EA 2EQAA 5LWHA 1DCMA 3JASB 3RUPA 4Y2XA 1UM8A 4WZ6A 2NQ2C 3OY2A 3AM1A 3ZQ4A 1TX4B 5HQTA 2CHFA 4J0DA 3ST7A 1ZMOA 1U0LA 2Q8NA 3SY8A 2ZAMA 5INTA 4EX7A 2G0NA 3VX3A 9ATCA 2J6HA 1ZSVA 3BK7A 1GZSA 4R5MA 3A70A 1W5AA 4C0WA 1ZRSA 4CR7A 3LF1A 4Y0VA 3TGLA 4ED9A 5CCEA 4II3A 5K45A 5I7SA 4XQGA 2JH3A 4MRMA 4PAGA 1WB9A 2X7HA 3DBLA 3I6ZA 3OQJA 4YJ3B 3FCAA 1XHLA 2E7ZA 3N05A 2ZIVB 5EEGA 1HK7A 4GYWA 3OZEA 3L0CA 4RENA 2O5EA 5KYXB 5AM1A 4I4TF 1ECBA 4PO8A 2OYRA 1P0QA 3T3PB 5M2QA 3HEBA 4O4JF 1LBHA 1HDOA 2FVYA 3TEFA 4F72A 3OQOA 4ZO6A 1P0FA 1AXGA 2QM8A 1DJNA 1MB4A 1RBMA 1YRYE 3GUVA 3OCXA 1Q74A 2AEEA 2AD5A 4C6HA 5KYKA 3THWA 1OD6A 2LVBA 2DX7A 1GQOA 4DDKA 2NSDA 1EFPB 3KR2A 5CP8A 3RI3A 5HIAA 5G53C 2D54A 3KSBC 1FUIA 3MOSA 3TCKA 3R7WA 1MVLA 4IGKA 1PR2A 3ORHA 4RHEA 3L0IB 2XRZA 2X3FA 2XE6A 2QTZA 4JEIA 4N5HX 3SR3A 2PEYA 5K0CA 3HDHA 4IF4A 1EP3B 5AK6A 3BIOA 4DCPA 1ZAYA 1OLUB 2Y67A 3KOYA 4IGFA 4C4YA 4Z49A 1J5XA 1Z12A 3A4NA 3DZKA 4CEJB 5DTIA 4MCIA 3QQ5A 1FPMA 3ZBPA 3K70D 1OWOA 4AG6A 2ZYWX 4ZDJA 5I9IA 2Q2NA 2B5WA 1HWYA 5EUMA 4ARAA 1AQUA 3HCEA 1URPA 3COYA 3D7LA 1CBUA 2HLNA 4RMGA 5EIAA 2DT8A 2FWJA 2FRXA 2PTHA 4XXHA 1T34A 3GLGE 3G0BA 5DGDA 1FF9A 5FPQA 3NBXX 1T4CB 1UBFA 2Z5LA 3ENWA 3SHWA 4OXKA 5AQ1A 4DLZA 1ISGA 5TV2A 5HZGA 1W87A 4HGZA 4GMGA 1DFHA 2DUMA 2CNWA 2AG1A 2H65A 1IWBB 1ZK3A 2QDXA 1RWMA 2JK0A 1RAEA 3FPEA 2BKXA 3WL5A 4RJ2A 3JQDA 2FP3A 3H11B 3OSZA 3EASA 3LW8A 2ZI4A 5E4YA 3TIGA 1ETUA 4PO9A 4C1BA 1ZD9A 2BGRA 1J0BA 4AQDA 5EGSA 4CM4B 4BNIA 1DBRA 5C4MA 4FVTA 4J6EA 4QEKA 2OP1A 2WIDA 1Q7GA 1VL0A 2FR0A 2Z6VA 2IYRA 3CUSA 4JT9A 4AF7A 1XKLA 1HYHA 2LNDA 4KC0A 1XXLA 2IPMA 3WB0A 1JWLA 3TJZA 1TUBA 2I7TA 3TS1A 1USGA 2LIVA 5LQCA 3WK7A 1CQJB 3LWBA 4L8YA 2QIPA 4LRUA 3V4OA 4DUGD 2POCA 2VBCA 4S05A 2HPHA 4TXNA 1OU4A 3HSYA 3UMVA 5ADHA 3QV2A 4KHZA 5FI3A 2AHOA 1FK8A 2QJFA 4FMBB 3WMWA 3U56A 3G9UA 4P82A 2HIGA 2O3QA 4OI2A 1RYMA 1P4AA 1NZJA 1Y0BA 5TQ2B 1MUUA 1EZ4A 1LLCA 2FXIA 2PZLA 2ZJ0A 2JBAB 4OK5A 3C7CB 4F3NA 1SKYB 3PENA 2D0OB 1N4AA 4OQZA 3CX3A 3T4UA 2BMAA 2FEMA 4YRBA 1Z33A 5AW9A 1K9SA 5ITVA 2IHBA 2O4UX 1PGJA 2K87A 3DLAA 1EP2B 3LP8A 4EX6A 2QZSA 3B6MA 4BE4A 2RD2A 4TTTS 1NUUA 3BMCB 4AKEA 3AX6A 4LF6B 1KRXA 2B21A 2R7NA 1J49A 2P1ZA 1JFLA 3ZVRA 1L6IA 4HQ0A 4ITVA 2XQFA 1SC4A 1JAYA 1GRVA 2VN8A 3VR3A 1PAUA 2RJOA 1F6BA 2ZSEA 2MINA 3ORFA 3NPAA 5B64A 1GZ6A 2PFKA 2PSHA 1PZMA 3HMQA 1M1ZA 3EVZA 3H8SA 4UW9A 5FFMA 4C7BA 1M5TA 3UC5A 5I4BA 3VO2A 4X45A 3ZS9A 5DM4A 3FZEA 1A88A 4X1IB 4O3FA 3D59A 3U39A 2ZM5A 1C14A 4KQCA 3AIIA 4IG4A 3ICOA 1VHQA 1W1WA 1DVRA 1NQWA 2IOQA 2PKWA 4BO2A 2CNLA 4GICA 1QV6A 2GM3A 4L8GA 4HUTA 4D25A 4C7JA 3ZW9A 1H5QA 2WFLA 2QSUA 3UT5A 1D4ZA 1G42A 2X4GA 5I45A 2PX3A 2WRZA 4HLCA 3AGPA 5D00A 4AUKA 1O8BA 4L51A 3P26A 1DUVG 1R0CA 1Z17A 3BB1A 1LF5A 2JFBA 5DNEA 2NUTB 1ZWKA 4PYQA 2F67A 4JNCA 3ZEAA 5L3QB 2CXPA 4XFDA 3LKBA 1E3TA 3W5AA 1O57A 1QHHA 4E2YA 1DQRA 3PUWA 4M83A 4CUJA 3AR3A 1AOXA 1J8MF 3QOWA 4NCNA 3EC1A 4PZ9A 4EHIA 4P5PA 5BP7A 1MJNA 3EIFA 3L8CA 2XTNA 3NGMA 2J3HA 4FX5A 4DV1B 2O8EB 5LQSA 1E9BA 5CDTA 5AVSA 3IOCA 4LJ4A 3MWEB 1TGYA 2CNOA 1PYOA 2ZWIA 1FC0A 5BUZA 5CVEA 4Q1BA 5I3CA 5JPIA 3Q8WA 1LDMA 3VVMA 3OZVA 4KE8A 5LLDA 3H2HA 4E3WA 1U4OA 2HMSA 4DMHA 4BFLA 4TKLA 2AD1A 3HKEA 1EXVA 4XM1A 1NFFA 4X6XA 4CF3A 3LVQE 1APBA 2JATA 4ND2A 2QQ5A 5ALRA 1BROA 3WWEA 1XZKA 2ZFUA 3DMPA 4RLFA 3R74A 5DCUA 1BX0A 2QMEA 1J0XO 1X87A 1NN3A 1MIHA 2H85A 4EB0A 5JBNA 3SNHA 2I6FA 1DRVA 2VLIA 3VNBA 3QW2A 3EHEA 5KVAA 4J0HA 5LP6A 3A1TA 3CRVA 4MR7B 1P75A 3C24A 2QM0A 1E7SA 1Z6ZA 1EUZA 1LV7A 3C6YA 2RGEA 5M3BA 3OQ6A 1LDYA 3RF7A 1WM1A 4EHLA 4KPUA 3S29A 3IXMA 5KTNA 5KTTA 1JR3D 4BGDA 2XTZA 3IB3A 3VPFA 2REQA 4Z9FA 2AOUA 2O6HA 3TFQA 3HCAA 1UC5B 1B0UA 2BM9A 4S2EA 4WY2A 3UWSA 3VR6D 2JDIA 3A06A 2IS1A 1RWXA 4N1AA 2WP0A 3R7SA 4EW6A 5J47A 1ZVMA 1LWNA 2CLOB 4G1UC 4M86A 3LGXA 3RRXA 1DO8A 4TTPA 1I0LA 1KNQA 4HZGA 2VDNB 2Y0EA 1QE0A 3WO0A 2R6ZA 3H7AA 3CCFA 4F9FA 2CLFB 4GXTA 4EYKA 1FSPA 4G2NA 4QDKA 1GPJA 4S12A 3PWTA 2DBVO 3BB4A 5IDYA 5HR5A 2PGXA 2EW8A 2ZULA 3FIJA 4JLWA 3VOBA 4DCNA 2C59A 3C85A 3AG6A 1C9MA 3KIPA 2PA3A 2EJUA 5JFGA 4Z9BA 3I28A 7ADHA 3IYLW 4NMXB 4JBNA 1EWRA 4F3YA 1Z6GA 1MVOA 4HEA6 1HYGA 4AUEA 2H8GA 3IS3A 1XZFA 4E1AA 5B4TA 5JQGA 3NYRA 4KLRA 1INLA 2EJCA 3HS3A 1PHRA 2V6MA 4W4TA 5IFLA 1EK0A 2TRSB 1H0HA 1W73A 4EA6A 5LKAA 2IKSA 4OXYA 4CIAA 1KKUA 1XK7A 2B36A 2XWPA 4P3XA 4D1YA 5ICEA 3MTAA 1PT7A 3U5ZB 1G0OA 2HM7A 3LWNA 3OOSA 3AHEA 3HUDA 3QU9A 4KFCA 1T1JA 2VUTA 4FWTA 1JKXA 1DIGA 3LCVB 1CUIA 1F6DA 2QNIA 5EQTA 1P45A 5HUQA 1Q19A 2BF7A 2DKNA 1AV6A 3DLTA 4Q0MA 4DPLA 3THYB 3WNZA 2Q0QA 2ZWMA 2BFBB 1C4WA 2VYND 3Q2KA 4D9EA 2YYAA 1QOZA 5K0GA 1GYRA 5CBKA 1A2QA 3B82A 3OIWA 2NOAA 3RS3A 4M1SA 5DBOA 2CB0A 1HE4A 1YHZA 3BSYA 3C48A 4N0QA 3WYAA 2JL1A 1KZHA 1PV1A 3PEWA 1XJCA 3KQTA 3N76A 5A2QA 1X7HA 1XTUA 2IK8A 2O3TA 1L8AA 2O6LA 2QLTA 3MBKA 1GTJ1 3NKLA 4MQBA 4MMYB 1Q20A 4PQGA 4R8LA 4WNAB 4XB6B 3OCVA 3ELWA 4GEKA 5CM9C 2PZBA 1XYVA 3ZHQA 1Y1QA 1SXJD 1XCBA 5KSYA 3P0HA 2GESA 2O8FB 1Q84A 3INGA 4JQOA 3SEAA 3ROGA 1YR3A 5CJJA 2A67A 4FILA 2IY7A 5HKBA 3NEAA 4PG4A 2A7XA 2NP6A 4EMUA 2HBYA 1FP6A 3OSUA 4FOPA 4E2FA 4H7EA 3SFTA 2FFBA 1G6OA 1N3BA 4H6VA 1NW3A 3MJSA 1SUFA 5HDQA 2IYYA 2AI2A 4NWIA 3TQOA 5B2FA 5JADA 2KBFA 5LXTB 2FWMX 4WJLA 1MZVA 2Z8ZA 4DEYA 4UMVA 1EA5A 3QMVA 3NHYA 3D2LA 4HQOA 4Y6LA 3S1AA 3BREA 3OZRA 4LMRA 1ZRNA 3MFQA 1RI1A 3ZOZA 1CC1S 3ZXUB 3R76A 2PCLA 4RVHA 1QDEA 2O4CA 3LDUA 3NOXA 3O0DA 3QXCA 1XTZA 6GPBA 3GGCA 1OLSB 2O8VA 1HY3A 1Q14A 4Y6SA 3RWBA 2IF0A 1LLUA 2YW9A 1EE2A 4LOLA 1JW9B 4HBZA 2AZTA 5F4BA 2NZ8A 2YZNA 1SCIA 2PQ2A 5AM5A 5HIJA 1OVMA 2QUKA 1IC6A 1JVBA 3GNLA 4EGCB 4K1XA 4P3OA 4AZ3B 1TA4A 2HLHA 1F60A 1JLKA 3P9SA 2P9JA 3JARB 4QUBA 3I9V6 4DIDA 2QI9C 2P62A 4MKIA 4AM8A 5DMXA 3LY8A 2RGDA 4LHXA 4AJNA 4NZZA 5GONA 1PHPA 2VT7A 3P7MA 4G8DA 2QEQA 2GZ2A 4U7TB 2OL4A 4HDKB 3PPYA 4RQAA 5CGQB 3PL1A 3PVSA 4KG7A 4B81A 1RVDA 1KY2A 1UBLS 4ZT3A 2NVWA 1J1IA 1Z07A 2QROA 4QQ8A 4KREA 1V45E 4G84A 4AG3A 1U9YA 3M1YA 1X7ZA 2ZRJA 3LAWA 1XMXA 3KXDA 1LW7A 5EIBC 4BRSA 2IYXA 5ALTA 1WLYA 5CT6A 2FG5A 1E2BA 4EEZA 5H59A 4A0HA 5GINE 3N53A 1ZCZA 3QG5A 5ELMA 3WQSB 2AYZA 3GAZA 3P9ZA 1Q83A 1EJBA 3GVXA 5B7PA 3KXPA 3Q9LA 2ZB2A 1QRAA 1Y7TA 1YR8A 2VDJA 2P7HA 1YT5A 2C94A 2UVQA 4QQKA 4B34A 4GDMA 4BX2A 3VYRB 4DQLA 1LBQA 2P2NA 3VZDA 1KI6A 2RK3A 4LWQA 1UH5A 1JMYA 3A31A 1U0FA 1NM5A 5T6BA 4CUZA 1J2EA 2BFPA 3EOAI 4L28A 1W34A 3JALA 2HTEA 3I9JA 1TQDA 1XG5A 3H4TA 1PWXA 4KRYA 5AXDA 3VRHA 1ONPA 1ZNXA 4AL4A 3ADBA 1ZX1A 4DM3A 1NLMA 1ZVKA 2R7KA 4YR7A 2EFEB 5KJ1A 2WD7A 2HZBA 3BWEA 4FFBA 3ZNPA 4BKPA 5KX5F 2V0GA 4HAOA 1Y89A 2C5HA 1YDEA 2N42A 1R5JA 1FQJA 4W5HA 3DDHA 4KITB 4KACA 4PONA 4F06A 3OP4A 1C1XB 1PQYA 3TEJA 2XXJA 1E61A 5JNWA 2NSHA 3SS8A 4K2HA 2YWEA 4RHXA 3GVIA 2X9VA 3DDWA 3GRKA 1XDDA 5AUOB 4B44A 2D5IA 4AJ2A 1P7WA 2O3RA 4EUHA 2AL7A 2WVHA 5PGMA 3NS7A 1GGNA 4I5IA 1K5PA 3WRXA 3NHFA 4ZZIA 4BKOA 4DB2A 1PT9A 3B9BA 3UAVA 3STWA 3I2JA 4R0VA 2PUFA 1KDOA 1KBOA 5FI1B 3UJNA 5HF9A 4YJHB 5JCOA 1YFLA 1VC2A 5ALWA 2RC6A 1JIJA 1XRLA 3LM8A 3W5BA 1R0LA 1OLXA 4O4JA 2R68A 5G02A 1VE1A 3NDRA 4WXHA 1NN5A 1CF2O 1NXVA 1U28C 2VK2A 3T9FA 5SY4A 2WMOB 1LPNA 2PKYX 5FPHA 1C80A 3HCFA 4TLBA 3CR7A 4AMVA 4XDHA 4DV2B 5EVCA 2PK3A 1DTWA 3V33A 2G77B 3CMMA 4IW3B 5C46F 5A9RA 2LCFA 4GP9A 4B0OA 3GJ6A 1L7VC 1EJ0A 1OA1A 1RKQA 3DMYA 2WVJA 1P44A 5ALQA 1I13A 2X2PA 2DY0A 1AHNA 3H6GA 5DTJA 2CJYA 3IEVA 1EESA 4LBWA 4UC0A 1E79A 2AGVA 5EN4A 3TAXA 1T15A 4DRZA 3N8KA 4MHTA 4IJQA 2DWQA 2H1OA 1KO8A 2ADFA 2JH8A 3UJDA 4N5LA 4LMBA 5D3MA 1JDBC 5JPCA 1SXJB 3I37X 2GSWA 2YX1A 3PL5A 5CVDA 4A03A 3P2IA 3FHJA 3ZWCA 2HBQA 2B1GA 4NV3A 2R97A 1SRQA 1Y33E 3FHCB 3M6MD 4ZHQF 1I2BA 2JAOA 3CCCA 3AUSA 1Z2OX 1PR1A 2ZYRA 4MQFA 5ERXA 2XMCA 3I83A 4RM3A 3I4CA 3ROPA 4DY4A 3V4RA 1ZNZA 1UJ5A 2DWCA 3NDJA 4JL8A 4RIFA 4MIYA 1ONOA 2O05A 3D6VA 3EIHA 3HCNA 4PZ0A 1ZUHA 4AO8A 2HA2A 4Z54A 3PDIB 5DBFA 1PNQA 5L7WA 5CFPA 5IX8A 3IKLA 1NAHA 3L8MA 4J3FA 3Q5GA 1DAKA 1I33A 3CW2A 3I8SA 1OY1A 3X1DA 3PKJA 3QF4A 1J7JA 4NOMA 1TYZA 4MJ3A 4N0PA 4BZZA 1E6LA 3P94A 4W7IA 1CB0A 4TXHA 1RI3A 2ORED 1GTL1 3BMQA 3CUTA 4RHFA 5AW5A 2IU4A 4J1NA 1AGXA 1ZH8A 3VSEA 1MRSA 3T54A 2P2DA 1X14A 4NXNB 4YRSA 4KDRA 2Q9CA 5IW8A 2EG9A 1GNQA 1FUEA 1P3Y1 2Y66A 3EOZA 3JQEA 5DTQA 1F14A 3ZNOA 1MW8X 5B2EA 3QWIA 4IGIA 2EP7A 1IVNA 1KQPA 3OOHA 4CHGA 1H65A 3KSZO 4MR7A 5L3RA 1E69A 4QPDA 2RGCA 3LRPA 5DYYA 5H1YA 1P2FA 4RC9A 1D07A 1DQYA 4RPHA 4Q9JA 1A9YA 3PP8A 1P7YA 1T1RA 4P6VF 2FR8A 1JXOA 1ZG3A 4RJKA 5TC4A 3S2EA 1IK4A 3TSZA 1KVUA 3T9CA 5DHTA 2CLDX 1YJ5A 3P5SA 1XPJA 2GUGA 3TVYA 2ERYA 3D3NA 4YQEA 4KRFA 1JHAA 3RK1A 4D4HA 1UEJA 3KU1A 1U0NA 1LQUA 3PYLA 1IY2A 4IV0A 2QR5A 3LIIA 2XHEA 1IBRA 1DC6A 3IL2A 1PJAA 1DZIA 3I2HA 3C7TA 1M1XB 4LZPA 3K0FA 1PS8A 4HNHA 1K86A 2PY6A 4U2GA 4GOMD 1K1EA 4ZOLA 4DR7B 2R60A 4J4TA 4I19A 5CNKA 5E4FA 4H7IA 5FOXA 2DGDA 3RNLA 1IB0A 4PE5B 4XCXA 1A9SA 4PG7A 4NLLA 1VFNA 4ZOEA 1GLNA 3I42A 2VT6A 2NPIA 2OHXA 3JRNA 2XY4A 3FKJA 2WG0A 4HYEA 3UGJA 3QMPA 2X58A 3KDSE 1KJQA 3UG7A 2XZTA 1JFFB 2G70A 4ZEWA 5GPBA 5DJ5A 3ZGVA 1YQGA 1P0IA 1QP0A 2Q41A 4MQMA 4HXFB 3CLSD 2F2TA 3V1TC 4BNFA 4E5DA 5BSKA 3AB3A 4AMGA 3W5IA 2PV0A 3JQAB 4DJTA 1KBQA 2ANBA 1NYRA 3BS4A 4Y98A 5IBRA 1LJ8A 3B1XA 4XASA 2V7TA 1E5TA 1O3YA 3OAAA 4QO8A 1FP4B 1NLZA 3C15C 3K9BA 5KSPA 1J1UA 2JGKA 4HNGA 4QOSA 4UXHA 2P4QA 3FSEA 4KTTE 4N3NA 3PUXA 1CHNA 4CR6A 1FFCA 5M29A 3T5PA 2HRBA 3A04A 2BFBA 1R4NA 3RASA 5JVDF 2A9RA 5A6SA 4GLBA 3TIIA 4XYLA 3ZGZA 3GLKA 4DF3A 5BNTA 2A3NA 5LYJA 5BN1A 5JV5A 2J4DA 1QGUA 3E05A 1WP9A 3AR6A 3GBVA 3EVEA 2QN6A 4LGYA 4MQ6A 4MR8B 4KV7A 1HX7A 2Z98A 4Y2VA 3W6OA 1F8GA 4C7OB 1QE5A 3DBRA 2W2VA 4RGBA 4DIMA 2DPMA 2PBRA 2FEPA 4LNUB 4D0LB 5A4AA 3HWRA 4R8VA 2P1RA 1VZ2A 1LB1B 4E4RA 3GLFE 3ZDBA 1I2DA 1SBIA 4A36A 2B5VA 4LRXA 4XJSA 1T36A 3CF4A 3V00A 5JDIA 3JVEA 1G8HA 3UH0A 2X77A 3U2QA 5I8PA 4QULA 1E8NA 1JGTA 2BBOA 3KQMA 1GKLA 3BWDD 3EIXA 2R8BA 4M1OA 5DK6A 3N74A 2WT8A 5TT0A 4LC1A 1MJHA 2IDZA 3Q7QA 4OHMA 2FSPA 4CKCA 5B6JA 5JPDA 3HFSA 2GASA 1QX4A 3L93A 3QKSB 2XYRA 4GBJA 1ESEA 4J16C 2GK4A 3NI2A 3DEZA 3H5VA 4FOTA 1H8HA 1NHWA 4Y6QA 1N2GA 1SIUA 4EF5A 3Q85A 3NBKA 4EI2A 4FB5A 3NDBB 4NONA 5A7FA 3SP1A 1U7XA 1XN1A 1SVMA 3RFXA 1P3DA 5J58A 2W70A 3F8WA 1QAOA 1G7CA 1AUVA 1Q21A 1BXZA 1Q1EA 1R9GA 2R7MA 2VDKB 2X1HA 1V6SA 3C87A 4XAQA 1V5EA 2ZCUA 2OK8A 3VU8A 4XOUA 1SKAA 2D2VA 3EVNA 4D6XA 5KB3A 5IKXA 3SQLA 3CNNA 4P84A 3WNDA 5KNBD 3NNDA 2BFWA 3RYCA 3FCEA 2J5QA 2FMFA 1V1RB 4L7VA 2B20A 3VH3A 3FFAA 3Q4GA 2OV4A 5LZ7A 5K8UA 4YK7A 1U5BA 1R5BA 3B1WA 3MQ2A 4IQGA 1HNXB 2CK3D 1X1CA 4YMHA 2AMJA 1K6EA 4UD6A 4F1JA 4FTWA 4KWHA 1TKBA 2W4IA 3EGOA 3KYCB 3QYJA 4YRPA 3RFVA 1ZLXA 1XMQB 1S8OA 3NP9A 3JWGA 2XODA 3FFTA 4P53A 1RHUA 1QWSA 2BHSA 2WSSA 4WA8A 4CLHA 3NVKI 2CSXA 1QG0A 5KKAA 3DJYA 5LJLA 2LUOA 3D3EA 5E8RA 3SJUA 3VGJA 2AI1A 1G21B 2FCRA 4UEKA 5DNWA 2ZM6B 3DR5A 3BE5A 4QX6A 3WWCA 4O2AB 2V98A 3FSGA 2DFDA 4BKMA 2CFTA 2P2YA 3AU9A 2DPXA 3HM9A 2UZ4A 5KHOC 3ZV5A 4FNMA 1YZTA 3SM9A 2W22A 3EY9A 3A8TA 1KO5A 1W35A 2C77A 2GCGA 3K2QA 3WGHA 2WIFA 1VSBA 2B4YA 2R6HA 1KAHA 3GVHA 3H4MA 3NFRA 2AEMA 3RVRA 3WLHA 3MGAA 3KJGA 3I2FA 4EO9A 1K3FA 3E8XA 2A1IA 1N6OA 1DPFA 4IVPA 5DM2A 1ISFA 2DHCA 1FJGB 3FSGD 3PQFA 2PTGA 2R8RA 3IAAA 1JIIA 4OGWA 3SK0A 3GDOA 4IL5A 1JJ7A 2D4HA 4TS9A 3R8XA 3TL2A 1OJLA 4LF4B 1HDIA 3SQXA 3P4UA 1U2GA 5F3RA 4LC0A 5K4AA 4BX9A 3C14C 4O2BF 3VBEA 2AC4A 4N6GA 1U9JA 2I4RA 4MJXA 4XD7D 3V9PA 4B3RB 2B34A 4MKGA 4J03A 2VWGA 4WK4B 2PJRA 3DC2A 5KWIA 2ZIGA 2J9RA 1IN7A 1UDXA 3GFSA 4BV8A 2ZR0A 3LYAA 2PSFA 3C3DA 1NSTA 1PKEA 1OZHA 5D5PA 4LY0A 1PNRA 1RCUA 3CF2A 4MULA 1KVQA 1IRIA 2O5RA 4B73A 4CKWB 5FOTA 4UNNA 2PXAA 1EXMA 1JSCA 1RZVA 2FHSA 1T9ZA 2JIPA 3AFHA 4E51A 5HNKA 4FR0A 3LKZA 1LW6E 1U8FO 5KX5B 3KD3A 2H2GA 2C8VA 3PEUA 4BBJA 2BFDB 5K8LA 2OFXA 4G07A 5AM4A 3WVNA 1WPRA 2SCUA 1LPOA 1LFAA 4DIOA 3ZGXA 4JHXA 1THMA 1A7UA 2P0EA 3JAKB 2MMCA 5E1MA 4I4CA 3KBOA 4MS1B 4A15A 1XEFA 4PFSA 4F84A 3O38A 2I6XA 4IX1A 4TL6A 5IHPA 3OJ0A 1O94D 4FMDF 3G0OA 5JS1A 5SY6A 1Q0QA 1NPTO 1JHVA 3ZWXA 2IH4A 4RABA 1RQLA 1SBNE 2XJ4A 4OH1A 3UIEA 2CEAA 5COQA 4HQNA 4QOEA 2Y1OA 2VRCD 1NW8A 1AK1A 4NEGA 4ENPA 5EE3A 1TO6A 2WDPA 5JCPA 1CDOA 3QLUA 4NZOA 1EM6A 2GCNA 3ZWOA 4PYIA 1P77A 3MD9A 4O4HF 4P54A 4B43A 4C43A 1FTWA 4OUKX 3UMGA 1TAUA 2BSQA 3HB1A 3A2KA 4MVYA 1HO3A 3T7IA 1XNRB 4NVRA 4PX5A 3JZAA 1G4UR 5BY2A 2JKVA 1G19A 3Q6IA 2OHIA 3RW9A 4XYBA 2QZ9A 4CTJA 4WOKA 3TZCA 1X1AA 4QFDA 1FFDA 3A1FA 5DXJA 5K8JB 1UFRA 1MG5A 2GZMA 2A84A 4FFWA 4GYYA 5GJCA 3AOEA 3EC2A 3HY6A 3V4PB 4ER5A 3CH5A 2YQ4A 2I2XB 1E1YA 5DOZA 1G8GA 5TARA 1UQUA 3QFCA 1J9GA 1L5FA 1X3SA 1WVGA 4GG1A 3I6QA 3IXLA 5D5HA 1KVTA 4YCAA 2OBFA 1BA3A 4X1YA 1KJ9A 4KO1S 5HKKD 1NBOA 2Z58A 3TOSA 2IW1A 4KQWA 4ID9A 4RSRA 4FGUA 1CQWA 4K9PA 1NLFA 1HC7A 2E1PA 2F1JA 3IAS1 3NVMB 4I6EA 2OFPA 4M1MA 3T95A 1A9XB 2XRYA 1DG1G 3U40A 4EFNA 2YXPX 4UU8A 3VMMA 3BKXA 4JT2A 1SQ0A 3O75A 1C0IA 1RLTA 2R5WA 3GEGA 4QU5A 2WWTA 4KUGA 3IERA 1IQ0A 2HHAA 1K0UA 1SVNA 1FDWA 2HDWA 4RPLA 3RUIA 2ODBA 2P0YA 3ZQJA 3AEUA 1ZJ4A 1AX9A 2GN9A 2ZJFA 4ZVMA 5H4HA 1JTFA 4IDDA 2C0QA 2G25A 1Z0JA 1YQXA 3UJHA 2QRLA 1ZS9A 4AIRA 4C2UA 1XA3A 5L53A 5SYAA 4BMCA 5HVNA 1U0BB 1RC0A 3D2AA 1HNNA 1V1JA 2VQDA 2JFHA 3OWXA 4MVJI 2W2PA 1F2TA 2HA5A 2YTZA 2EGGA 3E81A 4I6GA 5ARDA 4PFJA 1JYSA 4RTQA 3M4YA 5BXYA 4D4JA 1THTA 1QVRA 1R8YA 1OWPA 2FPKA 1CRZA 3M1IA 1FJHA 1OZ0A 3TPZA 2AW3A 4FYPA 1DTEA 2G3YA 3R5FA 2J5RA 1YS7A 3P71T 3FIUA 2H07A 2X0JA 2IU3A 4K86A 1ZOLA 1EVIA 2YMPA 3A58B 1BKDR 1RS0A 4H9GA 3C7KA 5FBLB 2F1OA 2BDUA 4NG5A 1O5IA 5I9NA 5DP1A 1GFIA 2FFQA 4WK6A 3B8EA 1H6DA 2LDBA 3CISA 1F3LA 2VT3A 4JC5A 4WZAA 1JG4A 2WTNA 5IJ0B 4H31A 2UUPA 2DG2A 1QOPB 3F4BA 3HCRA 3VU9A 1E1DA 2D1RA 2C2WA 4GMKA 3L4SO 3PX3A 5IM4F 3Q7EA 4Q7JB 2WYWA 4DW8A 1IBMB 1BNCA 4R05A 5HK8A 1TVKA 3CEAA 4CLOA 2ODNA 2I9PA 4RJLA 2Y4OA 1T3TA 3HJHA 4MPDA 3PUIA 1TE2A 3FNGA 4C21A 2XCTB 5J59A 1F4LA 2HLPA 3CTMA 3GZTB 1CZRA 2NVUB 4EFKA 1Y1PA 1C1YA 3HYCA 2HJRA 3HZZA 4CU5A 2DVMA 3ROQA 5LU8A 1WUIS 5I7WA 1ULAA 4GMFA 3W9BA 5K8TA 4RZUA 1P19A 1DX6A 1BGXT 2ZLBA 3IUYA 1BCRB 2KJQA 5I51A 1E5QA 2CDAA 2IHJA 1JQJC 2Q3EA 1N25A 5IJAA 5CCXA 3JQ8B 4L9RA 2NSJA 4JBXA 5AJHA 4IIUA 2I34A 4PC1A 4X8HA 4TMYA 1DAGA 4OQFA 4MV4A 2FUCA 3F7OA 1WHSA 4PLCA 5I7OA 4OD0A 4QJIA 1J9ZA 2FA9A 3K96A 3PLNA 4Z0PA 1ZA1A 4W8GA 2VCYA 9LDBA 4BCCA 1UEXC 5LP6B 2H9YA 4ER3A 1T13A 1LDGA 2CLCX 3BCSA 3F67A 2A2ZA 3PFNA 4ZT6A 4ZV9A 3TX6A 1UC9A 1KETA 1O4WA 4QXQA 3PDJA 5D1HA 4B9EA 4I55F 2QXTA 5B1DA 5AM2A 3GGSA 4WCDA 4YP1A 1WXHA 4BNJA 3L6UA 1FNSA 2I29A 4IJ5A 1NX9A 2EBFX 3N2NA 5KOHA 3GMTA 2IZOA 2R1VB 2OY0A 2V3WA 3LUHA 2OGZA 4B32A 1V96A 4YGYA 3WTBA 3SZUA 1KMNA 2Y68A 3WK5A 4YUZA 2AW5A 2PX6A 3GCWA 3L0YA 4N03A 4OLFA 3MINB 4PC2A 3BGOS 2DE0X 3TLGA 4A1OA 4AURA 3M49A 2V7UA 4DSTA 4KIJA 1K8XB 1AV7A 3K1TA 2BEUB 4G36A 1YUBA 2FYTA 2EARA 3I53A 1GRCA 1XWFA 1RYZA 1NVVR 3D8NA 4MKXA 3PIIA 1C0LA 4Y2HA 4ZAWA 3WGTA 5FAKA 4M8SA 1KPHA 4FYKA 2XGJA 5KYTA 2NN3C 3BDIA 5TPZA 3PU6A 4KOAA 3I9KA 4MVCA 3BWMA 1UBHS 4FEEA 1J25A 1MCZA 2FK7A 1V7CA 3LHDA 2YWBA 3AUKA 1XR3A 3LO8A 3V8QA 2O07A 4WGGA 4WBSA 3UCXA 3PNQA 3WDMA 1SU8A 2CEKA 2IHTA 5IKEA 2QW0X 1IK6A 5JQGB 1A8SA 3NAGA 4DOMA 3SC4A 4UTZA 1A69A 2P9TA 4OFXA 1U8XX 1K9VF 4IHKA 5H5JA 3OCYA 4RMJA 3H1GA 1BX3A 2UYGA 3CZCA 1BWSA 2UVPA 4D56A 4EJSC 1I4OA 1O0SA 4JYMA 2ZBUA 1B2RA 4WVFA 1DIAA 4P58A 3NT4A 2PUTA 2G9QA 3I39X 3IILA 2PUDA 1SIBE 1DU4A 1G3QA 3KYCA 2NO6A 3PQDA 4YECA 3E3NA 2H2IA 2QW1A 1U5AA 3INRA 1ATIA 4NARA 1BXRB 1KYTA 3AP2A 3M6VA 1PWYE 3IQGX 1O2DA 2WWGA 3N75A 4J2OA 3VUFA 5DULA 5BQPA 3KPWA 3MERA 2BP7B 1KMMA 3WLTA 3JYOA 1NQOA 3SMVA 3GLGB 1AY0A 3FCXA 5LQMA 1XTJA 2QJTA 1BDBA 1UBKS 5KNDA 5ISMA 1QHGA 2J5KA 3FF4A 4FINA 3QLUC 2AEFA 3VI4B 3ED1A 1VB3A 2WJYA 7REQA 1CQJA 1BO6A 2ES4A 3SYMA 4MEJA 2ZB8A 1Q1QA 2WUVA 4LNHA 3LUBA 4LHSA 4CMJA 3AINA 3URKA 3GUUA 3U3ZA 3WGNA 2WQ6A 2WDZA 1CXZA 3KXLA 3E18A 4QXAA 1SXQA 1WXWA 4FS8A 2NPOA 2NTEA 2A1UB 1R5OA 3SICE 2WSYB 3AM5A 1B8UA 1J2UA 3ADPA 2BISA 4PBSA 4KO3S 2JVIA 1PW5A 4MNTA 1VCHA 3QU7A 5FO0A 2H1FA 3MXTA 5C1OA 1PYGA 2OCLA 2VJMA 1A2BA 4X41A 5KOYA 1NW5A 3ORYA 2VJBA 1ZH6A 2QG4A 4MCAA 1GAQA 2I87A 1FJ2A 3L43A 1M0TA 4K1LA 4P7JA 1ICEA 2DAPA 3UHFA 3QVJA 3ZE6A 2AJ8A 1DT3A 1L1RA 3CLTD 3GLIB 2BFMA 5C4IA 3M4JA 4ZXPA 4CG0A 1M34A 3KKLA 1OZFA 4K6HA 5JS6A 2SKDA 3V34A 2QTHA 4WLNA 1UFOA 1EIWA 1TYCA 3SC2A 3OKAA 5ALJA 1YBFA 3ZW8A 5B36A 1COZA 1LSSA 1N0WA 3EGEA 3T0FA 1CSEE 5HXAA 4FJ1A 4RULA 1UBTS 1FYDA 1MQSA 2A9JA 2Y9PB 2P8JA 4HUQA 1TFRA 4NV0A 1T5IA 2RB5A 1XIVA 2Z09A 4TVSA 2YYZA 4B3DA 4DDUA 2DCMA 5KNLA 3MTBA 3UCFA 1B8VA 4P0QB 4URZR 3FHOA 1NF2A 1V6CA 2C9DA 4GKBA 3ROEA 2CFIA 3D6MA 3EWNA 3QUAA 3LUCA 3VR6H 3FLEA 2RKWA 1F0NA 4WOCA 4YXWA 3I9V1 3AUXA 3JPYA 4M60A 4WLVA 1U04A 3LX8A 4CM9D 3ZXIA 1RXYA 2ZTLA 1CJBA 1SD1A 1XBTA 1DEOA 3C6ZA 3GJ4A 2AFIA 3PHBE 1HI9A 3GFPA 1NOJA 3QX9A 2GZ1A 1ITZA 3PI7A 4OQMA 2XSZD 3UB2A 7REQB 1WULS 3CRNA 4OOEA 1RE1A 3BDAA 2PUGA 3GA0A 3D1JA 5IKMA 1VL8A 3OO0A 2Z43A 5HE9A 2ZXFA 3RS8A 4B5LA 4UQLA 4XE5A 2EC5A 2YZKA 4JB3A 3ZU5A 3QE9Y 4YMGA 4RFSB 4EVRA 1T4GA 2A4KA 3DD1A 5D7NA 2R6JA 2V3VA 5J2TF 3SGLA 1USUA 3B12A 4OLJA 3T7KA 3OJFA 1P2VA 4M98A 1PS9A 2B4AA 2R6R1 3PCXA 3PX7A 2ENWA 3OLZA 2NTNA 5BUQA 5CITA 5T41A 2P90A 2YFHA 3AVOA 3DMRA 5GIPE 4D9NA 4R1MA 1PDVA 1H0SA 5L3SA 5JXGA 1VMAA 3RIYA 3QA9A 1U99A 2O50A 3R5HA 2WUWE 4GKVA 5F4ZA 3VPGA 4C87A 4P34A 2ZRPA 3REOA 1OWLA 2ZT7A 3FOWA 4O2AA 4OMDA 3VJMA 3WAKA 3O8LA 1FYXA 1AH2A 3JTMA 2XMQA 4Y2SA 2B4TO 4B4KA 2FG6C 4PLTA 3GARA 4EPTA 4K8OA 4OQQA 1UINA 1SKUA 4L74A 3GY0A 1KR5A 2D6FA 1ML4A 4OK3A 4R9UC 1Z13A 3QPBA 4JC4A 1T9BA 1HT2E 1VCOA 3A11A 3LUGA 4HRVA 3H19A 5C37A 4I9GA 4RH3A 3C5HA 4YAOA 5TEWA 4RU1A 1H1DA 1DRKA 3S28A 4JT8A 3N39C 2X42A 4W6ZA 3ZTWA 1NNUA 2Z5GA 1SVUA 3KZNA 4GSKA 3IUQA 1SKQA 3JYNA 1SUEA 3OTOB 4MVJG 2AC7A 2F3SA 2OGWA 1IATA 1I80A 3FRHA 4MYTA 4V1CI 2Q21A 2YIMA 3O2NA 2IYEA 4S1VA 3K92A 4RHYA 3KZOA 4GI3A 2HA3A 4BCDA 3HC7A 3D6TB 3LBNA 4TL7A 1N2CE 3CKMA 3GRYA 3QHQA 1FDUA 4TMFA 2HXYA 4F7WA 4F4CA 2NNLD 4XIGS 3WXMA 5IXYA 2Q7DA 3TECE 1X70A 4KN9S 1Z5PA 4NAVA 1ZD4A 4LFCB 1E1LA 3W6NA 4R8SA 6CHYA 1JIVA 4EHFA 1ZY2A 2WKPA 4IHJA 1L4KA 1DKPA 4I2VA 7ABPA 4S04A 4W5OA 1HE3A 1W49A 1WW3A 4HPXB 4JEMA 4KMSA 4R98A 2UUBB 2UZ0A 2ET6A 2D1SA 1A2OA 4UKDA 3OETA 1P61B 5LOVA 1JEAA 1SOWA 1ZCBA 4J3JA 3L1VA 4RQTA 4PANA 1QPBA 1HYEA 1LRKA 2ZYIA 4KI0A 1TZJA 4TWJA 3L4KA 3J7AC 2CDRA 1WG8A 1BMQA 1QFMA 4J75A 1JVNA 4A9AA 1FIUA 4RL6A 1WWKA 3ANXA 4RGVA 5K8VA 2Y77A 4FR5A 3YASA 1C7QA 5JMWA 4NX2A 4XSVA 3FNBA 5E3HA 2AXQA 2J9ZB 4E3ZA 3ZV4A 3LV8A 5I5GA 4WLOA 5FV7A 3HFGA 4ZT5A 3G2KA 4M8NE 5J4HA 4LJRA 4DIEA 4Z4EA 4N40A 4DCJA 1RPTA 4QXMA 2GD2A 1RHJA 3CUUA 4MWSA 4W1QA 5SYNA 4A0QA 3O8NA 2FI1A 4FS3A 1G1AA 4FHDA 3RSZA 1XOIA 3P9CA 5B37A 1O94A 5J3JA 5JQWA 1VGRA 4YO8A 1KEKA 3VU9B 3QY9A 3UN1A 4C06A 1Y9AA 4FJ2A 2GS9A 3QXGA 1DS6A 3UEOA 3Q8LA 2F8SA 1S89A 1JWAB 2WWFA 3SKXA 1YDGA 5FWXB 5LNK6 2FP4A 3G68A 4HAZA 1NTOA 3F6RA 5L7YA 4NBLA 3MSCA 1YQEA 4LRQA 1NVBA 1J0EA 1OC2A 5FTWA 4FOLA 2X0DA 2HEGA 1UK9A 1ECGA 1CB7A 3NVAA 2GOYA 3VTKA 2EERA 3GLVA 1NW9B 2OQVA 3VFDA 5IYZB 4JI8B 4HEQA 1JQEA 4Q66C 3U7QB 3EGWA 3LGSA 4L3VA 3VZCA 4Q1EA 1BMTA 1HOXA 2YINC 3TIFA 2JBHA 3HB9A 1K3TA 4FXOA 4HN2A 4IHQA 5DYNA 4AYWA 1FFBA 2AG5A 1E2GA 1XTBA 3FJ1A 4KDFA 3TEMA 4C78A 3DEKA 1LDEA 2IEAA 5U1PA 1I2AA 1GVNB 2FZWA 4URFA 5EJIA 2JLWA 4JA2A 3EZLA 3T3DA 4FFRA 3X1WA 1GM5A 3CSUA 3F6EX 3LVFO 4NCHA 4IDBA 1TUEA 4E31A 1QPZA 4OA8A 3FPKA 3MRTA 1D3AA 3OZTA 3THXA 2C83A 5JJBA 4ZGWA 1R8XA 5LZ2A 3FTDA 3NU1A 1CJMA 3K0SA 2BKLA 1CEYA 4XCQA 3Q5DA 3OPVA 4LDNA 4CTKA 3L77A 1SZPA 5J5AA 2Q2QA 2O7NA 5BWMA 5REQB 3H1BA 3E5MA 1N7IA 2J0UA 2JEOA 2UXDB 2YHUA 3K09C 2YRFA 4Y1FA 1UT6A 5GWXA 1CU1A 2D3WA 4UDYX 1H4VB 5LB4A 4XRGA 4ANFA 1AHIA 1UMBA 4AY6A 2CZQA 1UBNA 6AT1A 1YJXA 4QU8A 4DXHA 3AKZA 3IVAA 4PLHA 2FRDC 2GR9A 5FR2A 3W4IA 3RJTA 3VR4D 2D1YA 3NX4A 2VXCA 3VDXA 4EIWA 2ORWA 4MKHA 1W52X 3BE8A 3FI9A 3UXYA 4BEJA 3VGPA 3VPXA 1TPYA 1P2TA 3ZWNA 1Q12A 1Z4PX 2D7JA 3DFMA 4ZYVA 3KKZA 1NHGA 4DWWA 5AVOA 4JDPA 2C2YA 1DX4A 2FHPA 3L7KA 3BMXA 2CXTA 4H3HB 1KDYA 5CG1A 4LA4A 2PRSA 3LC1O 5HOQA 4GUAA 1UBMS 1L7RA 1N4DA 1BXGB 4EK9A 3AESA 1V3QE 4OCZA 3QVKA 4MUJA 4OP3A 1LTHR 3H2KA 1A4UA 3D31A 1S3GA 3B2NA 2QP3A 3CUEF 3NRBA 4MV9A 2ADMA 2OORC 3HYTA 5IASA 5KQMA 4XX1A 4ETIA 2HHJA 1P1HA 1PL8A 2JFZA 3H17A 4HS4A 3S1SA 5IJ9A 1F4VA 1QE3A 3ITKA 2QX9A 3WGOA 2NSLA 2B94A 1Z0SA 2W2OA 1R3UA 2HPVA 4LUCA 5GGYA 4I1YA 1UBCA 3H5WA 4C4TA 4C5CA 2IT1A 2H9AA 1C9YA 5ALMA 1HQDA 5JSZA 5AVJA 3GELA 2NVBA 2YUTA 3EGDA 3PVZA 1ADBA 1HG0A 4QRHA 2SHKA 2HRDA 4GLFA 5AKIA 4BKRA 4ENWA 2HT1A 2VPTA 1Y5LA 4ZMSA 1IM5A 4HAIA 3TD6A 5B57C 1PJ3A 5HMLA 4MV3A 3P32A 4X62B 5CHEA 1UBSB 5FAXA 1WPGA 5ELXA 2HNAA 3C5WP 5KBYA 1IHUA 1SOAA 3QU2A 5JAZA 2V54A 3KT3A 4YCJA 3TDNA 3RS9A 1IOVA 1BU8A 3ROXA 2H4FA 3EVCA 2Q46A 3M2PA 4D2IA 3ENQA 4W8OA 5CEJA 4KAAA 1GPKA 5FF9A 1VJTA 1L4EA 1XDSA 1N2IA 4NCAA 4NFLA 4AKGA 4UAVA 1ZVVA 3N6RA 3WB2A 3THWB 2J3EA 5I9TA 1GFSA 1YVPA 4Q9HA 1Y8QA 2QW8A 2XUFA 4IJUA 3T06B 5G0TA 1PFGA 1R6VA 1SKBA 4E94A 4C4RA 2CHEA 1KDRA 4M46A 1Z5OA 1ZGAA 1Z4KA 3ZD8A 1EWTA 3BRWA 3KP1A 4IWXA 1LXCA 3IRVA 3LT2A 3EG5A 2RI6A 3H99A 3R2JA 3SVZA 4B6PA 5JZSA 2XV1A 3AQ4A 1CJVC 1QG4A 1VCIA 2CCGA 3E7PA 4R2JA 2A86A 3C41J 3U7RA 4DQDA 4YJ3A 3KEFA 5IDVA 2P67A 2HDNB 5AOCA 1EFAA 3BXPA 2B8WA 2CL6X 5DEIA 2GYVA 2C9YA 4CKBB 4BNDB 3LHSA 5DNDA 1PQWA 1ZOPA 2WMDA 3M9WA 5JDIC 1I51A 2OD2A 3RHSA 2HFKA 5G0WA 1GSHA 4QXPA 1L5LA 5IWCA 4M8KA 2LCQA 1G5FA 4RTPA 3BWXA 1KZYC 4HZUA 4CF4A 2L19A 3TQQA 3ZUGA 3A2LA 5C0OE 4KXNA 2DR2A 1TAGA 2VWPA 1VKRA 2WJ4A 3HUTA 3OU7A 2L69A 2VQ6A 1F20A 1UM9B 1Z5VA 3JYLA 3N0TA 4WNYA 4ZEOA 4FZRA 5HA5A 2A5FA 2QMHA 5CYOA 5JXWA 2CXQA 3OIGA 1PR9A 2EF0A 5IC4A 1HZZA 2ZUUA 1RZRD 5ENZA 2ZT6A 1AHPA 1Q6YA 1O95D 4DA7A 1L7DA 2BL4A 1QO0D 4DZZA 2AXPA 3L3BA 4N6NA 5CLGA 2FKAA 4R1TA 5EWLA 3RYIB 2ZT8A 6YASA 4LGCA 1KWGA 1QQ7A 2B69A 5KVCA 1QQ6A 2I78A 3KD2A 4HDNB 4IRMA 4GE0A 2WAOA 1AGPA 4KMOA 5H80A 3ROFA 1U5CA 3FFWA 3FPCA 1OB5A 1C7ZA 4BQRA 4P4GA 2ZUSA 3DGFC 4YXFA 2QY9A 1Z3IX 2DPGA 3SQNA 2BKEA 1FA9A 1ZN9A 1QV9A 4NEHB 3I9OA 5EWMA 3X44A 1ZM2A 2DBRA 3A6LA 4L1KA 1LD3A 1P74A 4M1TA 5T3YA 3ANTA 1D9XA 1VLMA 2AA3A 3CA8A 3Q9SA 4MQEB 5ENDA 4EG6A 1K7FB 5KWSA 4AO7A 1RWPA 3TE7A 1DV2A 1O5OA 4DABA 1PK7A 3HR7A 4G4GA 3GLUA 4AVYA 4D9BA 5FFFA 1U9IA 1T0JB 5DLYA 2XITA 1HH4A 2X7JA 4CBVA 1I7PA 3BHNA 4WWHA 1WUHS 5BQOA 3S8EA 3L0ZA 2GCPA 2O3JA 3U7GA 4EHNA 1IJBA 1N2CB 5AWFC 5HTKA 1E62A 3P4XA 3IKTA 3MT9A 4Q6WA 3L0DA 1N78A 1N9GA 1TF5A 4Y9UA 2W2QA 4PWZA 4E11A 3KOUA 5LN1A 1RWQA 3KC2A 1D9ZA 3DTVB 1ZICA 4G0XA 4TKVB 4X93A 4UZSA 2OOKA 3O83A 4NP6A 2PKQO 3EYWA 3P2EA 1RJGA 3HWX1 3G3EA 3D8UA 1PWZA 4H15A 1AUXA 4P4LA 1ONSA 1ND5A 1YASA 5DKFA 2V9CA 3E0QA 5BQ5A 1FXWF 1JHZA 1DQPA 1O08A 3FBTA 3QJYA 3D3WB 4RD2A 5DGIA 2REBA 4U7FA 2MSLA 3REQA 1FSGA 4ESHA 3ETCA 5L4NA 4NESA 2Q4TA 8GPBA 3KKPA 1KH3A 1CDDA 3D6FA 2J7KA 1J20A 3RRMA 3EARA 1GUDA 4B80A 1SBQA 3F7NA 1YZKA 3MC1A 3OECA 3QXXA 3E9ZA 4CODB 1EDZA 1P1FA 4L27A 3MMZA 3I1IA 4PLZA 3H9UA 3ADKA 2QUHA 3THRA 3W78A 1QDUA 2P5TB 1NF3A 2DWOA 4JBYA 4MGZR 4MWGA 5AVZA 3PNSA 4IFIA 5NULA 3EDRA 4HDNA 5IJ0A 3GZNA 2HWXA 3WGKA 1DG9A 3Q7SA 2B83A 3D3WA 3N0WA 2CC2A 2XAAA 1XU4A 3NG1A 4X92A 4DLLA 4EVIA 9GPBA 4IIJA 1P8JA 1ZM9A 1XMIA 3KB2A 1C9KA 4NJOA 3UAXA 3MTQA 1EJ2A 5LCXA 4B75A 1MO6A 2F3QA 1GZ7A 1JUDA 3BQMB 4RANA 5TB5A 4ZVSA 1KP2A 2JS7A 2AFHE 3X43A 3A6PC 3FYDA 4MUHA 3FD8A 3D7MA 4CIDA 4OB7A 1E58A 2P9CA 1GKIA 4E13A 1W9MA 2H1IA 1R7RA 1VL6A 4XOIA 4I55B 4OFZA 3QMMA 3HG7A 1K7SN 1U02A 2HCBA 3AF1A 3U0VA 4BQEA 2YC4C 2QNRA 3CXUA 4LJAA 1G8KA 2PKRA 2FNAA 2GAOA 5AW7A 4ICIA 3SFVA 1UBOS 3JX9A 3ZIUA 4EUSA 2G5GX 2EX1A 1RC8A 4BX3A 1ZCAA 3TRDA 5A5DA 3LFUA 1PEYA 1OYWA 4YWJA 3CONA 1DKOA 3LMKA 4O0MA 2Z1DA 2GKOA 3B36A 5FFNA 2J9GA 3ESYA 1V9CA 4WGFA 1GPMA 3QKRB 1T0HB 3K31A 2WTBA 5KSOA 1X94A 1ZIOA 2HSWA 5KAPA 1GT6A 4UAGA 2PGLA 4HJXA 4OJNA 1J5PA 1SU4A 3IXQA 2ODTX 5I8ZA 4BLOA 1V8PA 4A0SA 3FNQA 3NWOA 2Q1WA 4LKRA 3V48A 4HI0E 1MB0A 4AP5A 5BVGA 1ILEA 2IV3A 3WNQA 3H1PA 3IA7A 3SC2B 3E1SA 4BLSA 4CT5A 2VJAA 2C88A 2VH2A 3FE2A 3QK7A 4JS0A 4LQDA 5BSTA 5K3SA 2J3DA 3HO1A 4L8LA 4R4JA 4NS1A 1Z4JA 1H42A 4HNAA 1U3FA 3ACDA 5DASA 1YTUA 3NMUF 5IH3A 2NU6B 3WYEA 2Y76A 4OUDA 4GVXA 4X64B 3L0BA 5TMPA 1WXFA 5EHXA 4DYVA 1SVKA 1E2DA 1ZM3A 1L5WA 3SX0A 1NR1A 1X7GA 2ZGVA 2DKFA 1BHJA 3AUAA 4FLFA 5CVUA 1UXIA 3WGZA 7AT1A 2BR5A 3A9WA 4ODIA 2X0RA 4BNYA 4KPFC 5KQPA 2IITA 1VECA 3L0SA 3MWFA 3QELB 1E2PA 1ZQ9A 1TEXA 1PL6A 1YU6A 3UHOA 2Q62A 2NTYC 2X19A 3FRIA 4L5BA 3II6X 5DSXA 3OHSX 4QT0A 3T1HB 3M4XA 2OP0A 3N7UA 3ETEA 4CLEA 1ML3A 5A9SA 1GT91 1T0IA 2JCSA 4C6TA 1KQFA 1WBBA 2IP2A 3KEMA 2ZR9A 1J21A 4G5YA 1HL7A 5DW0A 4ZEMA 1EP1B 4Q4JA 4AJ4A 1VL1A 2PYIA 3WISA 4XLTA 4WDQA 2VPYA 3UENA 1Z4LA 4BOYA 1JSXA 1YL5A 3FGOA 3BGWA 1SOMA 4TTVA 4BGIA 3BL8A 3INTA 3IT1A 4EQ6A 5JY1A 2JIBA 2RGBA 2JVJA 1YJBA 2C7RA 1IUPA 3HDGA 1VI2A 1T10A 3L7YA 1VLVA 5LMCA 1YA4A 2A1TR 1MQ9A 1JHPA 4F97A 3QE0A 4N4AA 4Y18A 3RSOA 4GHWA 2D8AA 4RGYA 3GLRA 1SVWA 5F2KA 3CX8A 3PHLA 1UOEA 5H70A 1A82A 4RA6B 2ZB7A 1T4CA 2A9PA 1FDVA 4IXDA 4R9VA 3JR7A 3KFLA 3OE5A 2IXTA 4NL4H 1ODFA 1V48A 4WZBE 2YWRA 1Z4QA 3NXSA