4APOA

Aip tpr domain in complex with human tomm20 peptide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
142
structure length
142
Chain Sequence
b'AEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALEARI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AH RECEPTOR-INTERACTING PROTEIN
publication title Structure of the Tpr Domain of Aip: Lack of Client Protein Interaction with the C-Terminal Alpha-7 Helix of the Tpr Domain of Aip is Sufficient for Pituitary Adenoma Predisposition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 60
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4apoA00
3GZ2A 3CVNA 3LY8A 1HZ4A 3RO2A 4UI9J 5AYWD 5BW8C 1IHGA 5M72A 2XPIA 5KJLA 4BWRA 1HXIA 2C0MA 3SF4A 3CKBA 4N2QA 2IF4A 3ESKA 4G1TA 3ULQA 2WQHA 2WPVA 4UQXA 3UUXA 2Q7FA 2HR2A 3QKYA 4KBQA 2UY1B 4BT8A 3S7FA 3Q49B 4I2ZA 5FTPA 3GZ1A 2XGMA 3PDNA 4Y6CA 4CDRA 4IN3B 3OXFA 2FEZA 5JJ6A 2HO1A 1KLXA 4J8DA 4GA2A 4KYOB 5G05C 4HORA 2R5SA 3ASHA 4XIFA 3N71A 2VQ2A 5FZQA 3HYMB 2YHCA 5FT9A 3CV0A 5KJMA 3MA5A 3S7DA 2FBNA 3CKCA 3OXLA 4BT9A 4HOQA 4B94A 3CVPA 4I17A 5LCWC 4NQ0A 1P5QA 5BT1A 2ONDA 3PE4A 4O6FA 4GPKA 4WNGA 5HQ8A 1ELRA 2C0LA 5D0OD 4UQZA 1Y8MA 4GZ5A 2LSUA 2HYZA 3QOUA 4YNDA 5JJTA 2UWJG 3O48A 4GYWA 4I2WA 4EQFA 3FP3A 1WM5A 2XCCA 3TG5A 5KJNA 3TG4A 3BEEA 2KCKA 4I9CA 1PC2A 1IYGA 2UY1A 3CVLA 2C2LA 2E2EA 1ELWA 3ZHEB 4CGWA 4GA1A 4GYYA 4HOTA 3Q47B 3VTXA 3FFLA 5LCWJ 5EX0A 4JA7A 4U07A 5G04C 4U04A 3ASGA 4JL0A 3QWPA 3ASDA 4JA9A 3CK9A 3RIBA 3VTYA 4AY5A 3Q4AB 4U0UA 2VSYA 3E4BA 5CCLA 2NC9A 5DIZA 3LCAA 3MV3B 4I9EA 3CVQA 4GZ6A 2FF4A 2PQRA 4N3AA 2P58C 5EX3A 2JLBA 4BTBA 2KCVA 5CCMA 3U3WA 3AS5A 2VGXA 2XEVA 3WXXA 4N5CA 3RKVA 2PQNA 4UQYA 4GCNA 4HOUA 1OUVA 3Q5MA 3MEKA 5G04J 4RG6A 4G2VA 2QFCA 4Y6WA 3ZHEA 1FCHA 2OOEA 4RG9A 2XGSA 2BUGA 1WAO1 2VGXB 2J9QA 2KCLA 2DBAA 4AIFA 3LY9A 2FO7A 1XNFA 5JJ7A 3TAXA 4WNFA 1W3BA 2XGOA 4UI9K 3U4TA 5A7DB 5FJYA 2V5FA 3Q15A 5G05J 2PZIA 2KC7A 3RJVA 4ME2A 5DBKA 5A6CA 1ZBPA 2FI7A 3ASFA 3K9IA 3IEGA 4CGVA 4G24A 3GW4A 2KATA 5EKQD 4AY6A 3R9AB 1NA3A 1KT1A 3ZPJA 3MKRA 2IFUA 4GA0A 2Y4UA 3UPVA 3S7BA 3AS8A 4YVQC 1HH8A 3GYZA 4HOSA 4BTAA 1E96B 2L6JA 2I6HA 2YQ8A 2VSNA 3KAEA 2LNIA 5HI7A 3CK8A 2VYIA 3AS4A 1NZNA 4GCOA 5BNWA 2GW1A 3QWWA 1ZU2A 4N3CA 4GZ3A 4G26A 3RO3A 3KD7A 3EDTB 3KS2A 4H7YA 3RU0A 5C1DA 1B89A 4A1SA 2LSVA 4NRHB 5FZSA 4J8FA 3QWVA 5D0QD 1QZ2A 3LY7A 4H7XA 5CHEE 3PE3A 3QDNA 4KXKB 2AVPA 4XI0A 4I1AA 4XI9A 3LYAA 4WNDA 1TJCA 3SZ7A 3NF1A 4N2SA 3OXGA 4UI9C 4JHRA 4AM9A 4APOA 4WUYA 5FZRA 3MV2B 3LKUA 4ABNA 4U0ZA 3JYSA 4N3BA 1NA0A 3ZGQA 3UQ3A 3S7JA 2XCBA 1YA0A 4F3VA 3FWVA 3ZFWA 5KJKA 5ARGA 1KT0A 4LEUA 2Y4TA 1A17A 3URZA 2VGYA 4N39A 4GYOA 4G23A 4YVOA 1QQEA 2MHKA 4W9RA 5ARFA 3CEQA 4J0UA 2PL2A 4J8EA 3TGOA 3ZN3A 4WNEA 4U0SA 3CK7A 4G25A 3LPZA
chains in the Genus database with same CATH superfamily
3EIJA 2V8SE 2GRRB 3GZ2A 3IHYA 4TXRA 4LRZA 3RO2A 1EF1C 2WQ6A 4I6EA 5AYWD 4ANXA 4ZHBA 4N5QA 1FT2A 3PNTB 3V31A 1E8YA 4DX7D 5FQ6A 5LOZA 4LG6A 1JCRA 3ASNE 3CHMA 2ILRA 2P9LG 3V79K 4G1TA 3ZEFA 2WPVA 4UQXA 1OWPA 1HO8A 4NURA 1DC2A 1UN9A 4GTRA 4HLLA 3LVQE 3FUFA 2IOSA 1DNPA 2XS1A 3RSEG 3CVVA 4J7WA 1OXJA 3AG4E 3Q49B 4I2ZA 5FTPA 3GZ1A 5B3SE 2XGMA 1QNFA 4Y6CA 4CDRA 3Q75A 4IN3B 4V3IA 4GMJA 4J8DA 1H19A 1JPLA 3JQ0A 3ASHA 4XIFA 1N11A 4K5BA 4XX5A 1HU3A 2WMOA 5KJMA 2FBNA 2ZGGA 4I17A 1MQSA 1P5QA 5AAOA 5BT1A 3EHMA 1O5MA 3MYVA 3MGBA 3Q79A 1D8EA 5FIOA 1UJKA 4B89A 4FJYA 2LSUA 1KZOA 1RZ4A 4EBAG 4M7CA 4G8KA 1SW6A 5JJTA 1UOHA 4AOFA 3OTNA 4D10C 2I2OA 1WM5A 2YHEA 3TG5A 5ANRA 3BEEA 1QYMA 2RKKA 4FADA 3UT4A 2ZIRA 3FUDA 1IYGA 2F8YA 2E2EA 3ZYMA 2XRYA 3DSUA 4PH4B 4UWFA 2MRIA 2GRQB 4U8YD 1A5EA 4HOTA 2J49A 3VTXA 3FFLA 1TNYA 5EX0A 4K5AB 4LERA 3JCKC 2B6CA 4JA9A 5EIBE 3QJZA 4RQIA 3V2XA 4AY5A 3Q4AB 3HXEA 2LO6A 3E4BA 1N9AA 4KVMA 2NC9A 4IRUA 3CSFA 5ITZF 3CLJA 4I9EA 1GW6A 3FUMA 2VTBB 4F53A 2RFMA 2P58C 2JLBA 3DXMG 3QB2A 1Q2ZA 4ANWA 3I3NA 4TXQA 2XEVA 4N5CA 3U9WA 4QFVA 2PQNA 3TWUA 2CHXA 4ANVA 2LAHA 1NL4A 4O60A 5AQBA 3FULA 3DSWA 1UJJA 2NXPA 4HRLA 2X3MA 5JHBA 4G2VA 3Q9UC 3R7QA 2BTDA 3FUIA 1HX8A 2QC9A 4EECA 1H6OA 2BUGA 3HXCA 2VGXB 2DBAA 5FINA 4HLEA 5JMND 4A63B 2DVWA 1EPUA 2FULA 2H6HA 3MCXA 1K3ZD 3Q15A 2KC7A 4BETA 4BX8A 2QYUA 1JCQA 3JXJA 3CHOA 3ASFA 4CGVA 4HRMB 4L23A 3GW4A 5EKQD 3LJNA 1NA3A 2IFUA 2L0TB 2I1JA 4GTPA 3EJNA 3UPVA 4TV3A 4YVQC 2YINA 5CEDB 1Y6IA 2CHZA 1HH8A 3LS8A 3QC1A 5AQ9A 1MX4A 3FU5A 2I6HA 4XE0A 3DWLG 1JUQA 4G11A 2LNIA 5HI7A 5FQ8A 1OWOA 2WB2A 2GW1A 3QWWA 1UG3A 3E37A 4FULA 4N3CA 2A5EA 3FTVA 1O1SA 4K0RA 3RO3A 3PRZA 4DX6D 1BD8A 3KS2A 3RU0A 2R02A 4A1SA 5BV1A 2AXZA 2KM4A 1OWLA 1QBQA 1LD7A 3I4GA 3PE3A 3DBSA 3QDNA 1MX2A 4QQIA 2AVPA 4Q96A 4GTOA 2A4ZA 4KVOA 1H0AA 1YCSB 4WNDA 3FU0A 2WXPA 3UX4A 3I4RB 1TJCA 2KBXA 1UN8A 3OXGA 4DLQA 2OEVA 2ZGDA 2OVFA 4JHRA 3PS6A 2JEKA 3TJPA 4ACKA 1E90A 2P9IG 4U0ZA 2OVBA 3JYSA 2XRZA 2XEHA 1YA0A 1AP7A 3FWVA 1OT8A 3ZXPA 5KJKA 4C0EA 4L7TA 3CQCB 5ARGA 1KT0A 4GTVA 3ZVVA 1IHBA 1OWMA 2WXHA 2PM6A 3UT7A 4YVOA 3JUIA 5CECB 4DJAA 1JCSA 2MHKA 5ARFA 3B7SA 4L9PA 2PL2A 2XQ0A 4BFRA 1DCEA 4DPRA 4WNEA 4CZ2D 4U0SA 2IONA 2J07A 4ATZD 2CFUA 1K1BA 1H6PA 5FQ4A 1IHGA 3TXNA 3JQ1A 2C0MA 3SF4A 3MZLB 3UKUG 4KZCA 5ENRD 3Q9NC 3CKBA 4HQDA 1EYHA 3EU9A 4N2QA 3ESKA 4J8SA 5ENQD 3UUXA 3QNKA 3ABKE 3HXFA 2BEDA 4GTMA 4YDEA 2AXUA 2Q7FA 3E34A 4I43A 5IY5E 1HG2A 2P2CP 3FTSA 2LXLA 4HNAD 2WM9A 3AG3E 2UY1B 2WXMA 3ZIMA 4I6GA 3AU5A 1N4RA 2JABA 3PDNA 5AENA 4OAVB 3F6QA 1KLXA 4KYOB 2XZDG 4TUMA 2J08A 3N71A 3PEUB 3NB2A 1K1AA 3T9KA 3FTZA 4RSYA 3E32A 2DZOA 3EHQA 3CKCA 2MYOA 2OCCE 2CG3A 3PZ3A 4LNUD 1H2UA 4HOQA 3FDHA 1H2TC 4FHKA 4O1OA 3D9OA 4NQ0A 1Z3XA 3J5QB 3ISMC 2P9KG 2XPZA 2A5UA 3PE4A 3RRMB 3J5PA 4DLOA 4GPKA 2WXOA 3UM3A 1ELRA 2C0LA 4U7EB 3B95A 4JEHA 4CYMD 4JVSA 4UUCA 1FT1A 4JD2G 4JXTA 2CHWA 1E8ZA 4YNDA 2UWJG 2ZXWE 3DEOA 1DVPA 4GYWA 1N52A 3TXMA 4EQFA 5EDSA 1IKND 2P9SG 3D9NA 3PH0C 4DRXE 1PC2A 2UY1A 2F37A 4JC8A 3PUKA 3ZHEB 4LNGA 2H6FA 3E30A 1TEZA 3D9JA 3ZYKA 3LJ3A 5HKPA 3ESLA 3EHRA 2L6BA 5G04C 2YNQA 3FTXA 3L17A 4I6JA 3QWPA 1TNUA 2XZTG 4L2YA 2Y69E 3TWTA 1S70B 3CK9A 2R2LA 3VTYA 3CHRA 3KEZA 3T8KA 2VSYA 3VLEA 3LCAA 4GZ6A 3W9FA 4DI3A 2PQRA 3UKRG 1SZAA 5FQ7A 1BI7B 5EX3A 4BTBA 1IQUA 3U3WA 2Y1LE 3AS5A 4DK5A 2HM8A 2P9UG 5LP0A 1K8KG 2GROB 3ZNGA 4XZ4A 3ULYA 4UQYA 3C3RA 3BG1B 4U8VD 1OUVA 5CMYA 4P29A 2WVIA 3RAUA 5G04J 3UM0A 1MJ0A 5CERB 4GMLA 4MLPA 3OAWA 1O1RA 4M3OA 3T5XA 3ZHEA 3VLFA 2XHEA 2OOEA 2XGSA 4GPMA 2EINE 4NIKA 2J9QA 1N4SA 2EQXA 1MZCA 2FO7A 2P9PG 1XNFA 5JJ7A 1SA5A 1Z3YA 3T8MA 3PZ1A 1YMPA 3MJWA 5E75A 5FJYA 3RJVA 2WXQA 4EPZA 4HBDA 3CR3A 5A6CA 3K9IA 4G24A 3L6AA 2NYJA 1KT1A 2DYRE 3MKRA 2WXGA 2IO2C 2X6HA 3IHVA 4Z68A 2ETCA 1LF8A 3GYZA 2J4BA 4B8CB 1E96B 2AWIA 2L6JA 3PUJA 1OCZE 3DXKG 5G55A 3APCA 3HHMA 5ENNA 3AAAC 3ZKJA 3CK8A 3S2AA 2VYIA 3NZSA 5BNWA 3FUKA 1TJFA 3KSLA 1ZU2A 3R9MA 3QK0A 4LNBA 1N0RA 3SI5A 3ENEA 2F8XK 2OEWA 3EDTB 4H7YA 5T4YA 4MRUA 4FLHA 2AW6A 2R05A 2I1KA 4UWGA 2OV8A 5A23A 3QWVA 3ABLE 1OCCE 4A3VA 3LY7A 3D9MA 3IV0A 1S64A 4KXKB 1WG0A 1X81A 2WXNA 4PS3A 3MKQB 3Q7FA 3SZ7A 3NF1A 4N2SA 4DX2A 2RG8A 4AM9A 4APOA 3SFZA 3MV2B 3LKUA 4A3TA 4B0ZA 1KPSB 2WXLA 4GTTA 4N3BA 1V55E 3ZGQA 4CRWA 3UQ3A 3TWXA 4KMOA 4J6IA 3FU6A 3ZFWA 4EBAA 5CRVA 3WG7E 5G2NA 5AARA 4LEUA 3D9KA 1A17A 4PS8A 3PREA 3JUEA 3Q7AA 1HF8A 4G23A 1QQEA 5J90A 3IXEA 3CEQA 3G2VA 4ILHB 3TGOA 1HG5A 3ONLA 3LPZA 3D9HA 1HZ4A 5HS0A 1XGWA 4GTQA 2GRMA 5M72A 4F1PA 4GZCA 4XEIG 2XPIA 5KJLA 1HXIA 2DCPA 4BESA 3ULQA 2WQHA 4U8HA 3SGHA 3MKQA 1N95A 3D9IA 2DIWA 4AJWA 4KBQA 3FY4A 3SFXA 4FLBA 3EIQC 4L1BA 2I9CA 2KZTB 3SHFA 4PUCA 5JJ6A 4GA2A 4RVBA 5G05C 1NP7A 2AXVA 2R5SA 3PZDA 4URKA 5BXUA 3BU8A 5ENOD 4KZ0A 5FT9A 1BPOA 3MA5A 3S7DA 2J8SD 4B94A 3LVRE 3C3OA 5ENPD 3BQOA 1BLXB 2EIME 3LXUX 4O6FA 5CBNA 4HRNA 4WNGA 5D0OD 1X5BA 1VDYA 1D9SA 4GZ5A 3QOUA 3UT8A 4BEPA 3SY2A 2EIKE 4I2WA 4JB8P 2XCCA 2KCKA 3FEYA 2RD0A 4I9CA 2L0IA 3FTYA 2Y0BG 5KCMA 4EZKA 2C2LA 3CSTA 1SZ9A 1ELWA 3G2SA 3SNXA 4CGWA 2X6JA 4JZYA 2KZTA 3DPYA 4GA1A 5KNGA 3KEAA 4GYYA 3Q47B 4U07A 4FC8A 3ASGA 4JL0A 3B13A 5T3RA 3ASDA 1OY3D 3TL5A 1SA4A 3B7RL 5DIZA 3HG0D 2H6GA 4AEZC 2FF4A 1H2VC 3FTUA 3IBEA 2GRNB 4N3AA 4TXPA 3ZXSA 5AN8A 1PAQA 5CCMA 3ZYLA 1FVHA 4IULA 1N54A 2IU1A 4F1SA 3WXXA 4LCTA 2VJ8A 3CQGB 2KXPC 2EILE 5KBAA 3ML8A 4C48B 4F7AA 3Q5MA 1IXVA 5JA4D 4ZFHA 3CVUA 1N94A 3UIPC 1LTXA 3VLDA 3RRUA 3DRAA 3FU3A 4HI9A 2FO1E 3SO8A 5C2YA 3B7TA 1PY1A 1WAO1 4GZDA 4WAFA 4WWOA 4XKBA 2DWZA 3TAXA 1IQRA 2ZISA 2R03A 2VSOE 1W3BA 2XGOA 2IO3C 3U4TA 3FUNA 2X38A 2Y3AA 2V5FA 2BF0X 2PZIA 4HXIA 1UW4B 2V4LA 5DBKA 3FH7A 2B0OE 4JHKA 1HS6A 4FJZA 4AY6A 2KATA 5AQAA 4HB5A 5BUZA 4GB9A 4GA0A 2Y4UA 3UM2A 2PNNA 4HOSA 4BTAA 1BI8B 2YQ8A 2VSNA 2J4DA 2LAIA 2GGFA 4AVXA 2ETBA 4CT4A 4GCOA 2XEEA 3UI2A 3FTWA 4KT6B 1FVFA 1N4QA 5ANLA 3CHQA 4ATGA 2X6FA 3LEWA 4C0MA 3DPDA 3UINC 5BXOA 4PS7A 5C1DA 2NSZA 1B89A 2DYSE 3PNLB 3TWVA 4OAUC 2ZU6B 2LSVA 4NRHB 5EILA 5FZSA 3W9GA 3SBSA 4J8FA 3L13A 4H7XA 1TNBA 5D66A 4A55A 4I1AA 1H6KA 3T5VA 1OCRE 4LSZE 4TUUA 3LYAA 4YDYA 4BSZB 3ULEG 3FUEA 4UI9C 3FUJA 2LUHA 5HRYA 4ABNA 3HXDA 3AG2E 3P2BA 3QARA 3HVEB 2WQ7A 3CGHA 4PDXA 1ZB1A 1OWNA 5FWQA 4R7LA 3S7JA 2X6KA 5AJDA 4IYPA 3APFA 3PEVB 4BERA 3C72A 4I1OB 2R17C 4G8LA 3URZA 3Q78A 4N39A 3U66A 4GYOA 2QZAA 3C3QA 3L22A 4U95D 1E7VA 4W9RA 3X2QE 2IY0C 3FHEA 4J0UA 3RRNB 5ENSD 3DEPA 4OYSA 4HFGA 3ZN3A 3B7BA 4G25A 3KSQA 2GRLA 3QAQA 4J8YA 3APDA 3B7UX 3C98A 3FUHA 3DSSA 1N0QA 3CVNA 3LY8A 5B1AE 4UI9J 1JWFA 3L08A 5BW8C 2V5QC 1Z6TA 4BWRA 4B93B 1V54E 1Z5SC 3L16A 2IF4A 2VSXE 2AJAA 3DSVA 4X8QA 2V0PA 4YDOA 3HDXA 2XS8A 1LD8A 2CFZA 1TYQG 4DX5D 1JWGA 4DUIA 5B1BE 4GU5A 2HR2A 3QKYA 4JW1A 3HVEA 1TNZA 3DSXA 4DX1A 2IJGX 4BT8A 3S7FA 2H6IA 4UWKA 3FH8A 3OXFA 4AV7A 1DCQA 2FEZA 3ABME 1NI1A 2HO1A 1AWCB 4HORA 3V2OA 1EDUA 1TR4A 5FZQA 2VQ2A 3HYMB 4MBGA 4E85A 2J09A 5EN5D 4ILIA 2YHCA 3CV0A 4BY6A 2MOWA 5BPPA 3OXLA 4BT9A 3CVPA 4I1MA 5LCWC 4UWHA 5KNHD 2ONDA 4K03A 4XKCA 4CCAA 3SBTB 5AJLA 5HQ8A 1NFIE 2V4HC 4UQZA 1Y8MA 3MX3A 5H7PA 2WXFA 3FEXA 3HXBA 3L9TA 2IEJA 3L54A 4JPSA 3CIAA 2HYZA 3UMVA 3O48A 4JEUA 3BG0B 5EYPF 3FP3A 2WXIA 5KJNA 3TG4A 1BU9A 4EHMA 1TN6A 4JHJA 4GAAA 3FH5A 4BSXA 2VTBA 5AQ7A 3NBNB 3CVLA 5J08A 3CVWA 3ZU7B 3G2UA 3G2TA 4AP2A 3V30A 2QYJA 5E76A 5T8IA 1E8XA 1S0PA 3CVXA 2WMNA 1HFAA 5LCWJ 4JA7A 1TNOA 4U04A 3CVYA 4K5CA 4Q69A 4U63A 2P9NG 3RIBA 4LUNU 5CEAA 1D8DA 4U0UA 5CCLA 1YYHA 1INZA 3MV3B 3CVQA 4UWLA 4FHJA 5D2MC 3ZYQA 3SQVA 5KWDA 2KCVA 1SQMA 1WY6A 3P1UA 5EIDA 5LX8A 1WDYA 2VGXA 3EU5A 3PZ4A 3Q73A 5JHAA 3ML9A 3BUAA 3RKVA 2L9BA 4GCNA 5CMWA 4HOUA 4ACLA 4EZJA 3MEKA 3UTMA 1MHQA 1E8WA 1TN8A 1G3NB 2LXMA 3AU4A 4RG6A 3IKOB 3DSTA 2QFCA 4Y6WA 1MYOA 2WXRA 2XPYA 2X6IA 5LFAA 3HRAA 3ASOE 1L5JA 4WWNA 1FCHA 3TWWA 4RG9A 4GMRA 3ZW3A 4WWPA 3SFYA 2IQCA 2KCLA 3NZUA 4AIFA 3E33A 3LY9A 3EHNA 3NOGD 3R7RA 4WNFA 4YDWA 3L82A 4UI9K 2DZNA 5A7DB 3CHPA 1RW2A 2BKGA 4MKTA 4HI8A 5G05J 1E7UA 4CEMA 3UIOC 4ME2A 3ZUVB 1ZBPA 4ILGA 2HE0A 2FI7A 3IEGA 4FP7A 3NAWA 3R9AB 3ZPJA 4APFA 4OVUA 3UXGA 5BV0A 3S7BA 3NOCD 3AS8A 4TRQA 4Q94A 4OVVA 2E0IA 4O1PA 1ELKA 2WXKA 2F0YA 4BX9A 2VGEA 3KAEA 3GZSA 4GTSA 2IOLA 5ENTD 4DI4A 4RLYA 3AS4A 1NZNA 1S63A 5CRUA 1SVXA 4AXHA 3HIZA 3CHSA 2XENA 3G2WA 4GZ3A 2BKKB 4C9BB 4G26A 1KZPA 4CDMA 3KD7A 2M63A 3AG1E 1O1TA 2QY7A 3ONKA 4ANUA 3D9PA 4A1GA 1FPPA 3JXIA 3D3MA 3PVLA 4CT0A 5D0QD 1QZ2A 4CDNA 5CHEE 2R59A 1TN7A 4XI0A 1MX6A 3AJIA 4L2LA 4EZLA 2WXJA 4XI9A 5AIJA 3NQPA 1N4PA 4NACA 3TWQA 2PM7A 4MS6A 3LDZA 4HS2A 1U2VG 3PZ2A 3UM1A 4WUYA 5FZRA 3RK6A 2EIJE 3U64A 3C5RA 3EUVA 1NA0A 1OCOE 4FA6A 5EYLA 3TWSA 2XCBA 2CG2A 4F3VA 2GRPB 5CBOA 3O4ZA 2ETAA 4E6HA 3TWRA 4FU3A 2RFAA 4B8AA 2Y4TA 4HVBA 3SD5A 3I5PA 2VGYA 1U3CA 1U3DA 3D9LA 4U96D 3ZRHA 4J8EA 1HE8A 4F6RD 3CK7A
chains in the Genus database with same CATH topology
3EIJA 2V8SE 3APDA 3B7UX 3C98A 2CFUA 3FUHA 3GZ2A 3CVNA 3LY8A 1HZ4A 3IHYA 4LRZA 3RO2A 1EF1C 2WQ6A 1XGWA 4UI9J 4I6EA 5FQ4A 5AYWD 4ANXA 1JWFA 3L08A 5BW8C 2GRMA 1IHGA 5M72A 3PNTB 4GZCA 1Z6TA 2XPIA 5KJLA 1E8YA 4BWRA 1HXIA 3TXNA 3JQ1A 2C0MA 5FQ6A 3MZLB 5LOZA 3SF4A 4KZCA 2DCPA 3CKBA 3CHMA 1EYHA 3L16A 2IF4A 2ILRA 3ESKA 4N2QA 4G1TA 2VSXE 3ULQA 3ZEFA 2WQHA 2V0PA 4U8HA 2WPVA 4J8SA 4UQXA 3SGHA 3UUXA 3HDXA 3QNKA 3MKQA 2CFZA 1OWPA 1HO8A 2AXUA 1JWGA 3D9IA 2Q7FA 4GU5A 2HR2A 4NURA 2DIWA 1UN9A 3QKYA 4JW1A 4AJWA 4I43A 1HG2A 4KBQA 3FY4A 3FTSA 3FUFA 3LVQE 3EIQC 2IOSA 4FLBA 4L1BA 3HVEA 1DNPA 2WM9A 2UY1B 2WXMA 2IJGX 3ZIMA 3CVVA 4I6GA 3AU5A 2I9CA 4BT8A 3S7FA 2KZTB 3Q49B 4I2ZA 5FTPA 3SHFA 3GZ1A 4PUCA 2XGMA 4UWKA 1QNFA 3PDNA 4Y6CA 4CDRA 3FH8A 4IN3B 3OXFA 5AENA 4AV7A 4V3IA 2FEZA 5JJ6A 4GMJA 2HO1A 1KLXA 4J8DA 4GA2A 4RVBA 4KYOB 1H19A 5G05C 1NP7A 1JPLA 2AXVA 3JQ0A 4HORA 2R5SA 3ASHA 1EDUA 4XIFA 2J08A 3N71A 2VQ2A 5FZQA 3PZDA 3PEUB 3HYMB 4XX5A 4URKA 4E85A 2J09A 3FTZA 4RSYA 4KZ0A 4ILIA 2YHCA 1HU3A 5FT9A 1BPOA 2WMOA 3CV0A 5KJMA 3MA5A 3S7DA 4BY6A 2FBNA 2MOWA 3CKCA 5BPPA 2CG3A 3OXLA 4BT9A 1H2UA 4HOQA 3FDHA 4B94A 1H2TC 3CVPA 3LVRE 4FHKA 4I1MA 3D9OA 4I17A 5LCWC 4NQ0A 1MQSA 1P5QA 1Z3XA 5BT1A 4UWHA 2XPZA 2ONDA 4K03A 3LXUX 2A5UA 3EHMA 3PE4A 4O6FA 4XKCA 4CCAA 3SBTB 3MYVA 3RRMB 5AJLA 3MGBA 4DLOA 4GPKA 2WXOA 4WNGA 5HQ8A 1ELRA 2C0LA 4JEHA 5D0OD 4JVSA 4UQZA 1X5BA 1UJKA 1VDYA 1Y8MA 3MX3A 4FJYA 4B89A 2WXFA 3FEXA 4GZ5A 4JXTA 2LSUA 4EBAG 3L54A 2CHWA 4JPSA 3CIAA 2HYZA 1E8ZA 3QOUA 4YNDA 5JJTA 3UT8A 2UWJG 4AOFA 1DVPA 3OTNA 3UMVA 3O48A 4GYWA 3BG0B 1N52A 4JEUA 4I2WA 3TXMA 2I2OA 4D10C 4EQFA 3FP3A 1WM5A 2WXIA 2XCCA 2YHEA 3TG5A 5EDSA 5ANRA 3TG4A 5KJNA 3BEEA 2KCKA 3FEYA 2RD0A 4JHJA 3D9NA 3PH0C 4I9CA 4FADA 4GAAA 3FH5A 2L0IA 3FTYA 4BSXA 3UT4A 1PC2A 5KCMA 4EZKA 3FUDA 2VTBA 2UY1A 1IYGA 3CVLA 2C2LA 2E2EA 3CSTA 1SZ9A 3ZYMA 2XRYA 5J08A 3G2UA 1ELWA 3PUKA 4JC8A 4PH4B 3G2SA 3G2TA 3ZHEB 3SNXA 4CGWA 4UWFA 2X6JA 2MRIA 4JZYA 4AP2A 2KZTA 4GA1A 5E76A 5T8IA 1TEZA 3D9JA 4GYYA 3ZYKA 4HOTA 1E8XA 1S0PA 2J49A 3Q47B 3CVXA 3VTXA 3FFLA 3LJ3A 2WMNA 1HFAA 3ESLA 5LCWJ 5EX0A 4JA7A 4U07A 5G04C 2YNQA 3FTXA 4FC8A 3L17A 4U04A 3ASGA 4I6JA 4JL0A 4Q69A 3B13A 3CVYA 4U63A 3QWPA 4LERA 3JCKC 5T3RA 3ASDA 4JA9A 4L2YA 3CK9A 3QJZA 3RIBA 3VTYA 4AY5A 3Q4AB 4LUNU 3CHRA 3KEZA 4U0UA 2LO6A 3TL5A 3B7RL 2VSYA 3E4BA 5CCLA 4KVMA 2NC9A 4IRUA 5DIZA 3CSFA 3VLEA 3LCAA 1INZA 3CLJA 3MV3B 1GW6A 4I9EA 3FUMA 3CVQA 4GZ6A 4UWLA 4AEZC 2FF4A 2VTBB 4DI3A 4F53A 2PQRA 1H2VC 3FTUA 3IBEA 4FHJA 4N3AA 3ZXSA 1SZAA 1PAQA 5FQ7A 3ZYQA 2P58C 5EX3A 2JLBA 4BTBA 2KCVA 1SQMA 1IQUA 1WY6A 3P1UA 5CCMA 3U3WA 3QB2A 3ZYLA 5LX8A 1FVHA 3AS5A 4IULA 1N54A 2IU1A 4ANWA 4DK5A 4F1SA 2HM8A 5LP0A 2VGXA 3I3NA 5JHAA 2XEVA 3WXXA 4N5CA 3ML9A 4LCTA 4XZ4A 2VJ8A 3CQGB 3U9WA 3RKVA 4QFVA 2PQNA 2L9BA 4UQYA 2CHXA 4GCNA 3ML8A 3BG1B 4ANVA 5CMWA 4F7AA 2LAHA 4HOUA 4ACLA 1OUVA 3Q5MA 5CMYA 3FULA 4EZJA 4P29A 1UJJA 2WVIA 3MEKA 2NXPA 5G04J 2X3MA 1MHQA 1E8WA 3AU4A 4RG6A 5JHBA 4G2VA 3IKOB 4GMLA 2QFCA 4Y6WA 2WXRA 3CVUA 2XPYA 2X6IA 4MLPA 3OAWA 5LFAA 4M3OA 3R7QA 1L5JA 4WWNA 3T5XA 2BTDA 1FCHA 3RRUA 3VLDA 2XHEA 3FUIA 3VLFA 3ZHEA 3FU3A 2OOEA 4RG9A 5C2YA 1HX8A 3B7TA 4EECA 2XGSA 3ZW3A 2BUGA 1PY1A 1WAO1 4WWPA 2IQCA 2J9QA 2KCLA 2VGXB 2EQXA 3NZUA 2DBAA 4GZDA 4AIFA 4HLEA 4WAFA 3LY9A 2FO7A 3EHNA 4WWOA 1XNFA 5JJ7A 4XKBA 3TAXA 1Z3YA 1IQRA 3R7RA 1EPUA 3T8MA 4WNFA 2FULA 2VSOE 1W3BA 2XGOA 4UI9K 3U4TA 3MJWA 5E75A 3FUNA 3MCXA 5A7DB 3CHPA 2X38A 4MKTA 5FJYA 2Y3AA 2V5FA 2BF0X 3Q15A 5G05J 2PZIA 1E7UA 2KC7A 4HXIA 4CEMA 3RJVA 4BX8A 2WXQA 4EPZA 4ME2A 1UW4B 3CR3A 2V4LA 5DBKA 3FH7A 5A6CA 1ZBPA 4ILGA 4JHKA 1HS6A 2FI7A 3CHOA 3ASFA 3K9IA 3IEGA 4CGVA 4FJZA 4G24A 4L23A 3GW4A 2KATA 5EKQD 4AY6A 3L6AA 4FP7A 5BUZA 1NA3A 1KT1A 3R9AB 3ZPJA 4APFA 3MKRA 3CVWA 2IFUA 4OVUA 2L0TB 4GB9A 2I1JA 2WXGA 3EJNA 4GA0A 2Y4UA 3UPVA 5BV0A 4TV3A 3S7BA 3AS8A 4TRQA 4YVQC 2YINA 2X6HA 3IHVA 4Q94A 1Y6IA 2CHZA 1HH8A 1LF8A 3LS8A 3QC1A 4OVVA 3GYZA 2J4BA 4B8CB 4HOSA 4BTAA 1E96B 2AWIA 2I6HA 2L6JA 3FU5A 3PUJA 4XE0A 2E0IA 1JUQA 5G55A 1ELKA 2WXKA 3APCA 3HHMA 5ENNA 4BX9A 2YQ8A 2VSNA 4G11A 2J4DA 3KAEA 2LAIA 2LNIA 3GZSA 2GGFA 4AVXA 5HI7A 3CK8A 3S2AA 4CT4A 2IOLA 5FQ8A 1OWOA 2VYIA 2WB2A 3NZSA 4DI4A 3AS4A 1NZNA 3FUKA 4GCOA 4AXHA 5BNWA 2GW1A 3QWWA 1TJFA 1ZU2A 3HIZA 3CHSA 1UG3A 3FTWA 3QK0A 3G2WA 4FULA 4KT6B 4N3CA 3SI5A 1FVFA 4GZ3A 3FTVA 3ENEA 4C9BB 5ANLA 4G26A 4CDMA 4K0RA 3CHQA 4ATGA 3RO3A 2X6FA 3PRZA 3LEWA 4C0MA 3KD7A 2M63A 3DPDA 3EDTB 3KS2A 4H7YA 3RU0A 2QY7A 4PS7A 5C1DA 5T4YA 2NSZA 3ONKA 1B89A 4ANUA 3PNLB 3D9PA 4MRUA 4FLHA 2AW6A 4A1GA 2I1KA 4UWGA 4A1SA 5BV1A 2ZU6B 2LSVA 2OV8A 4NRHB 5A23A 5FZSA 2AXZA 3SBSA 4J8FA 3QWVA 3D3MA 3PVLA 3L13A 4CT0A 5D0QD 1QZ2A 2KM4A 4A3VA 3LY7A 4CDNA 1OWLA 4H7XA 5CHEE 3I4GA 3PE3A 2R59A 3D9MA 3DBSA 3QDNA 3IV0A 4KXKB 4A55A 2AVPA 4XI0A 4I1AA 4Q96A 1H6KA 3T5VA 2A4ZA 4L2LA 4KVOA 2WXNA 1H0AA 4EZLA 2WXJA 4TUUA 4XI9A 5AIJA 3NQPA 4PS3A 3LYAA 4WNDA 3FU0A 2WXPA 3UX4A 3I4RB 4NACA 3MKQB 1TJCA 3FUEA 3SZ7A 2PM7A 4MS6A 3NF1A 1UN8A 4N2SA 3OXGA 4DLQA 4UI9C 2RG8A 3LDZA 3FUJA 2OVFA 4HS2A 4JHRA 4AM9A 3PS6A 4APOA 4WUYA 5FZRA 3SFZA 3MV2B 3RK6A 2JEKA 3LKUA 4A3TA 4ABNA 3TJPA 3P2BA 4ACKA 1E90A 3QARA 4B0ZA 3HVEB 2WQ7A 3CGHA 4U0ZA 3U64A 2OVBA 2WXLA 4PDXA 3JYSA 4N3BA 1NA0A 1OWNA 3ZGQA 4FA6A 4CRWA 2XRZA 5FWQA 3UQ3A 4R7LA 3S7JA 2XCBA 2CG2A 1YA0A 2X6KA 4KMOA 5AJDA 4F3VA 4J6IA 3FU6A 3O4ZA 4IYPA 3FWVA 3ZFWA 4E6HA 3APFA 5KJKA 4EBAA 4C0EA 4L7TA 4FU3A 3CQCB 5ARGA 5G2NA 3PEVB 1KT0A 4B8AA 4LEUA 2Y4TA 4I1OB 3ZVVA 2R17C 4HVBA 3SD5A 3D9KA 1A17A 3I5PA 4PS8A 1OWMA 2WXHA 2VGYA 3PREA 3URZA 4N39A 3U66A 1HF8A 1U3CA 4GYOA 2PM6A 3L22A 4G23A 1U3DA 3UT7A 4YVOA 3JUIA 1QQEA 1E7VA 3D9LA 2MHKA 4DJAA 5J90A 4W9RA 5ARFA 3B7SA 3CEQA 3FHEA 4J0UA 2PL2A 2XQ0A 3RRNB 4BFRA 3ZRHA 3G2VA 4ILHB 4J8EA 3TGOA 4OYSA 1HG5A 1HE8A 4HFGA 4WNEA 3ZN3A 4DPRA 4U0SA 2IONA 2J07A 3ONLA 3CK7A 4G25A 2GRLA 3QAQA 3LPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZ2 A;  3CVN A;  3LY8 A;  1HZ4 A;  3RO2 A;  4UI9 J;  5AYW D;  5BW8 C;  1IHG A;  5M72 A;  2XPI A;  5KJL A;  4BWR A;  1HXI A;  2C0M A;  3SF4 A;  3CKB A;  4N2Q A;  2IF4 A;  3ESK A;  4G1T A;  3ULQ A;  2WQH A;  2WPV A;  4UQX A;  3UUX A;  2Q7F A;  2HR2 A;  3QKY A;  4KBQ A;  2UY1 B;  4BT8 A;  3S7F A;  3Q49 B;  4I2Z A;  5FTP A;  3GZ1 A;  2XGM A;  3PDN A;  4Y6C A;  4CDR A;  4IN3 B;  3OXF A;  2FEZ A;  5JJ6 A;  2HO1 A;  1KLX A;  4J8D A;  4GA2 A;  4KYO B;  5G05 C;  4HOR A;  2R5S A;  3ASH A;  4XIF A;  3N71 A;  2VQ2 A;  5FZQ A;  3HYM B;  2YHC A;  5FT9 A;  3CV0 A;  5KJM A;  3MA5 A;  3S7D A;  2FBN A;  3CKC A;  3OXL A;  4BT9 A;  4HOQ A;  4B94 A;  3CVP A;  4I17 A;  5LCW C;  4NQ0 A;  1P5Q A;  5BT1 A;  2OND A;  3PE4 A;  4O6F A;  4GPK A;  4WNG A;  5HQ8 A;  1ELR A;  2C0L A;  5D0O D;  4UQZ A;  1Y8M A;  4GZ5 A;  2LSU A;  2HYZ A;  3QOU A;  4YND A;  5JJT A;  2UWJ G;  3O48 A;  4GYW A;  4I2W A;  4EQF A;  3FP3 A;  1WM5 A;  2XCC A;  3TG5 A;  5KJN A;  3TG4 A;  3BEE A;  2KCK A;  4I9C A;  1PC2 A;  1IYG A;  2UY1 A;  3CVL A;  2C2L A;  2E2E A;  1ELW A;  3ZHE B;  4CGW A;  4GA1 A;  4GYY A;  4HOT A;  3Q47 B;  3VTX A;  3FFL A;  5LCW J;  5EX0 A;  4JA7 A;  4U07 A;  5G04 C;  4U04 A;  3ASG A;  4JL0 A;  3QWP A;  3ASD A;  4JA9 A;  3CK9 A;  3RIB A;  3VTY A;  4AY5 A;  3Q4A B;  4U0U A;  2VSY A;  3E4B A;  5CCL A;  2NC9 A;  5DIZ A;  3LCA A;  3MV3 B;  4I9E A;  3CVQ A;  4GZ6 A;  2FF4 A;  2PQR A;  4N3A A;  2P58 C;  5EX3 A;  2JLB A;  4BTB A;  2KCV A;  5CCM A;  3U3W A;  3AS5 A;  2VGX A;  2XEV A;  3WXX A;  4N5C A;  3RKV A;  2PQN A;  4UQY A;  4GCN A;  4HOU A;  1OUV A;  3Q5M A;  3MEK A;  5G04 J;  4RG6 A;  4G2V A;  2QFC A;  4Y6W A;  3ZHE A;  1FCH A;  2OOE A;  4RG9 A;  2XGS A;  2BUG A;  1WAO 1;  2VGX B;  2J9Q A;  2KCL A;  2DBA A;  4AIF A;  3LY9 A;  2FO7 A;  1XNF A;  5JJ7 A;  3TAX A;  4WNF A;  1W3B A;  2XGO A;  4UI9 K;  3U4T A;  5A7D B;  5FJY A;  2V5F A;  3Q15 A;  5G05 J;  2PZI A;  2KC7 A;  3RJV A;  4ME2 A;  5DBK A;  5A6C A;  1ZBP A;  2FI7 A;  3ASF A;  3K9I A;  3IEG A;  4CGV A;  4G24 A;  3GW4 A;  2KAT A;  5EKQ D;  4AY6 A;  3R9A B;  1NA3 A;  1KT1 A;  3ZPJ A;  3MKR A;  2IFU A;  4GA0 A;  2Y4U A;  3UPV A;  3S7B A;  3AS8 A;  4YVQ C;  1HH8 A;  3GYZ A;  4HOS A;  4BTA A;  1E96 B;  2L6J A;  2I6H A;  2YQ8 A;  2VSN A;  3KAE A;  2LNI A;  5HI7 A;  3CK8 A;  2VYI A;  3AS4 A;  1NZN A;  4GCO A;  5BNW A;  2GW1 A;  3QWW A;  1ZU2 A;  4N3C A;  4GZ3 A;  4G26 A;  3RO3 A;  3KD7 A;  3EDT B;  3KS2 A;  4H7Y A;  3RU0 A;  5C1D A;  1B89 A;  4A1S A;  2LSV A;  4NRH B;  5FZS A;  4J8F A;  3QWV A;  5D0Q D;  1QZ2 A;  3LY7 A;  4H7X A;  5CHE E;  3PE3 A;  3QDN A;  4KXK B;  2AVP A;  4XI0 A;  4I1A A;  4XI9 A;  3LYA A;  4WND A;  1TJC A;  3SZ7 A;  3NF1 A;  4N2S A;  3OXG A;  4UI9 C;  4JHR A;  4AM9 A;  4APO A;  4WUY A;  5FZR A;  3MV2 B;  3LKU A;  4ABN A;  4U0Z A;  3JYS A;  4N3B A;  1NA0 A;  3ZGQ A;  3UQ3 A;  3S7J A;  2XCB A;  1YA0 A;  4F3V A;  3FWV A;  3ZFW A;  5KJK A;  5ARG A;  1KT0 A;  4LEU A;  2Y4T A;  1A17 A;  3URZ A;  2VGY A;  4N39 A;  4GYO A;  4G23 A;  4YVO A;  1QQE A;  2MHK A;  4W9R A;  5ARF A;  3CEQ A;  4J0U A;  2PL2 A;  4J8E A;  3TGO A;  3ZN3 A;  4WNE A;  4U0S A;  3CK7 A;  4G25 A;  3LPZ A; 
#chains in the Genus database with same CATH topology
 3EIJ A;  2V8S E;  2GRR B;  3GZ2 A;  3IHY A;  4TXR A;  4LRZ A;  3RO2 A;  1EF1 C;  2WQ6 A;  4I6E A;  5AYW D;  4ANX A;  4ZHB A;  4N5Q A;  1FT2 A;  3PNT B;  3V31 A;  1E8Y A;  4DX7 D;  5FQ6 A;  5LOZ A;  4LG6 A;  1JCR A;  3ASN E;  3CHM A;  2ILR A;  2P9L G;  3V79 K;  4G1T A;  3ZEF A;  2WPV A;  4UQX A;  1OWP A;  1HO8 A;  4NUR A;  1DC2 A;  1UN9 A;  4GTR A;  4HLL A;  3LVQ E;  3FUF A;  2IOS A;  1DNP A;  2XS1 A;  3RSE G;  3CVV A;  4J7W A;  1OXJ A;  3AG4 E;  3Q49 B;  4I2Z A;  5FTP A;  3GZ1 A;  5B3S E;  2XGM A;  1QNF A;  4Y6C A;  4CDR A;  3Q75 A;  4IN3 B;  4V3I A;  4GMJ A;  4J8D A;  1H19 A;  1JPL A;  3JQ0 A;  3ASH A;  4XIF A;  1N11 A;  4K5B A;  4XX5 A;  1HU3 A;  2WMO A;  5KJM A;  2FBN A;  2ZGG A;  4I17 A;  1MQS A;  1P5Q A;  5AAO A;  5BT1 A;  3EHM A;  1O5M A;  3MYV A;  3MGB A;  3Q79 A;  1D8E A;  5FIO A;  1UJK A;  4B89 A;  4FJY A;  2LSU A;  1KZO A;  1RZ4 A;  4EBA G;  4M7C A;  4G8K A;  1SW6 A;  5JJT A;  1UOH A;  4AOF A;  3OTN A;  4D10 C;  2I2O A;  1WM5 A;  2YHE A;  3TG5 A;  5ANR A;  3BEE A;  1QYM A;  2RKK A;  4FAD A;  3UT4 A;  2ZIR A;  3FUD A;  1IYG A;  2F8Y A;  2E2E A;  3ZYM A;  2XRY A;  3DSU A;  4PH4 B;  4UWF A;  2MRI A;  2GRQ B;  4U8Y D;  1A5E A;  4HOT A;  2J49 A;  3VTX A;  3FFL A;  1TNY A;  5EX0 A;  4K5A B;  4LER A;  3JCK C;  2B6C A;  4JA9 A;  5EIB E;  3QJZ A;  4RQI A;  3V2X A;  4AY5 A;  3Q4A B;  3HXE A;  2LO6 A;  3E4B A;  1N9A A;  4KVM A;  2NC9 A;  4IRU A;  3CSF A;  5ITZ F;  3CLJ A;  4I9E A;  1GW6 A;  3FUM A;  2VTB B;  4F53 A;  2RFM A;  2P58 C;  2JLB A;  3DXM G;  3QB2 A;  1Q2Z A;  4ANW A;  3I3N A;  4TXQ A;  2XEV A;  4N5C A;  3U9W A;  4QFV A;  2PQN A;  3TWU A;  2CHX A;  4ANV A;  2LAH A;  1NL4 A;  4O60 A;  5AQB A;  3FUL A;  3DSW A;  1UJJ A;  2NXP A;  4HRL A;  2X3M A;  5JHB A;  4G2V A;  3Q9U C;  3R7Q A;  2BTD A;  3FUI A;  1HX8 A;  2QC9 A;  4EEC A;  1H6O A;  2BUG A;  3HXC A;  2VGX B;  2DBA A;  5FIN A;  4HLE A;  5JMN D;  4A63 B;  2DVW A;  1EPU A;  2FUL A;  2H6H A;  3MCX A;  1K3Z D;  3Q15 A;  2KC7 A;  4BET A;  4BX8 A;  2QYU A;  1JCQ A;  3JXJ A;  3CHO A;  3ASF A;  4CGV A;  4HRM B;  4L23 A;  3GW4 A;  5EKQ D;  3LJN A;  1NA3 A;  2IFU A;  2L0T B;  2I1J A;  4GTP A;  3EJN A;  3UPV A;  4TV3 A;  4YVQ C;  2YIN A;  5CED B;  1Y6I A;  2CHZ A;  1HH8 A;  3LS8 A;  3QC1 A;  5AQ9 A;  1MX4 A;  3FU5 A;  2I6H A;  4XE0 A;  3DWL G;  1JUQ A;  4G11 A;  2LNI A;  5HI7 A;  5FQ8 A;  1OWO A;  2WB2 A;  2GW1 A;  3QWW A;  1UG3 A;  3E37 A;  4FUL A;  4N3C A;  2A5E A;  3FTV A;  1O1S A;  4K0R A;  3RO3 A;  3PRZ A;  4DX6 D;  1BD8 A;  3KS2 A;  3RU0 A;  2R02 A;  4A1S A;  5BV1 A;  2AXZ A;  2KM4 A;  1OWL A;  1QBQ A;  1LD7 A;  3I4G A;  3PE3 A;  3DBS A;  3QDN A;  1MX2 A;  4QQI A;  2AVP A;  4Q96 A;  4GTO A;  2A4Z A;  4KVO A;  1H0A A;  1YCS B;  4WND A;  3FU0 A;  2WXP A;  3UX4 A;  3I4R B;  1TJC A;  2KBX A;  1UN8 A;  3OXG A;  4DLQ A;  2OEV A;  2ZGD A;  2OVF A;  4JHR A;  3PS6 A;  2JEK A;  3TJP A;  4ACK A;  1E90 A;  2P9I G;  4U0Z A;  2OVB A;  3JYS A;  2XRZ A;  2XEH A;  1YA0 A;  1AP7 A;  3FWV A;  1OT8 A;  3ZXP A;  5KJK A;  4C0E A;  4L7T A;  3CQC B;  5ARG A;  1KT0 A;  4GTV A;  3ZVV A;  1IHB A;  1OWM A;  2WXH A;  2PM6 A;  3UT7 A;  4YVO A;  3JUI A;  5CEC B;  4DJA A;  1JCS A;  2MHK A;  5ARF A;  3B7S A;  4L9P A;  2PL2 A;  2XQ0 A;  4BFR A;  1DCE A;  4DPR A;  4WNE A;  4CZ2 D;  4U0S A;  2ION A;  2J07 A;  4ATZ D;  2CFU A;  1K1B A;  1H6P A;  5FQ4 A;  1IHG A;  3TXN A;  3JQ1 A;  2C0M A;  3SF4 A;  3MZL B;  3UKU G;  4KZC A;  5ENR D;  3Q9N C;  3CKB A;  4HQD A;  1EYH A;  3EU9 A;  4N2Q A;  3ESK A;  4J8S A;  5ENQ D;  3UUX A;  3QNK A;  3ABK E;  3HXF A;  2BED A;  4GTM A;  4YDE A;  2AXU A;  2Q7F A;  3E34 A;  4I43 A;  5IY5 E;  1HG2 A;  2P2C P;  3FTS A;  2LXL A;  4HNA D;  2WM9 A;  3AG3 E;  2UY1 B;  2WXM A;  3ZIM A;  4I6G A;  3AU5 A;  1N4R A;  2JAB A;  3PDN A;  5AEN A;  4OAV B;  3F6Q A;  1KLX A;  4KYO B;  2XZD G;  4TUM A;  2J08 A;  3N71 A;  3PEU B;  3NB2 A;  1K1A A;  3T9K A;  3FTZ A;  4RSY A;  3E32 A;  2DZO A;  3EHQ A;  3CKC A;  2MYO A;  2OCC E;  2CG3 A;  3PZ3 A;  4LNU D;  1H2U A;  4HOQ A;  3FDH A;  1H2T C;  4FHK A;  4O1O A;  3D9O A;  4NQ0 A;  1Z3X A;  3J5Q B;  3ISM C;  2P9K G;  2XPZ A;  2A5U A;  3PE4 A;  3RRM B;  3J5P A;  4DLO A;  4GPK A;  2WXO A;  3UM3 A;  1ELR A;  2C0L A;  4U7E B;  3B95 A;  4JEH A;  4CYM D;  4JVS A;  4UUC A;  1FT1 A;  4JD2 G;  4JXT A;  2CHW A;  1E8Z A;  4YND A;  2UWJ G;  2ZXW E;  3DEO A;  1DVP A;  4GYW A;  1N52 A;  3TXM A;  4EQF A;  5EDS A;  1IKN D;  2P9S G;  3D9N A;  3PH0 C;  4DRX E;  1PC2 A;  2UY1 A;  2F37 A;  4JC8 A;  3PUK A;  3ZHE B;  4LNG A;  2H6F A;  3E30 A;  1TEZ A;  3D9J A;  3ZYK A;  3LJ3 A;  5HKP A;  3ESL A;  3EHR A;  2L6B A;  5G04 C;  2YNQ A;  3FTX A;  3L17 A;  4I6J A;  3QWP A;  1TNU A;  2XZT G;  4L2Y A;  2Y69 E;  3TWT A;  1S70 B;  3CK9 A;  2R2L A;  3VTY A;  3CHR A;  3KEZ A;  3T8K A;  2VSY A;  3VLE A;  3LCA A;  4GZ6 A;  3W9F A;  4DI3 A;  2PQR A;  3UKR G;  1SZA A;  5FQ7 A;  1BI7 B;  5EX3 A;  4BTB A;  1IQU A;  3U3W A;  2Y1L E;  3AS5 A;  4DK5 A;  2HM8 A;  2P9U G;  5LP0 A;  1K8K G;  2GRO B;  3ZNG A;  4XZ4 A;  3ULY A;  4UQY A;  3C3R A;  3BG1 B;  4U8V D;  1OUV A;  5CMY A;  4P29 A;  2WVI A;  3RAU A;  5G04 J;  3UM0 A;  1MJ0 A;  5CER B;  4GML A;  4MLP A;  3OAW A;  1O1R A;  4M3O A;  3T5X A;  3ZHE A;  3VLF A;  2XHE A;  2OOE A;  2XGS A;  4GPM A;  2EIN E;  4NIK A;  2J9Q A;  1N4S A;  2EQX A;  1MZC A;  2FO7 A;  2P9P G;  1XNF A;  5JJ7 A;  1SA5 A;  1Z3Y A;  3T8M A;  3PZ1 A;  1YMP A;  3MJW A;  5E75 A;  5FJY A;  3RJV A;  2WXQ A;  4EPZ A;  4HBD A;  3CR3 A;  5A6C A;  3K9I A;  4G24 A;  3L6A A;  2NYJ A;  1KT1 A;  2DYR E;  3MKR A;  2WXG A;  2IO2 C;  2X6H A;  3IHV A;  4Z68 A;  2ETC A;  1LF8 A;  3GYZ A;  2J4B A;  4B8C B;  1E96 B;  2AWI A;  2L6J A;  3PUJ A;  1OCZ E;  3DXK G;  5G55 A;  3APC A;  3HHM A;  5ENN A;  3AAA C;  3ZKJ A;  3CK8 A;  3S2A A;  2VYI A;  3NZS A;  5BNW A;  3FUK A;  1TJF A;  3KSL A;  1ZU2 A;  3R9M A;  3QK0 A;  4LNB A;  1N0R A;  3SI5 A;  3ENE A;  2F8X K;  2OEW A;  3EDT B;  4H7Y A;  5T4Y A;  4MRU A;  4FLH A;  2AW6 A;  2R05 A;  2I1K A;  4UWG A;  2OV8 A;  5A23 A;  3QWV A;  3ABL E;  1OCC E;  4A3V A;  3LY7 A;  3D9M A;  3IV0 A;  1S64 A;  4KXK B;  1WG0 A;  1X81 A;  2WXN A;  4PS3 A;  3MKQ B;  3Q7F A;  3SZ7 A;  3NF1 A;  4N2S A;  4DX2 A;  2RG8 A;  4AM9 A;  4APO A;  3SFZ A;  3MV2 B;  3LKU A;  4A3T A;  4B0Z A;  1KPS B;  2WXL A;  4GTT A;  4N3B A;  1V55 E;  3ZGQ A;  4CRW A;  3UQ3 A;  3TWX A;  4KMO A;  4J6I A;  3FU6 A;  3ZFW A;  4EBA A;  5CRV A;  3WG7 E;  5G2N A;  5AAR A;  4LEU A;  3D9K A;  1A17 A;  4PS8 A;  3PRE A;  3JUE A;  3Q7A A;  1HF8 A;  4G23 A;  1QQE A;  5J90 A;  3IXE A;  3CEQ A;  3G2V A;  4ILH B;  3TGO A;  1HG5 A;  3ONL A;  3LPZ A;  3D9H A;  1HZ4 A;  5HS0 A;  1XGW A;  4GTQ A;  2GRM A;  5M72 A;  4F1P A;  4GZC A;  4XEI G;  2XPI A;  5KJL A;  1HXI A;  2DCP A;  4BES A;  3ULQ A;  2WQH A;  4U8H A;  3SGH A;  3MKQ A;  1N95 A;  3D9I A;  2DIW A;  4AJW A;  4KBQ A;  3FY4 A;  3SFX A;  4FLB A;  3EIQ C;  4L1B A;  2I9C A;  2KZT B;  3SHF A;  4PUC A;  5JJ6 A;  4GA2 A;  4RVB A;  5G05 C;  1NP7 A;  2AXV A;  2R5S A;  3PZD A;  4URK A;  5BXU A;  3BU8 A;  5ENO D;  4KZ0 A;  5FT9 A;  1BPO A;  3MA5 A;  3S7D A;  2J8S D;  4B94 A;  3LVR E;  3C3O A;  5ENP D;  3BQO A;  1BLX B;  2EIM E;  3LXU X;  4O6F A;  5CBN A;  4HRN A;  4WNG A;  5D0O D;  1X5B A;  1VDY A;  1D9S A;  4GZ5 A;  3QOU A;  3UT8 A;  4BEP A;  3SY2 A;  2EIK E;  4I2W A;  4JB8 P;  2XCC A;  2KCK A;  3FEY A;  2RD0 A;  4I9C A;  2L0I A;  3FTY A;  2Y0B G;  5KCM A;  4EZK A;  2C2L A;  3CST A;  1SZ9 A;  1ELW A;  3G2S A;  3SNX A;  4CGW A;  2X6J A;  4JZY A;  2KZT A;  3DPY A;  4GA1 A;  5KNG A;  3KEA A;  4GYY A;  3Q47 B;  4U07 A;  4FC8 A;  3ASG A;  4JL0 A;  3B13 A;  5T3R A;  3ASD A;  1OY3 D;  3TL5 A;  1SA4 A;  3B7R L;  5DIZ A;  3HG0 D;  2H6G A;  4AEZ C;  2FF4 A;  1H2V C;  3FTU A;  3IBE A;  2GRN B;  4N3A A;  4TXP A;  3ZXS A;  5AN8 A;  1PAQ A;  5CCM A;  3ZYL A;  1FVH A;  4IUL A;  1N54 A;  2IU1 A;  4F1S A;  3WXX A;  4LCT A;  2VJ8 A;  3CQG B;  2KXP C;  2EIL E;  5KBA A;  3ML8 A;  4C48 B;  4F7A A;  3Q5M A;  1IXV A;  5JA4 D;  4ZFH A;  3CVU A;  1N94 A;  3UIP C;  1LTX A;  3VLD A;  3RRU A;  3DRA A;  3FU3 A;  4HI9 A;  2FO1 E;  3SO8 A;  5C2Y A;  3B7T A;  1PY1 A;  1WAO 1;  4GZD A;  4WAF A;  4WWO A;  4XKB A;  2DWZ A;  3TAX A;  1IQR A;  2ZIS A;  2R03 A;  2VSO E;  1W3B A;  2XGO A;  2IO3 C;  3U4T A;  3FUN A;  2X38 A;  2Y3A A;  2V5F A;  2BF0 X;  2PZI A;  4HXI A;  1UW4 B;  2V4L A;  5DBK A;  3FH7 A;  2B0O E;  4JHK A;  1HS6 A;  4FJZ A;  4AY6 A;  2KAT A;  5AQA A;  4HB5 A;  5BUZ A;  4GB9 A;  4GA0 A;  2Y4U A;  3UM2 A;  2PNN A;  4HOS A;  4BTA A;  1BI8 B;  2YQ8 A;  2VSN A;  2J4D A;  2LAI A;  2GGF A;  4AVX A;  2ETB A;  4CT4 A;  4GCO A;  2XEE A;  3UI2 A;  3FTW A;  4KT6 B;  1FVF A;  1N4Q A;  5ANL A;  3CHQ A;  4ATG A;  2X6F A;  3LEW A;  4C0M A;  3DPD A;  3UIN C;  5BXO A;  4PS7 A;  5C1D A;  2NSZ A;  1B89 A;  2DYS E;  3PNL B;  3TWV A;  4OAU C;  2ZU6 B;  2LSV A;  4NRH B;  5EIL A;  5FZS A;  3W9G A;  3SBS A;  4J8F A;  3L13 A;  4H7X A;  1TNB A;  5D66 A;  4A55 A;  4I1A A;  1H6K A;  3T5V A;  1OCR E;  4LSZ E;  4TUU A;  3LYA A;  4YDY A;  4BSZ B;  3ULE G;  3FUE A;  4UI9 C;  3FUJ A;  2LUH A;  5HRY A;  4ABN A;  3HXD A;  3AG2 E;  3P2B A;  3QAR A;  3HVE B;  2WQ7 A;  3CGH A;  4PDX A;  1ZB1 A;  1OWN A;  5FWQ A;  4R7L A;  3S7J A;  2X6K A;  5AJD A;  4IYP A;  3APF A;  3PEV B;  4BER A;  3C72 A;  4I1O B;  2R17 C;  4G8L A;  3URZ A;  3Q78 A;  4N39 A;  3U66 A;  4GYO A;  2QZA A;  3C3Q A;  3L22 A;  4U95 D;  1E7V A;  4W9R A;  3X2Q E;  2IY0 C;  3FHE A;  4J0U A;  3RRN B;  5ENS D;  3DEP A;  4OYS A;  4HFG A;  3ZN3 A;  3B7B A;  4G25 A;  3KSQ A;  2GRL A;  3QAQ A;  4J8Y A;  3APD A;  3B7U X;  3C98 A;  3FUH A;  3DSS A;  1N0Q A;  3CVN A;  3LY8 A;  5B1A E;  4UI9 J;  1JWF A;  3L08 A;  5BW8 C;  2V5Q C;  1Z6T A;  4BWR A;  4B93 B;  1V54 E;  1Z5S C;  3L16 A;  2IF4 A;  2VSX E;  2AJA A;  3DSV A;  4X8Q A;  2V0P A;  4YDO A;  3HDX A;  2XS8 A;  1LD8 A;  2CFZ A;  1TYQ G;  4DX5 D;  1JWG A;  4DUI A;  5B1B E;  4GU5 A;  2HR2 A;  3QKY A;  4JW1 A;  3HVE A;  1TNZ A;  3DSX A;  4DX1 A;  2IJG X;  4BT8 A;  3S7F A;  2H6I A;  4UWK A;  3FH8 A;  3OXF A;  4AV7 A;  1DCQ A;  2FEZ A;  3ABM E;  1NI1 A;  2HO1 A;  1AWC B;  4HOR A;  3V2O A;  1EDU A;  1TR4 A;  5FZQ A;  2VQ2 A;  3HYM B;  4MBG A;  4E85 A;  2J09 A;  5EN5 D;  4ILI A;  2YHC A;  3CV0 A;  4BY6 A;  2MOW A;  5BPP A;  3OXL A;  4BT9 A;  3CVP A;  4I1M A;  5LCW C;  4UWH A;  5KNH D;  2OND A;  4K03 A;  4XKC A;  4CCA A;  3SBT B;  5AJL A;  5HQ8 A;  1NFI E;  2V4H C;  4UQZ A;  1Y8M A;  3MX3 A;  5H7P A;  2WXF A;  3FEX A;  3HXB A;  3L9T A;  2IEJ A;  3L54 A;  4JPS A;  3CIA A;  2HYZ A;  3UMV A;  3O48 A;  4JEU A;  3BG0 B;  5EYP F;  3FP3 A;  2WXI A;  5KJN A;  3TG4 A;  1BU9 A;  4EHM A;  1TN6 A;  4JHJ A;  4GAA A;  3FH5 A;  4BSX A;  2VTB A;  5AQ7 A;  3NBN B;  3CVL A;  5J08 A;  3CVW A;  3ZU7 B;  3G2U A;  3G2T A;  4AP2 A;  3V30 A;  2QYJ A;  5E76 A;  5T8I A;  1E8X A;  1S0P A;  3CVX A;  2WMN A;  1HFA A;  5LCW J;  4JA7 A;  1TNO A;  4U04 A;  3CVY A;  4K5C A;  4Q69 A;  4U63 A;  2P9N G;  3RIB A;  4LUN U;  5CEA A;  1D8D A;  4U0U A;  5CCL A;  1YYH A;  1INZ A;  3MV3 B;  3CVQ A;  4UWL A;  4FHJ A;  5D2M C;  3ZYQ A;  3SQV A;  5KWD A;  2KCV A;  1SQM A;  1WY6 A;  3P1U A;  5EID A;  5LX8 A;  1WDY A;  2VGX A;  3EU5 A;  3PZ4 A;  3Q73 A;  5JHA A;  3ML9 A;  3BUA A;  3RKV A;  2L9B A;  4GCN A;  5CMW A;  4HOU A;  4ACL A;  4EZJ A;  3MEK A;  3UTM A;  1MHQ A;  1E8W A;  1TN8 A;  1G3N B;  2LXM A;  3AU4 A;  4RG6 A;  3IKO B;  3DST A;  2QFC A;  4Y6W A;  1MYO A;  2WXR A;  2XPY A;  2X6I A;  5LFA A;  3HRA A;  3ASO E;  1L5J A;  4WWN A;  1FCH A;  3TWW A;  4RG9 A;  4GMR A;  3ZW3 A;  4WWP A;  3SFY A;  2IQC A;  2KCL A;  3NZU A;  4AIF A;  3E33 A;  3LY9 A;  3EHN A;  3NOG D;  3R7R A;  4WNF A;  4YDW A;  3L82 A;  4UI9 K;  2DZN A;  5A7D B;  3CHP A;  1RW2 A;  2BKG A;  4MKT A;  4HI8 A;  5G05 J;  1E7U A;  4CEM A;  3UIO C;  4ME2 A;  3ZUV B;  1ZBP A;  4ILG A;  2HE0 A;  2FI7 A;  3IEG A;  4FP7 A;  3NAW A;  3R9A B;  3ZPJ A;  4APF A;  4OVU A;  3UXG A;  5BV0 A;  3S7B A;  3NOC D;  3AS8 A;  4TRQ A;  4Q94 A;  4OVV A;  2E0I A;  4O1P A;  1ELK A;  2WXK A;  2F0Y A;  4BX9 A;  2VGE A;  3KAE A;  3GZS A;  4GTS A;  2IOL A;  5ENT D;  4DI4 A;  4RLY A;  3AS4 A;  1NZN A;  1S63 A;  5CRU A;  1SVX A;  4AXH A;  3HIZ A;  3CHS A;  2XEN A;  3G2W A;  4GZ3 A;  2BKK B;  4C9B B;  4G26 A;  1KZP A;  4CDM A;  3KD7 A;  2M63 A;  3AG1 E;  1O1T A;  2QY7 A;  3ONK A;  4ANU A;  3D9P A;  4A1G A;  1FPP A;  3JXI A;  3D3M A;  3PVL A;  4CT0 A;  5D0Q D;  1QZ2 A;  4CDN A;  5CHE E;  2R59 A;  1TN7 A;  4XI0 A;  1MX6 A;  3AJI A;  4L2L A;  4EZL A;  2WXJ A;  4XI9 A;  5AIJ A;  3NQP A;  1N4P A;  4NAC A;  3TWQ A;  2PM7 A;  4MS6 A;  3LDZ A;  4HS2 A;  1U2V G;  3PZ2 A;  3UM1 A;  4WUY A;  5FZR A;  3RK6 A;  2EIJ E;  3U64 A;  3C5R A;  3EUV A;  1NA0 A;  1OCO E;  4FA6 A;  5EYL A;  3TWS A;  2XCB A;  2CG2 A;  4F3V A;  2GRP B;  5CBO A;  3O4Z A;  2ETA A;  4E6H A;  3TWR A;  4FU3 A;  2RFA A;  4B8A A;  2Y4T A;  4HVB A;  3SD5 A;  3I5P A;  2VGY A;  1U3C A;  1U3D A;  3D9L A;  4U96 D;  3ZRH A;  4J8E A;  1HE8 A;  4F6R D;  3CK7 A; 
#chains in the Genus database with same CATH homology
 3EIJ A;  2V8S E;  3APD A;  3B7U X;  3C98 A;  2CFU A;  3FUH A;  3GZ2 A;  3CVN A;  3LY8 A;  1HZ4 A;  3IHY A;  4LRZ A;  3RO2 A;  1EF1 C;  2WQ6 A;  1XGW A;  4UI9 J;  4I6E A;  5FQ4 A;  5AYW D;  4ANX A;  1JWF A;  3L08 A;  5BW8 C;  2GRM A;  1IHG A;  5M72 A;  3PNT B;  4GZC A;  1Z6T A;  2XPI A;  5KJL A;  1E8Y A;  4BWR A;  1HXI A;  3TXN A;  3JQ1 A;  2C0M A;  5FQ6 A;  3MZL B;  5LOZ A;  3SF4 A;  4KZC A;  2DCP A;  3CKB A;  3CHM A;  1EYH A;  3L16 A;  2IF4 A;  2ILR A;  3ESK A;  4N2Q A;  4G1T A;  2VSX E;  3ULQ A;  3ZEF A;  2WQH A;  2V0P A;  4U8H A;  2WPV A;  4J8S A;  4UQX A;  3SGH A;  3UUX A;  3HDX A;  3QNK A;  3MKQ A;  2CFZ A;  1OWP A;  1HO8 A;  2AXU A;  1JWG A;  3D9I A;  2Q7F A;  4GU5 A;  2HR2 A;  4NUR A;  2DIW A;  1UN9 A;  3QKY A;  4JW1 A;  4AJW A;  4I43 A;  1HG2 A;  4KBQ A;  3FY4 A;  3FTS A;  3FUF A;  3LVQ E;  3EIQ C;  2IOS A;  4FLB A;  4L1B A;  3HVE A;  1DNP A;  2WM9 A;  2UY1 B;  2WXM A;  2IJG X;  3ZIM A;  3CVV A;  4I6G A;  3AU5 A;  2I9C A;  4BT8 A;  3S7F A;  2KZT B;  3Q49 B;  4I2Z A;  5FTP A;  3SHF A;  3GZ1 A;  4PUC A;  2XGM A;  4UWK A;  1QNF A;  3PDN A;  4Y6C A;  4CDR A;  3FH8 A;  4IN3 B;  3OXF A;  5AEN A;  4AV7 A;  4V3I A;  2FEZ A;  5JJ6 A;  4GMJ A;  2HO1 A;  1KLX A;  4J8D A;  4GA2 A;  4RVB A;  4KYO B;  1H19 A;  5G05 C;  1NP7 A;  1JPL A;  2AXV A;  3JQ0 A;  4HOR A;  2R5S A;  3ASH A;  1EDU A;  4XIF A;  2J08 A;  3N71 A;  2VQ2 A;  5FZQ A;  3PZD A;  3PEU B;  3HYM B;  4XX5 A;  4URK A;  4E85 A;  2J09 A;  3FTZ A;  4RSY A;  4KZ0 A;  4ILI A;  2YHC A;  1HU3 A;  5FT9 A;  1BPO A;  2WMO A;  3CV0 A;  5KJM A;  3MA5 A;  3S7D A;  4BY6 A;  2FBN A;  2MOW A;  3CKC A;  5BPP A;  2CG3 A;  3OXL A;  4BT9 A;  1H2U A;  4HOQ A;  3FDH A;  4B94 A;  1H2T C;  3CVP A;  3LVR E;  4FHK A;  4I1M A;  3D9O A;  4I17 A;  5LCW C;  4NQ0 A;  1MQS A;  1P5Q A;  1Z3X A;  5BT1 A;  4UWH A;  2XPZ A;  2OND A;  4K03 A;  3LXU X;  2A5U A;  3EHM A;  3PE4 A;  4O6F A;  4XKC A;  4CCA A;  3SBT B;  3MYV A;  3RRM B;  5AJL A;  3MGB A;  4DLO A;  4GPK A;  2WXO A;  4WNG A;  5HQ8 A;  1ELR A;  2C0L A;  4JEH A;  5D0O D;  4JVS A;  4UQZ A;  1X5B A;  1UJK A;  1VDY A;  1Y8M A;  3MX3 A;  4FJY A;  4B89 A;  2WXF A;  3FEX A;  4GZ5 A;  4JXT A;  2LSU A;  4EBA G;  3L54 A;  2CHW A;  4JPS A;  3CIA A;  2HYZ A;  1E8Z A;  3QOU A;  4YND A;  5JJT A;  3UT8 A;  2UWJ G;  4AOF A;  1DVP A;  3OTN A;  3UMV A;  3O48 A;  4GYW A;  3BG0 B;  1N52 A;  4JEU A;  4I2W A;  3TXM A;  2I2O A;  4D10 C;  4EQF A;  3FP3 A;  1WM5 A;  2WXI A;  2XCC A;  2YHE A;  3TG5 A;  5EDS A;  5ANR A;  3TG4 A;  5KJN A;  3BEE A;  2KCK A;  3FEY A;  2RD0 A;  4JHJ A;  3D9N A;  3PH0 C;  4I9C A;  4FAD A;  4GAA A;  3FH5 A;  2L0I A;  3FTY A;  4BSX A;  3UT4 A;  1PC2 A;  5KCM A;  4EZK A;  3FUD A;  2VTB A;  2UY1 A;  1IYG A;  3CVL A;  2C2L A;  2E2E A;  3CST A;  1SZ9 A;  3ZYM A;  2XRY A;  5J08 A;  3G2U A;  1ELW A;  3PUK A;  4JC8 A;  4PH4 B;  3G2S A;  3G2T A;  3ZHE B;  3SNX A;  4CGW A;  4UWF A;  2X6J A;  2MRI A;  4JZY A;  4AP2 A;  2KZT A;  4GA1 A;  5E76 A;  5T8I A;  1TEZ A;  3D9J A;  4GYY A;  3ZYK A;  4HOT A;  1E8X A;  1S0P A;  2J49 A;  3Q47 B;  3CVX A;  3VTX A;  3FFL A;  3LJ3 A;  2WMN A;  1HFA A;  3ESL A;  5LCW J;  5EX0 A;  4JA7 A;  4U07 A;  5G04 C;  2YNQ A;  3FTX A;  4FC8 A;  3L17 A;  4U04 A;  3ASG A;  4I6J A;  4JL0 A;  4Q69 A;  3B13 A;  3CVY A;  4U63 A;  3QWP A;  4LER A;  3JCK C;  5T3R A;  3ASD A;  4JA9 A;  4L2Y A;  3CK9 A;  3QJZ A;  3RIB A;  3VTY A;  4AY5 A;  3Q4A B;  4LUN U;  3CHR A;  3KEZ A;  4U0U A;  2LO6 A;  3TL5 A;  3B7R L;  2VSY A;  3E4B A;  5CCL A;  4KVM A;  2NC9 A;  4IRU A;  5DIZ A;  3CSF A;  3VLE A;  3LCA A;  1INZ A;  3CLJ A;  3MV3 B;  1GW6 A;  4I9E A;  3FUM A;  3CVQ A;  4GZ6 A;  4UWL A;  4AEZ C;  2FF4 A;  2VTB B;  4DI3 A;  4F53 A;  2PQR A;  1H2V C;  3FTU A;  3IBE A;  4FHJ A;  4N3A A;  3ZXS A;  1SZA A;  1PAQ A;  5FQ7 A;  3ZYQ A;  2P58 C;  5EX3 A;  2JLB A;  4BTB A;  2KCV A;  1SQM A;  1IQU A;  1WY6 A;  3P1U A;  5CCM A;  3U3W A;  3QB2 A;  3ZYL A;  5LX8 A;  1FVH A;  3AS5 A;  4IUL A;  1N54 A;  2IU1 A;  4ANW A;  4DK5 A;  4F1S A;  2HM8 A;  5LP0 A;  2VGX A;  3I3N A;  5JHA A;  2XEV A;  3WXX A;  4N5C A;  3ML9 A;  4LCT A;  4XZ4 A;  2VJ8 A;  3CQG B;  3U9W A;  3RKV A;  4QFV A;  2PQN A;  2L9B A;  4UQY A;  2CHX A;  4GCN A;  3ML8 A;  3BG1 B;  4ANV A;  5CMW A;  4F7A A;  2LAH A;  4HOU A;  4ACL A;  1OUV A;  3Q5M A;  5CMY A;  3FUL A;  4EZJ A;  4P29 A;  1UJJ A;  2WVI A;  3MEK A;  2NXP A;  5G04 J;  2X3M A;  1MHQ A;  1E8W A;  3AU4 A;  4RG6 A;  5JHB A;  4G2V A;  3IKO B;  4GML A;  2QFC A;  4Y6W A;  2WXR A;  3CVU A;  2XPY A;  2X6I A;  4MLP A;  3OAW A;  5LFA A;  4M3O A;  3R7Q A;  1L5J A;  4WWN A;  3T5X A;  2BTD A;  1FCH A;  3RRU A;  3VLD A;  2XHE A;  3FUI A;  3VLF A;  3ZHE A;  3FU3 A;  2OOE A;  4RG9 A;  5C2Y A;  1HX8 A;  3B7T A;  4EEC A;  2XGS A;  3ZW3 A;  2BUG A;  1PY1 A;  1WAO 1;  4WWP A;  2IQC A;  2J9Q A;  2KCL A;  2VGX B;  2EQX A;  3NZU A;  2DBA A;  4GZD A;  4AIF A;  4HLE A;  4WAF A;  3LY9 A;  2FO7 A;  3EHN A;  4WWO A;  1XNF A;  5JJ7 A;  4XKB A;  3TAX A;  1Z3Y A;  1IQR A;  3R7R A;  1EPU A;  3T8M A;  4WNF A;  2FUL A;  2VSO E;  1W3B A;  2XGO A;  4UI9 K;  3U4T A;  3MJW A;  5E75 A;  3FUN A;  3MCX A;  5A7D B;  3CHP A;  2X38 A;  4MKT A;  5FJY A;  2Y3A A;  2V5F A;  2BF0 X;  3Q15 A;  5G05 J;  2PZI A;  1E7U A;  2KC7 A;  4HXI A;  4CEM A;  3RJV A;  4BX8 A;  2WXQ A;  4EPZ A;  4ME2 A;  1UW4 B;  3CR3 A;  2V4L A;  5DBK A;  3FH7 A;  5A6C A;  1ZBP A;  4ILG A;  4JHK A;  1HS6 A;  2FI7 A;  3CHO A;  3ASF A;  3K9I A;  3IEG A;  4CGV A;  4FJZ A;  4G24 A;  4L23 A;  3GW4 A;  2KAT A;  5EKQ D;  4AY6 A;  3L6A A;  4FP7 A;  5BUZ A;  1NA3 A;  1KT1 A;  3R9A B;  3ZPJ A;  4APF A;  3MKR A;  3CVW A;  2IFU A;  4OVU A;  2L0T B;  4GB9 A;  2I1J A;  2WXG A;  3EJN A;  4GA0 A;  2Y4U A;  3UPV A;  5BV0 A;  4TV3 A;  3S7B A;  3AS8 A;  4TRQ A;  4YVQ C;  2YIN A;  2X6H A;  3IHV A;  4Q94 A;  1Y6I A;  2CHZ A;  1HH8 A;  1LF8 A;  3LS8 A;  3QC1 A;  4OVV A;  3GYZ A;  2J4B A;  4B8C B;  4HOS A;  4BTA A;  1E96 B;  2AWI A;  2I6H A;  2L6J A;  3FU5 A;  3PUJ A;  4XE0 A;  2E0I A;  1JUQ A;  5G55 A;  1ELK A;  2WXK A;  3APC A;  3HHM A;  5ENN A;  4BX9 A;  2YQ8 A;  2VSN A;  4G11 A;  2J4D A;  3KAE A;  2LAI A;  2LNI A;  3GZS A;  2GGF A;  4AVX A;  5HI7 A;  3CK8 A;  3S2A A;  4CT4 A;  2IOL A;  5FQ8 A;  1OWO A;  2VYI A;  2WB2 A;  3NZS A;  4DI4 A;  3AS4 A;  1NZN A;  3FUK A;  4GCO A;  4AXH A;  5BNW A;  2GW1 A;  3QWW A;  1TJF A;  1ZU2 A;  3HIZ A;  3CHS A;  1UG3 A;  3FTW A;  3QK0 A;  3G2W A;  4FUL A;  4KT6 B;  4N3C A;  3SI5 A;  1FVF A;  4GZ3 A;  3FTV A;  3ENE A;  4C9B B;  5ANL A;  4G26 A;  4CDM A;  4K0R A;  3CHQ A;  4ATG A;  3RO3 A;  2X6F A;  3PRZ A;  3LEW A;  4C0M A;  3KD7 A;  2M63 A;  3DPD A;  3EDT B;  3KS2 A;  4H7Y A;  3RU0 A;  2QY7 A;  4PS7 A;  5C1D A;  5T4Y A;  2NSZ A;  3ONK A;  1B89 A;  4ANU A;  3PNL B;  3D9P A;  4MRU A;  4FLH A;  2AW6 A;  4A1G A;  2I1K A;  4UWG A;  4A1S A;  5BV1 A;  2ZU6 B;  2LSV A;  2OV8 A;  4NRH B;  5A23 A;  5FZS A;  2AXZ A;  3SBS A;  4J8F A;  3QWV A;  3D3M A;  3PVL A;  3L13 A;  4CT0 A;  5D0Q D;  1QZ2 A;  2KM4 A;  4A3V A;  3LY7 A;  4CDN A;  1OWL A;  4H7X A;  5CHE E;  3I4G A;  3PE3 A;  2R59 A;  3D9M A;  3DBS A;  3QDN A;  3IV0 A;  4KXK B;  4A55 A;  2AVP A;  4XI0 A;  4I1A A;  4Q96 A;  1H6K A;  3T5V A;  2A4Z A;  4L2L A;  4KVO A;  2WXN A;  1H0A A;  4EZL A;  2WXJ A;  4TUU A;  4XI9 A;  5AIJ A;  3NQP A;  4PS3 A;  3LYA A;  4WND A;  3FU0 A;  2WXP A;  3UX4 A;  3I4R B;  4NAC A;  3MKQ B;  1TJC A;  3FUE A;  3SZ7 A;  2PM7 A;  4MS6 A;  3NF1 A;  1UN8 A;  4N2S A;  3OXG A;  4DLQ A;  4UI9 C;  2RG8 A;  3LDZ A;  3FUJ A;  2OVF A;  4HS2 A;  4JHR A;  4AM9 A;  3PS6 A;  4APO A;  4WUY A;  5FZR A;  3SFZ A;  3MV2 B;  3RK6 A;  2JEK A;  3LKU A;  4A3T A;  4ABN A;  3TJP A;  3P2B A;  4ACK A;  1E90 A;  3QAR A;  4B0Z A;  3HVE B;  2WQ7 A;  3CGH A;  4U0Z A;  3U64 A;  2OVB A;  2WXL A;  4PDX A;  3JYS A;  4N3B A;  1NA0 A;  1OWN A;  3ZGQ A;  4FA6 A;  4CRW A;  2XRZ A;  5FWQ A;  3UQ3 A;  4R7L A;  3S7J A;  2XCB A;  2CG2 A;  1YA0 A;  2X6K A;  4KMO A;  5AJD A;  4F3V A;  4J6I A;  3FU6 A;  3O4Z A;  4IYP A;  3FWV A;  3ZFW A;  4E6H A;  3APF A;  5KJK A;  4EBA A;  4C0E A;  4L7T A;  4FU3 A;  3CQC B;  5ARG A;  5G2N A;  3PEV B;  1KT0 A;  4B8A A;  4LEU A;  2Y4T A;  4I1O B;  3ZVV A;  2R17 C;  4HVB A;  3SD5 A;  3D9K A;  1A17 A;  3I5P A;  4PS8 A;  1OWM A;  2WXH A;  2VGY A;  3PRE A;  3URZ A;  4N39 A;  3U66 A;  1HF8 A;  1U3C A;  4GYO A;  2PM6 A;  3L22 A;  4G23 A;  1U3D A;  3UT7 A;  4YVO A;  3JUI A;  1QQE A;  1E7V A;  3D9L A;  2MHK A;  4DJA A;  5J90 A;  4W9R A;  5ARF A;  3B7S A;  3CEQ A;  3FHE A;  4J0U A;  2PL2 A;  2XQ0 A;  3RRN B;  4BFR A;  3ZRH A;  3G2V A;  4ILH B;  4J8E A;  3TGO A;  4OYS A;  1HG5 A;  1HE8 A;  4HFG A;  4WNE A;  3ZN3 A;  4DPR A;  4U0S A;  2ION A;  2J07 A;  3ONL A;  3CK7 A;  4G25 A;  2GRL A;  3QAQ A;  3LPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...