4APQC

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-sulfatide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
201
structure length
196
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIGEN-PRESENTING GLYCOPROTEIN CD1D1
publication title Type-II Natural Killer T Cell Antigen Receptor Mediated Recognition of Cd1D-Sulfatide
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 35
structure length 196
sequence length 201
ec nomenclature
pdb deposition date 2012-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4apqC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4apqC02
1WFTA 3QPQC 4PJ7A 1JV5A 4O02L 2B1AL 4M7JL 2DMBA 4OZFG 1YY9D 1AXIB 4K3HA 4P9HC 4U1HA 1UM6H 4Z78B 2OK0H 1OSPH 1X4ZA 3FOLA 3KPPA 4OCSL 4R7NB 3KLDA 5DQJB 1HHKA 2O5ZH 5EB9A 2G2RB 5IVXA 4M48H 3FT4B 5T1KA 4XVTL 4RNRB 5BS0D 3AMLA 1AGBA 5TFSH 3SDXA 1D5ZB 1B0RA 2NQCA 3BYYA 3GSOB 4X4XA 1W0WA 2BZDA 1YY8B 2VQTA 3MGTB 5I17A 3MOQA 2EDTA 1TTUA 3BD4A 2WWKT 5IKCA 2MKWA 1S7QB 3DRQA 3REVB 1QR1A 3QI9A 1EFXA 3U9UA 4YE4L 3OJMB 2IPKB 2RAMA 2H2SC 5IQ9A 2XRAH 3B5HA 4X0KB 1JPST 3Q6FA 1M1SA 1UM4H 3DSFL 3UYOD 5E8EB 2KQNA 1EO5A 3P0VL 3DNKA 5GGVH 3QA3B 2AXHA 4OQTL 4OZHA 1LO4L 3CK0L 4LARL 4F8TA 2H3NA 5SX5H 1KTDB 1IFHL 3IDYC 4JPKH 2NY1C 2QQKH 4KMQA 3H9SD 2GT9B 3G9AB 2ZKHL 4FQJL 5EH1A 2V2XA 1I3GH 2VR4A 4RGMC 1HZHH 2J8UB 5DRZA 1AIFB 4UDTA 4AM0A 2P49B 5IB4A 3G5YB 4KRPD 2WUBH 2Z4QB 3FRPA 1KJ2L 4HMCA 5ICZA 2CK0L 3D2UA 3EOBB 4AG4H 4WFED 2DQGL 4I5BA 1P1ZA 1EEQA 3QCVH 3OX8A 1MIMH 2OP4L 4BSVB 3IDYB 2NY1B 2CK2A 4M1CD 1TJHL 2UWEE 4GH7B 2ZG2A 3TZVA 3PGDB 2JLLA 4FFZH 1NMCC 1ROWA 2KUTA 1LILA 4LPCA 4E42B 4EBQH 4RGMB 4XTRD 4HWEL 2MCG1 4F2MA 4Y4KD 1U8PA 4LAQL 5CJ5A 5EPMA 4DJMA 4L5FL 1I1AD 5SWSD 3MLUH 4M6OH 1A6TB 1QSEB 1HIMH 5A2KH 3P73B 1Q0YH 1ND0A 4P59H 3SKNB 3QUZD 3UJTL 3IS0X 1KELH 5FKAB 5TDOA 3UPCA 4JN2B 4XPFL 5D8JL 4POZD 3V8OA 1U91B 1X5XA 4L8CB 3OMZA 1NMCB 1Y18B 4QRPD 3DYPA 2Y06L 2HLAB 1ORQB 3HZKA 4RMWA 4TTGA 1MFBH 3UTSE 5C0CD 4JN1L 4GBXD 2EE3A 2ZCHL 1BZ9B 4D9LL 1AGFB 3B9AA 4KKCD 3O41A 2FJFA 3V5KB 2HWZH 2Z31C 4C4KO 4FXLA 4I1NB 1KIPA 3QDAA 4HG4J 1OD9A 1IKNA 2UY6A 3D48R 3MBEC 3SBWA 1JF1B 5I18L 4ZFOL 1WIPA 5ESAB 1HH9B 1RZGB 5BMFL 2IC2A 4Y2DC 5FDWB 3PL6D 4MB4A 1GOHA 2ITCA 5I30L 5IFAH 4I9WE 4R4NC 4MAYA 3HKFA 3HI5H 2VLLA 1FVCA 3PWVB 2YEZA 5I1JH 4J3XA 3L3DA 2Z31B 3P2TA 1NGXB 3BXNB 3IFOA 3MYJB 3KYMB 1GGCH 4NZRL 4KVCL 3T3MF 3MBEB 2NY2D 2C9AA 4PD4J 1FYHB 2X1WL 1D5XA 3P4MA 3NCCB 3MO1A 2A83A 4HC1H 4KVNH 4Z7WA 5GHWH 4ZNCD 3KWWA 1Q38A 4Y2DB 1PSKL 5JQ6H 2O5YH 4ACPA 3GIVA 3J7HA 1KFAH 4ZO8A 1G7QB 1BFTA 4GG6E 1ZT7B 3S5LA 3FO9A 5DK3A 3GI9H 5LJYH 1I3VA 3LEYH 4HPYL 2PTTA 4OCRL 1BVLA 5C0IB 3STLA 3ZKSD 2BVQA 1LO3H 2LU3A 4HEPG 1FRGH 2NW3A 4D3CH 1FZOA 4WU7B 1DANU 3W0WE 4PGCB 2D31B 1TDQA 5EOTB 4JFHE 5IBTH 1BBDH 4QHMA 1MCNA 2DQTH 3NCJL 3GK8H 4OLUH 3FQUB 3MROB 5IMMA 4LU5H 4DW2L 1QPXA 1KULA 1XF5A 3MXWL 1ZHNB 5KTEL 4GW1A 1F3RB 2JJSA 2VLKE 4GLRH 2MQ0A 1MHPH 1GGBL 2EDQA 3CFKB 1HXMA 3CVHB 4GW4A 1U95A 1RUKL 1NL0H 2YRZA 1NAMB 4PJAA 5IB5A 2APFA 3ULUH 4K9EL 1OAYH 4I3SL 1KUMA 4YBLC 4LQFH 1GVIA 2E9JA 4Y19E 3OGCB 1S9YB 2C3VB 1V3KA 5B39B 4PJXB 5E8OA 2FRGP 4QRPA 1NFKA 4ZDHB 3KPOB 2B4CH 3RWJB 2F74A 4R8WL 3VGEA 2ZSVB 1G1YA 3DWTA 1W8OA 4JAMA 2A6DB 1GZPB 3MLVH 4GBXA 2EO9A 3UDWC 4HKBB 3O6FA 1WLHA 3GZKA 3H7BA 1KLGB 2IH1B 1NC4D 5HDBE 3S3SA 2GEEA 3OJ2C 1DJSA 3F7YB 4JO3L 1FZJA 2ATKA 1H3VA 4XXCA 5DC4B 2VDPL 2H32A 1G6VK 4YBLB 3HI6H 3BQUA 4HUXB 1VA9A 3RHWF 4JO2H 3X12B 3C8HA 2YRLA 4NN5C 4JPWL 5CSZA 1J1XH 3IXAA 4J1UA 2JELL 3QDMA 3QEQD 5EDXA 3RL2B 1QLEH 4ZTOL 4G8EA 3QHTC 2CIIA 3O3AB 1I7ZA 3VFNB 1MCKA 4OLWL 3VU2A 2ORBH 5FOBB 4RQQA 4ONHA 3MUGB 3S9DB 3ARSA 1MNUL 3R8BB 3C6LD 2X4UB 3OPZH 4JZJC 3C8KA 2R0KL 3V52L 2D9CA 3PP3K 3SE8L 2WUCL 3CUPB 2FD6H 4L8BA 2EC8A 5F1KC 4KI5E 2VDKL 4WFGD 4YHLH 3QHFL 1JMZA 4HQQL 4YHOH 5DS8A 4NN5B 3VFMA 2HJLB 5KG9A 1LK2B 4OV5A 2MHAA 1IM3B 1YYMH 2BVTA 4NC0B 12E8L 3DOSA 1U58A 2VDQH 3BE1L 2W0PA 4HKJA 3H0TA 3PHOB 3GBML 4LASL 4N5EC 4U1GC 4LAJH 3QIBA 3FN3A 4JFZH 4P99A 4XP1H 1P84J 1V7NH 1XZ0A 5GS1A 3KVQA 2J4WH 1JHLH 4JZJB 2JJVA 4O5LH 2CLVB 3QNYA 1E4WL 2DB8A 1XCTB 4PPTA 1T66C 3R8QA 5FM5M 3QZWA 1FORH 1YEJH 2JCCB 3QAZC 1DBMH 3WXVH 2DWDA 1YQ2A 1CVRA 4BSWB 2P8LB 4IMKA 5E6YA 5E94B 3RVUC 1LMKA 5KSBE 2XV6B 4U1GB 3FRUB 5DFTA 1NFDF 4B41A 4PYHA 3VXPB 4X4ZA 4X99A 2IFFH 2E6QA 3FTGA 2X4NB 3CSYB 4ZUVA 5C0JA 4IMLB 3ZHKA 5ACZA 3TJHC 4ZUWA 2WWKO 3QAZB 2HMID 4LCUA 4NM8H 1JGLL 1F90H 2Y5TB 3NFNB 1A6PA 4ENEC 3FHAA 1IGIL 3LCYA 3ZL4H 4ZUUA 3TEUA 1A47A 1UYWH 5GGRY 3T4YA 5IF0B 1JN6B 1JNLL 2AW2A 1QFOA 3X14B 3V6BR 4PG2C 1XFPA 3IRZA 2XQYK 1I8IB 1UC6A 3HFML 4QKXB 3KPSD 2I07A 4AEHH 4PB9L 4HH8A 1FG2B 3I3DA 4B7LA 1FPTL 2V5TA 2WIIB 1RJYA 1YEKL 2HH0L 4UOJA 3TN0D 1MSPA 3KS0J 4L9DA 3AU1A 2E7BA 2WK2A 5I8CB 3BZFA 1CFTB 1B6UA 4Q6YA 4XCCL 3IAQA 4PR5A 4FQPA 4U6YA 4O9HL 5L9DL 4ZOEA 1NFIA 5BV7L 3EIFA 3FCTB 4KK6D 2ATPB 3S96A 2C3HA 4P57B 4QOKD 3G04B 3QDHA 5JLZA 2CO7B 1EUUA 3T1FB 4MXWL 3SGDH 1R5IB 4ORGA 4G7YL 4CVWA 3DVIA 5EU4A 3C6LA 2CGRH 1AGEA 4LIQE 3E6FB 4WI5A 3L3KA 2ADFL 1JPSL 4Y4HC 1NC2D 2V17L 4ZSOA 1Q9KB 4OFPA 3VRIB 1H5BA 1I7UB 4XCNB 4Y16A 1GGYA 5E2WL 2YPLD 1I7TB 1EO8L 5ISZB 4S1SL 5BO1H 3K2UH 4JGJA 1CL7L 1FZKA 1ZHLB 2FHBA 4U7SA 4FTVE 4MNGA 2EIDA 4Y1AE 1WEJL 2CRZA 2X7LB 3V0VA 4BZYA 5AAWA 1N5AB 2UZYB 3MOBL 2NY5L 3TM6A 3VD3A 1DL7H 3PWLB 1TCMA 3PGFL 3QFJE 3O2WL 5MEND 5JORA 5HD8D 2PYEA 5HI5D 3MUHL 1A64A 4F9PA 2AJXH 1BOGA 4JVPA 4Y4HB 3U9PH 5F7WC 5GGUA 4LSTL 4MJ5B 1AXSB 4NO3B 3WKNA 4J4PC 1JHKH 4WEBH 4NNPH 2NYYD 3VFOB 1U8IA 3O2DA 3F5WB 3L5WA 3QYCA 3QJFA 4M6NH 4TUOB 3BIKB 4IRZH 3OKMA 3MGAA 4XPGL 4K23H 3QB7C 3ULSA 1MHCA 4NQCD 3VXSB 2BSTA 3REWA 5T1LB 4YGVA 1CGSH 4XCFL 2SEBB 5HTSA 4GMSH 1FH5L 1T2JA 1OSPL 2K1MA 1W0VB 4ODVH 4JO4H 4X6DE 1C5BH 1HSBA 4K3JL 4M48L 1LWRA 1QHOA 1DEEA 1NCCH 3P30H 4UU9B 2BY2A 5TFSL 3HZVA 5B39G 2GTZB 4N9OB 2XACC 4FQ1H 1ZSDA 5ERWA 4NQSA 1SYVB 1OL0A 1PG7L 4NYLB 4BJLA 1WF5A 2R1XA 5I76B 4JPIA 2F15A 2AK4D 1IQWH 4L3ED 1GC1C 3BEWA 2A0LD 3UZVB 1VHPA 4WEUD 4Y5YC 3KPSA 4JM4L 1VSCA 5HHNA 1QG3A 4M8QB 1Y6NR 1TJIH 1NGQH 2BHZA 4LLMB 2FSEB 4QGYA 1BD2B 4K71C 1UM4L 3AY4C 3IDMA 4JHAH 5GGVL 3HC0A 3PIQA 1T2QH 4R96B 2MFNA 4W6WB 1XGYH 1QQDB 4N0UB 5FUOL 2YHGA 1PLGH 1RVFH 3ZHLA 2HFTA 1SVZA 5FF6B 3VGGA 3CDGB 4JPKL 2QQKL 3VI4E 3MLSH 3H3PH 1QRND 2XKNA 4QY8B 2WWMD 1AO7E 4NQED 4I2XB 4PJCA 1AKJB 3GSXA 4GUPA 1ED3B 1ZE3C 4PJHE 4Y5YB 1V3JA 1IILE 1MCPH 4ZQKB 1HSAB 5DUBA 4DKAA 1CK0H 4HS3A 4MNHA 2GIYA 5FO8A 4NQVB 4WWKA 3X3FL 5ITBL 4K71B 2P1YA 5FYJU 2EEBA 3OXSB 1BIIB 2UWEF 4PFEA 4AG4L 1I8MB 1Z9OA 3EOAA 3C5SA 1MQKH 5EZIH 2YPLA 1UCTA 4H25A 3VFRB 2FO4A 4S0TD 1MIML 4PJ7E 1KIQB 3ME0A 2VXVH 1UZ8B 2ARJB 3IVKB 5J06A 5FM4A 2JB5H 2ID5A 4NKOA 3AROA 3GSUA 1MCEA 5FXCH 4FABH 5F9DC 3ULUC 5E8PA 3U0TA 3S3JA 3V2AR 3MLUL 3MRLA 3GNMH 4M6OL 1J0YA 1HIML 5AYUL 3WIHH 1Q0YL 4WU5A 3SDXE 2H8PA 3SDAC 3RX5A 4NRYA 1CU4H 4OQ1A 2HJKB 4CVXB 2M1KA 1KELL 4LDOB 2Y07H 4IHOB 5E00A 2BNRD 1KPUA 2AJ3B 3WE6B 1F6AB 2K3TA 2YA2A 2RHEA 5KSUB 4I77H 4Q97A 1XGPB 4CW1A 1VENA 4YPGB 5C07D 1A4KA 3LN4B 4M62H 3ZYIA 3RWDB 1OAZH 1EJOH 1Z3GH 5E6ID 4OZHE 1XGQA 3SDAB 1Q1JL 3QEHA 1MJJA 3ZT7A 2HWZL 2D0GA 3MPCA 3OB0K 4IRSA 5BCAA 4DZ8B 5A3IC 3ARGA 2APWA 4JFPA 5FM8A 1VKXA 3GB7B 3VWJD 3QWOA 1J9CT 5EO9A 1UA6H 1PZUB 2MPAH 4R26H 1DZBA 5ESVA 4L3EA 4KJPC 4Y4FC 3EYSH 3QJHB 4KDWA 1MCSA 4HUWB 1KJVB 4PGDA 4X6FA 5I1JL 1U3HD 3D85B 3LKRB 4NNXA 2EKJA 1CFVH 1NANH 2O26U 4QYOB 3KJ6H 4NRZB 2ZUTA 3CFDA 1IMHC 2QEJA 4AENA 5GSVB 4P4RB 3PHQA 4GG6F 1DSFH 3HNTL 4HC1L 1QRNA 4KVNL 5GHWL 3ZKXC 5EFIA 5DUPH 5FO9A 4NQEA 4M9OA 2G60H 2D3VA 5JQ6L 3QPQD 3DXAA 1KFAL 1MH5B 5GRWA 4JKPL 3IFLH 5HYEA 4TVPH 3BWAB 1HXYA 4Y4FB 5CEZD 3SCMA 3V5DB 1LO0H 2EH8L 3GI9L 4QNPE 5HJ3A 5JW3H 3GMOA 5SV3A 5B8CA 3LEYL 2VJXA 2K7QA 3RGVA 5GIRA 4KDTC 3FO0H 1FRGL 4OF3A 4D3CL 2QSCH 1Q8MA 5B4MD 4CADA 4YFDB 4ZXBC 3VXTB 2EDOA 3ZYOA 5IBTL 1EVTC 1BBDL 3WFDH 7FABH 3HZYB 2DQTL 3GK8L 1CE6B 3WJJC 3ZKXB 2X9WA 3U48A 4LU5L 3VDBA 3OSKA 2AP2A 3F12A 3QFDB 4H0GA 1NCUA 4DCQA 1B6DA 1EEZA 4XH2B 5CIPB 1A2YB 1MHPL 1MI5A 1UEYA 1D5IL 3QO1A 2EO1A 4TSCL 5IV2B 4FZ8H 2H2SD 4DZBB 2X4OB 5HYJB 4J7RA 1NL0L 5C2UB 4TUJA 1OAYL 4KMTH 1E6OH 4ZXBB 1M7DA 5D6CB 5E2TH 1CBVH 2XOTA 1HWHB 2BNRA 2QHRH 4UTBH 2H26A 2BVOB 1P4LB 4G8FA 5HDBF 3SJVD 1EA9C 5E03A 1P9MC 2B4CL 5C07A 1UXWA 2NY1D 4HDIB 1RMFH 3BP6A 2IADB 1MCOH 2YD1A 1OVZA 3J8F7 1BBJB 2BOCA 2P24B 4XNQB 2I26N 2Z93B 3CX5K 4JY4B 5D7IA 1TZGH 4V2BA 2P46B 4YC2C 1LQSR 4R3SB 1Q9OA 2HVKA 2XN9B 5E6IA 1RIVH 2EKSB 3ARFC 2X89D 1CICA 5HVWA 3S37H 3EJZC 3MV9A 5IM7A 3HI6L 3PJSB 1XR9B 3IETA 5ALCH 4Z7WE 1CD1A 1IL1B 4OGAC 4LNRB 5FB8B 5EBMA 4LVEA 1J1XL 3IGAA 4NPYB 4D8PB 3VJ6A 5KVEH 3HCVB 3NACH 1QLEL 5A1AA 1FL5A 3GSVA 4RMVA 4KGJA 4HGMA 5FA3A 3SDDC 1PD6A 4HWBH 4YC2B 5DJDB 4KI5F 2I9LB 5J6GA 4HV8A 3OPZL 2FLBT 3ARFB 4P48A 3T1WA 4S10A 4Z78A 1P2CB 4YHNB 3QNZB 3QDJB 4R7NA 2ZUQC 2FD6L 2IPUG 5DQJA 3DBXB 3QXVA 3CSBA 4YHLL 2G2RA 2PETA 3FT4A 4YHOL 3L5IA 1JVKA 4FXKB 4WUKH 5M7QA 1YYML 1NLDH 1D5ZA 4JREC 3GSOA 2I24N 4N90D 3U7AA 2PW2B 4RAVA 1C8PA 3QNXB 1EHXA 1CG9B 1SYSB 1CGVA 3SDDB 5EA0H 4JFZL 4XP1L 1S7QA 4TSAL 3M1BB 2CSPA 4PJAE 5I8EA 2J4WL 1KB5B 2F54D 5T3ZE 5FYJD 2ZUQB 5GS2D 3ZDXE 3EW3B 3KNBA 4R0LC 3P11H 3CIQA 1A21A 5E2VL 2NY3C 1FORL 3OGOE 5HHMB 1CTOA 3HMXH 2VZUA 4Q9QL 4LRIC 1DBML 4QRPE 5KSBF 4QXWA 2F8OA 3QA3A 1OTTD 4JREB 4MQXC 3O8XD 3TIDB 4F7TB 1QHPA 2WZPD 1KTDA 1BEYH 2EC9T 3VA2C 2NXZC 1TCRB 2GT9A 2IFFL 5T1DH 3KR3L 4M6MH 4KK9C 5JPMA 2WV3A 3FFDB 1AIFA 4R0LB 1MFCH 1WBXB 2NY3B 1U8KB 3G5YA 5KSAA 5FKPB 1J11A 4DVRH 3EOBA 4UILH 1JGEB 1IGTB 1C08B 3QDME 4A2LA 3U6RB 3ZL4L 3BSZH 1UYWL 2VZVA 4BSVA 2Q6WB 3MNWB 1CIDA 3JUZA 3VW3H 4I0PD 2NXZB 2BP3A 1OGAB 5F88B 3PGDA 2QJDA 5E1AB 1FV1B 2A6JA 4K55A 4E42A 4JRWA 2ADIB 3S35L 4NZDA 5B38B 2HT3C 2X89A 1B0GB 5J7CC 5DD3H 2R8SH 1EHLH 3P9MB 1RUQL 2D7QA 4NQDB 3FB7B 1A6TA 1QSEA 4HHAB 5EBWB 3P73A 4XWGH 3DI3B 3SKNA 1C7TA 4O2FB 5F97E 1IZKA 5FKAA 2ZPKL 3V6ZB 3UCRA 4F7CB 2DS4A 2VDRH 4JN2A 4MA3B 3IT8D 3S36L 3HB3C 4PJIB 1XMWA 3BESR 1Y18A 5GISH 2HLAA 2H1PH 1ORQA 2CGRL 5DC0A 5LAXA 2XT1B 3I50H 3OZ9H 4YX2L 1JGUH 3MCG1 2GCYB 1A3RH 5T5NF 4P2OC 1BZ9A 3ULVE 1KEML 3V5KA 5BO1L 3K2UL 3MLWH 1SY6H 5E5UB 2JJWA 2NX5B 1H3XA 3VFGH 5FGBC 5BQ7B 3BVNB 3HS0B 1WIOA 5F44A 3WLBA 1JZ8A 1J0KA 3A6CH 4U33A 4HK0B 4OZ4A 1DL7L 5ESAA 1HH9A 1FN4A 1RZGA 1YJDL 3H9YA 5FDWA 5LG1A 3RTQC 4Q9BA 4UAOC 2AJXL 3MV7D 3U9PL 2NTFA 5I19H 4J2XA 1HEZA 2HRPH 4DUVA 4P2OB 1JHKL 4NNPL 3PWVA 2IBZY 2YUZA 3IU4H 2P8MB 5ACLA 2Z31A 4M6NL 4IRZL 3PV7A 3U7YH 4K23L 5AD0B 3MBEA 1JF5A 1P7KB 5HI3D 1CGSL 3BZDA 4X6DF 1F4WH 1QFWM 2F19L 4GAGH 1C5DB 5DI8A 2AXGB 5DJYB 4Y2DA 1R3KB 1U92B 3RWCB 4ALAH 3Q3GB 1U8MA 4RAHA 3M17B 3RTQB 3H3BC 4UAOB 4P23A 1BQHB 4ODVL 5I71C 3KXFD 4JO4L 4YDKL 1C5BL 3GI8L 5HHVL 3ESUF 3RI5K 1RK1B 2VLRD 1ZT7A 2BC4A 2DLTA 1NCCL 5HHPB 3P30L 1XR8B 3WFEH 2BY3A 4M9PA 3KPLB 2EDJA 3PP3H 1FVEA 3VXMD 4KAQH 4FQ1L 4LPTA 4XB7A 4WU7A 2HTLC 4PGCA 3JWDH 2D31A 5EOTA 1RZ7L 4JY6B 1EGJH 4U6XB 3TYFB 5HI4D 4F58H 1IQWL 3EYOB 3FQUA 3MLXH 1X5ZA 1ZT1B 4OF8A 3H9HB 4JCLA 2DIBA 5CP3A 5BJTB 4ZSOE 1NGQL 5I71B 1RPQA 1ZHNA 3BOVA 3CSPA 4N5ED 5E6ZA 4JHAL 3VI4F 4IJ3C 3DURB 5CAYB 2QQQA 1T2QL 4AYFA 3DLQR 1XGYL 1SMAA 1K8DA 4MNGE 3CVHA 1KNOB 1K4CB 4K7PX 1NAMA 4MCZA 4PJHF 1I7RB 1N8ZB 3EZJB 3UROR 4G80B 1MCLA 3H3PL 5GRJH 4PLKC 3BDYH 1CTNA 3HE7C 4PREB 4YDJB 3OQ3B 1S9YA 2C3VA 3DRTB 5B39A 2PYEE 4PJXA 2I9TA 1F4YL 2P5ED 1MCPL 3LQZB 4ZDHA 4XXDB 1CK0L 1YEGH 3RVUD 3RWJA 4S2SB 2ZSVA 3NCYP 4PJ7F 1FIEA 2A6DA 1GZPA 2R2CA 5BRZB 4IJ3B 4HKBA 4ODSH 2A1WH 3NBNA 3W39A 1KLGA 3GSNH 2MOVA 3T77B 1MQKL 1S9XB 2IH1A 1NGZB 4IRJD 1TZIB 3F7YA 1RFDH 4FQXC 5FA4B 2VXVL 1FYTB 1OGTB 1T7YA 5A40E 3O3EB 5IOPB 1FLTX 3HE7B 5IVXF 3DECA 4JY5L 5E99L 4UQ2B 4HUXA 3EOTH 1N6UA 2ZSWB 3X12A 3SDXF 4FMKA 1AGDA 3JVGC 2BFVH 4FABL 5E9DA 3UC0H 2N7AA 3RL2A 1GL4B 2V2WA 3VFNA 1CT8B 3UDWA 4HBCL 3WIHL 5FOBA 3JWOC 1CU4L 5H35B 4LSUH 4OUUB 4FQXB 5ENWB 5JDSB 4TNWK 3CUPA 5HGAA 1LP9A 2VDMH 5C0RH 2QR0A 4I77L 1EEYA 1KG0B 5ISZD 5KS9B 2HJLA 3KPSE 1LK2A 1IM3A 2XY2A 4M62L 4KU1A 5EUOB 1RZKL 1EJOL 3PHOA 4XCYA 3RAJH 1QPPA 4R2GD 3QEUB 1ADQA 3S8WA 4X98A 2XY1A 4JZJA 3CU1A 2CLVA 2NXYC 4YO0B 4Y4HD 1XCTA 3IF1B 2H2PC 4NWUH 4ESKA 2VITB 1S7XB 1UA6L 4PJCE 5DMJB 2JCCA 2OBGA 5I1HH 1JPFB 2MPAL 3QIUC 1XGUB 2OQJB 5F7FA 3VDCA 4EN3C 4R26L 2J6EA 2W65B 2P8LA 4QF1B 3VXSD 5E94A 5B38G 2LFGA 1T3FA 1MUJB 3EYSL 1L6XA 3GJFK 1A14H 1FL5B 3ZKNC 4HD9A 1G9EA 2UZXB 1MLBB 2C3WA 2WQ8A 2YPLE 4GJTB 5TDNA 3SE3C 2NXYB 3RL1B 1VEPA 4HXBH 2X4NA 1Z9LA 1FFPB 4ZODA 4JKKA 3CSYA 5JUEL 1IGFH 1DSFL 3O0RH 2DDQH 3QIUB 5DUPL 2VZ3A 4EN3B 1X5JA 2G60L 2YPVH 1ZT4B 3IFLL 4TVPL 2PTVA 2DF3A 5IF0A 1JN6A 1LO0L 5D5MB 5L7XH 3X14A 4JHWH 4ONGH 5T3XD 4QWWD 4HIEB 1XH3B 3TNMB 2OXHA 1I8IA 5DHVB 4MD0B 3FO0L 5TGBB 2I5YH 2QSCL 5F70A 5TPWH 1YEDB 1FG2A 5DR5H 2W07A 2WIIA 43C9B 4OM1H 4KZDL 2DD8L 3WFDL 5F7EH 1JGVH 4NNYB 3AS1A 4KJQD 1KT2A 1QLFB 2FX9L 1PW3A 2KKQA 5I8CA 2CLRB 1AQDB 3DMMD 5L88L 2IWGA 4MLSA 2PUQT 4CMHC 3FCTA 1X3DA 2ATPA 2C4FU 4P57A 3G04A 3B8YA 4CRPA 1IC5H 1OPGH 3UP1A 5FGRA 2DJSA 3T1FA 5D96C 3NIGE 4BQ9A 1MCQA 2YD6A 5HSFA 3RWEA 2X10A 4KMTL 1E6OL 3E6FA 1I75A 2ZUSA 3D25B 4ODXB 1CBVL 1Y0LB 4ZOAA 3VRIA 5FUZH 1I7UA 1S7SB 1UKSA 2QHRL 3JBG7 4GS7C 2JK5B 3PWPD 3F6LA 5ISZA 4L3EE 2JTDA 1RMFL 2VDOH 1MCOL 3ALWA 4B53A 4CMHB 4BUHA 5F7HA 4M8VA 3U83A 4J3WA 2X7LA 1TZGL 4Z7WF 1N5AA 5D96B 4Z7UB 3T2NH 3U4EB 3PWLA 3DVGA 1K3ZA 5LGHH 3VGDA 3S97C 4MXQC 4MA1C 4WFFE 2EDLA 3SGDI 3LKQB 4MJ5A 1QRNE 1AXSA 3THML 4GS7B 4NO3A 4NQEE 5MERB 4LIQH 1VFOA 3BO8B 1TZHA 1UB5A 1VGEL 2VQ1B 3VFOA 3DXAE 4TUOA 4Z7NE 5KVEL 3BIKA 2DM3A 3NACL 4NKDB 3V6FB 3VFSA 3W9DB 5T1LA 1FNAA 4ETYA 5EG6C 2HKFL 2E5EA 4POUB 2VB5A 1ZA3A 5DK2B 1BFSA 2F5AL 1J5OH 4MA1B 3MRHB 2WBWB 3G6JB 3BIBX 3BWUC 2WINB 3SDAD 4GSDH 2VXUH 3ET9F 4J4PA 4U2ZA 4UU9A 5DO2C 1JZ2A 1NLDL 2GTZA 1T1XA 5DGRA 5FCUH 4DK3A 4ZO6A 4PJAF 3IYLW 3S6CA 4MAUH 4GAYB 5GGTA 5HDQH 1MI5E 4X7TA 3ZDXF 5EA0L 1SYVA 3L3OB 5FOJA 4W6YB 2EE2A 4KC3B 1NCWH 2Y6SC 4P5TD 5GZOC 5I76A 3FONB 3LHPH 5CILH 1WZKA 1AY1H 3P11L 1OWRM 4LLMA 3VXRA 1BD2A 2BNRE 5E5MB 4OTXL 1IM9A 3HMXL 3D85D 3HNSL 3RI5F 1KACB 3RWIB 1CDJA 5C07E 1QQDA 3MRNB 4YHPB 3HZMB 4N0UA 5JA9A 2FEEL 4PRAB 3DETC 5FF6A 3CDGA 5D7IE 1BEYL 2XTLA 1U9KA 1NLBL 3RNKB 1T83C 3MXVH 3VFUB 1ETZB 2YD3A 4I2XA 4POYA 2ZNXA 1AKJA 5T1DL 4M6ML 3OJVC 5DJ2B 1MLCB 5ID1B 5J56B 2Q20A 1ED3A 4Y5YA 1NMBH 1HSAA 3MV9E 5IHUH 4Z7VF 3KAAA 4NIKB 1MFCL 4GKSB 1N5YH 4NQVA 5GRUH 3AY4A 3LEVH 4WHTB 4BUGA 3GJEB 3EDEA 3OXSA 2W9DL 1BIIA 4UILL 1I8MA 1MHEB 2V9TA 3BSZL 3VFRA 2IQ9H 1FO0H 3CFBA 1HYSD 3IDGB 1SBSH 4WUUB 4XNMB 3QDGA 1H3GA 3CFCH 3VW3L 2ARJA 1FIGH 3IVKA 1OD7A 2CD0A 3QUXC 1HHJB 4HFUL 1XAUA 1FNFA 3B5TA 3OKOB 3D87B 2NY0C 3O4OC 1EHLL 5HVHC 3ECBB 4XMLH 4PRBB 4XWGL 4X9IA 1WQVT 2W0FB 2HJKA 4CVXA 4EI6B 4X4YB 4ZXBD 3U30C 2VDRL 4JZNB 2AJ3A 1KIRA 3WE6A 1F6AA 3QUXB 1PX3A 5KSUA 5A16B 1XGPA 5GISL 1RU9H 1JK8B 3VD4A 3ULVF 2NY0B 3LN4A 1F8TH 3NA4A 3O4OB 3OZ9L 1ERNA 1MELA 3RWDA 5HVHB 1P5UA 3NIFE 5D7JC 3MRFB 2XN9D 4PJ9C 4O2EA 1S9WB 3SDAA 2NZIA 5MEQA 3U30B 4DZ8A 4JKMA 3K8MA 5I0DA 3GB7A 3A6CL 4TNWF 1EXUB 3L3HB 2EXWD 3F65A 3EFDH 4Y2OA 1YN6A 4ZD3H 4EOWH 4YXHH 1HNFA 5I19L 4FQHB 2FYYA 2HRPL 1MRFH 3QJHA 4BZ2H 5D7JB 2GFBB 4PJ9B 4HUWA 3SGKC 3LKRA 3GKZA 3ARFD 4P2QD 1H8SA 4QYOA 4G8IA 5EOCH 1T20B 3EJZD 3W2DH 3ZMRA 1WUNT 3OHXB 2EDDA 1KGCD 3CU7A 3L3GB 3PP4H 1F4WL 4KROD 4M7LT 1ES0A 4P4RA 4GAGL 4KDVA 2Z0BA 2X4RA 4OF6A 2MMXA 4G8GB 5I8KH 2DQDH 1MH5A 1EX0A 4YBQC 4MZ2A 3MRPA 4Y4FA 4U1IA 4PJDA 5IGXH 1QSEE 1RK0B 2VISB 3BEVB 3V5DA 4HJGA 4G7VL 4DTGH 5CHNB 3UBXB 3UJJH 1BHGA 3UTQA 3WFEL 2WP3T 1BF2A 3UTPD 4FA8A 4KAQL 3RPIB 1NANI 1AFVH 2XI9A 4LCIH 2OL3B 3JWDL 2NLJB 3DVFA 4PGEB 4HULB 5KVDL 1EGJL 3HZYA 2XG4A 4F58L 1CE6A 4WI9A 4OD3H 3MLXL 5F7NC 4AIZA 4LOUC 1G6RB 4NKIL 4JRXB 2KZWA 4XPTH 4ZUSB 4RZCB 1MCDA 3QFDA 3BISA 5IBLD 2EDBA 1QBML 4XH2A 5CIPA 3DUSB 4PG9B 4RDQF 3C8DA 5HDOA 4KDTA 5JA8B 2W59A 4DZBA 5HYJA 1AXTH 4KJWC 5D6CA 2DQCH 5C0BB 3BDYL 2XA8H 2YS4A 2DYPD 3WJJA 1P53A 4ODUB 3STBA 4RGNC 5IESL 4LMQI 2BVOA 1P4LA 3LS5H 1FNLA 1YEGL 5FYJE 4HDIA 2IADA 2EH7H 2NXZD 1OGAD 2P24A 4XNQA 2JIXA 2Z93A 4JY4A 3VCLB 1U8LB 4ODSL 4ZPVA 4L3AA 1R24A 5F6HJ 1HH6A 3GSNL 3IRPX 4KK9D 4R3SA 4DGVH 5AUMB 2EKSA 5FYKU 3CDFA 3AREA 3C5ZC 4HT1L 4OCXH 1N6QH 1UQSB 4NQDD 5GSRB 3ZO0A 1A6UH 3PJSA 1XR9A 4HCRH 2UUDH 3EOTL 4RGNB 3V8CA 4LK4A 4LNRA 2H45A 5FB8A 2BFVL 4D8PA 4NPYA 3HUJB 3LIZH 3PWJA 3Q5TA 3UC0L 3GGWB 3HCVA 2QSVA 5DDHB 3PDGA 4NFBA 1INQB 2CDEB 5IW1A 1YC8A 5DJDA 3GRWA 1J18A 4PJFB 1A1NB 2I60H 3TYGH 2I9LA 1CLZH 5J1AB 5EOQH 4LSUL 5J6HB 2LVEA 3C5ZB 5D1ZA 4YHNA 1P2CA 1T04B 2RR3A 3QNZA 3QDJA 4KTEH 3UPRB 4H8WC 3MZTA 2VDML 2EXYC 3IJHB 3DBXA 2GJZB 3ALPA 3ARYA 4FXKA 1FC2D 3VD9A 3L3JB 4PJ5A 3W81A 2FJGA 3QNXA 4R7DA 3WHE0 4EQ3A 1CG9A 1OCWH 4ZYKA 3SDDA 1QKZL 3RAJL 4XP6H 4PJCF 3BJLA 1PKQA 1D9KC 4KRMB 1X5FA 1KB5A 1I9RH 3VMOA 1A4JA 1B2WL 4O58H 4P2OD 4NWUL 3TNNB 2IGFH 3PWUB 3RWHB 5I1HL 4PJXE 2R2EB 2EDNA 3UX9B 1I3RB 2KQMA 4YZFE 1CDHA 2EZ0D 1J05B 4MGXA 4F7TA 1J0IA 1A14L 3HC3L 4AY0A 2HP4A 1TCRA 4PRID 3BW9B 5IROC 3MLZH 1D9KB 3ES6B 3MRDB 3RTQD 3AM8C 1R6VA 4U3XA 4F7EB 4IOFC 3FFDA 3T0BA 4R0LA 1WBXA 1JPTH 1U8KA 1IGFL 4JM2A 5LCVH 3D3VD 3NCFB 3KLHC 5FKPA 4LRIA 2XWTB 1ACZA 1HYRC 2FZ3B 2RIKA 1JGEA 4HX1B 1IGTA 5E9DE 2YPVL 1C08A 5KVMC 3U6RA 3TWCH 1FNSL 3BPNC 3OAUH 2Q6WA 3MNWA 5L7XL 4JHWL 4ONGL 4QHNA 2FEEI 3KPMB 4O2CA 5F88A 3GSQA 5T1MB 3FMGH 2J1KA 4DAGH 2ADIA 2I5YL 5TPWL 4P46D 5DR5L 2VLMD 4IM8A 4NZTL 4Z8FH 1LP9E 4OM1L 3BUYA 1B0GA 5F7EL 1JGVL 3ZE0E 1BOYA 2RGSA 4NQDA 3FB7A 4HHAA 2OTUB 4A6YB 4RWYH 5EBWA 5INDB 2PW1B 1DQLH 5EBGA 5DMGD 4O2FA 4H88H 3DX9B 3NIGF 5GJTH 1IQDB 3BPNB 3ROOB 3V6ZA 4XVJL 4F7CA 1DR9A 4MA3A 1IRAY 5IW3A 5JO5B 3KPNB 4PJIA 4KXZI 5C08A 1FLRH 1L7TH 3BP7B 3OR6A 1KTLB 3V7MA 2JCCE 5FUZL 2GCYA 5BXFB 4JRYB 4HXAH 3O6MH 3MREA 4Q6IA 1BJMA 4PV8B 2X1OA 1PDKA 5H2BB 1V5JA 1HHHB 3W82A 1FYTD 2NX5A 4DFIA 2Z8SA 2VDOL 5IFJB 3D0VB 5LGJB 1MFAL 2LQRA 1J10A 5CEYB 3B9KC 5ALBL 5BQ7A 3BVNA 3HS0A 3NZ8B 5ANMA 1NKOA 4HG4K 4HK0A 5KN5B 3JV6B 2EYSB 4OCMC 1RSFA 4KTDH 4OLYH 3C2SA 5LGHL 2VE6B 3O11A 4KJYB 5CKGA 4Z7NF 3AS0A 2BJMH 4HUUB 2XYCA 2CKBB 2BVEA 2XZQL 3QEGH 4LIQL 5D2NB 3H2WA 4ELMA 5AG9A 1MWAH 1MCIA 4ZPTB 1QLRB 2P8MA 5F3HB 3S88H 1H3TA 2Q3ZA 4L4TB 1BJ1J 3ULVH 4WO4D 4ZFFA 2DBJA 5FGBA 2JF1A 3B9KB 1CR9L 3IAPA 1IC1A 3PGCB 1WBYB 4K94H 4PD4K 2AXGA 2CJUH 1R3KA 1U92A 3RWCA 1J5OL 3Q3GA 4LFHG 3KPRA 3Q0HA 1BQHA 4HAGA 4YHIA 4XX1G 4NHUB 1Z5LB 4WENB 4GSDL 2VXUL 4NDMA 5HHPA 1XR8A 3KPLA 1AE6L 4Z0BH 4U1SA 3BDBA 2YUVA 3NGBC 4MAUL 1K6QH 3C6SB 4HMDA 4P2RD 5HDQL 3MRBB 1FGVH 1UH4A 4LGRB 4JDVB 2FGWH 4NO0D 3ZDZE 4JY6A 3LPFA 4LHUA 4U6XA 5CD3A 3TYFA 4E41B 3RJQB 3ZHDA 1DBJL 2WBJC 3EYOA 4WV1C 1G0YR 1MJ8L 1ZT1A 4YEFA 4KTYA 4DN3H 1WJ3A 2UV3A 3L7FA 5IB1B 1J86A 5BJTA 1Q9WA 3FFCD 5AEAA 4OCNC 4XNXH 5F1IA 4LCWB 5D7IF 1X44A 1JI1A 2AQ2A 3W11C 2YN5A 4V1DA 2DL2A 5ISZE 4OBRA 3O4LD 2R2HB 2NXYD 2B20A 1U36A 1BWMA 1K8IA 4D0CB 2IPTL 3NGBB 1KNOA 5MI0C 1K4CA 1I7RA 1YN7B 1N8ZA 5ADOH 1MFNA 1YJDC 4G80A 4CDHA 4OGXL 3PABA 3MXVL 3QIUD 4MJIB 4PREA 4YDJA 2WP3O 1CFSA 2WBJB 4WV1B 3DRTA 1CGUA 3P0YL 5IFHH 2IANB 1NMBL 3ARUA 3LQZA 4M4PA 5F9JA 1NBVH 4DVBB 1N5YL 5GRUL 3JXAA 1OP5K 1AI1L 3LEVL 4X5WB 5BRZA 4DGYH 2N7BA 1S9XA 3ESVF 4GG8A 4AIXA 1G9ML 1DUYB 1TZIA 5MI0B 1FO0L 5DD5H 2D4DA 3BAEH 1SBSL 1ZWIB 4BKLB 1OGTA 4M7LL 3CNKA 1FIGL 3QWRA 3O3EA 4JHZA 5IOPA 3MX0A 3MV11 4RMRA 4XGZB 5JHLH 3HE7A 1B4RA 3OR7B 1EERB 2ZSWA 1H3PH 1U3YA 3MCKB 3WLWC 4GRMA 3KPTA 4MQ7A 2HLFC 2QSQA 1R5WB 3MUY1 2MCPL 1F11B 3N1MC 1CT8A 1LE5B 1U8NB 4D2NA 1FFQA 3RIFK 1J1PH 4N8VB 2YA0A 5HYIA 5H35A 3LB6C 3CXHJ 1E28B 3SKMB 4JFXA 4ZO9A 1KB9J 3ELAT 1F00I 4FQXA 5F72S 5ENWA 2XQBL 1KIUA 3TA3A 2R15A 5GGSB 3CZJA 1YY9C 5DURD 1D6VH 3VFVB 3NIFF 1KG0A 1RU9L 3GMNA 3HE6D 3GO1H 3JVGA 1X5IA 4FFVD 1F8TL 3VXRE 3U0WH 1BD2E 1EV2E 1JZ7A 5HGHB 2BDNL 1F45A 4NQUA 3V95A 4P3WA 1P4BH 4KMLB 4WHDA 4N0UE 3I3EA 3TVMD 3QUYA 2F53D 2BCKB 1KBGH 4YO0A 1OTUC 4MVBD 1A7NL 1FJ1A 3ARQA 3GSRB 5IT2H 5DD0L 1GCFA 4I2XE 2MNUA 3A67H 3D18B 3EFDL 5EBLB 5TH2A 2B39A 2OQJA 5DJ8A 4DKDC 3FT2B 3RWFB 2LV4A 2NCMA 2W65A 5ABDE 4QF1A 4EOWL 2W9LA 1O0VA 1I8KB 1IKFH 1MRDH 2R39A 3LZFH 4N8CL 5BS0B 1MUJA 4BZ2L 5JW4R 2G5BA 3IKKA 3NH7H 3PQYD 1MLBA 3HR5B 5HGGS 3BGMB 3QUKA 1R3IH 2Q7NA 4P5MB 3U2SB 1A6VH 1HI6B 4OZFH 1VFUA 4GKNB 4L4VA 5SX5K 3HG1B 3ARRA 4JZOB 2ZJSL 5EOCL 3RL1A 3W2DL 3MNVB 3QDGE 3M8OL 1FFPA 1A7PH 3B5GA 4LEXH 4GKZB 2P48B 4PRHD 4AT6B 3LQAH 4HWBA 5DRNB 3QIUA 4EN3A 1UWEH 4C59B 3I6LE 5I8KL 3FB5A 2DQDL 3X13B 2ICCA 1MCJA 4D9QD 1ZT4A 1HILB 3LDBC 3RVWC 1A8JH 3AXLA 5IGXL 5DMKA 3OKLB 5D5MA 2APVA 3ARZA 4DTGL 5BZDB 3UJJL 2NZ9D 5EC2B 3QXWA 4HIEA 4LGSB 3TNMA 3JUYA 5DHVA 4MD0A 5TGBA 2X44D 4W70A 3SE3A 4M1CC 1H0DB 1YEDA 1AFVL 4FRWA 5C0DB 4X7CC 43C9A 1SMOA 2ITDA 4NNYA 3ZKMC 4XTRC 1JFQH 2X05A 4OD3L 2PF6A 1RZKC 4Y4KC 3ARPA 4XPTL 1I1AC 2CLRA 3LDBB 3ULUE 1AQDA 1ZLUK 1MIEH 3QUZC 1SJHB 1KXQE 2AS5M 4YEEA 3S34H 1N3NA 3D1MC 1AXTL 3PWNB 2CXGA 2X70B 3EYVB 3N1PC 4ODXA 3N9GH 2DQCL 1FFOB 1NEZB 5IEKB 4DKEH 1Y0LA 1XF1A 1YNTB 2JK5A 4K8RL 1DQML 4Y4KB 2FECL 4L8DA 3AVEA 1I1AB 3LS5L 5SWSB 2WNGA 3MC0A 1FDLH 2DKSA 4WUUD 1R0AH 4CJ1A 2EH7L 5E8NB 3RZCD 4KKCC 3DIFB 4EI5D 3QUZB 4JFDD 3OL2A 3T2OA 1LO5B 2R29H 4DGVL 3S4SB 3U4EA 4NC2B 1K9TA 2FJHA 1N6QL 1CDUA 5IW6A 5BVJB 3L7EB 1A6UL 1CFBA 4YJZL 4Z6AT 3PL6C 4PGZA 1S7TA 1K2DB 4LSQH 5MERA 3IJSB 1J8KA 5C9JA 3BO8A 1CXEA 2IPUK 2W38A 3V4UH 3T04D 3I6GA 1LDPL 5FHAH 5CS7A 4NKDA 3V6FA 5I1GL 2HVJB 4PJDE 1RJCA 3W9DA 1YECL 3EGSB 3QUXD 3IJYB 4TULH 3T8XB 4KPHH 2I60L 3TYGL 2J2ZA 1CDYA 4NBYB 5DK2A 2NY0D 3QO0B 3TCXA 1WVZA 4M1DL 4N0FB 1BIHA 4NWTL 3AUVA 3MRHA 5DVMA 1I4FB 4HGKC 1N64H 3G6JA 4HJ0C 3PL6B 2WINA 4S1RL 3QG6B 1U93B 4CN1A 4O51B 4GRWF 4WHYG 1CD0A 3EDJA 4GAYA 5JMRA 1OCWL 4WCYH 3OF6D 2XTJC 4H0HB 3L3OA 4XP6L 2PYFA 1TITA 4YIQA 4JEGB 5HYJE 4PJXF 3FONA 5EU6D 3KDMB 1ZLSH 1I9RL 3JTSB 1SY6A 1H8OA 4I4WA 4KH2A 4YZFF 5FO7B 3WS6C 5LQBH 2ESVB 4JJ5A 4O58L 1NFDB 2DI7A 1LDSA 1DANT 5E5MA 4EQ2A 1BQUA 1RZ8B 1YPZF 5CMAB 3RY6C 3RWIA 2BSSB 4X6CF 5HYQB 3MRNA 3HZMA 5JR1L 4PRAA 5DTFB 2XTJB 3PV6A 1XIWD 3EO9H 4ZAKA 4PV9B 2NR6C 3RNKA 5D70H 5CJXC 1NCDH 3VFUA 3MLZL 1ETZA 4FFWD 4G8GD 4N8VG 3T08A 1V3MA 1MLCA 4PGJA 4FZEH 4BH8B 3FJTA 1AJ7H 3BP5B 2YXFA 4GKSA 1T1ZB 5T3ZL 5LCVL 2BHUA 3GJEA 3T0EC 3C5JA 1II4E 1MHEA 1LE9B 3E0GA 3TWCL 4JB9H 1AR2A 2P7TA 3IDGA 4XNMA 1LP9F 5DQ9B 1T83A 1IC7H 1HN1A 1RURH 3ZE0F 3FMGL 1DQJA 2GSIB 1A9EB 1AC6A 4DAGL 4JRXD 4YBQD 3QDJE 4R90H 4Z8FL 5IBUG 3IFPA 1I8LA 3ECBA 3PF2A 4GXUN 4PRBA 3T0EB 2ZWLT 4RWYL 1DQLL 3DVNB 3A6OA 4XPBH 4G6KH 3IDJA 4EI6A 4PJ5E 5D72H 5GJTL 4X4YA 3NIDE 5HHOB 4XNUH 4JZNA 5C1MB 4G3YH 1RZJH 3OV6A 4JFOB 3K4DA 5C0GA 1PKQE 3VG0L 2JCCF 1JRHH 5A16A 2EYTB 3EO1B 4LCCC 1AQKL 1QFPA 5JPNB 4LLYB 1L7TL 1PKOA 4TRPL 3ARVA 5HHME 4HXAL 3O6ML 4OFIA 5DJCB 1UB6B 2ZUXA 1EBAA 1S9WA 3OKDB 5I75C 2GAZB 5LKNA 4M3JA 1QVOB 3RIFF 2VN4A 3WMSA 2D03H 4KJWD 2YUXA 3TT3H 2UYLB 2CUHA 4FOMA 1EXUA 3L3HA 4H1LB 4KTDL 4LCCB 2WW8A 4OLYL 2OLDA 5CEZH 1HHGB 5JMOC 1BVKB 5I66B 5IK3A 1NJ9A 4NN7C 4P9HH 4FQHA 3INUH 1D6EB 5D7JA 2GFBA 3QEGL 4PJ9A 3MV8D 3MFFB 1ZTXH 5I75B 3S88L 4D94A 3C5ZD 3NCMA 3NFSH 3OJDA 2AAVA 3VMPA 3ULVL 4U0RC 2AQ1A 1KPVB 5CZXD 3DX6B 1SQ2N 4K94L 3I02B 4G8GA 3VXUD 4NN7B 1PY4A 4MSWA 4HJJH 5DSCB 4NQDE 1NEZG 1RK0A 2VISA 1FFRA 3SGKA 5CHNA 3UBXA 3RIAF 3ZDZF 3HC4H 3BRDA 4PTUB 1IAKA 3RPIA 2M8XA 4PJEF 1K6QL 4U0RB 2OL3A 1RUPH 4RWHA 1FGVL 4OSUH 4PRPB 4PGEA 5A2JH 1FL6B 4PJIE 5K9KB 1WTLA 5C08E 3TBWB 4PRDA 5C6WH 4JQVC 3S4SG 4MMZC 1G6RA 4JRXA 4DN3L 4ZUSA 5B22A 3TN0C 4XNXL 1VACB 1EDQA 3Q1SL 4OD1L 2F8VA 2JB6B 3DUSA 4JFFD 5KZCD 5C0ND 1D9KD 4PG9A 4MXVF 1MEXH 2NX5E 4KK6C 2NW2B 2A73B 5SWQA 3ABZA 2J8OA 5ADOL 3VD7A 5ANME 4NRXB 3DI2B 2FHFA 2UWEB 2HFFB 3SQOH 5C0BA 4TQEH 3IDXH 3M45A 1BM3H 4OF5A 1BP3B 2FB4H 5IFHL 4F3FB 1YDPB 1KCSH 5KVGH 3TN0B 3NTCH 3UYPA 4HUVB 1D5MA 3BT2H 2A6KB 4JVWA 4FXGA 2YWYA 4DGYL 4L9LC 4ELME 1JNNH 3IDNB 2QQLL 5GQBA 2COQA 3EYFB 4G43B 5AUMA 4Z77A 5DD5L 4QOKB 3BAEL 4YHZH 5IQ7L 2OXGA 4CU6A 3FOMA 5BZWB 3D39D 1UQSA 1NUDA 5GSRA 3KLHD 1V8HA 2FWOB 5JHLL 1M05B 5HD8C 1PYWB 1NCNA 3KPRE 5DVKA 2B8OT 1E4KA 4NHCL 3HUJA 2DKUA 2DMKA 3UTSB 3H8NA 1X6LA 1LEKB 2ENSA 2FECI 2NYYC 1INQA 2CDEA 4L9LB 4JJHA 5FYJH 1J1PL 1MCRA 5GS2H 4PJFA 3RDTC 1A1NA 1IGCH 2BVUA 2VWEE 3TH4T 5J1AA 5J6HA 1NGWB 2FEDD 2R56H 3C5ZA 5F1NA 3E2HC 3O2DL 1T04A 2VR9A 1D6VL 4AH2A 5MENB 3IJHA 4LF3A 4HS6B 2GJZA 3MA7B 4QEGA 3GO1L 4OZIF 2EIZB 4MNQB 4OLZH 4C54A 4QHLA 3MRJB 3L3JA 5K9OB 2EE9A 2R23B 4V1DE 2VKXA 1KLFA 1P4BL 2V5MA 3RDTB 2GJ6D 4NQCB 1MCWM 1BFOB 4RIRA 1NCBH 1T7VA 1KBGL 3E2HB 1U8OB 3OWEA 4R6UA 1WCBB 4H5SA 4EVNA 3QPXL 3WNLA 5IEHB 2LE9A 3N1QC 5ILTH 3PWUA 2A0LC 3A67L 1G1CA 3RWHA 2R2EA 4P3CL 2V5RA 3CX2A 1I3RA 3DO7B 3LVEA 4ONOA 2AGJH 1J05A 1IKFL 3LZFL 4GG6B 1UFUA 5BRZE 3NH7L 3ARXA 2Z35A 3T4AB 3BW9A 1T4KA 5DJAA 1A6VL 1T7ZA 1G9NC 3MRDA 2BY0A 1JWMB 3PUCA 4WI8A 3EUUA 5IVOA 1GJIA 1YMMB 5C0AB 3CVHH 2G5RA 4LEXL 1E4XI 1NAMH 5C09A 5IR1B 2B1HL 5TQ2L 3TBVB 2XWTA 1UWEL 2FZ3A 3OAZK 1QSFD 4RFNC 1WK0A 4WFHE 3R1GH 5TF0A 1HINL 5AZEH 2VLKB 2AEIT 3KPMA 3SGEI 1CD8A 1FVDA 5T1MA 4O4YH 2EIBA 4FS0A 1KTKE 3MR9B 5EO0A 1KPRB 3ULUF 1KCRH 4LCWD 3SDCC 3OKEB 5HHXH 1JFQL 1GH7A 2IH3A 2OTUA 4A6YA 3HAEB 2PW1A 3BZEA 4H1LG 4M5ZH 4RFNB 4BQBA 1TVHB 3DX9A 1IQDA 4FQQB 3ROOA 1MIEL 5F7UA 5I1LB 1HOCB 4QRUB 3MCLH 4MJID 5JO5A 3WV0A 4Y5VC 4OI8A 3TBYA 2VOTA 3KPNA 2GQHA 3S34L 3U82B 5ESQA 3EBAA 1F2XK 4MX7B 3RKPA 2FX7L 3BP7A 2X4SA 5IVZA 3SDCB 3EJYD 4DKEL 1KTLA 5T33H 3LS4H 3W11D 1WITA 5BXFA 4JRYA 1BX2B 3C60C 1T0PB 2OJEB 1G7JB 4PV8A 4CU7A 5H2BA 4WTXA 5GGRB 1HHHA 5IFJA 3D0VA 5LGJA 3I3BA 3WHXA 1VERA 2HJFB 1DBKH 2QQNL 4Y5VB 5FYKE 1YNKL 3WHE1 2R29L 1G7LB 5KN5A 2M26A 3JV6A 1TIUA 4L4VE 3VXOB 1RIUL 2EYSA 2XA3A 2XWJB 4G6FD 3WFBL 4D0DB 2QBWA 3DGGB 5D9SB 3T0AA 2VE6A 1ADQH 2P43B 1VFMA 1OP5H 3MV01 4HUUA 1NUFA 3N0PB 1BAFH 4PJDF 1F6LL 2CKBA 3C60B 4LSQL 4IS6B 1W8NA 4ZPTA 1QLRA 5J89A 3V4UL 4K3GA 3CLFH 5FHAL 4L4TA 5F1SA 2MTPA 1ODAA 4JANB 2J6EH 3B9KA 5I6XC 1PG7X 1U3HC 4JDZB 5D5ME 3O2VH 5CUSH 5F1OB 1U8JB 1I9JH 4KPHL 4KUCF 2DJUA 3PGCA 4R4BB 5L6YL 1IBGH 5TE6H 2P5WD 4OD2A 4WDIB 2HLFD 5K33A 3VFPB 4ERSH 5JOFB 2QTEA 1AD9B 1JUFB 1N64L 5GGQH 1EZVY 4NHUA 1PJ9A 2ICEB 1GGIH 3LB6D 1QFUL 3QIWC 1FG9C 3LH2L 2Z8RA 4X83A 1NSNH 1B88A 3HNVH 3C6SA 3JTTB 5I6XB 1U3HB 2IAMD 2PXYD 4UINL 4WCYL 2FBJH 3V5HB 5GS3A 3CDYA 4JDVA 4TSBH 4EUPB 3ILQC 4E41A 5F7DA 5B4MC 1ZLSL 5LQBL 4Z5RB 2BK8A 3MLPA 3GMLA 3KYKH 4KY1H 5IB1A 2EDFA 3CFJB 3TP4A 4Q9RH 4LCWA 4PRNA 4C56D 3QXDB 4XBEH 3QIWB 5CGTA 5F3BA 3HG1D 4ODTH 3S7GA 1OTUD 1IEAB 4D0CA 4MWFB 3WEXA 2BVYA 3UTTD 1BQLH 2VLJD 3T65B 2VH5H 5D70L 3ZTNH 3T0WA 1NCDL 1X7QB 2VL5B 3QH3B 2WBJA 4WV1A 5CSBA 2GHWB 1QFHA 1RHHB 1QFWH 2IANA 1CD9B 2KZ1B 1AJ7L 4JKWA 2Y72A 4MS8C 1LNUB 3NN8B 3RU8H 3DV4B 3IDIB 3L1OH 4CMMA 3KJ4C 4X5WA 4MQSB 1V05A 4RX4D 3BN3B 1M71B 1WT5C 1ZHBA 4WWID 4WGWB 5F96H 1HCVA 2E27H 4G42A 2C1PB 1DUYA 1PZ5B 3LY6A 2A9NH 5L2KD 4Z7OE 1ZWIA 3ZKQD 4BKLA 3MRKB 4W81A 1V7MH 4XGZA 4NM4H 1OLZA 1RURL 3OR7A 2AV1B 2XIDA 4EXKA 1YEHL 3VE0B 3LSOB 1Q9LB 5J4MA 3RVWD 4R90L 3MCKA 5ETUB 1DDHB 2X6MA 4WJ5A 3G6JE 3NIDF 4MCYB 1R5WA 4H20H 3WNPA 1LEGB 1F11A 3KJ4B 1LE5A 3SJVB 3H7LA 5I1DB 4N8VA 4OZGA 1NBYA 3BKYL 4XPBL 4G6KL 3MA9H 1E28A 5D72L 3SKMA 4M7KH 1ZOXA 4D9QE 4FTVB 5EZLB 3DX7B 2AJYH 4Y1AB 5GGSA 4XNUL 1OT1A 5IB2A 1SM3H 3OKNA 4G3YL 3ZKMD 4JFYB 1RZJL 2W9EH 4KKBD 3DV6B 1N4XL 1JRHL 3KLAB 4XRCB 3VFVA 3KS0H 3QFJB 4P2YA 2DI9A 4HZLA 3V6OA 1UCBH 4OKVB 1ZLUH 4LBEB 4TYUA 2CO6B 5GS0L 1BFVH 4PLOB 4MDJB 1UVQB 4LSSH 4G9FA 5HGHA 1T89C 1ZGLA 4PJGB 5SX4H 2RFXB 1Q0XH 2D03L 3O45B 4XPAH 4PB0H 2CDGB 3TT3L 5HYSB 2HRLA 4JM2F 1B9ZA 1MVUB 5GGTH 4AQ1B 3D18A 4XVUD 4XBPB 3RWFA 1IZJA 1JYVA 3UO1L 1H3UA 3F7VB 3O9WC 4P9HL 1I8KA 2UZIH 2UVEA 1SVCP 5BS0A 1AD0B 1S8DB 2VZOA 3INUL 5ICXA 1G9MC 1OTTC 2AJVH 3MRQB 3HR5A 4HCRA 3O8XC 5EC1B 1NH6A 4Y0GA 4BZ1H 4P5MA 4OIIH 4TOYH 1ZVSB 2R4RL 3HAEG 1HI6A 4GKNA 3NFSL 4YXKH 4JZOA 5D7SH 4E0RB 4YHKH 3MNVA 1L6ZA 3BH8B 4MD4B 4GKZA 4G9DA 2F54B 1G84A 4AT6A 3JSSA 4UQ3B 5DRNA 4OLVH 4I13B 3IFNL 4Y7MA 5I16B 3VGFA 3X13A 3G9VA 3RY4A 2D0FA 3L3IB 3O9WB 1HILA 1GC1H 4HJJL 2PCPB 4DGIL 1JZ3A 3OKLA 5BZDA 3O8XB 4QCIB 4UUJB 2GK0B 5EC2A 3WS3B 4F57H 4G6MH 2AXFA 2ESVD 3L5XH 4I0PC 3O3UN 1H0DA 3RVTC 1U2HA 3TPUB 3H9SA 1RUPL 5HYFA 4HJ0D 4XCEA 4Z7QE 4HS8H 4OSUL 4Z0XB 2OZ4A 2F8XC 1DQTA 5EN2B 4RGOH 4L4JA 4HFWB 1DBAL 3P9LB 5L8KB 3UZQA 3RNQB 3V9FA 4NZJA 4N5UA 5AG8A 1N2RB 3P4LA 5DYOB 4ODWB 2XTJD 4U6HB 2A77H 3PXJA 4I3RH 4GQ9L 2FDBP 1SJHA 2OMBA 3C87A 3MMEB 1MEXL 3DROB 5CFHA 4I0PB 1OP9A 5D7KD 1DN0B 3PWNA 4UIKL 2X70A 4QXGH 1ITBB 4ODBD 2VNCA 5MHSD 3SQOL 3BKJH 1NEZA 4TQEL 1NBZB 1BM3L 3RX8A 5FGCB 1YNTA 5E2UH 5JIHA 3FQWB 3R06A 4ELMF 4Y4KA 4Z9KB 5JOEA 3FOLB 5DXWA 1I1AA 2X9YA 2XZCH 5SWSA 1KCSL 1KCLA 3FZUD 5KVGL 1HHKB 3E1F1 3NTCL 5E8DH 25C8H 5C0FA 5IVXB 2NR6D 1CGXA 1NKRA 4K2UH 3BT2L 3DIFA 3QUZA 1AGBB 3FN0L 1UKTA 1CI5A 1ZHKB 3SDXB 2FHCA 3I6KA 1LO5A 4YNYB 3ALXA 3AMKA 1FL3B 3OB8A 1W0WB 3S4SA 1A6ZB 1KJMB 4YHZL 2HN7B 3GMRB 1J0ZA 4LCYB 4GO6B 5LWYH 5BVJA 5DLMH 3L7EA 1R5VB 2YKLH 3T0ED 5L8LB 3U9UB 4EUPG 2DQUH 1I1YA 1K2DA 5C6TL 3IJSA 4G8GE 5C0CA 5IQ9B 2R69L 5HHOD 2E7MA 4HKZA 5JXAL 3EGSA 1RY7B 2OSLA 5FYJL 1IGCL 4KUZH 3GUTB 1WZLA 2AERT 8FABA 4HIXH 4N0FA 1YC7A 4XB8A 5HI3C 3BD3A 4JPVL 1NEUA 4J6RH 4WRLA 1I4FA 2OR8A 3F8UB 2WAHA 3TH2T 2V2XB 4N0YL 3PL6A 4IBLT 4DK6A 2LAGB 3MV7B 5D2LA 2VABB 4JRXE 2YA1A 3MQIA 4UDTB 4OLZL 1WZ1H 4HPOH 4P0DA 4KZEH 5ICZB 5CINH 4I5BB 5GRZA 4S0SD 4PBXA 4YR6B 4L8SC 3OX8B 3KDMA 1TENA 5A2FA 1ZS8B 5C0BE 4DUXA 5HI4C 5JXED 5F6IC 2NNAA 3TC9A 1KN4L 1RZ8A 5CMAA 3KXFB 4F2MB 2DLEA 2BSSA 1MRCH 2VLRB 5HYQA 5EPMB 2AGJL 3DX8B 5SWZB 5DTFA 2P45B 4YWGH 4MA7H 1T22B 4PV9A 5E70A 2CIKB 3TCLB 4Y8DC 3VXMB 5IG7B 4XC3H 5CIPH 4L8SB 4JG1H 3QXAB 1MWAA 3S35X 1HCFX 1IKNC 4GRLC 3WS6A 1OQXA 4BH8A 2WQRA 3BP5A 1NPUA 3D0LB 3CVHL 3EDKA 1IAMA 1NAML 2BHYA 1T1ZA 5F6IB 4RGNE 2IG2H 3JV5A 3HUJE 5DRWB 1QOKA 2BSED 2IMMA 3QUMB 4TPRH 5AZEL 3SPVB 4MAYC 4PRPD 2AK1H 3S36X 3TLRA 2YMXH 2CMRL 4IRJC 1P5VA 4PJFE 5DQ9A 3KYNA 4X7SH 1YMHB 3NOIA 4O4YL 3U7WH 3GHEH 3Q48A 5FIEA 1A9EA 2J5LC 4GRLB 3GMPA 2E8YA 2NMSA 3HLAA 1KCRL 5HHXL 3DARA 5HYSG 5I1AB 3ZT5A 2P5EB 4I48B 3T0EA 4M5ZL 3DVNA 3MBXH 5EU3B 5KVFH 4MJ6B 4MAYB 2AI0L 2ENYA 5JNYB 1NC4A 2YEZB 3MCLL 4IRJB 2N4IA 4JFOA 3WD5L 3KHOA 3IAGC 3EO1A 2DQJL 2J5LB 5JPNA 2CR3A 4KHTH 4LLYA 2AJZA 3QQ9C 3GRWH 5E4IA 1CGTA 3MO1B 3LS4L 4Z7WB 4PP1D 5DJCA 3G6AB 3H6JA 3LV3B 1YA5A 3QEQA 1RJZB 3VRLF 3MSPA 3OKDA 5E2JA 3GIVB 2GAZA 3B83A 2CLZA 4LSDA 4R2GC 2RJMA 4AZ8A 5A43C 1DTUA 2UYLA 4XP5H 1DBKL 3STLB 3CFIC 3P4OB 4LLQB 2I27N 3FB8B 4R97B 4H1LA 4LCCA 3UTSD 1BVKA 1JRHI 1ADQL 2KPNA 5I66A 4MB5A 1T5XB 3TJEH 1KB5H 5C09E 1BAFL 1REIA 4PLJC 1D6EA 4HLJA 3NPSC 2C5DC 3GM8A 2D7PA 3MFFA 5J57B 1NCAH 1TMCB 3T2QA 4U7KA 1UT9A 4GW1B 3ETBF 1X5AA 4FQ2H 1F4XH 2J6EL 4R2GB 1QYGL 2ED7A 3O6FC 5CUSL 2OJZH 2ICWJ 2P44B 1FAIH 4EDWH 1KPVA 3DX6A 3QQNA 5TE6L 5IB5B 4MNQD 1G7HA 1B3JA 3SN6N 4XXCC 3VWKC 1F6FB 2XWBB 2P42B 4LSRH 3BQUC 5DSCA 3GKWH 4XHJC 3NPSB 3RDTD 5L2JB 2YBRB 2OMNA 2AVGA 1NSNL 3CCHA 4PTUA 3HNVL 3RVVD 4PJBB 4QWWC 3O6FB 4LEOA 3TO4D 2FBJL 1UM6L 4PRPA 2OK0L 1FL6A 5K9KA 3AS3A 1OB1A 3TBWA 2O5ZL 4NUGH 4UNTA 1NQBA 3CVIH 1M7IB 2H32B 3KYKL 4KY1L 1XCQB 3VWKB 3H9ZA 4KJQC 4RA3A 3BQUB 1VACA 4Q9RL 4JRYE 5DK0B 2JB6A 2DRUA 2LU4A 3DMMC 3HI1B 3CH8A 1FZMB 4ODTL 4Z7VB 4G8EB 2CIIB 2NW2A 2A73A 4QHUB 1YMMD 3W0WD 2XNAB 4DOHE 5C0AD 1QBLH 4JFHD 1BQLL 4NRXA 3RQ3A 3QIBC 3G5XB 2XRAL 3RKDC 1X5HA 2C4FT 1DEDA 3BP4A 5JQHC 4XHQA 4JQVA 1QFWL 2D2OA 4OZFA 5FYLE 1YDPA 5J8OA 3LEXB 4L8BB 1TNMA 2ICWB 3TN0A 2VLKD 5HVGB 4HUVA 3RU8L 4Z7OF 1H15B 4BSJA 2A6KA 3WDJA 1BWWA 2MHAB 3DMMB 3IDNA 5IIEB 2E27L 4WW1A 4L4TE 3EYFA 2EIEA 4HKJB 4QOKA 3FQXA 5C6PB 3BH9B 1I3GL 1JTTA 1IGJB 3FRPG 4XI5D 3QIBB 1HZHL 4HIIB 2FWOA 4NM4L 3OAZH 2W60A 1AP2A 3MNZB 1P7QD 3QNYB 4NGHH 1OY3B 4HMEA 4AEEA 2WUBL 1NC2A 4X8JA 4YDIH 1EAJA 5K59E 2QKIB 2Z9TA 1OAKH 1CQYA 1F2QA 3PWPB 1A1OA 4H20L 4LLVB 3VGHA 3QCVL 1F97A 3GBNH 4L9LA 3CK0H 2ERJC 3MA9L 1W72B 4M1GH 1NGWA 1TQCC 4FFZL 3SDCD 2AJYL 3BZ4B 6CGTA 1IFHH 5HGBB 4EBQL 2A74A 2W9EL 4M3KB 4FQJH 4X99B 5MENA 4E41E 3ILPA 3BDXA 2VO5A 3FTGB 4DUWA 3MA7A 2EIZA 2C3XA 1UCBL 4MNQA 4P59L 3SQBA 3MRJA 1Z9SA 1BFVL 4LCWE 4LSSL 4OAWB 3HTLX 2FO1A 2P8PB 5DVNA 3BPLC 4BQ6A 4K7FB 3RDTA 3TGXA 4NQCA 4WW2C 2ERJB 1BFOA 3TESA 3KLSA 2OP4H 3KYAA 1MY5A 1TQCB 3T4YB 5JOPE 1Q0XL 4WI7A 4XPAL 4PB0L 4AL8H 4CN4A 1J0HA 3CAFA 4KI5D 4P5TC 4RRPG 5IEHA 2O5XH 3C60D 1LO2H 1MFBL 3IKCB 5GGTL 1OW0A 4FFYH 2I25N 3B43A 2I07B 3RY5A 2VDNH 3ZDYE 2IANE 1DVFD 5CBEB 1A3QA 4DQOH 1DQQB 1INDH 2UZIL 1P4IH 2AJVL 3BPLB 1MFEH 3IDUA 3T4AA 1CZ8H 1D7FA 3CLEH 4BZ1L 4WW2B 4TOYL 4OIIL 3UJTH 1UH3A 1M7XA 3BUTA 1JWMA 4YHKL 3PDOB 4NKMB 4NT6B 4L29A 1UH2A 1YMMA 4P5TB 5C0AA 3BRFA 2AK4A 4ZS7H 3GJFB 5IR1A 2Y06H 5IFAL 5DJ6A 4OLVL 3TBVA 4DKFH 5EU4B 3AAZB 1AGEB 3HI5L 3HPLA 3L3KB 4F9PC 1IJ9A 1EZVX 1G7MB 1GC1L 4UMGA 1XF2A 2ZCHH 1GGCL 5E24E 5I1IH 4Z7QF 2GJJA 1FNEB 4OZGE 5MP6H 4C55A 1ZLWH 1O7VA 4XNYH 1HYSC 2GSGB 4KFZC 5ICYA 3L5XL 1DE4B 3MR9A 4XPHH 5E1HB 1X4YA 1KPRA 2PR4H 4HS8L 3OKEA 4UT7H 2O5YL 2EE6A 4RGOL 3QIWD 5BMFH 4YUEH 2PYEB 3V6OE 1TVHA 5FV1L 1J8HB 4G9FE 2A77L 1LO3L 5GRYA 4I3RL 4J8RB 4GT7A 5I1LA 1BMGA 1HOCA 3ILQD 4QRUA 1BQSA 1IE5A 1U8IB 3CC5A 3SDYH 4M61A 3ULSB 5CBAB 3BGAA 1S7RB 3BMWA 3ZTJG 4MX7A 5GXBB 4HAFA 4YK4C 4XP4H 4OLUL 3VFTB 4OB5H 3SGJA 4APQD 4XBGA 1F4AA 4ETQB 3GSWB 2VXSH 2GW5A 1JE6A 1BX2A 1EK3A 2Q8BH 1G7JA 1E27B 1TLKA 2XZCL 4QTIH 5GGRA 5CWSB 5E8DL 5BS0E 25C8L 1C1EH 4OBSA 3VGAC 4K2UL 1DEEB 2GTWB 4U49A 1GAFH 4P4KD 5JW4M 3ULUL 2HJFA 2VUYA 4OCRH 4Y5VA 1G7LA 4LQFL 3VXOA 3L9RB 4UV7H 4X5LA 3JWOH 4YK4B 3DGGA 5D9SA 5LWYL 4MS8D 3UTZB 2L7JA 1EEUA 2X4TB 5DLML 2EXWC 1L0QA 2LU7A 3VD5A 2R1XB 2YKLL 5HVFB 1A3LH 3C60A 2DQUL 1FFNA 3MLVL 4BYHA 3Q6GH 4FTVD 4OI7A 4QRRB 4Y1AD 4WWKC 4QHKI 2A38A 4JANA 5JHDB 1DBBH 3VGAB 5KW9H 1HQRB 1U8JA 1WWBX 5IHBA 3QFJD 4R4BA 4KUZL 4U3CA 2ADGB 4F7MB 2R2BA 4WDIA 3F6IA 4HIXL 3H9SE 5DHYB 3SY0B 5BW7C 3VWJA 4JO2L 5FYKH 4KROC 3VFPA 5JOFA 3ZSSA 2FIKA 5GGSY 1JUFA 4XWOD 4NQXB 4GUPB 4AK1A 1CL7I 2ORBL 3D6GA 4LQ1A 5JDJA 4WWKB 4WFEE 3JTTA 1MREH 1U3HA 4HLZG 3QT2A 3V4PH 3OBAA 4P2QB 5CINL 1OM3H 3EOAB 3V5HA 4P3DB 3PNWB 4EUPA 2ED8A 5B21A 4GXVH 2FO4B 4QXUH 4Z5RA 4KROB 4RNRA 5DHVH 1T03H 3K80A 1S78C 3CFJA 1XGRB 2VDQL 2EECA 1ZEAH 1YY8A 4JPWH 3GSUB 3QIWA 5IMOB 3MGTA 5SWSE 5IBLC 2UVFA 2JELH 1IEAA 2GY5A 3MRLB 1V7NL 4MWFA 3QZWG 3REVA 5ITFB 1JHLL 4MA7L 4OLWH 4O5LL 3N85H 4NQTA 2IPKA 2VL5A 4JG1L 4X0KA 3O9WD 1YEJL 1AGCB 3ARGC 5E8EA 3HUJF 1KPUB 3WXVL 1LHZA 2VKWA 2JKXA 1LNUA 3DV4A 3IDIA 2IG2L 3HRZB 5C0CE 4PJFF 4Z18A 1M71A 1A7OH 3FQRB 4J3UA 3DTXB 1I9EA 1PZ5A 1A0QH 4P9MH 4UOW0 1WC7B 2AK1L 1AO7D 2YMXL 3MRKA 3ZE2E 2J8UA 4X7SL 2HFEB 4OJFH 5F8QC 3WNKA 3GHEL 5CCKH 3VE0A 3BHBB 3ARGB 2Z4QA 5ETUA 1YUHB 4NM8L 1DDHA 1F90L 2DYPB 2R4SH 2UUDK 4MCYA 2C7UB 4RMQA 4WIQA 1LEGA 3SJVA 5D2LE 1A7BA 4IOIB 5FEBA 3RVTD 3DSNA 3U4BH 5KVFL 2FNBA 5EZLA 3DX7A 3SCMC 3CXHK 4AEHL 5GRXG 4PGDB 1KB9K 4G6AC 5B8CC 1BGXH 4YGAB 2DL9A 3DV6A 3RGVC 5D6DC 3KLAA 4XRCA 3I75B 4MJ4A 4KHTL 3GRWL 1JHTB 4RSVA 4OKVA 5T1KD 1VGKB 1A02N 4MDJA 1UVQA 1FQ9C 1JBJA 2CH8A 5FO9B 5F9OH 1JGLH 4PJGA 2ARJQ 3CZFB 1D5BB 1WV7T 2C26A 3RP1A 1HXYB 1U91A 2RFXA 4L8CA 4LSPH 3O45A 3SCMB 5EZJB 2XTJE 3E6HB 2CDGA 2MWCA 5KOMC 2Q86B 4CL7A 5B8CB 5HYSA 4XP5L 3QI9D 1EFXD 5C70A 3RGVB 2D9QB 1MVUA 3HFMH 3SE4C 4XBPA 2V9QA 2IALB 4CADB 1FPTH 3F7VA 1YEKH 2VERN 1AGFA 1JTPA 2HH0H 1MVFA 3TJEL 1KB5L 1MCHA 4FG6D 4RDQG 1AD0A 4M43H 5IUSA 2EZ0C 3MRQA 5EC1A 3F12B 1CE1H 2XXMB 1ZVSA 3T0XA 2F5BH 1JF1A 4DCQB 1T21B 3WIFB 3MJ7B 8CGTA 4FQ2L 4E0RA 3TBSB 1F4XL 1MI5B 2O93L 1JWUB 2OJZL 4MD4A 1FAIL 4EDWL 2F54A 4MXWH 5AWNH 3CSGA 1CICC 5I16A 4WEBL 4HF5H 1CFQB 2PCPA 3GKWL 1NGXA 3BXNA 3KYMA 3MYJA 4RBPH 2H26B 3T0EE 5F71A 5MEPB 2WLYA 3O8XA 2HAZA 4QCIA 4G8FB 2GK0A 3WS3A 5TJWK 3WNNA 1UXWB 1OTSC 2BOCB 4PRIB 1GZQB 4Y8AA 3V4VH 4GMSL 4HSQA 4XAKD 3WXWH 1KJ2B 1Q9OB 2HVKB 4Z0XA 5C7XH 2NY5H 2YD7A 5EN2A 4HFWA 3P9LA 1G7QA 3PGFH 4P46C 3O2WH 1TJGH 3RNQA 5GS0C 4NUGL 1XGTB 1CICB 3CVIL 1EIBA 2MQ3A 5SWZD 3MV9B 3D3VB 1N2RA 4ODWA 3IETB 5C0IA 2Q76B 1IEHA 4U6HA 4OF7A 1CD1B 4X9BA 5DMGC 1Z0MA 3QEQE 3RBSA 4K3DH 5H37G 3MMEA 3WNOA 3DROA 3FB6B 1AH1A 4K8RD 4I0PA 1QBLL 1DN0A 5FA3B 3MROA 3WFCH 4XCFH 1NBZA 1TJIL 3O81A 1ZXQA 4HV8B 5J6GB 4P46B 1VPOH 3FQWA 1FH5H 1XF3B 2OX5A 4PY7B 3TPKA 2VN7A 4WFGE 1U42A 4Q0XH 4HKXB 3CFKA 4LPWA 4K3JH 1PLGL 1RVFL 2J8HA 1ZHKA 1NGYB 4YNYA 4GRLD 1FL3A 3MLSL 3NABH 4RAVB 2XG5A 3RVXC 3OGCA 1A6ZA 1KJMA 2HN7A 3GMRA 4O00A 4AEFA 3VDAA 4LCYA 5K59F 1PG7H 4I18C 3EOYG 4CU8A 3KPOA 1R5VA 3CH1B 5I8EB 1UJTA 2DLIA 4L1DA 4NGHL 4JM4H 4YDIL 5DEGB 3KNBB 4MAYD 3MTRA 1OAKL 5EZIL 5J3HC 3BRGC 4GLRI 1Q94B 5KSAC 2X5PA 3GBNL 4ZFOB 3VGBA 1P6AB 2K9UA 4ELKB 4WO4C 3GUTA 5FUOH 4YH6A 3T3PE 3D9AH 5I8OH 4M1GL 2JB5L 2F9BT 4PRPE 4I18B 3D69B 4S1QH 4YAQB 1QR4A 4DWHA 5ACMA 5K9QI 3O3AA 3UXFA 5JPMB 3MV7A 2VZTA 3GNML 3TFKC 2VABA 4WI3A 1MY7A 3X3FH 5ITBH 3MUGA 2DKMA 1L0XA 2HA1A 5KSAB 2DIJA 3BI9X 4UBDD 5IHZB 2X4UA 2OI9C 2Y07L 1E0OB 4WO4B 4YR6A 5I15H 3QQ9D 4TTDC 5H8DA 3CXDH 3ZDYF 1FBIH 5C92A 2VDLH 4AL8L 2NY7H 5M95B 1ZS8A 1PBYA 4OZHF 3NPZB 1D3CA 2O5XL 1LO2L 3MJ9A 4FFYL 2A6JB 3O3DB 2OL3H 2VDNL 1OAZL 1SEQH 1Z3GL 3KXFA 1T5WB 5ECJE 2VLRA 4ZS6C 5HPOA 3DX8A 4K9EC 4DQOL 5SWZA 1INDL 5FAAA 1P4IL 1G6RH 5CP7B 1KYOK 5AYUH 2OI9B 1T22A 1MFEL 2CIKA 3TCLA 1CZ8L 3CLEL 3VXMA 5IG7A 5T3ZD 1N59B 4P2RB 4L8SA 4QOKE 3QXAA 1S9VB 5D1XC 4NO0B 1MCFA 4PLJD 3D0LA 4BSWA 4ZS7L 1CLOH 4LPUA 1ZANH 2AJUH 2LAAA 4OZGF 4DKFL 3FFCB 1JYNA 1UGNA 5LAXB 5DRWA 3RWGB 3FRUA 3I85A 3R4DA 3O6FD 1CFVL 2QL1A 3QUMA 3SPVA 3Q2CA 3VXPA 1LD9B 1MHHB 2NY6C 3O4LB 4RRPA 3KJ6L 1P69B 5EU5B 4BA8A 5I1IL 5CJOH 1Q1JH 3MLRH 5MP6L 1YMHA 4XNYL 4IMLA 4GRLA 3VWKD 5D1XB 4XPHL 4QNPF 3BQUD 3WLBB 2PR4L 1KEGH 2Y5TA 3NFNA 4XHJD 2ZCLH 3O6KH 4UT7L 1VB9A 4OZ4B 5MENE 1FN4B 1TNNA 5I1AA 2P5EA 3QDMD 4YUEL 4I48A 4MNQE 1UADC 4P23C 5JW3L 2NTFB 2OYPA 5EU3A 4B0MM 4MJ6A 1HEZB 2NY6B 1WFUA 5JNYA 2V5SA 4IRJA 1TPXC 4FQCH 4ZG1A 4I0KA 4NQCE 4KKAD 3SDYL 4UV4H 1A1MB 7FABL 4XP4L 5FHBH 4OB5L 4EDXB 1QSZA 4Q2ZB 3P9WB 2VXSL 2K7PA 3HE6C 5DI8B 3HNTH 1CFTA 5CD5C 1U41A 2FATH 2Q8BL 1MPAH 3G6AA 3LV3A 4U6VH 4FFVC 1U8MB 1RJZA 4C57C 4P23B 4JKLA 4JKPH 4PG2A 4QTIL 5J1SC 3TV3H 1ZKAA 1C1EL 2BC4B 3QIBD 3RZWA 2ADJB 2EH8H 4FZ8L 1R5IA 2YN3A 1GAFL 1I1CA 2DJ4A 3RKDD 1TPXB 2X40A 3P4OA 4LLQA 3TVMC 1G7IB 3FB8A 5IMLB 5E2TL 1KSRA 1FVEB 4MVBC 4OCWH 4N0CD 4UV7L 1Q9KA 5DURB 3JWOL 4FQLH 2PTUA 4XCNA 4UTBL 1YMME 5C0AE 3M07A 1I7TA 2AK4E 1T5XA 4UI2A 3HE6B 3ULVD 1L9NA 1A3LL 3E3QC 1ZHLA 1DUZB 4H8WH 3QCTH 1U0QA 4UIMB 1GIGH 3Q6GL 4HIHB 1QZ1A 3E8UH 1RIVL 5DA0B 1DBBL 3K2MC 5KW9L 2V2TB 4QHKJ 5C86A 3TVMB 2F53B 2YUWA 1D5IH 5F89B 4TSCH 1K8DB 2ZZUT 4GRWB 4Y4HA 3S37L 4MCZB 4E9LA 5ALCL 3WNMA 1X5YA 5DJ0B 5FYKL 3K81A 2VL4A 5F93C 4EJ1C 2XWBA 3F5WA 3FQNB 1I1RA 4KK5D 4X7FC 3SKUD 5L2JA 3QQ4B 2I9TB 3VXSA 2YBRA 2ZOLB 3UJIH 1RULH 4HWBL 3PQYB 3EO0B 2SEBA 2NZ9C 4PJBA 1EJ6A 1MREL 3V4PL 1IAIH 2EICA 3W39B 2DM7A 1OM3L 1YPZB 1HHIB 5CJBA 4X6CB 3RUGB 1FGNH 1W0VA 2KDGA 4GXVL 4N68A 1R3JB 2MKLC 1M7IA 1NCTA 5M94B 4QXUL 4WUKL 4PRHB 1T03L 1XCQA 3VWKA 5DD6B 5BV7C 4LPVA 3O6LH 5DF0A 1ZEAL 5DK0A 1AGDB 3OG6B 5FDYA 3HI1A 1FZMA 5E9DB 4NYLA 4Z7VA 4A6YH 2V2WB 1Z2KA 3CJJA 4OIAA 4QHUA 2XNAA 5DJZB 2RB8A 2Q8AH 3HRPA 3LRHA 3N85L 1SHMA 2XPGB 3G5XA 2FH8A 4M8QA 4X5XB 6FABH 3V0WH 2FSEA 4JCMA 4JLRB 3TO2B 4YDVB 2ZNWA 3UPAA 5HGAB 1LP9B 4RFOH 3LEXA 4Y16D 5BV7B 2ICWA 4R96A 2QR0B 1EEYB 1H15A 5DZOA 1UKQA 3ZE2F 2NY5C 3DMMA 1T0MB 1C12B 1A7OL 5IIEA 3RZCC 4X6EB 4EI5C 2HT2D 2B5IC 4QY8A 1A0QL 4P9ML 5DQDH 3BH9A 4XCYB 4B7IA 1IGJA 4HIIA 5L8JB 3P4NB 2EEAA 4ZFZB 4ZQKA 1TXKA 2PYED 3LD8C 4TSAH 2L7UA 1S7WB 4OJFL 4X98B 1MQ8A 3QP3A 5CCKL 2AV7B 3KG5A 3MNZA 5CGMA 5D2LF 3UAJD 1QRKA 1J8HD 4DVRL 3LRSB 4M93C 4XP9H 2QKIA 2R4SL 4ZO7A 5E2VH 3BPOC 3PWPA 1C5CH 1GRWA 4LLVA 1IVLA 2BRRH 3CMGA 4Q9QH 1WIUA 5FYLH 4PS4H 1FC1A 1KIQA 1RZFH 1UACH 1JNJA 1UZ8A 2Y25A 3RZCB 2CKBH 5F21B 3C9NB 3U4BL 2B5IB 4EI5B 1W72A 1T3FB 4JFDB 4NJAH 4K7PY 3BZ4A 5HGBA 2PKDA 2ARWA 4Y5XC 1BGXL 2ZOKB 1CXIA 3LD8B 4OFYD 4HH9B 5TDNB 1KCKA 2BOBB 3KR3H 5DD3L 2R8SL 3LN5B 2FR4B 4UNUA 4M93B 3BPOB 4OAWA 1VCAA 3O3BB 4AMKH 2P8PA 5F9OL 4IHOA 4K7FA 5CEZE 5J0BA 2W0KA 1VEMA 2A2QT 3VH8B 4LSPL 4YPGA 2BMKB 2H1PL 4Y5XB 3R0NA 4F37K 1U8HB 2E7LC 3IKCA 4NCC2 3I50L 1JGUL 5KAQF 1A3RL 3S35H 4QRRD 1FNGB 1QNZH 4BH7B 5CBEA 4WTZG 1PQZB 2HKHH 5JHDD 2PNDA 1DQQA 3MLWL 1SY6L 4WTWA 1RUQH 2LTQC 5TQ0H 4M43L 1KT2B 3QISA 3VFGL 4N1HB 5MEOB 1CE1L 4WW2A 1T7XA 3P77B 2F5BL 3QXUA 2ZPKH 5EU7C 1XIWC 3PDOA 4NKMA 1A6WH 3LKSB 4KI1A 4NT6A 4P5TA 1ONQB 1H8NA 4FFWC 2J8UE 5TDPB 3S36H 3VXQB 1SBBA 5EU6B 1KXTB 3GJFA 5EORH 5IWLC 5TF1H 4NN6C 5AWNL 3RWEB 2VZ1A 4Y89A 3MGOB 4PJEB