4APOA

Aip tpr domain in complex with human tomm20 peptide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
142
structure length
142
Chain Sequence
AEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALEARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AH RECEPTOR-INTERACTING PROTEIN
publication title Structure of the Tpr Domain of Aip: Lack of Client Protein Interaction with the C-Terminal Alpha-7 Helix of the Tpr Domain of Aip is Sufficient for Pituitary Adenoma Predisposition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 60
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4apoA00
3FP3A 4NQ0A 2P58C 2C2LA 3CK8A 2Y4UA 3LYAA 2HO1A 2LSVA 4O6FA 5BW8C 2VQ2A 1PC2A 3UUXA 2XPIA 2ONDA 3LKUA 1ZU2A 4GYYA 3TG5A 3PDNA 3ZN3A 3LY8A 5A6CA 1P5QA 4J8DA 1IYGA 3UQ3A 4U0UA 3IEGA 2XCCA 5CCLA 2GW1A 5LCWJ 3ESKA 2NC9A 3Q49B 4GPKA 3MV2B 1B89A 3ZFWA 1ELRA 3U4TA 2XCBA 4CGVA 3BEEA 2LNIA 5A7DB 2C0MA 3MA5A 4ABNA 1ELWA 5BT1A 3CVPA 4GZ6A 4A1SA 3PE4A 4WNDA 3GW4A 3AS8A 5FT9A 4CGWA 3URZA 3Q4AB 4G24A 4GCNA 4CDRA 5DIZA 3VTYA 2VGYA 4GYWA 3WXXA 3EDTB 2IF4A 4Y6CA 1TJCA 4N5CA 4H7XA 2VSNA 4UI9K 3Q15A 2WPVA 5FTPA 3OXLA 3MEKA 3KS2A 3GZ1A 2I6HA 3FWVA 4RG6A 3ASFA 1W3BA 4N3CA 1WM5A 2PZIA 3KAEA 3AS5A 3ASGA 2KCVA 5HQ8A 5KJMA 5AYWD 5CHEE 2UY1B 3O48A 4UI9J 2FI7A 4U0SA 3ZHEA 5EX0A 3ASHA 4U07A 1HXIA 2MHKA 3OXGA 2XGMA 4J8FA 1YA0A 4U0ZA 2IFUA 4WNFA 4YNDA 4I17A 4N3AA 2FO7A 2XGSA 2FBNA 2VGXA 4WUYA 3UPVA 3ZGQA 4Y6WA 5G05J 3JYSA 4IN3B 4XIFA 3S7BA 4BTBA 4GYOA 3CVQA 3N71A 3TG4A 4UQXA 5CCMA 4I2WA 4NRHB 2FEZA 2JLBA 3QWWA 4GA1A 3LPZA 3CVLA 4GZ3A 3Q5MA 4G26A 4F3VA 2WQHA 4JHRA 3ZHEB 4AM9A 5BNWA 3QWPA 4U04A 3LY9A 5ARFA 3MV3B 2XGOA 2YHCA 5KJNA 5HI7A 4UI9C 4I9CA 3RO3A 4YVOA 3RU0A 4I9EA 5EKQD 2YQ8A 2L6JA 4N3BA 2PQNA 5M72A 3QWVA 1KT0A 2PL2A 4BTAA 4GA0A 1NZNA 5G04J 3KD7A 4JL0A 3QDNA 2VSYA 3QOUA 4I1AA 3TAXA 2V5FA 2UWJG 4I2ZA 5FJYA 3SF4A 5C1DA 3CEQA 3MKRA 2DBAA 5JJ7A 1ZBPA 4YVQC 5EX3A 3NF1A 4G23A 3TGOA 4N2QA 5G05C 5LCWC 4HOUA 2KC7A 3LY7A 3RKVA 2HR2A 4W9RA 3U3WA 1KLXA 4WNGA 3S7JA 3OXFA 5JJ6A 4HOQA 4XI9A 4BT8A 3ASDA 1IHGA 4UQZA 3RIBA 2QFCA 1FCHA 4H7YA 3FFLA 3R9AB 4BWRA 3GZ2A 3VTXA 5D0OD 4AIFA 1NA3A 4GCOA 1WAO1 4GA2A 4EQFA 5G04C 2PQRA 3PE3A 3CK9A 4N2SA 4APOA 4G2VA 3CKBA 5ARGA 2AVPA 2BUGA 1HZ4A 2HYZA 3QKYA 3Q47B 2FF4A 2VYIA 5D0QD 1NA0A 2KCKA 2UY1A 5JJTA 3ULQA 4J0UA 2OOEA 2E2EA 4LEUA 5KJKA 3AS4A 1OUVA 1HH8A 2Y4TA 5FZRA 4B94A 3S7FA 4KBQA 3CVNA 4G1TA 1XNFA 4BT9A 4HORA 1Y8MA 3SZ7A 3E4BA 2XEVA 4AY6A 3GYZA 4GZ5A 3RO2A 2Q7FA 3ZPJA 4UQYA 2VGXB 4N39A 2C0LA 4ME2A 1A17A 3LCAA 2LSUA 4G25A 5DBKA 4RG9A 1QZ2A 4HOTA 5KJLA 3K9IA 4J8EA 3CKCA 2J9QA 1KT1A 4WNEA 4XI0A 5FZQA 3CK7A 3RJVA 4KYOB 3S7DA 3CV0A 4KXKB 4JA7A 5FZSA 4JA9A 4HOSA 2KATA 4AY5A 1QQEA 1E96B 3HYMB 2R5SA 2KCLA
chains in the Genus database with same CATH superfamily
3FP3A 2VSXE 3CVVA 1IQUA 3L22A 3W9GA 4LUNU 4DPRA 3CK8A 3AG1E 3DSWA 4OAVB 2MOWA 3ZYMA 2P9LG 4CT4A 2VQ2A 1ZU2A 3SFXA 4R7LA 4GYYA 2WXPA 3PDNA 1NI1A 4CDMA 3QARA 3LY8A 3FUMA 1IYGA 3UQ3A 3IEGA 4L2YA 4FJZA 2AXZA 3NAWA 2I9CA 3SY2A 4XKCA 3CSTA 1KZPA 2KZTA 3I4GA 4AEZC 3FDHA 4KMOA 1N0QA 3CSFA 3U4TA 5EN5D 4CGVA 5A7DB 5KBAA 4HXIA 2C0MA 3MA5A 5AENA 1WDYA 5LP0A 5JMND 1S70B 4X8QA 4TXPA 3GW4A 4WWPA 3D9LA 3FU0A 3URZA 4FA6A 4GCNA 4UWLA 1HE8A 3UTMA 2VGYA 4JW1A 4Y6CA 2VSNA 2WPVA 4RVBA 3L16A 5ITZF 3V79K 2I6HA 4RG6A 3ASFA 4N3CA 2KXPC 1WM5A 2WXQA 3KAEA 2KCVA 5KJMA 4I1MA 5AYWD 5CBNA 2L6BA 4O60A 4DUIA 1E8WA 3Q9UC 4BX9A 3L08A 2UY1B 3FTXA 3QB2A 3PNLB 4D10C 4U0SA 2NSZA 3PEUB 1PAQA 3ULEG 3ZNGA 3ASNE 3CHMA 4F53A 4LSZE 2VSOE 2XGMA 5A23A 3BG0B 3JUEA 3UT8A 2EIME 3QJZA 3V31A 5CMWA 1N94A 2DIWA 4I17A 3NOGD 3ML9A 2FBNA 1E7VA 3ZXSA 4DLQA 4IN3B 5KNGA 4BTBA 4TXQA 3ULYA 3N71A 3TG4A 2NXPA 2J4BA 1RZ4A 3D9JA 1NFIE 5CEDB 4NRHB 5JA4D 2R05A 3AG2E 3Q5MA 5BV1A 4JHJA 5T3RA 1E8YA 2WXIA 4M3OA 2ZXWE 3MV3B 5B3SE 2KBXA 2YHCA 4HRLA 1H6KA 4ANVA 4OYSA 2RKKA 5FQ6A 2F8YA 5BXUA 2PQNA 4U95D 4TUUA 3MGBA 2BF0X 5M72A 3CVYA 2OV8A 4BTAA 4BSZB 3KD7A 1OCRE 3PZ4A 3IBEA 1H2VC 4EECA 2VSYA 1EYHA 3TAXA 2V5FA 4GTOA 2UWJG 4I2ZA 4I6EA 4U63A 1JCRA 5JJ7A 1OXJA 2LXMA 4ZFHA 4MLPA 5EX3A 3MZLB 1WY6A 2JABA 3EIQC 1DCQA 2AJAA 3DEPA 3QAQA 3TWVA 3CQCB 3FU3A 2HR2A 4W9RA 3FEYA 3D9OA 4GTPA 1E8ZA 1QYMA 3AG3E 3OXFA 2BTDA 4NACA 4F7AA 1K3ZD 3FTUA 1E8XA 1DC2A 4DI4A 3TWTA 4PS7A 3RIBA 2WXHA 1FCHA 4H7YA 3FFLA 2GRNB 4BWRA 3PZDA 3VTXA 3SBSA 2YINA 3I3NA 3C3QA 1OWMA 2J8SD 3PREA 3DSTA 4GA2A 2CG3A 4EPZA 3B7TA 5AARA 5G04C 4GTTA 2PQRA 1O5MA 4APOA 5ARGA 5LOZA 4L2LA 2J08A 4L1BA 2B0OE 2AVPA 1DCEA 1NL4A 1AP7A 4BETA 3PNTB 3TJPA 5JJTA 1IHBA 3HVEB 5ENRD 2IO3C 1MX4A 3AS4A 4V3IA 1OWNA 3TXMA 3PZ1A 1JWFA 1OWPA 2CG2A 1XNFA 4UUCA 3FULA 3NB2A 1V54E 4B89A 4GZ5A 3RO2A 3ZPJA 3HRAA 4Q96A 4A3VA 3RSEG 1TYQG 2E0IA 2EIKE 2C0LA 1H2TC 3FUIA 4HS2A 4B8CB 5JHAA 3FTVA 1UN8A 3C72A 1S64A 2RD0A 2XPZA 3BU8A 3L9TA 3PVLA 5KJLA 1UOHA 2QYUA 1O1TA 4JEUA 5CEAA 4I6JA 2IQCA 2V8SE 3CK7A 2VJ8A 4DLOA 5AQAA 3RJVA 3U64A 4AJWA 4JA7A 3ML8A 3R7QA 4JA9A 4UWKA 3PUKA 3ABLE 3L82A 1QQEA 2CHZA 5T8IA 3HYMB 2VTBA 2R5SA 1OCZE 2J09A 5D2MC 2KCLA 4EBAA 4ATGA 3CHOA 5JHBA 3C3RA 2P9PG 4WWOA 4BX8A 5KWDA 4O6FA 1H6PA 5BW8C 5EYPF 3SO8A 3R7RA 1Z3XA 4J8DA 1MJ0A 5ENPD 2YHEA 2XCCA 4U8HA 4BSXA 1TN6A 3UINC 2GW1A 5LCWJ 3ESKA 3FTYA 4P29A 2X6FA 2A4ZA 4FHJA 3CLJA 3ZFWA 2WQ6A 2XCBA 2ZGGA 4YDWA 2HM8A 2CFUA 1Q2ZA 3AG4E 2ZU6B 2PM7A 5BT1A 2ZIRA 1OY3D 4WNDA 2VTBB 1JCQA 4Z68A 5CRUA 5FT9A 3CVWA 4KZCA 2Y0BG 4GYWA 3EDTB 2IF4A 2QYJA 5AQ7A 3HXCA 4N5CA 3UIOC 3QNKA 3OXLA 4YDOA 1VDYA 2XEHA 2YNQA 2DYRE 2WXOA 2PZIA 1SA5A 3AS5A 1IKND 1HX8A 4WWNA 3UM3A 5HQ8A 4XZ4A 1UJKA 1TEZA 4NURA 5FQ8A 3AU4A 1UW4B 2FI7A 2J07A 3CVXA 4ATZD 2WXGA 2RG8A 2R59A 1N95A 1UJJA 3RK6A 3E30A 4HQDA 3RRUA 5EIBE 3UM1A 3LXUX 2R03A 3UMVA 4LERA 3FUNA 3ZYKA 5B1AE 4N3AA 3HG0D 2WMOA 3UT7A 3SGHA 3VLFA 5AJDA 4HLLA 4WUYA 3ZUVB 3ZGQA 4Y6WA 5G05J 3B95A 3UM2A 3JYSA 3SFYA 4HLEA 3MKQA 3CVQA 5CCMA 1TN7A 5BUZA 1N4RA 3DSVA 4FC8A 4JZYA 4B0ZA 1U3CA 2JLBA 4GA1A 2XQ0A 4UWHA 3CVLA 4FP7A 5AAOA 2WQHA 4JHRA 3PEVB 4GB9A 4AM9A 4EHMA 5BNWA 1HU3A 3QWPA 3L54A 1BLXB 4DX6D 2F37A 3AAAC 1OCOE 3RU0A 4I9EA 3S2AA 5EKQD 5E76A 5AJLA 1UN9A 2Y1LE 4ILHB 5HKPA 1JPLA 3QWVA 4KT6B 3BUAA 2IONA 1NZNA 3ZEFA 1TNYA 1A5EA 3QDNA 4I1AA 5C2YA 1SA4A 2R02A 5FJYA 1MYOA 3EU5A 3MKRA 4GMJA 2DBAA 1H0AA 4FULA 2ETAA 3TL5A 2KZTB 3FUDA 4LNBA 4C0MA 2XENA 3Q78A 3MKQB 3TGOA 4I1OB 1X5BA 1N0RA 4MBGA 2KC7A 3LY7A 3TWXA 2B6CA 4TUMA 4OAUC 3L17A 4IRUA 3HDXA 3ASDA 4AP2A 2VGEA 4QQIA 3NBNB 3MCXA 5CERB 1IHGA 4UQZA 2QFCA 3T8KA 3PZ3A 3R9AB 2V5QC 1SW6A 2V0PA 3L13A 1TNOA 4JHKA 4MRUA 1H2UA 4O1OA 2DZOA 3KEZA 1WAO1 1H6OA 3FU6A 4HRMB 4JEHA 4EQFA 3BQOA 2WXMA 4A1GA 3ZVVA 3ENEA 3UT4A 2X6IA 3PE3A 3CK9A 4J7WA 3RRMB 1TNZA 2GRLA 3CKBA 4CCAA 4N5QA 4NIKA 4K03A 2BUGA 3FTSA 1HZ4A 4KVOA 2HYZA 1IXVA 2VYIA 1MX6A 1NA0A 3JQ0A 4M7CA 4I6GA 1JUQA 3D9PA 3AJIA 4DX2A 1XGWA 1N54A 2JEKA 4G1TA 4BT9A 3FH8A 3E4BA 3DXKG 2Q7FA 1E7UA 3IKOB 4F1PA 1O1SA 2LSUA 4G25A 4HFGA 5DBKA 4AXHA 1Z5SC 4J8SA 4K5AB 3UX4A 2GRQB 4J8EA 3Q73A 2EILE 3SI5A 3PZ2A 2WB2A 3SNXA 1KT1A 1TJFA 4WNEA 3B13A 1UG3A 3G2TA 2AXVA 4KYOB 4KXKB 3KSQA 3T9KA 4HOSA 5CRVA 4AY5A 4ZHBA 2H6IA 4PUCA 1N4QA 2P9UG 3G2UA 1HS6A 4PDXA 2QY7A 1BU9A 1KPSB 3ZIMA 2P58C 2C2LA 2IOLA 2GRRB 3LYAA 1OWLA 3Q7FA 3NZUA 2HO1A 2LSVA 3LKUA 4K5CA 2DVWA 4PS8A 4LRZA 4AV7A 5J08A 3W9FA 1P5QA 5FIOA 5KNHD 3E37A 4U0UA 3F6QA 5CCLA 1JWGA 2BEDA 4BESA 4GTMA 4GPMA 1SZAA 4L23A 5AN8A 4JC8A 1K8KG 1AWCB 3FUJA 1X81A 4ABNA 3PUJA 5BXOA 5ENNA 3CVPA 4GZ6A 5ENSD 1INZA 2XS1A 3P1UA 4A1SA 1HG2A 4APFA 3CHSA 4GTRA 3AS8A 2L0TB 2X6HA 2H6FA 3MX3A 2KM4A 2H6HA 3Q4AB 2GROB 5DIZA 4DI3A 5EIDA 3FUKA 3FUFA 3J5PA 3RAUA 1DVPA 1TJCA 3B7BA 4MKTA 5KCMA 4C0EA 3LS8A 3MEKA 3E33A 4DX7D 2XHEA 4GMRA 3C98A 4G8KA 3ASGA 3EU9A 3U66A 3T5VA 3FHEA 4YDEA 2Y3AA 1LD7A 3EHRA 3HXEA 3FTWA 3O48A 4UI9J 5LFAA 1FT1A 3VLEA 4TRQA 3DSUA 5AQ9A 5EX0A 1OWOA 4HB5A 1HXIA 2MHKA 3TWSA 4J8FA 1YA0A 4A3TA 3UKRG 4U0ZA 1TR4A 4BFRA 2DWZA 4WNFA 5G55A 3G2SA 2FO7A 3T5XA 1TN8A 4BEPA 2VGXA 1PY1A 3DXMG 3DRAA 2WM9A 4JD2G 3S7BA 4DX1A 2L0IA 3FH5A 4UQXA 2CHWA 5EDSA 2XPYA 2X6JA 2FEZA 3QWWA 4E6HA 4C48B 3LPZA 5ANRA 2WVIA 4GZ3A 1LF8A 4F3VA 5AIJA 2ZGDA 3FY4A 2QZAA 2I1KA 4I43A 3Q7AA 1QBQA 3LY9A 5ARFA 1NP7A 4FADA 2XGOA 2XRZA 2Y69E 5HI7A 1EPUA 1HG5A 4I9CA 4XEIG 3EUVA 2P2CP 1E90A 3TWUA 4N3BA 2XZTG 3JXJA 2F0YA 4UWGA 2MRIA 1KT0A 3D9IA 3D9KA 4TV3A 3DPYA 4ANXA 5ENQD 4BY6A 1Z3YA 4JL0A 5CBOA 3QOUA 3MYVA 4DX5D 5ENOD 3SF4A 4FHKA 3CEQA 2GGFA 1ZBPA 2IOSA 3EJNA 4G23A 2AW6A 3X2QE 1TNBA 3CQGB 4KZ0A 3DPDA 5G05C 5HRYA 2WXNA 4HOUA 3UKUG 4TXRA 3UM0A 3CHQA 3CVUA 3U3WA 1MHQA 3G2VA 4A63B 4GAAA 2FO1E 5JJ6A 2DZNA 3V2OA 1D8DA 2AXUA 4XI9A 4BT8A 5CMYA 4G8LA 4CEMA 4K0RA 3LDZA 1N52A 4A55A 4Q69A 3LVQE 4U8YD 1NA3A 1BD8A 2ILRA 1G3NB 1SQMA 3TXNA 2V4LA 4LG6A 2IU1A 2X6KA 3L6AA 5IY5E 1ELKA 3UI2A 4FLBA 3HXFA 1LD8A 2AWIA 3TWWA 4CT0A 3DBSA 1N11A 4N2SA 3FU5A 1RW2A 4G2VA 4GTSA 2V4HC 4AVXA 4IYPA 2XZDG 3LJNA 3JQ1A 1SVXA 5D0QD 2KCKA 1MX2A 2UY1A 3SQVA 3ULQA 4J0UA 2OOEA 3TWRA 2E2EA 1QNFA 4XKBA 3CHRA 4LEUA 3DEOA 1DNPA 1O1RA 1HH8A 2Y4TA 4KBQA 1WG0A 3CVNA 5G2NA 2H6GA 5T4YA 3DSXA 2WMNA 3SZ7A 1MQSA 2OCCE 3JUIA 4G11A 1EDUA 2MYOA 2XEVA 3GYZA 2XEEA 4ME2A 2ETCA 2OVFA 1A17A 1Z6TA 3LCAA 4RG9A 4HOTA 2XS8A 3AU5A 3V30A 4LNUD 1S0PA 2J9QA 2DYSE 2BKKB 3D9HA 2R17C 5J90A 3CIAA 3S7DA 2F8XK 2X3MA 5FZSA 3P2BA 1HF8A 2KATA 1N4PA 3FUEA 3LVRE 4EZLA 3HXBA 4PS3A 4NQ0A 4RLYA 1YMPA 2Y4UA 2IO2C 5FWQA 1YCSB 3D3MA 4K5BA 4URKA 2WXJA 1PC2A 3UUXA 2XPIA 2ONDA 3B7RL 3KSLA 4GU5A 3NZSA 3TG5A 3WG7E 4C9BB 4O1PA 3SBTB 3ZN3A 3Q75A 1BI8B 3C3OA 5A6CA 3EHMA 3HHMA 3RRNB 3IHYA 3ABME 3Q9NC 3IHVA 1HFAA 3KEAA 3FTZA 3LJ3A 2NC9A 3Q49B 4GPKA 2A5UA 1SZ9A 4HI9A 2DCPA 2GRPB 3IV0A 4FJYA 3MV2B 3OTNA 1B89A 1ELRA 4XX5A 5FQ4A 3BEEA 1FPPA 3O4ZA 2LNIA 4XE0A 2FULA 2BKGA 5H7PA 4B93B 4KVMA 1ELWA 3PE4A 3LEWA 1FVHA 2EIJE 4CGWA 4F1SA 4G24A 3APDA 4CDRA 2OEWA 3U9WA 3VTYA 3ABKE 4DJAA 2WXKA 2XRYA 3CR3A 4PH4B 3WXXA 1KZOA 2P9IG 1EF1C 4H7XA 4UI9K 3Q15A 5FTPA 2RFMA 3HXDA 3KS2A 3GZ1A 5LX8A 3SHFA 3FWVA 4U96D 5HS0A 1W3BA 3EHNA 3PS6A 4JPSA 2HE0A 4EZKA 4EBAG 2QC9A 2OVBA 3EIJA 3QC1A 4DRXE 4JB8P 4CDNA 1FT2A 1JCSA 4IULA 2IJGX 5CHEE 4HBDA 1L5JA 2OEVA 4RQIA 3ZKJA 2X38A 2LAIA 2P9NG 4RSYA 3ZHEA 3ASHA 1D8EA 4U07A 5BPPA 3HVEA 3OXGA 5B1BE 3ASOE 5EILA 1U2VG 2WQ7A 4Q94A 2J4DA 1H19A 2IFUA 3ZRHA 3R9MA 3B7SA 4YNDA 3HIZA 2XGSA 2PNNA 2P9KG 5BV0A 3ISMC 3UPVA 4BERA 3Q79A 4DK5A 3GZSA 4XIFA 3APCA 4GYOA 2LO6A 1K1AA 2WXLA 3G2WA 4I2WA 4U8VD 2RFAA 4LCTA 2L9BA 4LNGA 2ETBA 3BG1B 4G26A 4GMLA 5D66A 3I5PA 3ZHEB 2CHXA 4FLHA 4U04A 4CZ2D 5CECB 5FINA 3EHQA 5EYLA 5KJNA 4UI9C 1ZB1A 3RO3A 1LTXA 3ZYLA 4YVOA 4ANWA 2LAHA 4GZDA 4ILIA 1YYHA 2YQ8A 2L6JA 2EINE 2PL2A 4GA0A 5G04J 3NOCD 3CHPA 3V2XA 3JXIA 3JCKC 3D9MA 5C1DA 1GW6A 4YVQC 3QK0A 3NF1A 3SFZA 3UXGA 2I2OA 2GRMA 4OVVA 4N2QA 4ACKA 5LCWC 2CFZA 4HRNA 4JVSA 3ZYQA 3RKVA 4ILGA 3CGHA 1KLXA 1MZCA 2WXRA 3UIPC 4WNGA 4L9PA 2PM6A 3S7JA 4HOQA 3APFA 4CRWA 3T8MA 3OAWA 5FQ7A 3VLDA 3E32A 4ANUA 3FUHA 1TNUA 3ONLA 3SD5A 4F6RD 2LXLA 5AQBA 4CYMD 3GZ2A 4J8YA 3FEXA 5D0OD 3C5RA 3I4RB 4AIFA 3IXEA 4AOFA 3PRZA 3MJWA 4GCOA 4U7EB 4ACLA 2I1JA 2ZISA 1BI7B 1BPOA 4HI8A 4OVUA 4HVBA 4GTQA 2NYJA 2M63A 2WXFA 2R2LA 3J5QB 4YDYA 4EZJA 2J49A 5ANLA 3QKYA 3Q47B 2FF4A 3E34A 1OCCE 1D9SA 4MS6A 3B7UX 4GTVA 3ONKA 4WAFA 1S63A 2P9SG 5KJKA 1N9AA 1OUVA 3PH0C 1N4SA 5FZRA 4B94A 2EQXA 3S7FA 4QFVA 4HORA 1Y8MA 4E85A 2A5EA 4AY6A 4UWFA 4HNAD 5E75A 4UQYA 1V55E 2VGXB 4N39A 1Y6IA 2LUHA 1OT8A 5ENTD 1QZ2A 4B8AA 2IEJA 3K9IA 3NQPA 3CKCA 3ZXPA 3DSSA 1FVFA 4XI0A 5FZQA 3ESLA 1K1BA 4L7TA 3DWLG 1IQRA 3FH7A 3CV0A 4GZCA 4FU3A 4JXTA 1U3DA 3TWQA 3ZW3A 2IY0C 3D9NA 4J6IA 1E96B 3ZU7B 1HO8A
chains in the Genus database with same CATH topology
4EBAA 3G2UA 1HS6A 3FP3A 4ATGA 3CHOA 4PDXA 2QY7A 2VSXE 4EZLA 5JHBA 3CVVA 1IQUA 3L22A 4WWOA 3HYMB 4PS3A 4BX8A 4NQ0A 3ZIMA 2P58C 4LUNU 2C2LA 4DPRA 2IOLA 3CK8A 2Y4UA 3LYAA 5FWQA 1OWLA 2MOWA 3NZUA 2HO1A 3D3MA 2LSVA 3ZYMA 4O6FA 4CT4A 5BW8C 4URKA 2WXJA 2VQ2A 1PC2A 3UUXA 2XPIA 2ONDA 3LKUA 3B7RL 1ZU2A 4R7LA 4GU5A 4GYYA 4PS8A 4LRZA 3NZSA 3TG5A 4AV7A 2WXPA 3PDNA 4C9BB 3SBTB 4CDMA 3ZN3A 3QARA 5J08A 3LY8A 3FUMA 3R7RA 5A6CA 1P5QA 1Z3XA 3EHMA 3HHMA 4J8DA 3RRNB 3IHYA 1IYGA 3UQ3A 3LVRE 2YHEA 4U0UA 3IEGA 2XCCA 3IHVA 4U8HA 4BSXA 1HFAA 3FTZA 5CCLA 2GW1A 3LJ3A 5LCWJ 3ESKA 1JWGA 4L2YA 4FJZA 3FTYA 2NC9A 3Q49B 4P29A 4GPKA 2X6FA 2A5UA 1SZ9A 2A4ZA 2AXZA 2DCPA 2I9CA 3CLJA 3IV0A 3CSTA 4FHJA 4FJYA 4XKCA 2KZTA 3MV2B 3I4GA 4AEZC 3FDHA 3OTNA 1B89A 4KMOA 3ZFWA 2WQ6A 3CSFA 1ELRA 1SZAA 2XCBA 4L23A 4XX5A 3U4TA 4JC8A 5FQ4A 4CGVA 3BEEA 3O4ZA 2LNIA 5A7DB 2HM8A 4XE0A 4HXIA 2CFUA 2FULA 2C0MA 3FUJA 3MA5A 4ABNA 5AENA 3PUJA 2ZU6B 2PM7A 1ELWA 4KVMA 5BT1A 5ENNA 3CVPA 4GZ6A 1INZA 5LP0A 3P1UA 4A1SA 1HG2A 3PE4A 4WNDA 3LEWA 4APFA 3CHSA 2VTBB 3GW4A 3AS8A 4WWPA 2L0TB 3D9LA 1FVHA 2X6HA 3FU0A 3MX3A 5FT9A 2KM4A 3URZA 4CGWA 4FA6A 3Q4AB 4F1SA 4G24A 3CVWA 4GCNA 4UWLA 3APDA 4KZCA 5DIZA 1HE8A 3VTYA 3U9WA 4CDRA 4DI3A 4DJAA 2VGYA 2WXKA 2XRYA 4GYWA 3CR3A 4PH4B 3WXXA 3EDTB 2IF4A 3FUKA 3FUFA 4JW1A 4Y6CA 1DVPA 1TJCA 4N5CA 1EF1C 4H7XA 2VSNA 4UI9K 3Q15A 3QNKA 2WPVA 4MKTA 4RVBA 5FTPA 3L16A 5KCMA 3OXLA 3LS8A 3MEKA 4C0EA 3KS2A 3GZ1A 1VDYA 5LX8A 2I6HA 3SHFA 2XHEA 3FWVA 2YNQA 4RG6A 2WXOA 3ASFA 1W3BA 3EHNA 4N3CA 1WM5A 2WXQA 2PZIA 3KAEA 3PS6A 4JPSA 4EZKA 3C98A 3AS5A 1HX8A 4WWNA 3ASGA 4EBAG 2KCVA 2OVBA 5HQ8A 5KJMA 4XZ4A 3U66A 3EIJA 4I1MA 3QC1A 1UJKA 5AYWD 4CDNA 3T5VA 3FHEA 1TEZA 4NURA 1E8WA 2Y3AA 4IULA 2IJGX 5CHEE 5FQ8A 1L5JA 4BX9A 3AU4A 3L08A 2UY1B 3FTWA 3FTXA 1UW4B 3QB2A 3O48A 3PNLB 4UI9J 5LFAA 2FI7A 4D10C 4U0SA 2J07A 2NSZA 2X38A 3VLEA 2LAIA 3PEUB 3CVXA 1PAQA 4RSYA 4TRQA 3ZHEA 2WXGA 2RG8A 5EX0A 1OWOA 2R59A 3ASHA 3CHMA 4U07A 5BPPA 1UJJA 4F53A 3RK6A 1HXIA 3RRUA 2MHKA 2VSOE 2XGMA 3HVEA 3OXGA 5A23A 3LXUX 4J8FA 2WQ7A 3BG0B 4Q94A 2J4DA 1H19A 3UMVA 1YA0A 4LERA 3UT8A 3FUNA 4A3TA 4U0ZA 3QJZA 5CMWA 4BFRA 2IFUA 4WNFA 3ZRHA 2DIWA 3B7SA 4YNDA 3ZYKA 3HIZA 4I17A 5G55A 4N3AA 3G2SA 2FO7A 2XGSA 3ML9A 2WMOA 3T5XA 3UT7A 3SGHA 2FBNA 3VLFA 5AJDA 1E7VA 2VGXA 4WUYA 5BV0A 3UPVA 3ZGQA 4Y6WA 1PY1A 3ZXSA 5G05J 4DLQA 4DK5A 2WM9A 3GZSA 3JYSA 4IN3B 4XIFA 3S7BA 3APCA 4BTBA 4HLEA 4GYOA 3MKQA 2L0IA 2LO6A 3CVQA 3FH5A 2WXLA 3G2WA 3N71A 4UQXA 3TG4A 5CCMA 2NXPA 2J4BA 5BUZA 3D9JA 4FC8A 4JZYA 2CHWA 4B0ZA 4I2WA 1U3CA 5EDSA 2XPYA 4NRHB 2X6JA 2FEZA 2JLBA 3QWWA 4GA1A 4E6HA 2XQ0A 4LCTA 2L9BA 4UWHA 3LPZA 5ANRA 2WVIA 3CVLA 4GZ3A 3BG1B 1LF8A 3Q5MA 4G26A 4GMLA 4F3VA 4FP7A 2WQHA 5AIJA 4JHRA 3I5PA 3PEVB 3FY4A 5BV1A 2I1KA 4JHJA 5T3RA 3ZHEB 4GB9A 4I43A 4AM9A 1E8YA 5BNWA 2WXIA 1HU3A 2CHXA 4M3OA 3QWPA 4FLHA 4U04A 3LY9A 5ARFA 1NP7A 3MV3B 4FADA 2XGOA 2YHCA 2XRZA 3L54A 1H6KA 5KJNA 5HI7A 4ANVA 1EPUA 1HG5A 4OYSA 4UI9C 4I9CA 3RO3A 3ZYLA 4YVOA 5FQ6A 2LAHA 4GZDA 4ILIA 4I9EA 3RU0A 3S2AA 1E90A 4ANWA 5EKQD 2YQ8A 2L6JA 4N3BA 2PQNA 5E76A 5AJLA 1UN9A 4TUUA 3MGBA 4ILHB 2BF0X 1JPLA 4UWGA 5M72A 3QWVA 3CVYA 2OV8A 2MRIA 1KT0A 3D9IA 3D9KA 4KT6B 4TV3A 2PL2A 2IONA 4GA0A 1NZNA 4BTAA 4ANXA 5G04J 3KD7A 3ZEFA 4BY6A 1Z3YA 4JL0A 3IBEA 1H2VC 3QDNA 4EECA 2VSYA 1EYHA 3QOUA 3MYVA 4I1AA 3CHPA 5C2YA 2V5FA 3TAXA 2UWJG 3JCKC 3D9MA 4I2ZA 4I6EA 4U63A 5FJYA 4FHKA 3SF4A 5C1DA 3CEQA 2GGFA 3MKRA 2DBAA 1H0AA 4FULA 4GMJA 5JJ7A 1ZBPA 3TL5A 2KZTB 1GW6A 3FUDA 3QK0A 4MLPA 4YVQC 3NF1A 2IOSA 5EX3A 3SFZA 4C0MA 3MKQB 3MZLB 1WY6A 3EJNA 4G23A 2AW6A 3TGOA 2I2OA 2GRMA 4OVVA 4N2QA 3CQGB 4KZ0A 3DPDA 4I1OB 5G05C 3EIQC 4ACKA 5LCWC 1X5BA 2CFZA 4JVSA 2WXNA 4HOUA 2KC7A 3QAQA 3ZYQA 3LY7A 3RKVA 3CHQA 3CQCB 3FU3A 4ILGA 3CVUA 2HR2A 4W9RA 3U3WA 3CGHA 1KLXA 1MHQA 3D9OA 3G2VA 3FEYA 2WXRA 1E8ZA 3L17A 4GAAA 4WNGA 2PM6A 4IRUA 3S7JA 3OXFA 5JJ6A 4HOQA 2BTDA 3HDXA 4NACA 4F7AA 2AXUA 4XI9A 3FTUA 4BT8A 3ASDA 4AP2A 5CMYA 1E8XA 3APFA 4CEMA 4K0RA 4CRWA 3LDZA 3T8MA 3MCXA 3OAWA 5FQ7A 4DI4A 1N52A 1IHGA 4UQZA 3VLDA 4A55A 4PS7A 3RIBA 4Q69A 2WXHA 4ANUA 3FUHA 2QFCA 3ONLA 3SD5A 3LVQE 1FCHA 4H7YA 3FFLA 3R9AB 4BWRA 3GZ2A 3PZDA 3VTXA 3FEXA 5D0OD 3SBSA 2YINA 2V0PA 3I3NA 3L13A 3I4RB 4JHKA 4AIFA 4AOFA 4MRUA 1OWMA 1H2UA 1NA3A 3PRZA 3MJWA 2ILRA 4GCOA 1SQMA 3TXNA 3KEZA 3PREA 4ACLA 1WAO1 2V4LA 4GA2A 2CG3A 4EPZA 2I1JA 3B7TA 2IU1A 3FU6A 2X6KA 1BPOA 4OVUA 4JEHA 3L6AA 4HVBA 4EQFA 1ELKA 2WXMA 4A1GA 4FLBA 3ZVVA 5G04C 2AWIA 3ENEA 3UT4A 2PQRA 2X6IA 3PE3A 4CT0A 3CK9A 3DBSA 2M63A 3RRMB 2GRLA 3FU5A 4N2SA 4APOA 4G2VA 3CKBA 5ARGA 5LOZA 4CCAA 4AVXA 2WXFA 4L2LA 2J08A 4L1BA 4K03A 2AVPA 2BUGA 3FTSA 1HZ4A 4EZJA 4IYPA 2J49A 5ANLA 4KVOA 3JQ1A 2HYZA 3PNTB 3QKYA 3Q47B 2FF4A 2VYIA 5D0QD 1NA0A 4MS6A 3JQ0A 2KCKA 3B7UX 3ONKA 2UY1A 3TJPA 4I6GA 4WAFA 5JJTA 1JUQA 3ULQA 4J0UA 2OOEA 2E2EA 1QNFA 3D9PA 4XKBA 3HVEB 3CHRA 4LEUA 5KJKA 1DNPA 1XGWA 3AS4A 1OUVA 4V3IA 1N54A 3PH0C 1HH8A 1OWNA 2Y4TA 5FZRA 3TXMA 4B94A 2EQXA 3S7FA 1JWFA 4KBQA 1OWPA 3CVNA 2JEKA 5G2NA 2CG2A 4G1TA 1XNFA 4BT9A 4QFVA 4HORA 1Y8MA 4E85A 5T4YA 3FULA 2WMNA 3SZ7A 1MQSA 3FH8A 3E4BA 3JUIA 4G11A 1EDUA 2XEVA 4AY6A 4B89A 3GYZA 4GZ5A 4UWFA 3RO2A 2Q7FA 5E75A 3ZPJA 4UQYA 1E7UA 3IKOB 4Q96A 4A3VA 2VGXB 2E0IA 4N39A 1Y6IA 1H2TC 2C0LA 3FUIA 4ME2A 2OVFA 4HS2A 1A17A 4B8CB 1Z6TA 3LCAA 2LSUA 4G25A 5JHAA 3FTVA 1UN8A 4HFGA 5DBKA 4RG9A 1QZ2A 4B8AA 4AXHA 4HOTA 2RD0A 3AU5A 2XPZA 4J8SA 3PVLA 5KJLA 3UX4A 3K9IA 3NQPA 4J8EA 3CKCA 3SI5A 4JEUA 2WB2A 1S0PA 4I6JA 2J9QA 3SNXA 1FVFA 1KT1A 1TJFA 2IQCA 2V8SE 3B13A 4WNEA 4XI0A 5FZQA 3ESLA 2R17C 3CK7A 2VJ8A 4L7TA 1UG3A 5J90A 4DLOA 3RJVA 3CIAA 3G2TA 3U64A 2AXVA 1IQRA 3FH7A 4KYOB 4AJWA 3S7DA 3CV0A 4GZCA 4FU3A 4JXTA 1U3DA 4KXKB 2X3MA 4JA7A 3ML8A 3R7QA 5FZSA 3P2BA 4JA9A 4UWKA 1HF8A 4HOSA 2KATA 3PUKA 4AY5A 3ZW3A 1QQEA 3D9NA 4J6IA 1E96B 4PUCA 2CHZA 5T8IA 1HO8A 3FUEA 2VTBA 2R5SA 2J09A 2KCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FP3 A;  4NQ0 A;  2P58 C;  2C2L A;  3CK8 A;  2Y4U A;  3LYA A;  2HO1 A;  2LSV A;  4O6F A;  5BW8 C;  2VQ2 A;  1PC2 A;  3UUX A;  2XPI A;  2OND A;  3LKU A;  1ZU2 A;  4GYY A;  3TG5 A;  3PDN A;  3ZN3 A;  3LY8 A;  5A6C A;  1P5Q A;  4J8D A;  1IYG A;  3UQ3 A;  4U0U A;  3IEG A;  2XCC A;  5CCL A;  2GW1 A;  5LCW J;  3ESK A;  2NC9 A;  3Q49 B;  4GPK A;  3MV2 B;  1B89 A;  3ZFW A;  1ELR A;  3U4T A;  2XCB A;  4CGV A;  3BEE A;  2LNI A;  5A7D B;  2C0M A;  3MA5 A;  4ABN A;  1ELW A;  5BT1 A;  3CVP A;  4GZ6 A;  4A1S A;  3PE4 A;  4WND A;  3GW4 A;  3AS8 A;  5FT9 A;  4CGW A;  3URZ A;  3Q4A B;  4G24 A;  4GCN A;  4CDR A;  5DIZ A;  3VTY A;  2VGY A;  4GYW A;  3WXX A;  3EDT B;  2IF4 A;  4Y6C A;  1TJC A;  4N5C A;  4H7X A;  2VSN A;  4UI9 K;  3Q15 A;  2WPV A;  5FTP A;  3OXL A;  3MEK A;  3KS2 A;  3GZ1 A;  2I6H A;  3FWV A;  4RG6 A;  3ASF A;  1W3B A;  4N3C A;  1WM5 A;  2PZI A;  3KAE A;  3AS5 A;  3ASG A;  2KCV A;  5HQ8 A;  5KJM A;  5AYW D;  5CHE E;  2UY1 B;  3O48 A;  4UI9 J;  2FI7 A;  4U0S A;  3ZHE A;  5EX0 A;  3ASH A;  4U07 A;  1HXI A;  2MHK A;  3OXG A;  2XGM A;  4J8F A;  1YA0 A;  4U0Z A;  2IFU A;  4WNF A;  4YND A;  4I17 A;  4N3A A;  2FO7 A;  2XGS A;  2FBN A;  2VGX A;  4WUY A;  3UPV A;  3ZGQ A;  4Y6W A;  5G05 J;  3JYS A;  4IN3 B;  4XIF A;  3S7B A;  4BTB A;  4GYO A;  3CVQ A;  3N71 A;  3TG4 A;  4UQX A;  5CCM A;  4I2W A;  4NRH B;  2FEZ A;  2JLB A;  3QWW A;  4GA1 A;  3LPZ A;  3CVL A;  4GZ3 A;  3Q5M A;  4G26 A;  4F3V A;  2WQH A;  4JHR A;  3ZHE B;  4AM9 A;  5BNW A;  3QWP A;  4U04 A;  3LY9 A;  5ARF A;  3MV3 B;  2XGO A;  2YHC A;  5KJN A;  5HI7 A;  4UI9 C;  4I9C A;  3RO3 A;  4YVO A;  3RU0 A;  4I9E A;  5EKQ D;  2YQ8 A;  2L6J A;  4N3B A;  2PQN A;  5M72 A;  3QWV A;  1KT0 A;  2PL2 A;  4BTA A;  4GA0 A;  1NZN A;  5G04 J;  3KD7 A;  4JL0 A;  3QDN A;  2VSY A;  3QOU A;  4I1A A;  3TAX A;  2V5F A;  2UWJ G;  4I2Z A;  5FJY A;  3SF4 A;  5C1D A;  3CEQ A;  3MKR A;  2DBA A;  5JJ7 A;  1ZBP A;  4YVQ C;  5EX3 A;  3NF1 A;  4G23 A;  3TGO A;  4N2Q A;  5G05 C;  5LCW C;  4HOU A;  2KC7 A;  3LY7 A;  3RKV A;  2HR2 A;  4W9R A;  3U3W A;  1KLX A;  4WNG A;  3S7J A;  3OXF A;  5JJ6 A;  4HOQ A;  4XI9 A;  4BT8 A;  3ASD A;  1IHG A;  4UQZ A;  3RIB A;  2QFC A;  1FCH A;  4H7Y A;  3FFL A;  3R9A B;  4BWR A;  3GZ2 A;  3VTX A;  5D0O D;  4AIF A;  1NA3 A;  4GCO A;  1WAO 1;  4GA2 A;  4EQF A;  5G04 C;  2PQR A;  3PE3 A;  3CK9 A;  4N2S A;  4APO A;  4G2V A;  3CKB A;  5ARG A;  2AVP A;  2BUG A;  1HZ4 A;  2HYZ A;  3QKY A;  3Q47 B;  2FF4 A;  2VYI A;  5D0Q D;  1NA0 A;  2KCK A;  2UY1 A;  5JJT A;  3ULQ A;  4J0U A;  2OOE A;  2E2E A;  4LEU A;  5KJK A;  3AS4 A;  1OUV A;  1HH8 A;  2Y4T A;  5FZR A;  4B94 A;  3S7F A;  4KBQ A;  3CVN A;  4G1T A;  1XNF A;  4BT9 A;  4HOR A;  1Y8M A;  3SZ7 A;  3E4B A;  2XEV A;  4AY6 A;  3GYZ A;  4GZ5 A;  3RO2 A;  2Q7F A;  3ZPJ A;  4UQY A;  2VGX B;  4N39 A;  2C0L A;  4ME2 A;  1A17 A;  3LCA A;  2LSU A;  4G25 A;  5DBK A;  4RG9 A;  1QZ2 A;  4HOT A;  5KJL A;  3K9I A;  4J8E A;  3CKC A;  2J9Q A;  1KT1 A;  4WNE A;  4XI0 A;  5FZQ A;  3CK7 A;  3RJV A;  4KYO B;  3S7D A;  3CV0 A;  4KXK B;  4JA7 A;  5FZS A;  4JA9 A;  4HOS A;  2KAT A;  4AY5 A;  1QQE A;  1E96 B;  3HYM B;  2R5S A;  2KCL A; 
#chains in the Genus database with same CATH topology
 3FP3 A;  2VSX E;  3CVV A;  1IQU A;  3L22 A;  3W9G A;  4LUN U;  4DPR A;  3CK8 A;  3AG1 E;  3DSW A;  4OAV B;  2MOW A;  3ZYM A;  2P9L G;  4CT4 A;  2VQ2 A;  1ZU2 A;  3SFX A;  4R7L A;  4GYY A;  2WXP A;  3PDN A;  1NI1 A;  4CDM A;  3QAR A;  3LY8 A;  3FUM A;  1IYG A;  3UQ3 A;  3IEG A;  4L2Y A;  4FJZ A;  2AXZ A;  3NAW A;  2I9C A;  3SY2 A;  4XKC A;  3CST A;  1KZP A;  2KZT A;  3I4G A;  4AEZ C;  3FDH A;  4KMO A;  1N0Q A;  3CSF A;  3U4T A;  5EN5 D;  4CGV A;  5A7D B;  5KBA A;  4HXI A;  2C0M A;  3MA5 A;  5AEN A;  1WDY A;  5LP0 A;  5JMN D;  1S70 B;  4X8Q A;  4TXP A;  3GW4 A;  4WWP A;  3D9L A;  3FU0 A;  3URZ A;  4FA6 A;  4GCN A;  4UWL A;  1HE8 A;  3UTM A;  2VGY A;  4JW1 A;  4Y6C A;  2VSN A;  2WPV A;  4RVB A;  3L16 A;  5ITZ F;  3V79 K;  2I6H A;  4RG6 A;  3ASF A;  4N3C A;  2KXP C;  1WM5 A;  2WXQ A;  3KAE A;  2KCV A;  5KJM A;  4I1M A;  5AYW D;  5CBN A;  2L6B A;  4O60 A;  4DUI A;  1E8W A;  3Q9U C;  4BX9 A;  3L08 A;  2UY1 B;  3FTX A;  3QB2 A;  3PNL B;  4D10 C;  4U0S A;  2NSZ A;  3PEU B;  1PAQ A;  3ULE G;  3ZNG A;  3ASN E;  3CHM A;  4F53 A;  4LSZ E;  2VSO E;  2XGM A;  5A23 A;  3BG0 B;  3JUE A;  3UT8 A;  2EIM E;  3QJZ A;  3V31 A;  5CMW A;  1N94 A;  2DIW A;  4I17 A;  3NOG D;  3ML9 A;  2FBN A;  1E7V A;  3ZXS A;  4DLQ A;  4IN3 B;  5KNG A;  4BTB A;  4TXQ A;  3ULY A;  3N71 A;  3TG4 A;  2NXP A;  2J4B A;  1RZ4 A;  3D9J A;  1NFI E;  5CED B;  4NRH B;  5JA4 D;  2R05 A;  3AG2 E;  3Q5M A;  5BV1 A;  4JHJ A;  5T3R A;  1E8Y A;  2WXI A;  4M3O A;  2ZXW E;  3MV3 B;  5B3S E;  2KBX A;  2YHC A;  4HRL A;  1H6K A;  4ANV A;  4OYS A;  2RKK A;  5FQ6 A;  2F8Y A;  5BXU A;  2PQN A;  4U95 D;  4TUU A;  3MGB A;  2BF0 X;  5M72 A;  3CVY A;  2OV8 A;  4BTA A;  4BSZ B;  3KD7 A;  1OCR E;  3PZ4 A;  3IBE A;  1H2V C;  4EEC A;  2VSY A;  1EYH A;  3TAX A;  2V5F A;  4GTO A;  2UWJ G;  4I2Z A;  4I6E A;  4U63 A;  1JCR A;  5JJ7 A;  1OXJ A;  2LXM A;  4ZFH A;  4MLP A;  5EX3 A;  3MZL B;  1WY6 A;  2JAB A;  3EIQ C;  1DCQ A;  2AJA A;  3DEP A;  3QAQ A;  3TWV A;  3CQC B;  3FU3 A;  2HR2 A;  4W9R A;  3FEY A;  3D9O A;  4GTP A;  1E8Z A;  1QYM A;  3AG3 E;  3OXF A;  2BTD A;  4NAC A;  4F7A A;  1K3Z D;  3FTU A;  1E8X A;  1DC2 A;  4DI4 A;  3TWT A;  4PS7 A;  3RIB A;  2WXH A;  1FCH A;  4H7Y A;  3FFL A;  2GRN B;  4BWR A;  3PZD A;  3VTX A;  3SBS A;  2YIN A;  3I3N A;  3C3Q A;  1OWM A;  2J8S D;  3PRE A;  3DST A;  4GA2 A;  2CG3 A;  4EPZ A;  3B7T A;  5AAR A;  5G04 C;  4GTT A;  2PQR A;  1O5M A;  4APO A;  5ARG A;  5LOZ A;  4L2L A;  2J08 A;  4L1B A;  2B0O E;  2AVP A;  1DCE A;  1NL4 A;  1AP7 A;  4BET A;  3PNT B;  3TJP A;  5JJT A;  1IHB A;  3HVE B;  5ENR D;  2IO3 C;  1MX4 A;  3AS4 A;  4V3I A;  1OWN A;  3TXM A;  3PZ1 A;  1JWF A;  1OWP A;  2CG2 A;  1XNF A;  4UUC A;  3FUL A;  3NB2 A;  1V54 E;  4B89 A;  4GZ5 A;  3RO2 A;  3ZPJ A;  3HRA A;  4Q96 A;  4A3V A;  3RSE G;  1TYQ G;  2E0I A;  2EIK E;  2C0L A;  1H2T C;  3FUI A;  4HS2 A;  4B8C B;  5JHA A;  3FTV A;  1UN8 A;  3C72 A;  1S64 A;  2RD0 A;  2XPZ A;  3BU8 A;  3L9T A;  3PVL A;  5KJL A;  1UOH A;  2QYU A;  1O1T A;  4JEU A;  5CEA A;  4I6J A;  2IQC A;  2V8S E;  3CK7 A;  2VJ8 A;  4DLO A;  5AQA A;  3RJV A;  3U64 A;  4AJW A;  4JA7 A;  3ML8 A;  3R7Q A;  4JA9 A;  4UWK A;  3PUK A;  3ABL E;  3L82 A;  1QQE A;  2CHZ A;  5T8I A;  3HYM B;  2VTB A;  2R5S A;  1OCZ E;  2J09 A;  5D2M C;  2KCL A;  4EBA A;  4ATG A;  3CHO A;  5JHB A;  3C3R A;  2P9P G;  4WWO A;  4BX8 A;  5KWD A;  4O6F A;  1H6P A;  5BW8 C;  5EYP F;  3SO8 A;  3R7R A;  1Z3X A;  4J8D A;  1MJ0 A;  5ENP D;  2YHE A;  2XCC A;  4U8H A;  4BSX A;  1TN6 A;  3UIN C;  2GW1 A;  5LCW J;  3ESK A;  3FTY A;  4P29 A;  2X6F A;  2A4Z A;  4FHJ A;  3CLJ A;  3ZFW A;  2WQ6 A;  2XCB A;  2ZGG A;  4YDW A;  2HM8 A;  2CFU A;  1Q2Z A;  3AG4 E;  2ZU6 B;  2PM7 A;  5BT1 A;  2ZIR A;  1OY3 D;  4WND A;  2VTB B;  1JCQ A;  4Z68 A;  5CRU A;  5FT9 A;  3CVW A;  4KZC A;  2Y0B G;  4GYW A;  3EDT B;  2IF4 A;  2QYJ A;  5AQ7 A;  3HXC A;  4N5C A;  3UIO C;  3QNK A;  3OXL A;  4YDO A;  1VDY A;  2XEH A;  2YNQ A;  2DYR E;  2WXO A;  2PZI A;  1SA5 A;  3AS5 A;  1IKN D;  1HX8 A;  4WWN A;  3UM3 A;  5HQ8 A;  4XZ4 A;  1UJK A;  1TEZ A;  4NUR A;  5FQ8 A;  3AU4 A;  1UW4 B;  2FI7 A;  2J07 A;  3CVX A;  4ATZ D;  2WXG A;  2RG8 A;  2R59 A;  1N95 A;  1UJJ A;  3RK6 A;  3E30 A;  4HQD A;  3RRU A;  5EIB E;  3UM1 A;  3LXU X;  2R03 A;  3UMV A;  4LER A;  3FUN A;  3ZYK A;  5B1A E;  4N3A A;  3HG0 D;  2WMO A;  3UT7 A;  3SGH A;  3VLF A;  5AJD A;  4HLL A;  4WUY A;  3ZUV B;  3ZGQ A;  4Y6W A;  5G05 J;  3B95 A;  3UM2 A;  3JYS A;  3SFY A;  4HLE A;  3MKQ A;  3CVQ A;  5CCM A;  1TN7 A;  5BUZ A;  1N4R A;  3DSV A;  4FC8 A;  4JZY A;  4B0Z A;  1U3C A;  2JLB A;  4GA1 A;  2XQ0 A;  4UWH A;  3CVL A;  4FP7 A;  5AAO A;  2WQH A;  4JHR A;  3PEV B;  4GB9 A;  4AM9 A;  4EHM A;  5BNW A;  1HU3 A;  3QWP A;  3L54 A;  1BLX B;  4DX6 D;  2F37 A;  3AAA C;  1OCO E;  3RU0 A;  4I9E A;  3S2A A;  5EKQ D;  5E76 A;  5AJL A;  1UN9 A;  2Y1L E;  4ILH B;  5HKP A;  1JPL A;  3QWV A;  4KT6 B;  3BUA A;  2ION A;  1NZN A;  3ZEF A;  1TNY A;  1A5E A;  3QDN A;  4I1A A;  5C2Y A;  1SA4 A;  2R02 A;  5FJY A;  1MYO A;  3EU5 A;  3MKR A;  4GMJ A;  2DBA A;  1H0A A;  4FUL A;  2ETA A;  3TL5 A;  2KZT B;  3FUD A;  4LNB A;  4C0M A;  2XEN A;  3Q78 A;  3MKQ B;  3TGO A;  4I1O B;  1X5B A;  1N0R A;  4MBG A;  2KC7 A;  3LY7 A;  3TWX A;  2B6C A;  4TUM A;  4OAU C;  3L17 A;  4IRU A;  3HDX A;  3ASD A;  4AP2 A;  2VGE A;  4QQI A;  3NBN B;  3MCX A;  5CER B;  1IHG A;  4UQZ A;  2QFC A;  3T8K A;  3PZ3 A;  3R9A B;  2V5Q C;  1SW6 A;  2V0P A;  3L13 A;  1TNO A;  4JHK A;  4MRU A;  1H2U A;  4O1O A;  2DZO A;  3KEZ A;  1WAO 1;  1H6O A;  3FU6 A;  4HRM B;  4JEH A;  4EQF A;  3BQO A;  2WXM A;  4A1G A;  3ZVV A;  3ENE A;  3UT4 A;  2X6I A;  3PE3 A;  3CK9 A;  4J7W A;  3RRM B;  1TNZ A;  2GRL A;  3CKB A;  4CCA A;  4N5Q A;  4NIK A;  4K03 A;  2BUG A;  3FTS A;  1HZ4 A;  4KVO A;  2HYZ A;  1IXV A;  2VYI A;  1MX6 A;  1NA0 A;  3JQ0 A;  4M7C A;  4I6G A;  1JUQ A;  3D9P A;  3AJI A;  4DX2 A;  1XGW A;  1N54 A;  2JEK A;  4G1T A;  4BT9 A;  3FH8 A;  3E4B A;  3DXK G;  2Q7F A;  1E7U A;  3IKO B;  4F1P A;  1O1S A;  2LSU A;  4G25 A;  4HFG A;  5DBK A;  4AXH A;  1Z5S C;  4J8S A;  4K5A B;  3UX4 A;  2GRQ B;  4J8E A;  3Q73 A;  2EIL E;  3SI5 A;  3PZ2 A;  2WB2 A;  3SNX A;  1KT1 A;  1TJF A;  4WNE A;  3B13 A;  1UG3 A;  3G2T A;  2AXV A;  4KYO B;  4KXK B;  3KSQ A;  3T9K A;  4HOS A;  5CRV A;  4AY5 A;  4ZHB A;  2H6I A;  4PUC A;  1N4Q A;  2P9U G;  3G2U A;  1HS6 A;  4PDX A;  2QY7 A;  1BU9 A;  1KPS B;  3ZIM A;  2P58 C;  2C2L A;  2IOL A;  2GRR B;  3LYA A;  1OWL A;  3Q7F A;  3NZU A;  2HO1 A;  2LSV A;  3LKU A;  4K5C A;  2DVW A;  4PS8 A;  4LRZ A;  4AV7 A;  5J08 A;  3W9F A;  1P5Q A;  5FIO A;  5KNH D;  3E37 A;  4U0U A;  3F6Q A;  5CCL A;  1JWG A;  2BED A;  4BES A;  4GTM A;  4GPM A;  1SZA A;  4L23 A;  5AN8 A;  4JC8 A;  1K8K G;  1AWC B;  3FUJ A;  1X81 A;  4ABN A;  3PUJ A;  5BXO A;  5ENN A;  3CVP A;  4GZ6 A;  5ENS D;  1INZ A;  2XS1 A;  3P1U A;  4A1S A;  1HG2 A;  4APF A;  3CHS A;  4GTR A;  3AS8 A;  2L0T B;  2X6H A;  2H6F A;  3MX3 A;  2KM4 A;  2H6H A;  3Q4A B;  2GRO B;  5DIZ A;  4DI3 A;  5EID A;  3FUK A;  3FUF A;  3J5P A;  3RAU A;  1DVP A;  1TJC A;  3B7B A;  4MKT A;  5KCM A;  4C0E A;  3LS8 A;  3MEK A;  3E33 A;  4DX7 D;  2XHE A;  4GMR A;  3C98 A;  4G8K A;  3ASG A;  3EU9 A;  3U66 A;  3T5V A;  3FHE A;  4YDE A;  2Y3A A;  1LD7 A;  3EHR A;  3HXE A;  3FTW A;  3O48 A;  4UI9 J;  5LFA A;  1FT1 A;  3VLE A;  4TRQ A;  3DSU A;  5AQ9 A;  5EX0 A;  1OWO A;  4HB5 A;  1HXI A;  2MHK A;  3TWS A;  4J8F A;  1YA0 A;  4A3T A;  3UKR G;  4U0Z A;  1TR4 A;  4BFR A;  2DWZ A;  4WNF A;  5G55 A;  3G2S A;  2FO7 A;  3T5X A;  1TN8 A;  4BEP A;  2VGX A;  1PY1 A;  3DXM G;  3DRA A;  2WM9 A;  4JD2 G;  3S7B A;  4DX1 A;  2L0I A;  3FH5 A;  4UQX A;  2CHW A;  5EDS A;  2XPY A;  2X6J A;  2FEZ A;  3QWW A;  4E6H A;  4C48 B;  3LPZ A;  5ANR A;  2WVI A;  4GZ3 A;  1LF8 A;  4F3V A;  5AIJ A;  2ZGD A;  3FY4 A;  2QZA A;  2I1K A;  4I43 A;  3Q7A A;  1QBQ A;  3LY9 A;  5ARF A;  1NP7 A;  4FAD A;  2XGO A;  2XRZ A;  2Y69 E;  5HI7 A;  1EPU A;  1HG5 A;  4I9C A;  4XEI G;  3EUV A;  2P2C P;  1E90 A;  3TWU A;  4N3B A;  2XZT G;  3JXJ A;  2F0Y A;  4UWG A;  2MRI A;  1KT0 A;  3D9I A;  3D9K A;  4TV3 A;  3DPY A;  4ANX A;  5ENQ D;  4BY6 A;  1Z3Y A;  4JL0 A;  5CBO A;  3QOU A;  3MYV A;  4DX5 D;  5ENO D;  3SF4 A;  4FHK A;  3CEQ A;  2GGF A;  1ZBP A;  2IOS A;  3EJN A;  4G23 A;  2AW6 A;  3X2Q E;  1TNB A;  3CQG B;  4KZ0 A;  3DPD A;  5G05 C;  5HRY A;  2WXN A;  4HOU A;  3UKU G;  4TXR A;  3UM0 A;  3CHQ A;  3CVU A;  3U3W A;  1MHQ A;  3G2V A;  4A63 B;  4GAA A;  2FO1 E;  5JJ6 A;  2DZN A;  3V2O A;  1D8D A;  2AXU A;  4XI9 A;  4BT8 A;  5CMY A;  4G8L A;  4CEM A;  4K0R A;  3LDZ A;  1N52 A;  4A55 A;  4Q69 A;  3LVQ E;  4U8Y D;  1NA3 A;  1BD8 A;  2ILR A;  1G3N B;  1SQM A;  3TXN A;  2V4L A;  4LG6 A;  2IU1 A;  2X6K A;  3L6A A;  5IY5 E;  1ELK A;  3UI2 A;  4FLB A;  3HXF A;  1LD8 A;  2AWI A;  3TWW A;  4CT0 A;  3DBS A;  1N11 A;  4N2S A;  3FU5 A;  1RW2 A;  4G2V A;  4GTS A;  2V4H C;  4AVX A;  4IYP A;  2XZD G;  3LJN A;  3JQ1 A;  1SVX A;  5D0Q D;  2KCK A;  1MX2 A;  2UY1 A;  3SQV A;  3ULQ A;  4J0U A;  2OOE A;  3TWR A;  2E2E A;  1QNF A;  4XKB A;  3CHR A;  4LEU A;  3DEO A;  1DNP A;  1O1R A;  1HH8 A;  2Y4T A;  4KBQ A;  1WG0 A;  3CVN A;  5G2N A;  2H6G A;  5T4Y A;  3DSX A;  2WMN A;  3SZ7 A;  1MQS A;  2OCC E;  3JUI A;  4G11 A;  1EDU A;  2MYO A;  2XEV A;  3GYZ A;  2XEE A;  4ME2 A;  2ETC A;  2OVF A;  1A17 A;  1Z6T A;  3LCA A;  4RG9 A;  4HOT A;  2XS8 A;  3AU5 A;  3V30 A;  4LNU D;  1S0P A;  2J9Q A;  2DYS E;  2BKK B;  3D9H A;  2R17 C;  5J90 A;  3CIA A;  3S7D A;  2F8X K;  2X3M A;  5FZS A;  3P2B A;  1HF8 A;  2KAT A;  1N4P A;  3FUE A;  3LVR E;  4EZL A;  3HXB A;  4PS3 A;  4NQ0 A;  4RLY A;  1YMP A;  2Y4U A;  2IO2 C;  5FWQ A;  1YCS B;  3D3M A;  4K5B A;  4URK A;  2WXJ A;  1PC2 A;  3UUX A;  2XPI A;  2OND A;  3B7R L;  3KSL A;  4GU5 A;  3NZS A;  3TG5 A;  3WG7 E;  4C9B B;  4O1P A;  3SBT B;  3ZN3 A;  3Q75 A;  1BI8 B;  3C3O A;  5A6C A;  3EHM A;  3HHM A;  3RRN B;  3IHY A;  3ABM E;  3Q9N C;  3IHV A;  1HFA A;  3KEA A;  3FTZ A;  3LJ3 A;  2NC9 A;  3Q49 B;  4GPK A;  2A5U A;  1SZ9 A;  4HI9 A;  2DCP A;  2GRP B;  3IV0 A;  4FJY A;  3MV2 B;  3OTN A;  1B89 A;  1ELR A;  4XX5 A;  5FQ4 A;  3BEE A;  1FPP A;  3O4Z A;  2LNI A;  4XE0 A;  2FUL A;  2BKG A;  5H7P A;  4B93 B;  4KVM A;  1ELW A;  3PE4 A;  3LEW A;  1FVH A;  2EIJ E;  4CGW A;  4F1S A;  4G24 A;  3APD A;  4CDR A;  2OEW A;  3U9W A;  3VTY A;  3ABK E;  4DJA A;  2WXK A;  2XRY A;  3CR3 A;  4PH4 B;  3WXX A;  1KZO A;  2P9I G;  1EF1 C;  4H7X A;  4UI9 K;  3Q15 A;  5FTP A;  2RFM A;  3HXD A;  3KS2 A;  3GZ1 A;  5LX8 A;  3SHF A;  3FWV A;  4U96 D;  5HS0 A;  1W3B A;  3EHN A;  3PS6 A;  4JPS A;  2HE0 A;  4EZK A;  4EBA G;  2QC9 A;  2OVB A;  3EIJ A;  3QC1 A;  4DRX E;  4JB8 P;  4CDN A;  1FT2 A;  1JCS A;  4IUL A;  2IJG X;  5CHE E;  4HBD A;  1L5J A;  2OEV A;  4RQI A;  3ZKJ A;  2X38 A;  2LAI A;  2P9N G;  4RSY A;  3ZHE A;  3ASH A;  1D8E A;  4U07 A;  5BPP A;  3HVE A;  3OXG A;  5B1B E;  3ASO E;  5EIL A;  1U2V G;  2WQ7 A;  4Q94 A;  2J4D A;  1H19 A;  2IFU A;  3ZRH A;  3R9M A;  3B7S A;  4YND A;  3HIZ A;  2XGS A;  2PNN A;  2P9K G;  5BV0 A;  3ISM C;  3UPV A;  4BER A;  3Q79 A;  4DK5 A;  3GZS A;  4XIF A;  3APC A;  4GYO A;  2LO6 A;  1K1A A;  2WXL A;  3G2W A;  4I2W A;  4U8V D;  2RFA A;  4LCT A;  2L9B A;  4LNG A;  2ETB A;  3BG1 B;  4G26 A;  4GML A;  5D66 A;  3I5P A;  3ZHE B;  2CHX A;  4FLH A;  4U04 A;  4CZ2 D;  5CEC B;  5FIN A;  3EHQ A;  5EYL A;  5KJN A;  4UI9 C;  1ZB1 A;  3RO3 A;  1LTX A;  3ZYL A;  4YVO A;  4ANW A;  2LAH A;  4GZD A;  4ILI A;  1YYH A;  2YQ8 A;  2L6J A;  2EIN E;  2PL2 A;  4GA0 A;  5G04 J;  3NOC D;  3CHP A;  3V2X A;  3JXI A;  3JCK C;  3D9M A;  5C1D A;  1GW6 A;  4YVQ C;  3QK0 A;  3NF1 A;  3SFZ A;  3UXG A;  2I2O A;  2GRM A;  4OVV A;  4N2Q A;  4ACK A;  5LCW C;  2CFZ A;  4HRN A;  4JVS A;  3ZYQ A;  3RKV A;  4ILG A;  3CGH A;  1KLX A;  1MZC A;  2WXR A;  3UIP C;  4WNG A;  4L9P A;  2PM6 A;  3S7J A;  4HOQ A;  3APF A;  4CRW A;  3T8M A;  3OAW A;  5FQ7 A;  3VLD A;  3E32 A;  4ANU A;  3FUH A;  1TNU A;  3ONL A;  3SD5 A;  4F6R D;  2LXL A;  5AQB A;  4CYM D;  3GZ2 A;  4J8Y A;  3FEX A;  5D0O D;  3C5R A;  3I4R B;  4AIF A;  3IXE A;  4AOF A;  3PRZ A;  3MJW A;  4GCO A;  4U7E B;  4ACL A;  2I1J A;  2ZIS A;  1BI7 B;  1BPO A;  4HI8 A;  4OVU A;  4HVB A;  4GTQ A;  2NYJ A;  2M63 A;  2WXF A;  2R2L A;  3J5Q B;  4YDY A;  4EZJ A;  2J49 A;  5ANL A;  3QKY A;  3Q47 B;  2FF4 A;  3E34 A;  1OCC E;  1D9S A;  4MS6 A;  3B7U X;  4GTV A;  3ONK A;  4WAF A;  1S63 A;  2P9S G;  5KJK A;  1N9A A;  1OUV A;  3PH0 C;  1N4S A;  5FZR A;  4B94 A;  2EQX A;  3S7F A;  4QFV A;  4HOR A;  1Y8M A;  4E85 A;  2A5E A;  4AY6 A;  4UWF A;  4HNA D;  5E75 A;  4UQY A;  1V55 E;  2VGX B;  4N39 A;  1Y6I A;  2LUH A;  1OT8 A;  5ENT D;  1QZ2 A;  4B8A A;  2IEJ A;  3K9I A;  3NQP A;  3CKC A;  3ZXP A;  3DSS A;  1FVF A;  4XI0 A;  5FZQ A;  3ESL A;  1K1B A;  4L7T A;  3DWL G;  1IQR A;  3FH7 A;  3CV0 A;  4GZC A;  4FU3 A;  4JXT A;  1U3D A;  3TWQ A;  3ZW3 A;  2IY0 C;  3D9N A;  4J6I A;  1E96 B;  3ZU7 B;  1HO8 A; 
#chains in the Genus database with same CATH homology
 4EBA A;  3G2U A;  1HS6 A;  3FP3 A;  4ATG A;  3CHO A;  4PDX A;  2QY7 A;  2VSX E;  4EZL A;  5JHB A;  3CVV A;  1IQU A;  3L22 A;  4WWO A;  3HYM B;  4PS3 A;  4BX8 A;  4NQ0 A;  3ZIM A;  2P58 C;  4LUN U;  2C2L A;  4DPR A;  2IOL A;  3CK8 A;  2Y4U A;  3LYA A;  5FWQ A;  1OWL A;  2MOW A;  3NZU A;  2HO1 A;  3D3M A;  2LSV A;  3ZYM A;  4O6F A;  4CT4 A;  5BW8 C;  4URK A;  2WXJ A;  2VQ2 A;  1PC2 A;  3UUX A;  2XPI A;  2OND A;  3LKU A;  3B7R L;  1ZU2 A;  4R7L A;  4GU5 A;  4GYY A;  4PS8 A;  4LRZ A;  3NZS A;  3TG5 A;  4AV7 A;  2WXP A;  3PDN A;  4C9B B;  3SBT B;  4CDM A;  3ZN3 A;  3QAR A;  5J08 A;  3LY8 A;  3FUM A;  3R7R A;  5A6C A;  1P5Q A;  1Z3X A;  3EHM A;  3HHM A;  4J8D A;  3RRN B;  3IHY A;  1IYG A;  3UQ3 A;  3LVR E;  2YHE A;  4U0U A;  3IEG A;  2XCC A;  3IHV A;  4U8H A;  4BSX A;  1HFA A;  3FTZ A;  5CCL A;  2GW1 A;  3LJ3 A;  5LCW J;  3ESK A;  1JWG A;  4L2Y A;  4FJZ A;  3FTY A;  2NC9 A;  3Q49 B;  4P29 A;  4GPK A;  2X6F A;  2A5U A;  1SZ9 A;  2A4Z A;  2AXZ A;  2DCP A;  2I9C A;  3CLJ A;  3IV0 A;  3CST A;  4FHJ A;  4FJY A;  4XKC A;  2KZT A;  3MV2 B;  3I4G A;  4AEZ C;  3FDH A;  3OTN A;  1B89 A;  4KMO A;  3ZFW A;  2WQ6 A;  3CSF A;  1ELR A;  1SZA A;  2XCB A;  4L23 A;  4XX5 A;  3U4T A;  4JC8 A;  5FQ4 A;  4CGV A;  3BEE A;  3O4Z A;  2LNI A;  5A7D B;  2HM8 A;  4XE0 A;  4HXI A;  2CFU A;  2FUL A;  2C0M A;  3FUJ A;  3MA5 A;  4ABN A;  5AEN A;  3PUJ A;  2ZU6 B;  2PM7 A;  1ELW A;  4KVM A;  5BT1 A;  5ENN A;  3CVP A;  4GZ6 A;  1INZ A;  5LP0 A;  3P1U A;  4A1S A;  1HG2 A;  3PE4 A;  4WND A;  3LEW A;  4APF A;  3CHS A;  2VTB B;  3GW4 A;  3AS8 A;  4WWP A;  2L0T B;  3D9L A;  1FVH A;  2X6H A;  3FU0 A;  3MX3 A;  5FT9 A;  2KM4 A;  3URZ A;  4CGW A;  4FA6 A;  3Q4A B;  4F1S A;  4G24 A;  3CVW A;  4GCN A;  4UWL A;  3APD A;  4KZC A;  5DIZ A;  1HE8 A;  3VTY A;  3U9W A;  4CDR A;  4DI3 A;  4DJA A;  2VGY A;  2WXK A;  2XRY A;  4GYW A;  3CR3 A;  4PH4 B;  3WXX A;  3EDT B;  2IF4 A;  3FUK A;  3FUF A;  4JW1 A;  4Y6C A;  1DVP A;  1TJC A;  4N5C A;  1EF1 C;  4H7X A;  2VSN A;  4UI9 K;  3Q15 A;  3QNK A;  2WPV A;  4MKT A;  4RVB A;  5FTP A;  3L16 A;  5KCM A;  3OXL A;  3LS8 A;  3MEK A;  4C0E A;  3KS2 A;  3GZ1 A;  1VDY A;  5LX8 A;  2I6H A;  3SHF A;  2XHE A;  3FWV A;  2YNQ A;  4RG6 A;  2WXO A;  3ASF A;  1W3B A;  3EHN A;  4N3C A;  1WM5 A;  2WXQ A;  2PZI A;  3KAE A;  3PS6 A;  4JPS A;  4EZK A;  3C98 A;  3AS5 A;  1HX8 A;  4WWN A;  3ASG A;  4EBA G;  2KCV A;  2OVB A;  5HQ8 A;  5KJM A;  4XZ4 A;  3U66 A;  3EIJ A;  4I1M A;  3QC1 A;  1UJK A;  5AYW D;  4CDN A;  3T5V A;  3FHE A;  1TEZ A;  4NUR A;  1E8W A;  2Y3A A;  4IUL A;  2IJG X;  5CHE E;  5FQ8 A;  1L5J A;  4BX9 A;  3AU4 A;  3L08 A;  2UY1 B;  3FTW A;  3FTX A;  1UW4 B;  3QB2 A;  3O48 A;  3PNL B;  4UI9 J;  5LFA A;  2FI7 A;  4D10 C;  4U0S A;  2J07 A;  2NSZ A;  2X38 A;  3VLE A;  2LAI A;  3PEU B;  3CVX A;  1PAQ A;  4RSY A;  4TRQ A;  3ZHE A;  2WXG A;  2RG8 A;  5EX0 A;  1OWO A;  2R59 A;  3ASH A;  3CHM A;  4U07 A;  5BPP A;  1UJJ A;  4F53 A;  3RK6 A;  1HXI A;  3RRU A;  2MHK A;  2VSO E;  2XGM A;  3HVE A;  3OXG A;  5A23 A;  3LXU X;  4J8F A;  2WQ7 A;  3BG0 B;  4Q94 A;  2J4D A;  1H19 A;  3UMV A;  1YA0 A;  4LER A;  3UT8 A;  3FUN A;  4A3T A;  4U0Z A;  3QJZ A;  5CMW A;  4BFR A;  2IFU A;  4WNF A;  3ZRH A;  2DIW A;  3B7S A;  4YND A;  3ZYK A;  3HIZ A;  4I17 A;  5G55 A;  4N3A A;  3G2S A;  2FO7 A;  2XGS A;  3ML9 A;  2WMO A;  3T5X A;  3UT7 A;  3SGH A;  2FBN A;  3VLF A;  5AJD A;  1E7V A;  2VGX A;  4WUY A;  5BV0 A;  3UPV A;  3ZGQ A;  4Y6W A;  1PY1 A;  3ZXS A;  5G05 J;  4DLQ A;  4DK5 A;  2WM9 A;  3GZS A;  3JYS A;  4IN3 B;  4XIF A;  3S7B A;  3APC A;  4BTB A;  4HLE A;  4GYO A;  3MKQ A;  2L0I A;  2LO6 A;  3CVQ A;  3FH5 A;  2WXL A;  3G2W A;  3N71 A;  4UQX A;  3TG4 A;  5CCM A;  2NXP A;  2J4B A;  5BUZ A;  3D9J A;  4FC8 A;  4JZY A;  2CHW A;  4B0Z A;  4I2W A;  1U3C A;  5EDS A;  2XPY A;  4NRH B;  2X6J A;  2FEZ A;  2JLB A;  3QWW A;  4GA1 A;  4E6H A;  2XQ0 A;  4LCT A;  2L9B A;  4UWH A;  3LPZ A;  5ANR A;  2WVI A;  3CVL A;  4GZ3 A;  3BG1 B;  1LF8 A;  3Q5M A;  4G26 A;  4GML A;  4F3V A;  4FP7 A;  2WQH A;  5AIJ A;  4JHR A;  3I5P A;  3PEV B;  3FY4 A;  5BV1 A;  2I1K A;  4JHJ A;  5T3R A;  3ZHE B;  4GB9 A;  4I43 A;  4AM9 A;  1E8Y A;  5BNW A;  2WXI A;  1HU3 A;  2CHX A;  4M3O A;  3QWP A;  4FLH A;  4U04 A;  3LY9 A;  5ARF A;  1NP7 A;  3MV3 B;  4FAD A;  2XGO A;  2YHC A;  2XRZ A;  3L54 A;  1H6K A;  5KJN A;  5HI7 A;  4ANV A;  1EPU A;  1HG5 A;  4OYS A;  4UI9 C;  4I9C A;  3RO3 A;  3ZYL A;  4YVO A;  5FQ6 A;  2LAH A;  4GZD A;  4ILI A;  4I9E A;  3RU0 A;  3S2A A;  1E90 A;  4ANW A;  5EKQ D;  2YQ8 A;  2L6J A;  4N3B A;  2PQN A;  5E76 A;  5AJL A;  1UN9 A;  4TUU A;  3MGB A;  4ILH B;  2BF0 X;  1JPL A;  4UWG A;  5M72 A;  3QWV A;  3CVY A;  2OV8 A;  2MRI A;  1KT0 A;  3D9I A;  3D9K A;  4KT6 B;  4TV3 A;  2PL2 A;  2ION A;  4GA0 A;  1NZN A;  4BTA A;  4ANX A;  5G04 J;  3KD7 A;  3ZEF A;  4BY6 A;  1Z3Y A;  4JL0 A;  3IBE A;  1H2V C;  3QDN A;  4EEC A;  2VSY A;  1EYH A;  3QOU A;  3MYV A;  4I1A A;  3CHP A;  5C2Y A;  2V5F A;  3TAX A;  2UWJ G;  3JCK C;  3D9M A;  4I2Z A;  4I6E A;  4U63 A;  5FJY A;  4FHK A;  3SF4 A;  5C1D A;  3CEQ A;  2GGF A;  3MKR A;  2DBA A;  1H0A A;  4FUL A;  4GMJ A;  5JJ7 A;  1ZBP A;  3TL5 A;  2KZT B;  1GW6 A;  3FUD A;  3QK0 A;  4MLP A;  4YVQ C;  3NF1 A;  2IOS A;  5EX3 A;  3SFZ A;  4C0M A;  3MKQ B;  3MZL B;  1WY6 A;  3EJN A;  4G23 A;  2AW6 A;  3TGO A;  2I2O A;  2GRM A;  4OVV A;  4N2Q A;  3CQG B;  4KZ0 A;  3DPD A;  4I1O B;  5G05 C;  3EIQ C;  4ACK A;  5LCW C;  1X5B A;  2CFZ A;  4JVS A;  2WXN A;  4HOU A;  2KC7 A;  3QAQ A;  3ZYQ A;  3LY7 A;  3RKV A;  3CHQ A;  3CQC B;  3FU3 A;  4ILG A;  3CVU A;  2HR2 A;  4W9R A;  3U3W A;  3CGH A;  1KLX A;  1MHQ A;  3D9O A;  3G2V A;  3FEY A;  2WXR A;  1E8Z A;  3L17 A;  4GAA A;  4WNG A;  2PM6 A;  4IRU A;  3S7J A;  3OXF A;  5JJ6 A;  4HOQ A;  2BTD A;  3HDX A;  4NAC A;  4F7A A;  2AXU A;  4XI9 A;  3FTU A;  4BT8 A;  3ASD A;  4AP2 A;  5CMY A;  1E8X A;  3APF A;  4CEM A;  4K0R A;  4CRW A;  3LDZ A;  3T8M A;  3MCX A;  3OAW A;  5FQ7 A;  4DI4 A;  1N52 A;  1IHG A;  4UQZ A;  3VLD A;  4A55 A;  4PS7 A;  3RIB A;  4Q69 A;  2WXH A;  4ANU A;  3FUH A;  2QFC A;  3ONL A;  3SD5 A;  3LVQ E;  1FCH A;  4H7Y A;  3FFL A;  3R9A B;  4BWR A;  3GZ2 A;  3PZD A;  3VTX A;  3FEX A;  5D0O D;  3SBS A;  2YIN A;  2V0P A;  3I3N A;  3L13 A;  3I4R B;  4JHK A;  4AIF A;  4AOF A;  4MRU A;  1OWM A;  1H2U A;  1NA3 A;  3PRZ A;  3MJW A;  2ILR A;  4GCO A;  1SQM A;  3TXN A;  3KEZ A;  3PRE A;  4ACL A;  1WAO 1;  2V4L A;  4GA2 A;  2CG3 A;  4EPZ A;  2I1J A;  3B7T A;  2IU1 A;  3FU6 A;  2X6K A;  1BPO A;  4OVU A;  4JEH A;  3L6A A;  4HVB A;  4EQF A;  1ELK A;  2WXM A;  4A1G A;  4FLB A;  3ZVV A;  5G04 C;  2AWI A;  3ENE A;  3UT4 A;  2PQR A;  2X6I A;  3PE3 A;  4CT0 A;  3CK9 A;  3DBS A;  2M63 A;  3RRM B;  2GRL A;  3FU5 A;  4N2S A;  4APO A;  4G2V A;  3CKB A;  5ARG A;  5LOZ A;  4CCA A;  4AVX A;  2WXF A;  4L2L A;  2J08 A;  4L1B A;  4K03 A;  2AVP A;  2BUG A;  3FTS A;  1HZ4 A;  4EZJ A;  4IYP A;  2J49 A;  5ANL A;  4KVO A;  3JQ1 A;  2HYZ A;  3PNT B;  3QKY A;  3Q47 B;  2FF4 A;  2VYI A;  5D0Q D;  1NA0 A;  4MS6 A;  3JQ0 A;  2KCK A;  3B7U X;  3ONK A;  2UY1 A;  3TJP A;  4I6G A;  4WAF A;  5JJT A;  1JUQ A;  3ULQ A;  4J0U A;  2OOE A;  2E2E A;  1QNF A;  3D9P A;  4XKB A;  3HVE B;  3CHR A;  4LEU A;  5KJK A;  1DNP A;  1XGW A;  3AS4 A;  1OUV A;  4V3I A;  1N54 A;  3PH0 C;  1HH8 A;  1OWN A;  2Y4T A;  5FZR A;  3TXM A;  4B94 A;  2EQX A;  3S7F A;  1JWF A;  4KBQ A;  1OWP A;  3CVN A;  2JEK A;  5G2N A;  2CG2 A;  4G1T A;  1XNF A;  4BT9 A;  4QFV A;  4HOR A;  1Y8M A;  4E85 A;  5T4Y A;  3FUL A;  2WMN A;  3SZ7 A;  1MQS A;  3FH8 A;  3E4B A;  3JUI A;  4G11 A;  1EDU A;  2XEV A;  4AY6 A;  4B89 A;  3GYZ A;  4GZ5 A;  4UWF A;  3RO2 A;  2Q7F A;  5E75 A;  3ZPJ A;  4UQY A;  1E7U A;  3IKO B;  4Q96 A;  4A3V A;  2VGX B;  2E0I A;  4N39 A;  1Y6I A;  1H2T C;  2C0L A;  3FUI A;  4ME2 A;  2OVF A;  4HS2 A;  1A17 A;  4B8C B;  1Z6T A;  3LCA A;  2LSU A;  4G25 A;  5JHA A;  3FTV A;  1UN8 A;  4HFG A;  5DBK A;  4RG9 A;  1QZ2 A;  4B8A A;  4AXH A;  4HOT A;  2RD0 A;  3AU5 A;  2XPZ A;  4J8S A;  3PVL A;  5KJL A;  3UX4 A;  3K9I A;  3NQP A;  4J8E A;  3CKC A;  3SI5 A;  4JEU A;  2WB2 A;  1S0P A;  4I6J A;  2J9Q A;  3SNX A;  1FVF A;  1KT1 A;  1TJF A;  2IQC A;  2V8S E;  3B13 A;  4WNE A;  4XI0 A;  5FZQ A;  3ESL A;  2R17 C;  3CK7 A;  2VJ8 A;  4L7T A;  1UG3 A;  5J90 A;  4DLO A;  3RJV A;  3CIA A;  3G2T A;  3U64 A;  2AXV A;  1IQR A;  3FH7 A;  4KYO B;  4AJW A;  3S7D A;  3CV0 A;  4GZC A;  4FU3 A;  4JXT A;  1U3D A;  4KXK B;  2X3M A;  4JA7 A;  3ML8 A;  3R7Q A;  5FZS A;  3P2B A;  4JA9 A;  4UWK A;  1HF8 A;  4HOS A;  2KAT A;  3PUK A;  4AY5 A;  3ZW3 A;  1QQE A;  3D9N A;  4J6I A;  1E96 B;  4PUC A;  2CHZ A;  5T8I A;  1HO8 A;  3FUE A;  2VTB A;  2R5S A;  2J09 A;  2KCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...