4APOA

Aip tpr domain in complex with human tomm20 peptide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
142
structure length
142
Chain Sequence
AEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALEARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Tpr Domain of Aip: Lack of Client Protein Interaction with the C-Terminal Alpha-7 Helix of the Tpr Domain of Aip is Sufficient for Pituitary Adenoma Predisposition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
molecule keywords AH RECEPTOR-INTERACTING PROTEIN
total genus 60
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4apoA00
3Q4AB 3MV2B 2KCKA 2XCBA 2C0MA 2VQ2A 4XI9A 2L6JA 4J8EA 2VGXA 3CEQA 2NC9A 2XPIA 1FCHA 4NRHB 4GA1A 5KJKA 3EDTB 2GW1A 3HYMB 3CKCA 1B89A 4LEUA 2UY1A 3CVNA 3OXGA 4G24A 2FEZA 4G2VA 2XGMA 4U0UA 3CVLA 2HO1A 2MHKA 4JA9A 5LCWJ 3ASFA 4WNGA 2I6HA 2FI7A 4UQZA 4A1SA 1ZU2A 2E2EA 2PQNA 1Y8MA 2Y4UA 3GZ2A 3ULQA 3NF1A 1KT0A 3URZA 2VGXB 2C0LA 4N5CA 5D0QD 3ZGQA 3LYAA 3ESKA 4I1AA 4WNDA 4UQXA 4N3AA 1E96B 3MEKA 3SF4A 3ASGA 4BTAA 4Y6CA 2PQRA 3R9AB 1TJCA 1YA0A 4GPKA 5LCWC 4YVQC 4GCOA 5G05C 3PDNA 2DBAA 4YNDA 3U3WA 1HZ4A 5G04C 5HI7A 4G26A 3PE3A 4N3CA 4APOA 2P58C 4J8DA 3N71A 4U0SA 4BT8A 3LY7A 3Q5MA 2PL2A 1WAO1 3TG4A 3QKYA 2C2LA 4G23A 4GZ6A 3CK7A 2BUGA 4GYOA 5A7DB 4KBQA 5FZSA 4IN3B 1W3BA 1NA0A 3RO3A 4W9RA 2KCLA 3S7DA 3ZHEA 3GYZA 5G04J 2JLBA 4BTBA 1HXIA 5FJYA 3K9IA 4N2SA 3QDNA 5JJTA 3MV3B 2KC7A 2KCVA 4H7YA 3CK8A 3S7JA 3AS5A 4KYOB 4HOSA 1IHGA 2XEVA 3QWWA 4XIFA 4Y6WA 2XCCA 5M72A 4ME2A 2IFUA 4H7XA 1ELRA 4WNFA 4BT9A 3UQ3A 4HORA 2UY1B 3CVPA 4I2ZA 4U07A 3MA5A 3ZN3A 4GZ3A 2VYIA 4WUYA 3ZHEB 3SZ7A 5AYWD 2HR2A 4JA7A 5G05J 3Q49B 3AS8A 3LCAA 4JL0A 5ARGA 3RJVA 5FZQA 3TAXA 5D0OD 4B94A 3IEGA 3TGOA 3GZ1A 2VSNA 4J8FA 3S7FA 1KLXA 3KS2A 3Q15A 3QWVA 2J9QA 4YVOA 5FZRA 2OOEA 1HH8A 1A17A 2FF4A 3QOUA 3S7BA 4EQFA 4F3VA 4UQYA 5KJMA 2IF4A 4GYWA 4U0ZA 3PE4A 3AS4A 4I9CA 2ONDA 4XI0A 4N2QA 4CGVA 2Y4TA 4HOTA 3UPVA 5FT9A 3VTXA 5C1DA 2KATA 5DBKA 2LNIA 3OXLA 3GW4A 4I9EA 1NZNA 4O6FA 3Q47B 4RG6A 4ABNA 4G1TA 5CCMA 3WXXA 2R5SA 4GYYA 2AVPA 1WM5A 4JHRA 3LPZA 4BWRA 3BEEA 1QZ2A 4AY6A 3KD7A 2VSYA 1QQEA 3LY9A 3MKRA 5DIZA 5A6CA 1IYGA 2QFCA 3CVQA 5CHEE 3O48A 4UI9J 5EX3A 3TG5A 3UUXA 1NA3A 4I2WA 5JJ7A 3ASHA 2LSUA 3QWPA 2WQHA 3RIBA 4GA0A 4N39A 1ZBPA 4GCNA 3FFLA 4UI9K 5EKQD 5ARFA 4N3BA 4KXKB 3FP3A 4GA2A 4GZ5A 5FTPA 3ZFWA 4AY5A 2WPVA 4WNEA 3U4TA 5BW8C 3CK9A 2YHCA 3ASDA 2XGSA 2FO7A 4U04A 3FWVA 5CCLA 3RKVA 5KJLA 1OUVA 2YQ8A 5KJNA 3OXFA 2UWJG 4AIFA 3VTYA 2HYZA 4AM9A 3RU0A 5JJ6A 4NQ0A 1KT1A 3JYSA 5BT1A 2FBNA 4G25A 4HOUA 3ZPJA 3RO2A 4CDRA 5HQ8A 1P5QA 4I17A 1ELWA 2VGYA 3CKBA 4RG9A 3CV0A 4J0UA 3LKUA 2Q7FA 5BNWA 1PC2A 2XGOA 3E4BA 3KAEA 1XNFA 5EX0A 4HOQA 2V5FA 3LY8A 4CGWA 2PZIA 4UI9C 2LSVA
chains in the Genus database with same CATH superfamily
5AQBA 2VTBB 3OXGA 3O4ZA 1TNUA 3TWSA 2ETBA 3LYAA 2WM9A 2P9IG 3MEKA 3D9HA 1LTXA 3PZ4A 4Y6CA 3FUEA 4YVQC 4GCOA 3NB2A 1TJFA 2B0OE 1QYMA 1NL4A 4ANWA 1N4PA 4CRWA 2YNQA 4R7LA 2F8XK 4HOTA 2KCLA 4HLLA 3QDNA 3TWVA 2RFAA 4JW1A 4HRMB 1SW6A 4C9BB 4JL0A 1G3NB 3G2SA 2IJGX 2KBXA 3R7RA 3ABME 3AG3E 3UI2A 3E37A 2NXPA 1LF8A 4FADA 1FPPA 3DPDA 4NIKA 4V3IA 5LX8A 1QQEA 2WMOA 3C3RA 3UUXA 5JJ7A 1JWFA 4HVBA 1H6PA 1DNPA 3FP3A 2WPVA 2WXOA 4DX1A 5ITZF 5KJNA 1JUQA 4NQ0A 4PUCA 2HM8A 4K03A 4LNUD 4B89A 3OTNA 4HNAD 3DXKG 2Y69E 2LSVA 5BXOA 4AV7A 1WY6A 3P2BA 2VQ2A 1UJKA 3MJWA 4FLBA 3UXGA 2IY0C 4U95D 2FEZA 3AG2E 4CCAA 3PREA 2IQCA 3ZGQA 3EHMA 3ZYKA 2Y3AA 1TJCA 4QFVA 3DBSA 4I6JA 4CT4A 2MYOA 2GROB 4J8DA 5FQ6A 1AWCB 4J7WA 4A3VA 4IN3B 5J90A 3ZEFA 1D8EA 3D9PA 4H7YA 3SD5A 3TXNA 3RAUA 2UY1B 3CVPA 3RRUA 1H19A 3RJVA 3TAXA 3C3QA 2LAIA 3JUEA 3VLEA 2CG2A 4EQFA 4U0ZA 3PE4A 3AS4A 2LAHA 1Z5SC 4G8KA 4RG6A 1UN9A 4B8CB 3PZ1A 3FY4A 3C5RA 1ZBPA 2X6JA 5ARFA 1DCQA 4GZ5A 3UM2A 3NZSA 4EZKA 4BX8A 3G2WA 1OUVA 2MRIA 1UN8A 2UWJG 2HYZA 3V2XA 2X6KA 5BT1A 3ZPJA 4RG9A 4CDNA 2L9BA 2IOLA 3MX3A 1RZ4A 3ZVVA 2V5QC 1OWMA 2I9CA 2QC9A 4EECA 1SZAA 2OEWA 4MKTA 3NOGD 3SNXA 3URZA 4L9PA 3FTSA 3D9LA 4KT6B 4UQXA 1JCRA 3ASGA 5FQ4A 5LCWC 4B8AA 4APOA 1SA4A 3PUKA 2BEDA 3APDA 2BUGA 2XZTG 2BF0X 4DX6D 4GTMA 3SBSA 3K9IA 4JEUA 3L17A 4KYOB 1E8XA 2IFUA 3SZ7A 1EF1C 4E6HA 3LCAA 4DUIA 4J8FA 3CGHA 1HH8A 2IF4A 4AVXA 3PNLB 5CMWA 1H2TC 5AIJA 3OXLA 2WXNA 1HX8A 1WM5A 3ONKA 1OWLA 5CHEE 3T9KA 3RIBA 3FUNA 4GCNA 4OAUC 4WNEA 4KZ0A 3MZLB 4C0EA 3L16A 3MCXA 3PZ2A 3VTYA 3CVXA 3DPYA 2WXMA 1ELWA 4FULA 3CKBA 3DRAA 1DC2A 4EPZA 3UT4A 3FUFA 4GTTA 2CFUA 3IKOB 3L6AA 5KBAA 2B6CA 4U7EB 3CVUA 2L0IA 2V8SE 3CVNA 4G24A 3AG4E 2XZDG 1FVHA 3ONLA 4ANXA 4DRXE 3SBTB 2C0LA 2V0PA 4N5CA 5D0QD 1Q2ZA 3D9MA 4PH4B 3Q73A 1TYQG 3TG4A 4L1BA 4G23A 3ZHEA 3RO3A 3V2OA 3S7DA 3TWTA 1IKND 4TXRA 2AXZA 3QWWA 1O1RA 1V54E 5E75A 3FU5A 2J9QA 4FA6A 3RRNB 2DYRE 3S7BA 2QYJA 4UQYA 3CLJA 3CQCB 4UWFA 2J09A 4HLEA 3JCKC 5DBKA 1OWNA 2VSYA 4WWPA 5EX3A 3U9WA 2OCCE 4I43A 4F7AA 4JHKA 5EKQD 4N3BA 5FTPA 3HXDA 2ZGGA 3LVQE 4OYSA 3LXUX 2WMNA 1KZOA 2H6HA 4IULA 4ATZD 4PS7A 4L7TA 3KAEA 1XNFA 4CDMA 2P9UG 3PEVB 4DLQA 2XCBA 4J8EA 2VSOE 3Q78A 4UUCA 3E32A 2XGMA 4B0ZA 4UQZA 3L9TA 3ULQA 4JXTA 4I1AA 5A23A 1QNFA 1E8YA 2PQRA 3I3NA 5G05C 1EDUA 4UWHA 3QKYA 3MKQB 4URKA 3L54A 4ANUA 2Y0BG 3AS5A 4Y6WA 5M72A 2XCCA 3LJNA 4F1PA 4WNFA 1HF8A 2WXFA 3ABLE 2XHEA 3SFXA 4TUUA 5G05J 5D66A 3IBEA 4IRUA 2PM7A 4FHJA 1FVFA 2VSNA 3R9MA 2WQ7A 4FP7A 2FF4A 4XI0A 2WXLA 3ABKE 1ZB1A 4KVMA 2DVWA 3QK0A 3EHRA 4G8LA 5KNHD 3LVRE 3MKQA 4JPSA 4UI9K 4B93B 4U63A 3I4RB 3GZSA 5G55A 1BD8A 4TXPA 1KT1A 3JYSA 3W9FA 4U8VD 2VJ8A 1Y8MA 2I2OA 2GRRB 1SQMA 1MHQA 2KZTB 1Z3XA 4YDOA 4FC8A 3HHMA 4IYPA 5EILA 2HE0A 3L13A 4YNDA 3CHOA 5JA4D 5LP0A 3FEXA 1NA0A 4W9RA 5G04J 1V55E 2I1JA 4GU5A 1TEZA 4HS2A 2XRZA 1KZPA 1E8ZA 4HORA 5FQ7A 2HR2A 1IQRA 2VSXE 3V30A 2GRNB 5AQ9A 2Y1LE 3TJPA 4GMRA 3FTVA 2AVPA 1BI7B 3SFZA 3ZU7B 3PZDA 2XRYA 3CHSA 3FU3A 4JEHA 4A63B 3TG5A 1NA3A 2LSUA 3Q75A 3QWPA 1N4QA 5LFAA 5EDSA 1FT1A 4J8SA 4U04A 5ENOD 3ULYA 3KEAA 3FH5A 4QQIA 4I17A 4M7CA 3CV0A 3EHQA 4CGWA 2PZIA 4EZJA 5CMYA 2VGXA 5AJDA 2XQ0A 3ZW3A 1IHBA 4JB8P 3SY2A 3B7BA 5CECB 1TN7A 3NQPA 2UY1A 1OXJA 2HO1A 3FU0A 2I6HA 2GRPB 3GZ2A 1HS6A 1LD8A 1WG0A 1JCSA 3DWLG 3HXFA 1YYHA 3DSTA 3V31A 3UT7A 3BG0B 4PS3A 2DBAA 4OAVB 3U3WA 4BX9A 3HXEA 3N71A 5AQ7A 4CT0A 2AJAA 5AAOA 1N95A 4LRZA 1MYOA 4I2ZA 3MA5A 3SO8A 3ESLA 1OT8A 2GGFA 1D8DA 5AYWD 3Q49B 5ARGA 4EZLA 1S63A 3CR3A 4YVOA 4DK5A 4DX2A 4BESA 4X8QA 5FQ8A 5D2MC 2DYSE 3JXIA 4E85A 4G1TA 3D9JA 4AJWA 3MKRA 5DIZA 4I2WA 3FFLA 3MGBA 5B1AE 2IOSA 5ENTD 5ENQD 3ASDA 2DZNA 4LNGA 1A5EA 3FUJA 2RFMA 3EUVA 1N0QA 3RO2A 4ACKA 1P5QA 4RLYA 3CEQA 3ZXSA 2GW1A 4LEUA 4DX7D 5LCWJ 4BSXA 4WNGA 4O1OA 1KT0A 4TRQA 2OVFA 3Q79A 3PDNA 3ZUVB 5G04C 3LY7A 5JHAA 4AY5A 3S2AA 3EIJA 2RKKA 2ZIRA 4YDYA 1N0RA 4XIFA 1NP7A 3C98A 3EHNA 1K8KG 3TL5A 3AS8A 3HXBA 4F53A 3CHRA 1NFIE 2ZISA 4TV3A 2OEVA 4AOFA 3HVEA 4F3VA 3QOUA 4D10C 3LS8A 4EBAG 4O60A 3UPVA 2AW6A 3B7SA 3ZYMA 4LG6A 1DVPA 2WXKA 1IYGA 3LY9A 5CEAA 1MZCA 4ANVA 4HI8A 2LXMA 2YHEA 4LSZE 1IXVA 3FEYA 4KXKB 1N4SA 3ZNGA 3CK9A 3D9IA 2KXPC 4FU3A 5EYPF 5KJLA 4CZ2D 3FTZA 2L0TB 3P1UA 2VGYA 2F8YA 5BNWA 3LKUA 1RW2A 5ENSD 4XI9A 4BSZB 1NI1A 5EN5D 4NRHB 3FTWA 2ZU6B 4FJYA 1OCRE 3AG1E 3B7UX 4DI4A 3F6QA 4GTQA 3ESKA 3RRMB 3JQ0A 2RD0A 4N3CA 3U66A 2XPZA 2WXRA 5HS0A 4KBQA 2JEKA 5ANRA 3GYZA 4F6RD 3UKRG 4LNBA 5T8IA 1EPUA 2WXPA 2XEVA 3UM0A 3UQ3A 4GPMA 1Y6IA 4K0RA 5D0OD 3HDXA 2BKKB 4OVUA 3QWVA 1Z6TA 1TR4A 4CGVA 2Y4TA 2CHWA 1H6OA 1NZNA 4XE0A 3WXXA 4JHRA 1BLXB 3KD7A 3W9GA 3CVQA 2H6GA 1HE8A 3O48A 3Q7AA 1E8WA 4GTVA 4WWNA 3LEWA 4Q96A 4A3TA 2YHCA 3L22A 4AP2A 3LDZA 3SFYA 5JJ6A 2EIJE 2EIKE 2NYJA 5CBOA 1HG5A 2R17C 3PH0C 1U2VG 4I1MA 3MYVA 4KZCA 4RSYA 1INZA 2FO1E 3Q4AB 2L6JA 3JXJA 1MX4A 4FJZA 5KJKA 2AWIA 3AAAC 4PS8A 3EU5A 3FH8A 3DSUA 3QNKA 2CHXA 4JA9A 3DEOA 4MBGA 5IY5E 3TWUA 4A1SA 4ILIA 3FUDA 4DLOA 2J4BA 4BTAA 3R9AB 1TN8A 4XKBA 1WAO1 2C2LA 3NZUA 4GZ6A 4LUNU 3T5XA 5B3SE 2PM6A 2WXIA 2KCVA 2R2LA 3E30A 4H7XA 1ELRA 4PDXA 3UIPC 3NAWA 4JA7A 2IO3C 2GRLA 3DEPA 5FZQA 2X3MA 3FH7A 3KSLA 1H6KA 3KS2A 5BPPA 2OOEA 1QBQA 1A17A 3CHQA 4HXIA 3BQOA 2P9NG 3FU6A 4U96D 4K5BA 4GYYA 3ML8A 2QFCA 2VTBA 3JQ1A 5KWDA 3D9OA 3QC1A 1N52A 4DX5D 3E34A 2QYUA 4Z68A 4BERA 3PVLA 2A4ZA 1H2VC 1LD7A 3BG1B 2NSZA 1OWOA 3FTXA 5HQ8A 4MS6A 2Q7FA 2X6HA 3E4BA 2P9LG 4U8HA 3JUIA 4EHMA 4L23A 2KCKA 3FTUA 5CERB 3CHPA 1H0AA 1MX2A 4NACA 3CVLA 4ZFHA 1ZU2A 2Y4UA 4I6EA 3V79K 4CEMA 2R59A 4RQIA 3SQVA 3SGHA 3HRAA 4G26A 2XPYA 3Q5MA 5FZSA 1W3BA 3E33A 2ETAA 3UINC 4JVSA 3ISMC 1OY3D 2WXHA 3ZYQA 3ENEA 2ZGDA 2P9PG 2YINA 3Q7FA 3C3OA 5HRYA 2VYIA 1Z3YA 2M63A 4EBAA 4CYMD 1MX6A 3D9KA 5ANLA 4B94A 1YCSB 2WXJA 2EQXA 3IEGA 3IXEA 5B1BE 2R03A 2QZAA 3LJ3A 3QJZA 2I1KA 3PZ3A 3PRZA 3RSEG 4N2QA 2ONDA 5FT9A 1YMPA 2LNIA 3Q47B 4ZHBA 5AJLA 5BUZA 3J5PA 3LPZA 1S0PA 3KEZA 5T3RA 3RK6A 3AJIA 4AXHA 4GA0A 4N39A 3PUJA 4RVBA 4UWLA 2YQ8A 4M3OA 3L08A 5CRUA 4AM9A 2F37A 1U3CA 3LY8A 2LUHA 3B95A 2C0MA 3CVVA 3DSVA 2NC9A 4FHKA 5HKPA 1K1AA 3SHFA 3IHYA 3X2QE 2MHKA 5AARA 1N54A 5JMND 4Q69A 3QARA 2J49A 3UM3A 2VGXB 4WNDA 4N3AA 4G11A 4GPKA 1AP7A 1OCZE 4K5CA 5J08A 4BT8A 4GYOA 2IONA 1HFAA 2RG8A 5FIOA 2H6IA 2AXVA 3CK8A 4LERA 5AQAA 2WXQA 2CHZA 1H2UA 4U07A 2WB2A 4YDEA 4HB5A 2WXGA 4U8YD 3DSWA 2ETCA 4GTRA 3U64A 4ACLA 4O6FA 5H7PA 3B7TA 4HQDA 1KPSB 2KZTA 3UKUG 2XEEA 2FO7A 4J6IA 3T5VA 4F1SA 4BY6A 1HG2A 4L2LA 3D3MA 3RU0A 5EIBE 4I6GA 3WG7E 3HIZA 1L5JA 3ZKJA 3UM1A 2OV8A 4UI9C 3AU5A 3MV2B 2XPIA 5FINA 4GA1A 3EDTB 3HYMB 1UG3A 3FUHA 3ASFA 2WQ6A 1N9AA 2FI7A 2PQNA 2LO6A 5FWQA 1BPOA 3SF4A 3UT8A 3B13A 4APFA 1TNZA 2XENA 5HI7A 4L2YA 3ASOE 2XS8A 3TWXA 4N5QA 2P2CP 5FJYA 2J07A 2KC7A 1PAQA 2LXLA 3PS6A 4J8YA 4GTOA 4GZ3A 3EU9A 5KNGA 3QAQA 1OWPA 2J08A 4I1OB 4A1GA 3TGOA 3S7FA 1KLXA 3FUMA 3ASNE 3I5PA 3NOCD 3I4GA 1N94A 4I9CA 5C1DA 2DZOA 5JHBA 3GW4A 4ABNA 3PNTB 2R5SA 3BEEA 4UWGA 3CVYA 3HVEB 2P9SG 4UI9J 4XX5A 1WDYA 3ZYLA 2MOWA 3HXCA 4HRLA 4BFRA 3FWVA 3RKVA 1ELKA 4AIFA 4MLPA 3KSQA 3UTMA 4UWKA 4HFGA 5ENNA 2JABA 4J0UA 2XGOA 3FDHA 5E76A 4XKCA 2V4LA 2DWZA 5BXUA 2F0YA 1FCHA 3DSSA 3APCA 4BEPA 3DXMG 3NBNB 3D9NA 3IHVA 5CEDB 1E90A 4U0UA 1O1SA 2E2EA 2IU1A 1E7UA 3NF1A 5CCLA 4FLHA 4HBDA 1HU3A 3TWQA 2WVIA 2BKGA 3PE3A 2P58C 4U0SA 4OVVA 4A55A 3ZRHA 4JZYA 3APFA 3Q9UC 2X6IA 1D9SA 3S7JA 1X5BA 3C72A 4ME2A 5BV0A 4BETA 4GAAA 1SA5A 4GTSA 2BTDA 3PEUB 5FZRA 1UJJA 5KJMA 4KVOA 5C2YA 3UX4A 3VTXA 5T4YA 4I9EA 3HG0D 3CVWA 5CCMA 1IQUA 1DCEA 2VGEA 3G2TA 2V4HC 4AY6A 5A6CA 1JWGA 4XEIG 3ASHA 1PY1A 1HO8A 4GA2A 3FULA 5CRVA 4GMLA 4JC8A 1TN6A 2EIME 2X38A 3OXFA 2FBNA 4CDRA 2AXUA 4HRNA 4YDWA 5EX0A 4HOQA 3FUIA 1MJ0A 1SVXA 4ILHB 4DI3A 2PNNA 4DJAA 2FULA 1K1BA 2OVBA 4P29A 4K5AB 3VLFA 1E96B 3G2VA 3FTYA 4LCTA 1VDYA 2XEHA 2X6FA 2PL2A 2EINE 1MQSA 3CK7A 5A7DB 4NURA 4BTBA 1HXIA 3ZXPA 3MV3B 3R7QA 1X81A 4DPRA 1IHGA 2J8SD 1TNYA 2GRMA 4MRUA 3ZN3A 2E0IA 3CSFA 4C48B 4WUYA 3ZHEB 1O5MA 1JPLA 2CG3A 3Q15A 1BU9A 3UMVA 3VLDA 4GYWA 1TNBA 2A5EA 2A5UA 5EIDA 3SI5A 4TUMA 3BUAA 4ILGA 1O1TA 3Q9NC 1U3DA 3T8MA 1S70B 3ZFWA 4GB9A 3U4TA 2R05A 4GMJA 2XGSA 4AEZC 2EILE 3EJNA 3G2UA 3IV0A 4ATGA 1N4RA 2L6BA 4G25A 4HOUA 5CBNA 4WAFA 1PC2A 2ZXWE 3TWRA 4HI9A 3TWWA 5ENPD 1UW4B 3CKCA 3J5QB 1B89A 4G2VA 4Q94A 2J4DA 4KMOA 2CFZA 2H6FA 4WWOA 3ML9A 3QB2A 4GZCA 1JCQA 4O1PA 1YA0A 3ZIMA 3CHMA 4C0MA 1HZ4A 5AN8A 3DSXA 3FUKA 4GZDA 4TXQA 5EYLA 2JLBA 4N2SA 2XS1A 5JJTA 1OCCE 2KM4A 2R02A 4HOSA 3CSTA 4BT9A 5G2NA 1BI8B 3CIAA 2GRQB 3B7RL 3GZ1A 5ENRD 5KCMA 5AENA 1N11A 2QY7A 4JD2G 5BV1A 4JHJA 2KATA 3TXMA 2IO2C 1S64A 5LOZA 1EYHA 1TNOA 3AU4A 3OAWA 2IEJA 4BWRA 1QZ2A 3EIQC 3UIOC 1E7VA 3L82A 3CQGB 1XGWA 2DCPA 2WQHA 4GTPA 1FT2A 5BW8C 1K3ZD 3FHEA 4XZ4A 2P9KG 3T8KA 1GW6A 2DIWA 2ILRA 3ULEG 1OCOE 3BU8A 1SZ9A 2V5FA 1UOHA
chains in the Genus database with same CATH topology
3AU5A 3MV2B 4DLQA 2XCBA 4XI9A 4J8EA 2XPIA 4NRHB 4GA1A 2VSOE 2ZU6B 3EDTB 3FTWA 3HYMB 4FJYA 2VTBB 3OXGA 3O4ZA 1UG3A 2XGMA 3FUHA 4B0ZA 3ASFA 2WQ6A 2FI7A 4UQZA 2PQNA 3ULQA 2LO6A 3B7UX 5FWQA 4JXTA 4DI4A 1BPOA 3LYAA 3ESKA 2WM9A 4I1AA 3RRMB 3SF4A 3UT8A 3MEKA 5A23A 1QNFA 3B13A 4Y6CA 1E8YA 2PQRA 3FUEA 3JQ0A 3I3NA 4APFA 4YVQC 4GCOA 5G05C 5HI7A 2RD0A 1EDUA 4N3CA 1TJFA 4L2YA 3U66A 4UWHA 2XPZA 4ANWA 4CRWA 2WXRA 2YNQA 3QKYA 3MKQB 4R7LA 4URKA 4HOTA 4KBQA 2JEKA 5ANRA 2KCLA 3GYZA 3L54A 4ANUA 5FJYA 3QDNA 5T8IA 2J07A 2KC7A 1PAQA 1EPUA 3PS6A 2WXPA 3AS5A 4Y6WA 2XEVA 5M72A 2XCCA 4JW1A 4WNFA 1HF8A 2WXFA 3UQ3A 2XHEA 1Y6IA 4GZ3A 4TUUA 4C9BB 5G05J 4JL0A 4K0RA 3IBEA 3QAQA 5D0OD 4IRUA 2PM7A 4FHJA 1FVFA 3HDXA 1OWPA 2J08A 4I1OB 4OVUA 4A1GA 2VSNA 3TGOA 3S7FA 1KLXA 2WQ7A 3QWVA 1Z6TA 3G2SA 3FUMA 4FP7A 3I5PA 2FF4A 2IJGX 3I4GA 4I9CA 4XI0A 2WXLA 4CGVA 2Y4TA 4KVMA 3R7RA 5C1DA 2CHWA 5JHBA 3QK0A 3GW4A 2NXPA 1LF8A 1NZNA 4XE0A 4ABNA 4FADA 3WXXA 3PNTB 3DPDA 2R5SA 4JHRA 3BEEA 4UWGA 4V3IA 5LX8A 3CVYA 3KD7A 1QQEA 2WMOA 3HVEB 3LVRE 3CVQA 3MKQA 1HE8A 3O48A 4UI9J 4XX5A 3UUXA 3ZYLA 1E8WA 1JWFA 2MOWA 4JPSA 4HVBA 5JJ7A 4WWNA 1DNPA 4UI9K 4U63A 3LEWA 4Q96A 3FP3A 4A3TA 2WPVA 2WXOA 3I4RB 3GZSA 2YHCA 4BFRA 3FWVA 3RKVA 3L22A 4AP2A 1ELKA 5KJNA 5G55A 4AIFA 1JUQA 3LDZA 5JJ6A 4MLPA 4NQ0A 4PUCA 2HM8A 1KT1A 3JYSA 4K03A 4UWKA 1HG5A 2R17C 4HFGA 5ENNA 3PH0C 4J0UA 4B89A 4I1MA 2XGOA 3OTNA 3FDHA 5E76A 3MYVA 2V4LA 4KZCA 4XKCA 2VJ8A 4RSYA 1INZA 2LSVA 1Y8MA 3Q4AB 4AV7A 1WY6A 3P2BA 2VQ2A 1UJKA 2L6JA 3MJWA 4FLBA 2I2OA 1FCHA 3APCA 4FJZA 5KJKA 3D9NA 1SQMA 3IHVA 2AWIA 1MHQA 1E90A 2FEZA 4PS8A 4U0UA 3FH8A 2KZTB 1Z3XA 3QNKA 2CHXA 4JA9A 4A1SA 2E2EA 2IU1A 4FC8A 4ILIA 3FUDA 1E7UA 3HHMA 4CCAA 4DLOA 3NF1A 3PREA 2J4BA 2IQCA 3ZGQA 3EHMA 4FLHA 5CCLA 4IYPA 3ZYKA 4BTAA 2Y3AA 3L13A 3R9AB 1HU3A 1TJCA 4QFVA 2WVIA 4YNDA 3DBSA 3CHOA 4I6JA 3PE3A 4CT4A 2P58C 4J8DA 5FQ6A 4U0SA 4XKBA 5LP0A 4OVVA 1WAO1 3FEXA 2C2LA 3NZUA 4GZ6A 4LUNU 4A3VA 3T5XA 4IN3B 1NA0A 4W9RA 4A55A 3ZRHA 5J90A 5G04J 4JZYA 3ZEFA 2PM6A 2WXIA 3APFA 2KCVA 3D9PA 2I1JA 2X6IA 4GU5A 4H7YA 1TEZA 3S7JA 1X5BA 4HS2A 3SD5A 3TXNA 1E8ZA 2XRZA 4ME2A 4H7XA 1ELRA 5BV0A 4HORA 5FQ7A 4GAAA 2UY1B 3CVPA 3RRUA 4PDXA 1H19A 2HR2A 4JA7A 3RJVA 2GRLA 3TAXA 2LAIA 5FZQA 1IQRA 2VSXE 2X3MA 2BTDA 3FH7A 3VLEA 1H6KA 3KS2A 5BPPA 3PEUB 5FZRA 2OOEA 1A17A 1UJJA 2CG2A 4EQFA 5KJMA 3CHQA 4U0ZA 3PE4A 3AS4A 4HXIA 2LAHA 4KVOA 5C2YA 3TJPA 3UX4A 3VTXA 5T4YA 4I9EA 3FTVA 3FU6A 4RG6A 3CVWA 1UN9A 5CCMA 4B8CB 4GYYA 1IQUA 2AVPA 3G2TA 3ML8A 4AY6A 5A6CA 3SFZA 3FY4A 1JWGA 2QFCA 2VTBA 3PZDA 2XRYA 3CHSA 3FU3A 3JQ1A 4JEHA 3TG5A 3D9OA 1NA3A 3QC1A 3ASHA 2LSUA 3QWPA 1PY1A 1N52A 1HO8A 1ZBPA 5LFAA 2X6JA 5ARFA 4GA2A 3FULA 4GZ5A 3NZSA 4GMLA 4JC8A 4EZKA 5EDSA 4J8SA 4BX8A 3G2WA 4U04A 3PVLA 2A4ZA 1H2VC 1OUVA 2X38A 2MRIA 3OXFA 1UN8A 2UWJG 2HYZA 3BG1B 2NSZA 1OWOA 5BT1A 2X6KA 2FBNA 3FH5A 3FTXA 3ZPJA 4CDRA 5HQ8A 4I17A 2AXUA 4MS6A 4RG9A 3CV0A 4CDNA 2L9BA 2Q7FA 2X6HA 2IOLA 3E4BA 3MX3A 5EX0A 3ZVVA 4HOQA 4U8HA 4CGWA 2PZIA 3JUIA 3FUIA 4L23A 4EZJA 2KCKA 3FTUA 5CMYA 1OWMA 2VGXA 2I9CA 2XQ0A 5AJDA 4ILHB 3ZW3A 3CHPA 4EECA 1H0AA 4DI3A 4DJAA 3NQPA 1SZAA 2UY1A 4NACA 3CVLA 2HO1A 3FU0A 2FULA 2I6HA 4MKTA 1ZU2A 2Y4UA 3GZ2A 2OVBA 1HS6A 4I6EA 4P29A 3SNXA 3URZA 4CEMA 3FTSA 3D9LA 4KT6B 4UQXA 3VLFA 1E96B 3G2VA 3ASGA 5FQ4A 3FTYA 2R59A 4LCTA 3UT7A 5LCWC 3BG0B 4PS3A 2DBAA 1VDYA 4B8AA 3SGHA 3U3WA 2X6FA 4G26A 2XPYA 4APOA 4BX9A 3N71A 3Q5MA 2PL2A 3PUKA 1MQSA 3APDA 4CT0A 3CK7A 2BUGA 5A7DB 5FZSA 1W3BA 2BF0X 4JVSA 3SBSA 4NURA 4BTBA 1HXIA 3K9IA 4JEUA 3MV3B 3R7QA 2WXHA 3ZYQA 4LRZA 3ENEA 3L17A 4KYOB 4DPRA 1IHGA 1E8XA 2GRMA 2IFUA 4MRUA 2YINA 3ZN3A 2E0IA 4I2ZA 3CSFA 3ESLA 3MA5A 2VYIA 1Z3YA 2M63A 2GGFA 1EF1C 4WUYA 5AYWD 3SZ7A 3ZHEB 4E6HA 3Q49B 3LCAA 5ARGA 4EBAA 3D9KA 4EZLA 5ANLA 4B94A 2WXJA 2EQXA 3IEGA 4J8FA 3CGHA 1JPLA 2CG3A 3LJ3A 3Q15A 3QJZA 3CR3A 2I1KA 4YVOA 4DK5A 1HH8A 3UMVA 3PRZA 2IF4A 3VLDA 4AVXA 3PNLB 4GYWA 1H2TC 5CMWA 4N2QA 2ONDA 5AIJA 5FT9A 5FQ8A 2A5UA 2LNIA 3OXLA 2WXNA 3Q47B 4E85A 4G1TA 5AJLA 3D9JA 5BUZA 1HX8A 1WM5A 3LPZA 3ONKA 1OWLA 4AJWA 1S0PA 3MKRA 5DIZA 3SI5A 3KEZA 5CHEE 4ILGA 5T3RA 4I2WA 3RK6A 1U3DA 4AXHA 3T8MA 3RIBA 4GA0A 4N39A 3FUNA 3FFLA 3MGBA 4GCNA 3PUJA 3ZFWA 4GB9A 4WNEA 4RVBA 3U4TA 2IOSA 4KZ0A 4GMJA 3ASDA 2XGSA 3MZLB 4C0EA 4AEZC 3L16A 3MCXA 4UI9C 4UWLA 2YQ8A 4M3OA 3EJNA 3L08A 3G2UA 3VTYA 3FUJA 3IV0A 4AM9A 4ATGA 3CVXA 4G25A 4HOUA 3RO2A 4ACKA 1P5QA 2WXMA 1ELWA 4FULA 3CKBA 4WAFA 1PC2A 4EPZA 1U3CA 3LY8A 3UT4A 3FUFA 2CFUA 3IKOB 3L6AA 2C0MA 3CEQA 3CVVA 3ZXSA 2NC9A 4FHKA 3CVUA 3SHFA 2L0IA 2GW1A 1UW4B 3CKCA 1B89A 4LEUA 2V8SE 3CVNA 3IHYA 4G24A 4G2VA 4Q94A 2MHKA 1FVHA 5LCWJ 2J4DA 1N54A 4KMOA 2CFZA 4WNGA 4BSXA 3ONLA 4Q69A 3QARA 4ANXA 2J49A 4WWOA 3SBTB 1KT0A 2VGXB 2C0LA 2V0PA 4N5CA 5D0QD 4WNDA 4TRQA 3ML9A 3QB2A 4N3AA 4GZCA 2OVFA 3D9MA 4G11A 4PH4B 1YA0A 3ZIMA 3CHMA 4GPKA 4C0MA 3PDNA 1HZ4A 5G04C 5J08A 4BT8A 3LY7A 3TG4A 3FUKA 5JHAA 4L1BA 4G23A 4AY5A 4GZDA 4GYOA 3ZHEA 3RO3A 3S2AA 2IONA 3S7DA 2JLBA 3EIJA 1HFAA 2RG8A 4N2SA 5JJTA 2KM4A 2AXVA 3CK8A 4LERA 4HOSA 2AXZA 2WXQA 3QWWA 4XIFA 3CSTA 1NP7A 4BT9A 2CHZA 1H2UA 3C98A 5G2NA 4U07A 3EHNA 2WB2A 3TL5A 3AS8A 4F53A 3CHRA 3CIAA 3B7RL 3GZ1A 5E75A 4TV3A 2WXGA 3FU5A 4AOFA 5KCMA 2J9QA 4FA6A 3HVEA 3RRNB 4F3VA 3S7BA 3QOUA 5AENA 4UQYA 4D10C 2QY7A 3CLJA 3CQCB 3LS8A 4UWFA 4EBAG 5BV1A 2J09A 3JCKC 4HLEA 4JHJA 3UPVA 2AW6A 3B7SA 2KATA 3U64A 3ZYMA 5DBKA 3TXMA 4ACLA 4O6FA 5LOZA 1EYHA 1OWNA 3AU4A 3OAWA 4BWRA 1DVPA 2WXKA 3B7TA 1QZ2A 3EIQC 1IYGA 2VSYA 3LY9A 1E7VA 4WWPA 5EX3A 3U9WA 3CQGB 1XGWA 4ANVA 2DCPA 4I43A 2YHEA 2WQHA 4F7AA 4JHKA 5EKQD 2KZTA 4N3BA 3FEYA 4KXKB 5FTPA 5BW8C 3CK9A 3D9IA 4FU3A 2FO7A 4J6IA 3T5VA 3FHEA 4BY6A 4XZ4A 4F1SA 5KJLA 1HG2A 3LVQE 4L2LA 4OYSA 3LXUX 3D3MA 3RU0A 1GW6A 2WMNA 2DIWA 2ILRA 3FTZA 4IULA 2L0TB 3P1UA 2VGYA 5BNWA 4PS7A 3LKUA 4I6GA 3HIZA 4L7TA 3KAEA 1L5JA 1XNFA 1SZ9A 2V5FA 4CDMA 2OV8A 3PEVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q4A B;  3MV2 B;  2KCK A;  2XCB A;  2C0M A;  2VQ2 A;  4XI9 A;  2L6J A;  4J8E A;  2VGX A;  3CEQ A;  2NC9 A;  2XPI A;  1FCH A;  4NRH B;  4GA1 A;  5KJK A;  3EDT B;  2GW1 A;  3HYM B;  3CKC A;  1B89 A;  4LEU A;  2UY1 A;  3CVN A;  3OXG A;  4G24 A;  2FEZ A;  4G2V A;  2XGM A;  4U0U A;  3CVL A;  2HO1 A;  2MHK A;  4JA9 A;  5LCW J;  3ASF A;  4WNG A;  2I6H A;  2FI7 A;  4UQZ A;  4A1S A;  1ZU2 A;  2E2E A;  2PQN A;  1Y8M A;  2Y4U A;  3GZ2 A;  3ULQ A;  3NF1 A;  1KT0 A;  3URZ A;  2VGX B;  2C0L A;  4N5C A;  5D0Q D;  3ZGQ A;  3LYA A;  3ESK A;  4I1A A;  4WND A;  4UQX A;  4N3A A;  1E96 B;  3MEK A;  3SF4 A;  3ASG A;  4BTA A;  4Y6C A;  2PQR A;  3R9A B;  1TJC A;  1YA0 A;  4GPK A;  5LCW C;  4YVQ C;  4GCO A;  5G05 C;  3PDN A;  2DBA A;  4YND A;  3U3W A;  1HZ4 A;  5G04 C;  5HI7 A;  4G26 A;  3PE3 A;  4N3C A;  4APO A;  2P58 C;  4J8D A;  3N71 A;  4U0S A;  4BT8 A;  3LY7 A;  3Q5M A;  2PL2 A;  1WAO 1;  3TG4 A;  3QKY A;  2C2L A;  4G23 A;  4GZ6 A;  3CK7 A;  2BUG A;  4GYO A;  5A7D B;  4KBQ A;  5FZS A;  4IN3 B;  1W3B A;  1NA0 A;  3RO3 A;  4W9R A;  2KCL A;  3S7D A;  3ZHE A;  3GYZ A;  5G04 J;  2JLB A;  4BTB A;  1HXI A;  5FJY A;  3K9I A;  4N2S A;  3QDN A;  5JJT A;  3MV3 B;  2KC7 A;  2KCV A;  4H7Y A;  3CK8 A;  3S7J A;  3AS5 A;  4KYO B;  4HOS A;  1IHG A;  2XEV A;  3QWW A;  4XIF A;  4Y6W A;  2XCC A;  5M72 A;  4ME2 A;  2IFU A;  4H7X A;  1ELR A;  4WNF A;  4BT9 A;  3UQ3 A;  4HOR A;  2UY1 B;  3CVP A;  4I2Z A;  4U07 A;  3MA5 A;  3ZN3 A;  4GZ3 A;  2VYI A;  4WUY A;  3ZHE B;  3SZ7 A;  5AYW D;  2HR2 A;  4JA7 A;  5G05 J;  3Q49 B;  3AS8 A;  3LCA A;  4JL0 A;  5ARG A;  3RJV A;  5FZQ A;  3TAX A;  5D0O D;  4B94 A;  3IEG A;  3TGO A;  3GZ1 A;  2VSN A;  4J8F A;  3S7F A;  1KLX A;  3KS2 A;  3Q15 A;  3QWV A;  2J9Q A;  4YVO A;  5FZR A;  2OOE A;  1HH8 A;  1A17 A;  2FF4 A;  3QOU A;  3S7B A;  4EQF A;  4F3V A;  4UQY A;  5KJM A;  2IF4 A;  4GYW A;  4U0Z A;  3PE4 A;  3AS4 A;  4I9C A;  2OND A;  4XI0 A;  4N2Q A;  4CGV A;  2Y4T A;  4HOT A;  3UPV A;  5FT9 A;  3VTX A;  5C1D A;  2KAT A;  5DBK A;  2LNI A;  3OXL A;  3GW4 A;  4I9E A;  1NZN A;  4O6F A;  3Q47 B;  4RG6 A;  4ABN A;  4G1T A;  5CCM A;  3WXX A;  2R5S A;  4GYY A;  2AVP A;  1WM5 A;  4JHR A;  3LPZ A;  4BWR A;  3BEE A;  1QZ2 A;  4AY6 A;  3KD7 A;  2VSY A;  1QQE A;  3LY9 A;  3MKR A;  5DIZ A;  5A6C A;  1IYG A;  2QFC A;  3CVQ A;  5CHE E;  3O48 A;  4UI9 J;  5EX3 A;  3TG5 A;  3UUX A;  1NA3 A;  4I2W A;  5JJ7 A;  3ASH A;  2LSU A;  3QWP A;  2WQH A;  3RIB A;  4GA0 A;  4N39 A;  1ZBP A;  4GCN A;  3FFL A;  4UI9 K;  5EKQ D;  5ARF A;  4N3B A;  4KXK B;  3FP3 A;  4GA2 A;  4GZ5 A;  5FTP A;  3ZFW A;  4AY5 A;  2WPV A;  4WNE A;  3U4T A;  5BW8 C;  3CK9 A;  2YHC A;  3ASD A;  2XGS A;  2FO7 A;  4U04 A;  3FWV A;  5CCL A;  3RKV A;  5KJL A;  1OUV A;  2YQ8 A;  5KJN A;  3OXF A;  2UWJ G;  4AIF A;  3VTY A;  2HYZ A;  4AM9 A;  3RU0 A;  5JJ6 A;  4NQ0 A;  1KT1 A;  3JYS A;  5BT1 A;  2FBN A;  4G25 A;  4HOU A;  3ZPJ A;  3RO2 A;  4CDR A;  5HQ8 A;  1P5Q A;  4I17 A;  1ELW A;  2VGY A;  3CKB A;  4RG9 A;  3CV0 A;  4J0U A;  3LKU A;  2Q7F A;  5BNW A;  1PC2 A;  2XGO A;  3E4B A;  3KAE A;  1XNF A;  5EX0 A;  4HOQ A;  2V5F A;  3LY8 A;  4CGW A;  2PZI A;  4UI9 C;  2LSV A; 
#chains in the Genus database with same CATH topology
 5AQB A;  2VTB B;  3OXG A;  3O4Z A;  1TNU A;  3TWS A;  2ETB A;  3LYA A;  2WM9 A;  2P9I G;  3MEK A;  3D9H A;  1LTX A;  3PZ4 A;  4Y6C A;  3FUE A;  4YVQ C;  4GCO A;  3NB2 A;  1TJF A;  2B0O E;  1QYM A;  1NL4 A;  4ANW A;  1N4P A;  4CRW A;  2YNQ A;  4R7L A;  2F8X K;  4HOT A;  2KCL A;  4HLL A;  3QDN A;  3TWV A;  2RFA A;  4JW1 A;  4HRM B;  1SW6 A;  4C9B B;  4JL0 A;  1G3N B;  3G2S A;  2IJG X;  2KBX A;  3R7R A;  3ABM E;  3AG3 E;  3UI2 A;  3E37 A;  2NXP A;  1LF8 A;  4FAD A;  1FPP A;  3DPD A;  4NIK A;  4V3I A;  5LX8 A;  1QQE A;  2WMO A;  3C3R A;  3UUX A;  5JJ7 A;  1JWF A;  4HVB A;  1H6P A;  1DNP A;  3FP3 A;  2WPV A;  2WXO A;  4DX1 A;  5ITZ F;  5KJN A;  1JUQ A;  4NQ0 A;  4PUC A;  2HM8 A;  4K03 A;  4LNU D;  4B89 A;  3OTN A;  4HNA D;  3DXK G;  2Y69 E;  2LSV A;  5BXO A;  4AV7 A;  1WY6 A;  3P2B A;  2VQ2 A;  1UJK A;  3MJW A;  4FLB A;  3UXG A;  2IY0 C;  4U95 D;  2FEZ A;  3AG2 E;  4CCA A;  3PRE A;  2IQC A;  3ZGQ A;  3EHM A;  3ZYK A;  2Y3A A;  1TJC A;  4QFV A;  3DBS A;  4I6J A;  4CT4 A;  2MYO A;  2GRO B;  4J8D A;  5FQ6 A;  1AWC B;  4J7W A;  4A3V A;  4IN3 B;  5J90 A;  3ZEF A;  1D8E A;  3D9P A;  4H7Y A;  3SD5 A;  3TXN A;  3RAU A;  2UY1 B;  3CVP A;  3RRU A;  1H19 A;  3RJV A;  3TAX A;  3C3Q A;  2LAI A;  3JUE A;  3VLE A;  2CG2 A;  4EQF A;  4U0Z A;  3PE4 A;  3AS4 A;  2LAH A;  1Z5S C;  4G8K A;  4RG6 A;  1UN9 A;  4B8C B;  3PZ1 A;  3FY4 A;  3C5R A;  1ZBP A;  2X6J A;  5ARF A;  1DCQ A;  4GZ5 A;  3UM2 A;  3NZS A;  4EZK A;  4BX8 A;  3G2W A;  1OUV A;  2MRI A;  1UN8 A;  2UWJ G;  2HYZ A;  3V2X A;  2X6K A;  5BT1 A;  3ZPJ A;  4RG9 A;  4CDN A;  2L9B A;  2IOL A;  3MX3 A;  1RZ4 A;  3ZVV A;  2V5Q C;  1OWM A;  2I9C A;  2QC9 A;  4EEC A;  1SZA A;  2OEW A;  4MKT A;  3NOG D;  3SNX A;  3URZ A;  4L9P A;  3FTS A;  3D9L A;  4KT6 B;  4UQX A;  1JCR A;  3ASG A;  5FQ4 A;  5LCW C;  4B8A A;  4APO A;  1SA4 A;  3PUK A;  2BED A;  3APD A;  2BUG A;  2XZT G;  2BF0 X;  4DX6 D;  4GTM A;  3SBS A;  3K9I A;  4JEU A;  3L17 A;  4KYO B;  1E8X A;  2IFU A;  3SZ7 A;  1EF1 C;  4E6H A;  3LCA A;  4DUI A;  4J8F A;  3CGH A;  1HH8 A;  2IF4 A;  4AVX A;  3PNL B;  5CMW A;  1H2T C;  5AIJ A;  3OXL A;  2WXN A;  1HX8 A;  1WM5 A;  3ONK A;  1OWL A;  5CHE E;  3T9K A;  3RIB A;  3FUN A;  4GCN A;  4OAU C;  4WNE A;  4KZ0 A;  3MZL B;  4C0E A;  3L16 A;  3MCX A;  3PZ2 A;  3VTY A;  3CVX A;  3DPY A;  2WXM A;  1ELW A;  4FUL A;  3CKB A;  3DRA A;  1DC2 A;  4EPZ A;  3UT4 A;  3FUF A;  4GTT A;  2CFU A;  3IKO B;  3L6A A;  5KBA A;  2B6C A;  4U7E B;  3CVU A;  2L0I A;  2V8S E;  3CVN A;  4G24 A;  3AG4 E;  2XZD G;  1FVH A;  3ONL A;  4ANX A;  4DRX E;  3SBT B;  2C0L A;  2V0P A;  4N5C A;  5D0Q D;  1Q2Z A;  3D9M A;  4PH4 B;  3Q73 A;  1TYQ G;  3TG4 A;  4L1B A;  4G23 A;  3ZHE A;  3RO3 A;  3V2O A;  3S7D A;  3TWT A;  1IKN D;  4TXR A;  2AXZ A;  3QWW A;  1O1R A;  1V54 E;  5E75 A;  3FU5 A;  2J9Q A;  4FA6 A;  3RRN B;  2DYR E;  3S7B A;  2QYJ A;  4UQY A;  3CLJ A;  3CQC B;  4UWF A;  2J09 A;  4HLE A;  3JCK C;  5DBK A;  1OWN A;  2VSY A;  4WWP A;  5EX3 A;  3U9W A;  2OCC E;  4I43 A;  4F7A A;  4JHK A;  5EKQ D;  4N3B A;  5FTP A;  3HXD A;  2ZGG A;  3LVQ E;  4OYS A;  3LXU X;  2WMN A;  1KZO A;  2H6H A;  4IUL A;  4ATZ D;  4PS7 A;  4L7T A;  3KAE A;  1XNF A;  4CDM A;  2P9U G;  3PEV B;  4DLQ A;  2XCB A;  4J8E A;  2VSO E;  3Q78 A;  4UUC A;  3E32 A;  2XGM A;  4B0Z A;  4UQZ A;  3L9T A;  3ULQ A;  4JXT A;  4I1A A;  5A23 A;  1QNF A;  1E8Y A;  2PQR A;  3I3N A;  5G05 C;  1EDU A;  4UWH A;  3QKY A;  3MKQ B;  4URK A;  3L54 A;  4ANU A;  2Y0B G;  3AS5 A;  4Y6W A;  5M72 A;  2XCC A;  3LJN A;  4F1P A;  4WNF A;  1HF8 A;  2WXF A;  3ABL E;  2XHE A;  3SFX A;  4TUU A;  5G05 J;  5D66 A;  3IBE A;  4IRU A;  2PM7 A;  4FHJ A;  1FVF A;  2VSN A;  3R9M A;  2WQ7 A;  4FP7 A;  2FF4 A;  4XI0 A;  2WXL A;  3ABK E;  1ZB1 A;  4KVM A;  2DVW A;  3QK0 A;  3EHR A;  4G8L A;  5KNH D;  3LVR E;  3MKQ A;  4JPS A;  4UI9 K;  4B93 B;  4U63 A;  3I4R B;  3GZS A;  5G55 A;  1BD8 A;  4TXP A;  1KT1 A;  3JYS A;  3W9F A;  4U8V D;  2VJ8 A;  1Y8M A;  2I2O A;  2GRR B;  1SQM A;  1MHQ A;  2KZT B;  1Z3X A;  4YDO A;  4FC8 A;  3HHM A;  4IYP A;  5EIL A;  2HE0 A;  3L13 A;  4YND A;  3CHO A;  5JA4 D;  5LP0 A;  3FEX A;  1NA0 A;  4W9R A;  5G04 J;  1V55 E;  2I1J A;  4GU5 A;  1TEZ A;  4HS2 A;  2XRZ A;  1KZP A;  1E8Z A;  4HOR A;  5FQ7 A;  2HR2 A;  1IQR A;  2VSX E;  3V30 A;  2GRN B;  5AQ9 A;  2Y1L E;  3TJP A;  4GMR A;  3FTV A;  2AVP A;  1BI7 B;  3SFZ A;  3ZU7 B;  3PZD A;  2XRY A;  3CHS A;  3FU3 A;  4JEH A;  4A63 B;  3TG5 A;  1NA3 A;  2LSU A;  3Q75 A;  3QWP A;  1N4Q A;  5LFA A;  5EDS A;  1FT1 A;  4J8S A;  4U04 A;  5ENO D;  3ULY A;  3KEA A;  3FH5 A;  4QQI A;  4I17 A;  4M7C A;  3CV0 A;  3EHQ A;  4CGW A;  2PZI A;  4EZJ A;  5CMY A;  2VGX A;  5AJD A;  2XQ0 A;  3ZW3 A;  1IHB A;  4JB8 P;  3SY2 A;  3B7B A;  5CEC B;  1TN7 A;  3NQP A;  2UY1 A;  1OXJ A;  2HO1 A;  3FU0 A;  2I6H A;  2GRP B;  3GZ2 A;  1HS6 A;  1LD8 A;  1WG0 A;  1JCS A;  3DWL G;  3HXF A;  1YYH A;  3DST A;  3V31 A;  3UT7 A;  3BG0 B;  4PS3 A;  2DBA A;  4OAV B;  3U3W A;  4BX9 A;  3HXE A;  3N71 A;  5AQ7 A;  4CT0 A;  2AJA A;  5AAO A;  1N95 A;  4LRZ A;  1MYO A;  4I2Z A;  3MA5 A;  3SO8 A;  3ESL A;  1OT8 A;  2GGF A;  1D8D A;  5AYW D;  3Q49 B;  5ARG A;  4EZL A;  1S63 A;  3CR3 A;  4YVO A;  4DK5 A;  4DX2 A;  4BES A;  4X8Q A;  5FQ8 A;  5D2M C;  2DYS E;  3JXI A;  4E85 A;  4G1T A;  3D9J A;  4AJW A;  3MKR A;  5DIZ A;  4I2W A;  3FFL A;  3MGB A;  5B1A E;  2IOS A;  5ENT D;  5ENQ D;  3ASD A;  2DZN A;  4LNG A;  1A5E A;  3FUJ A;  2RFM A;  3EUV A;  1N0Q A;  3RO2 A;  4ACK A;  1P5Q A;  4RLY A;  3CEQ A;  3ZXS A;  2GW1 A;  4LEU A;  4DX7 D;  5LCW J;  4BSX A;  4WNG A;  4O1O A;  1KT0 A;  4TRQ A;  2OVF A;  3Q79 A;  3PDN A;  3ZUV B;  5G04 C;  3LY7 A;  5JHA A;  4AY5 A;  3S2A A;  3EIJ A;  2RKK A;  2ZIR A;  4YDY A;  1N0R A;  4XIF A;  1NP7 A;  3C98 A;  3EHN A;  1K8K G;  3TL5 A;  3AS8 A;  3HXB A;  4F53 A;  3CHR A;  1NFI E;  2ZIS A;  4TV3 A;  2OEV A;  4AOF A;  3HVE A;  4F3V A;  3QOU A;  4D10 C;  3LS8 A;  4EBA G;  4O60 A;  3UPV A;  2AW6 A;  3B7S A;  3ZYM A;  4LG6 A;  1DVP A;  2WXK A;  1IYG A;  3LY9 A;  5CEA A;  1MZC A;  4ANV A;  4HI8 A;  2LXM A;  2YHE A;  4LSZ E;  1IXV A;  3FEY A;  4KXK B;  1N4S A;  3ZNG A;  3CK9 A;  3D9I A;  2KXP C;  4FU3 A;  5EYP F;  5KJL A;  4CZ2 D;  3FTZ A;  2L0T B;  3P1U A;  2VGY A;  2F8Y A;  5BNW A;  3LKU A;  1RW2 A;  5ENS D;  4XI9 A;  4BSZ B;  1NI1 A;  5EN5 D;  4NRH B;  3FTW A;  2ZU6 B;  4FJY A;  1OCR E;  3AG1 E;  3B7U X;  4DI4 A;  3F6Q A;  4GTQ A;  3ESK A;  3RRM B;  3JQ0 A;  2RD0 A;  4N3C A;  3U66 A;  2XPZ A;  2WXR A;  5HS0 A;  4KBQ A;  2JEK A;  5ANR A;  3GYZ A;  4F6R D;  3UKR G;  4LNB A;  5T8I A;  1EPU A;  2WXP A;  2XEV A;  3UM0 A;  3UQ3 A;  4GPM A;  1Y6I A;  4K0R A;  5D0O D;  3HDX A;  2BKK B;  4OVU A;  3QWV A;  1Z6T A;  1TR4 A;  4CGV A;  2Y4T A;  2CHW A;  1H6O A;  1NZN A;  4XE0 A;  3WXX A;  4JHR A;  1BLX B;  3KD7 A;  3W9G A;  3CVQ A;  2H6G A;  1HE8 A;  3O48 A;  3Q7A A;  1E8W A;  4GTV A;  4WWN A;  3LEW A;  4Q96 A;  4A3T A;  2YHC A;  3L22 A;  4AP2 A;  3LDZ A;  3SFY A;  5JJ6 A;  2EIJ E;  2EIK E;  2NYJ A;  5CBO A;  1HG5 A;  2R17 C;  3PH0 C;  1U2V G;  4I1M A;  3MYV A;  4KZC A;  4RSY A;  1INZ A;  2FO1 E;  3Q4A B;  2L6J A;  3JXJ A;  1MX4 A;  4FJZ A;  5KJK A;  2AWI A;  3AAA C;  4PS8 A;  3EU5 A;  3FH8 A;  3DSU A;  3QNK A;  2CHX A;  4JA9 A;  3DEO A;  4MBG A;  5IY5 E;  3TWU A;  4A1S A;  4ILI A;  3FUD A;  4DLO A;  2J4B A;  4BTA A;  3R9A B;  1TN8 A;  4XKB A;  1WAO 1;  2C2L A;  3NZU A;  4GZ6 A;  4LUN U;  3T5X A;  5B3S E;  2PM6 A;  2WXI A;  2KCV A;  2R2L A;  3E30 A;  4H7X A;  1ELR A;  4PDX A;  3UIP C;  3NAW A;  4JA7 A;  2IO3 C;  2GRL A;  3DEP A;  5FZQ A;  2X3M A;  3FH7 A;  3KSL A;  1H6K A;  3KS2 A;  5BPP A;  2OOE A;  1QBQ A;  1A17 A;  3CHQ A;  4HXI A;  3BQO A;  2P9N G;  3FU6 A;  4U96 D;  4K5B A;  4GYY A;  3ML8 A;  2QFC A;  2VTB A;  3JQ1 A;  5KWD A;  3D9O A;  3QC1 A;  1N52 A;  4DX5 D;  3E34 A;  2QYU A;  4Z68 A;  4BER A;  3PVL A;  2A4Z A;  1H2V C;  1LD7 A;  3BG1 B;  2NSZ A;  1OWO A;  3FTX A;  5HQ8 A;  4MS6 A;  2Q7F A;  2X6H A;  3E4B A;  2P9L G;  4U8H A;  3JUI A;  4EHM A;  4L23 A;  2KCK A;  3FTU A;  5CER B;  3CHP A;  1H0A A;  1MX2 A;  4NAC A;  3CVL A;  4ZFH A;  1ZU2 A;  2Y4U A;  4I6E A;  3V79 K;  4CEM A;  2R59 A;  4RQI A;  3SQV A;  3SGH A;  3HRA A;  4G26 A;  2XPY A;  3Q5M A;  5FZS A;  1W3B A;  3E33 A;  2ETA A;  3UIN C;  4JVS A;  3ISM C;  1OY3 D;  2WXH A;  3ZYQ A;  3ENE A;  2ZGD A;  2P9P G;  2YIN A;  3Q7F A;  3C3O A;  5HRY A;  2VYI A;  1Z3Y A;  2M63 A;  4EBA A;  4CYM D;  1MX6 A;  3D9K A;  5ANL A;  4B94 A;  1YCS B;  2WXJ A;  2EQX A;  3IEG A;  3IXE A;  5B1B E;  2R03 A;  2QZA A;  3LJ3 A;  3QJZ A;  2I1K A;  3PZ3 A;  3PRZ A;  3RSE G;  4N2Q A;  2OND A;  5FT9 A;  1YMP A;  2LNI A;  3Q47 B;  4ZHB A;  5AJL A;  5BUZ A;  3J5P A;  3LPZ A;  1S0P A;  3KEZ A;  5T3R A;  3RK6 A;  3AJI A;  4AXH A;  4GA0 A;  4N39 A;  3PUJ A;  4RVB A;  4UWL A;  2YQ8 A;  4M3O A;  3L08 A;  5CRU A;  4AM9 A;  2F37 A;  1U3C A;  3LY8 A;  2LUH A;  3B95 A;  2C0M A;  3CVV A;  3DSV A;  2NC9 A;  4FHK A;  5HKP A;  1K1A A;  3SHF A;  3IHY A;  3X2Q E;  2MHK A;  5AAR A;  1N54 A;  5JMN D;  4Q69 A;  3QAR A;  2J49 A;  3UM3 A;  2VGX B;  4WND A;  4N3A A;  4G11 A;  4GPK A;  1AP7 A;  1OCZ E;  4K5C A;  5J08 A;  4BT8 A;  4GYO A;  2ION A;  1HFA A;  2RG8 A;  5FIO A;  2H6I A;  2AXV A;  3CK8 A;  4LER A;  5AQA A;  2WXQ A;  2CHZ A;  1H2U A;  4U07 A;  2WB2 A;  4YDE A;  4HB5 A;  2WXG A;  4U8Y D;  3DSW A;  2ETC A;  4GTR A;  3U64 A;  4ACL A;  4O6F A;  5H7P A;  3B7T A;  4HQD A;  1KPS B;  2KZT A;  3UKU G;  2XEE A;  2FO7 A;  4J6I A;  3T5V A;  4F1S A;  4BY6 A;  1HG2 A;  4L2L A;  3D3M A;  3RU0 A;  5EIB E;  4I6G A;  3WG7 E;  3HIZ A;  1L5J A;  3ZKJ A;  3UM1 A;  2OV8 A;  4UI9 C;  3AU5 A;  3MV2 B;  2XPI A;  5FIN A;  4GA1 A;  3EDT B;  3HYM B;  1UG3 A;  3FUH A;  3ASF A;  2WQ6 A;  1N9A A;  2FI7 A;  2PQN A;  2LO6 A;  5FWQ A;  1BPO A;  3SF4 A;  3UT8 A;  3B13 A;  4APF A;  1TNZ A;  2XEN A;  5HI7 A;  4L2Y A;  3ASO E;  2XS8 A;  3TWX A;  4N5Q A;  2P2C P;  5FJY A;  2J07 A;  2KC7 A;  1PAQ A;  2LXL A;  3PS6 A;  4J8Y A;  4GTO A;  4GZ3 A;  3EU9 A;  5KNG A;  3QAQ A;  1OWP A;  2J08 A;  4I1O B;  4A1G A;  3TGO A;  3S7F A;  1KLX A;  3FUM A;  3ASN E;  3I5P A;  3NOC D;  3I4G A;  1N94 A;  4I9C A;  5C1D A;  2DZO A;  5JHB A;  3GW4 A;  4ABN A;  3PNT B;  2R5S A;  3BEE A;  4UWG A;  3CVY A;  3HVE B;  2P9S G;  4UI9 J;  4XX5 A;  1WDY A;  3ZYL A;  2MOW A;  3HXC A;  4HRL A;  4BFR A;  3FWV A;  3RKV A;  1ELK A;  4AIF A;  4MLP A;  3KSQ A;  3UTM A;  4UWK A;  4HFG A;  5ENN A;  2JAB A;  4J0U A;  2XGO A;  3FDH A;  5E76 A;  4XKC A;  2V4L A;  2DWZ A;  5BXU A;  2F0Y A;  1FCH A;  3DSS A;  3APC A;  4BEP A;  3DXM G;  3NBN B;  3D9N A;  3IHV A;  5CED B;  1E90 A;  4U0U A;  1O1S A;  2E2E A;  2IU1 A;  1E7U A;  3NF1 A;  5CCL A;  4FLH A;  4HBD A;  1HU3 A;  3TWQ A;  2WVI A;  2BKG A;  3PE3 A;  2P58 C;  4U0S A;  4OVV A;  4A55 A;  3ZRH A;  4JZY A;  3APF A;  3Q9U C;  2X6I A;  1D9S A;  3S7J A;  1X5B A;  3C72 A;  4ME2 A;  5BV0 A;  4BET A;  4GAA A;  1SA5 A;  4GTS A;  2BTD A;  3PEU B;  5FZR A;  1UJJ A;  5KJM A;  4KVO A;  5C2Y A;  3UX4 A;  3VTX A;  5T4Y A;  4I9E A;  3HG0 D;  3CVW A;  5CCM A;  1IQU A;  1DCE A;  2VGE A;  3G2T A;  2V4H C;  4AY6 A;  5A6C A;  1JWG A;  4XEI G;  3ASH A;  1PY1 A;  1HO8 A;  4GA2 A;  3FUL A;  5CRV A;  4GML A;  4JC8 A;  1TN6 A;  2EIM E;  2X38 A;  3OXF A;  2FBN A;  4CDR A;  2AXU A;  4HRN A;  4YDW A;  5EX0 A;  4HOQ A;  3FUI A;  1MJ0 A;  1SVX A;  4ILH B;  4DI3 A;  2PNN A;  4DJA A;  2FUL A;  1K1B A;  2OVB A;  4P29 A;  4K5A B;  3VLF A;  1E96 B;  3G2V A;  3FTY A;  4LCT A;  1VDY A;  2XEH A;  2X6F A;  2PL2 A;  2EIN E;  1MQS A;  3CK7 A;  5A7D B;  4NUR A;  4BTB A;  1HXI A;  3ZXP A;  3MV3 B;  3R7Q A;  1X81 A;  4DPR A;  1IHG A;  2J8S D;  1TNY A;  2GRM A;  4MRU A;  3ZN3 A;  2E0I A;  3CSF A;  4C48 B;  4WUY A;  3ZHE B;  1O5M A;  1JPL A;  2CG3 A;  3Q15 A;  1BU9 A;  3UMV A;  3VLD A;  4GYW A;  1TNB A;  2A5E A;  2A5U A;  5EID A;  3SI5 A;  4TUM A;  3BUA A;  4ILG A;  1O1T A;  3Q9N C;  1U3D A;  3T8M A;  1S70 B;  3ZFW A;  4GB9 A;  3U4T A;  2R05 A;  4GMJ A;  2XGS A;  4AEZ C;  2EIL E;  3EJN A;  3G2U A;  3IV0 A;  4ATG A;  1N4R A;  2L6B A;  4G25 A;  4HOU A;  5CBN A;  4WAF A;  1PC2 A;  2ZXW E;  3TWR A;  4HI9 A;  3TWW A;  5ENP D;  1UW4 B;  3CKC A;  3J5Q B;  1B89 A;  4G2V A;  4Q94 A;  2J4D A;  4KMO A;  2CFZ A;  2H6F A;  4WWO A;  3ML9 A;  3QB2 A;  4GZC A;  1JCQ A;  4O1P A;  1YA0 A;  3ZIM A;  3CHM A;  4C0M A;  1HZ4 A;  5AN8 A;  3DSX A;  3FUK A;  4GZD A;  4TXQ A;  5EYL A;  2JLB A;  4N2S A;  2XS1 A;  5JJT A;  1OCC E;  2KM4 A;  2R02 A;  4HOS A;  3CST A;  4BT9 A;  5G2N A;  1BI8 B;  3CIA A;  2GRQ B;  3B7R L;  3GZ1 A;  5ENR D;  5KCM A;  5AEN A;  1N11 A;  2QY7 A;  4JD2 G;  5BV1 A;  4JHJ A;  2KAT A;  3TXM A;  2IO2 C;  1S64 A;  5LOZ A;  1EYH A;  1TNO A;  3AU4 A;  3OAW A;  2IEJ A;  4BWR A;  1QZ2 A;  3EIQ C;  3UIO C;  1E7V A;  3L82 A;  3CQG B;  1XGW A;  2DCP A;  2WQH A;  4GTP A;  1FT2 A;  5BW8 C;  1K3Z D;  3FHE A;  4XZ4 A;  2P9K G;  3T8K A;  1GW6 A;  2DIW A;  2ILR A;  3ULE G;  1OCO E;  3BU8 A;  1SZ9 A;  2V5F A;  1UOH A; 
#chains in the Genus database with same CATH homology
 3AU5 A;  3MV2 B;  4DLQ A;  2XCB A;  4XI9 A;  4J8E A;  2XPI A;  4NRH B;  4GA1 A;  2VSO E;  2ZU6 B;  3EDT B;  3FTW A;  3HYM B;  4FJY A;  2VTB B;  3OXG A;  3O4Z A;  1UG3 A;  2XGM A;  3FUH A;  4B0Z A;  3ASF A;  2WQ6 A;  2FI7 A;  4UQZ A;  2PQN A;  3ULQ A;  2LO6 A;  3B7U X;  5FWQ A;  4JXT A;  4DI4 A;  1BPO A;  3LYA A;  3ESK A;  2WM9 A;  4I1A A;  3RRM B;  3SF4 A;  3UT8 A;  3MEK A;  5A23 A;  1QNF A;  3B13 A;  4Y6C A;  1E8Y A;  2PQR A;  3FUE A;  3JQ0 A;  3I3N A;  4APF A;  4YVQ C;  4GCO A;  5G05 C;  5HI7 A;  2RD0 A;  1EDU A;  4N3C A;  1TJF A;  4L2Y A;  3U66 A;  4UWH A;  2XPZ A;  4ANW A;  4CRW A;  2WXR A;  2YNQ A;  3QKY A;  3MKQ B;  4R7L A;  4URK A;  4HOT A;  4KBQ A;  2JEK A;  5ANR A;  2KCL A;  3GYZ A;  3L54 A;  4ANU A;  5FJY A;  3QDN A;  5T8I A;  2J07 A;  2KC7 A;  1PAQ A;  1EPU A;  3PS6 A;  2WXP A;  3AS5 A;  4Y6W A;  2XEV A;  5M72 A;  2XCC A;  4JW1 A;  4WNF A;  1HF8 A;  2WXF A;  3UQ3 A;  2XHE A;  1Y6I A;  4GZ3 A;  4TUU A;  4C9B B;  5G05 J;  4JL0 A;  4K0R A;  3IBE A;  3QAQ A;  5D0O D;  4IRU A;  2PM7 A;  4FHJ A;  1FVF A;  3HDX A;  1OWP A;  2J08 A;  4I1O B;  4OVU A;  4A1G A;  2VSN A;  3TGO A;  3S7F A;  1KLX A;  2WQ7 A;  3QWV A;  1Z6T A;  3G2S A;  3FUM A;  4FP7 A;  3I5P A;  2FF4 A;  2IJG X;  3I4G A;  4I9C A;  4XI0 A;  2WXL A;  4CGV A;  2Y4T A;  4KVM A;  3R7R A;  5C1D A;  2CHW A;  5JHB A;  3QK0 A;  3GW4 A;  2NXP A;  1LF8 A;  1NZN A;  4XE0 A;  4ABN A;  4FAD A;  3WXX A;  3PNT B;  3DPD A;  2R5S A;  4JHR A;  3BEE A;  4UWG A;  4V3I A;  5LX8 A;  3CVY A;  3KD7 A;  1QQE A;  2WMO A;  3HVE B;  3LVR E;  3CVQ A;  3MKQ A;  1HE8 A;  3O48 A;  4UI9 J;  4XX5 A;  3UUX A;  3ZYL A;  1E8W A;  1JWF A;  2MOW A;  4JPS A;  4HVB A;  5JJ7 A;  4WWN A;  1DNP A;  4UI9 K;  4U63 A;  3LEW A;  4Q96 A;  3FP3 A;  4A3T A;  2WPV A;  2WXO A;  3I4R B;  3GZS A;  2YHC A;  4BFR A;  3FWV A;  3RKV A;  3L22 A;  4AP2 A;  1ELK A;  5KJN A;  5G55 A;  4AIF A;  1JUQ A;  3LDZ A;  5JJ6 A;  4MLP A;  4NQ0 A;  4PUC A;  2HM8 A;  1KT1 A;  3JYS A;  4K03 A;  4UWK A;  1HG5 A;  2R17 C;  4HFG A;  5ENN A;  3PH0 C;  4J0U A;  4B89 A;  4I1M A;  2XGO A;  3OTN A;  3FDH A;  5E76 A;  3MYV A;  2V4L A;  4KZC A;  4XKC A;  2VJ8 A;  4RSY A;  1INZ A;  2LSV A;  1Y8M A;  3Q4A B;  4AV7 A;  1WY6 A;  3P2B A;  2VQ2 A;  1UJK A;  2L6J A;  3MJW A;  4FLB A;  2I2O A;  1FCH A;  3APC A;  4FJZ A;  5KJK A;  3D9N A;  1SQM A;  3IHV A;  2AWI A;  1MHQ A;  1E90 A;  2FEZ A;  4PS8 A;  4U0U A;  3FH8 A;  2KZT B;  1Z3X A;  3QNK A;  2CHX A;  4JA9 A;  4A1S A;  2E2E A;  2IU1 A;  4FC8 A;  4ILI A;  3FUD A;  1E7U A;  3HHM A;  4CCA A;  4DLO A;  3NF1 A;  3PRE A;  2J4B A;  2IQC A;  3ZGQ A;  3EHM A;  4FLH A;  5CCL A;  4IYP A;  3ZYK A;  4BTA A;  2Y3A A;  3L13 A;  3R9A B;  1HU3 A;  1TJC A;  4QFV A;  2WVI A;  4YND A;  3DBS A;  3CHO A;  4I6J A;  3PE3 A;  4CT4 A;  2P58 C;  4J8D A;  5FQ6 A;  4U0S A;  4XKB A;  5LP0 A;  4OVV A;  1WAO 1;  3FEX A;  2C2L A;  3NZU A;  4GZ6 A;  4LUN U;  4A3V A;  3T5X A;  4IN3 B;  1NA0 A;  4W9R A;  4A55 A;  3ZRH A;  5J90 A;  5G04 J;  4JZY A;  3ZEF A;  2PM6 A;  2WXI A;  3APF A;  2KCV A;  3D9P A;  2I1J A;  2X6I A;  4GU5 A;  4H7Y A;  1TEZ A;  3S7J A;  1X5B A;  4HS2 A;  3SD5 A;  3TXN A;  1E8Z A;  2XRZ A;  4ME2 A;  4H7X A;  1ELR A;  5BV0 A;  4HOR A;  5FQ7 A;  4GAA A;  2UY1 B;  3CVP A;  3RRU A;  4PDX A;  1H19 A;  2HR2 A;  4JA7 A;  3RJV A;  2GRL A;  3TAX A;  2LAI A;  5FZQ A;  1IQR A;  2VSX E;  2X3M A;  2BTD A;  3FH7 A;  3VLE A;  1H6K A;  3KS2 A;  5BPP A;  3PEU B;  5FZR A;  2OOE A;  1A17 A;  1UJJ A;  2CG2 A;  4EQF A;  5KJM A;  3CHQ A;  4U0Z A;  3PE4 A;  3AS4 A;  4HXI A;  2LAH A;  4KVO A;  5C2Y A;  3TJP A;  3UX4 A;  3VTX A;  5T4Y A;  4I9E A;  3FTV A;  3FU6 A;  4RG6 A;  3CVW A;  1UN9 A;  5CCM A;  4B8C B;  4GYY A;  1IQU A;  2AVP A;  3G2T A;  3ML8 A;  4AY6 A;  5A6C A;  3SFZ A;  3FY4 A;  1JWG A;  2QFC A;  2VTB A;  3PZD A;  2XRY A;  3CHS A;  3FU3 A;  3JQ1 A;  4JEH A;  3TG5 A;  3D9O A;  1NA3 A;  3QC1 A;  3ASH A;  2LSU A;  3QWP A;  1PY1 A;  1N52 A;  1HO8 A;  1ZBP A;  5LFA A;  2X6J A;  5ARF A;  4GA2 A;  3FUL A;  4GZ5 A;  3NZS A;  4GML A;  4JC8 A;  4EZK A;  5EDS A;  4J8S A;  4BX8 A;  3G2W A;  4U04 A;  3PVL A;  2A4Z A;  1H2V C;  1OUV A;  2X38 A;  2MRI A;  3OXF A;  1UN8 A;  2UWJ G;  2HYZ A;  3BG1 B;  2NSZ A;  1OWO A;  5BT1 A;  2X6K A;  2FBN A;  3FH5 A;  3FTX A;  3ZPJ A;  4CDR A;  5HQ8 A;  4I17 A;  2AXU A;  4MS6 A;  4RG9 A;  3CV0 A;  4CDN A;  2L9B A;  2Q7F A;  2X6H A;  2IOL A;  3E4B A;  3MX3 A;  5EX0 A;  3ZVV A;  4HOQ A;  4U8H A;  4CGW A;  2PZI A;  3JUI A;  3FUI A;  4L23 A;  4EZJ A;  2KCK A;  3FTU A;  5CMY A;  1OWM A;  2VGX A;  2I9C A;  2XQ0 A;  5AJD A;  4ILH B;  3ZW3 A;  3CHP A;  4EEC A;  1H0A A;  4DI3 A;  4DJA A;  3NQP A;  1SZA A;  2UY1 A;  4NAC A;  3CVL A;  2HO1 A;  3FU0 A;  2FUL A;  2I6H A;  4MKT A;  1ZU2 A;  2Y4U A;  3GZ2 A;  2OVB A;  1HS6 A;  4I6E A;  4P29 A;  3SNX A;  3URZ A;  4CEM A;  3FTS A;  3D9L A;  4KT6 B;  4UQX A;  3VLF A;  1E96 B;  3G2V A;  3ASG A;  5FQ4 A;  3FTY A;  2R59 A;  4LCT A;  3UT7 A;  5LCW C;  3BG0 B;  4PS3 A;  2DBA A;  1VDY A;  4B8A A;  3SGH A;  3U3W A;  2X6F A;  4G26 A;  2XPY A;  4APO A;  4BX9 A;  3N71 A;  3Q5M A;  2PL2 A;  3PUK A;  1MQS A;  3APD A;  4CT0 A;  3CK7 A;  2BUG A;  5A7D B;  5FZS A;  1W3B A;  2BF0 X;  4JVS A;  3SBS A;  4NUR A;  4BTB A;  1HXI A;  3K9I A;  4JEU A;  3MV3 B;  3R7Q A;  2WXH A;  3ZYQ A;  4LRZ A;  3ENE A;  3L17 A;  4KYO B;  4DPR A;  1IHG A;  1E8X A;  2GRM A;  2IFU A;  4MRU A;  2YIN A;  3ZN3 A;  2E0I A;  4I2Z A;  3CSF A;  3ESL A;  3MA5 A;  2VYI A;  1Z3Y A;  2M63 A;  2GGF A;  1EF1 C;  4WUY A;  5AYW D;  3SZ7 A;  3ZHE B;  4E6H A;  3Q49 B;  3LCA A;  5ARG A;  4EBA A;  3D9K A;  4EZL A;  5ANL A;  4B94 A;  2WXJ A;  2EQX A;  3IEG A;  4J8F A;  3CGH A;  1JPL A;  2CG3 A;  3LJ3 A;  3Q15 A;  3QJZ A;  3CR3 A;  2I1K A;  4YVO A;  4DK5 A;  1HH8 A;  3UMV A;  3PRZ A;  2IF4 A;  3VLD A;  4AVX A;  3PNL B;  4GYW A;  1H2T C;  5CMW A;  4N2Q A;  2OND A;  5AIJ A;  5FT9 A;  5FQ8 A;  2A5U A;  2LNI A;  3OXL A;  2WXN A;  3Q47 B;  4E85 A;  4G1T A;  5AJL A;  3D9J A;  5BUZ A;  1HX8 A;  1WM5 A;  3LPZ A;  3ONK A;  1OWL A;  4AJW A;  1S0P A;  3MKR A;  5DIZ A;  3SI5 A;  3KEZ A;  5CHE E;  4ILG A;  5T3R A;  4I2W A;  3RK6 A;  1U3D A;  4AXH A;  3T8M A;  3RIB A;  4GA0 A;  4N39 A;  3FUN A;  3FFL A;  3MGB A;  4GCN A;  3PUJ A;  3ZFW A;  4GB9 A;  4WNE A;  4RVB A;  3U4T A;  2IOS A;  4KZ0 A;  4GMJ A;  3ASD A;  2XGS A;  3MZL B;  4C0E A;  4AEZ C;  3L16 A;  3MCX A;  4UI9 C;  4UWL A;  2YQ8 A;  4M3O A;  3EJN A;  3L08 A;  3G2U A;  3VTY A;  3FUJ A;  3IV0 A;  4AM9 A;  4ATG A;  3CVX A;  4G25 A;  4HOU A;  3RO2 A;  4ACK A;  1P5Q A;  2WXM A;  1ELW A;  4FUL A;  3CKB A;  4WAF A;  1PC2 A;  4EPZ A;  1U3C A;  3LY8 A;  3UT4 A;  3FUF A;  2CFU A;  3IKO B;  3L6A A;  2C0M A;  3CEQ A;  3CVV A;  3ZXS A;  2NC9 A;  4FHK A;  3CVU A;  3SHF A;  2L0I A;  2GW1 A;  1UW4 B;  3CKC A;  1B89 A;  4LEU A;  2V8S E;  3CVN A;  3IHY A;  4G24 A;  4G2V A;  4Q94 A;  2MHK A;  1FVH A;  5LCW J;  2J4D A;  1N54 A;  4KMO A;  2CFZ A;  4WNG A;  4BSX A;  3ONL A;  4Q69 A;  3QAR A;  4ANX A;  2J49 A;  4WWO A;  3SBT B;  1KT0 A;  2VGX B;  2C0L A;  2V0P A;  4N5C A;  5D0Q D;  4WND A;  4TRQ A;  3ML9 A;  3QB2 A;  4N3A A;  4GZC A;  2OVF A;  3D9M A;  4G11 A;  4PH4 B;  1YA0 A;  3ZIM A;  3CHM A;  4GPK A;  4C0M A;  3PDN A;  1HZ4 A;  5G04 C;  5J08 A;  4BT8 A;  3LY7 A;  3TG4 A;  3FUK A;  5JHA A;  4L1B A;  4G23 A;  4AY5 A;  4GZD A;  4GYO A;  3ZHE A;  3RO3 A;  3S2A A;  2ION A;  3S7D A;  2JLB A;  3EIJ A;  1HFA A;  2RG8 A;  4N2S A;  5JJT A;  2KM4 A;  2AXV A;  3CK8 A;  4LER A;  4HOS A;  2AXZ A;  2WXQ A;  3QWW A;  4XIF A;  3CST A;  1NP7 A;  4BT9 A;  2CHZ A;  1H2U A;  3C98 A;  5G2N A;  4U07 A;  3EHN A;  2WB2 A;  3TL5 A;  3AS8 A;  4F53 A;  3CHR A;  3CIA A;  3B7R L;  3GZ1 A;  5E75 A;  4TV3 A;  2WXG A;  3FU5 A;  4AOF A;  5KCM A;  2J9Q A;  4FA6 A;  3HVE A;  3RRN B;  4F3V A;  3S7B A;  3QOU A;  5AEN A;  4UQY A;  4D10 C;  2QY7 A;  3CLJ A;  3CQC B;  3LS8 A;  4UWF A;  4EBA G;  5BV1 A;  2J09 A;  3JCK C;  4HLE A;  4JHJ A;  3UPV A;  2AW6 A;  3B7S A;  2KAT A;  3U64 A;  3ZYM A;  5DBK A;  3TXM A;  4ACL A;  4O6F A;  5LOZ A;  1EYH A;  1OWN A;  3AU4 A;  3OAW A;  4BWR A;  1DVP A;  2WXK A;  3B7T A;  1QZ2 A;  3EIQ C;  1IYG A;  2VSY A;  3LY9 A;  1E7V A;  4WWP A;  5EX3 A;  3U9W A;  3CQG B;  1XGW A;  4ANV A;  2DCP A;  4I43 A;  2YHE A;  2WQH A;  4F7A A;  4JHK A;  5EKQ D;  2KZT A;  4N3B A;  3FEY A;  4KXK B;  5FTP A;  5BW8 C;  3CK9 A;  3D9I A;  4FU3 A;  2FO7 A;  4J6I A;  3T5V A;  3FHE A;  4BY6 A;  4XZ4 A;  4F1S A;  5KJL A;  1HG2 A;  3LVQ E;  4L2L A;  4OYS A;  3LXU X;  3D3M A;  3RU0 A;  1GW6 A;  2WMN A;  2DIW A;  2ILR A;  3FTZ A;  4IUL A;  2L0T B;  3P1U A;  2VGY A;  5BNW A;  4PS7 A;  3LKU A;  4I6G A;  3HIZ A;  4L7T A;  3KAE A;  1L5J A;  1XNF A;  1SZ9 A;  2V5F A;  4CDM A;  2OV8 A;  3PEV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...