4APVA

The klebsiella pneumoniae primosomal prib protein: identification, crystal structure, and ssdna binding mode
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
97
Chain Sequence
b'TNRLELSGIICRTPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIISGHENQAITHSITVGSAVTVRGFISCHKALSKMVLHAEQIELID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRIMOSOMAL REPLICATION PROTEIN N
publication title Crystal Structure and DNA-Binding Mode of Klebsiella Pneumoniae Primosomal Prib Protein.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Replication
total genus 15
structure length 97
sequence length 100
ec nomenclature
pdb deposition date 2012-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4apvA00
1WOCA 3I56A 3UE1A 3KF8B 1E3PA 3MXNB 4JV5Q 4LF5L 4R4CA 5JJLA 1TWCH 5J3BA 5M3MG 2QA4A 4A3BG 4LFBL 4P73A 2WP8J 1IBLQ 2UXDQ 1S72A 1PH7A 2ZJQA 3S1RH 1AE3A 1TWHH 5LMUQ 1RIPA 2JA8H 4KHPL 1VQEA 1TWGH 2PI2A 4UP9A 4OWWB 2Y0SG 3K80C 2HHHL 4H02A 3OYYA 2E5LQ 3PUXA 4P75A 1EQRA 4QL5A 1MJEA 4BY1G 2EQSA 3CCUA 3J80c 2UU9L 1N32L 2WAQE 3CPWA 4LF4L 5AJ3Q 5BR8Q 1KC8C 3E9HA 2IHEA 3HKSA 5M5YH 3S1NH 2OQ0A 1RL2A 1UE6A 3KF6B 5FLMG 1LYLA 5C44H 1CKOA 1PH6A 4LFBQ 2OCEA 5C4XH 1YVCA 4DV5Q 2UUBQ 1EUJA 2L15A 3GTMH 4DKAC 2I0QA 1OXVA 1KXLA 2R6GA 2JA8G 3J7A5 3CCLA 2I5LX 4X62Q 4JI6L 3HOVH 4DV6L 3GTGH 1B70B 1E1TA 3S24A 2UXBQ 4BBSH 2FXQA 1Y1VG 3K8AA 2BA1A 3PV0A 3CXCA 4NXML 1XJVA 4L5RC 4A75A 5IYDH 3T1HL 1U0LA 4KLKA 1PH2A 4C3JH 4LF4Q 3HOXH 1O7IA 2A8VA 4A3MH 3PSIA 2ID0A 2MFIA 3CAMA 5HY6A 4LWCA 1HZ9A 3S2DH 2JA9A 2JEAI 4FDBA 4X6AH 2A1AA 4UP8A 4AYBE 1XNRL 5C44G 1YITA 4A3CH 5C4XG 2JJQA 4LNQA 3KYHC 3RN2A 1MKHA 4GNXA 1NJIC 1H95A 2F4VL 3TRZA 4JBWA 1KAWA 1PV4A 1XMOL 1YJ9A 1EIFA 4BBSG 2NZHA 1PYSB 4NXMQ 2MO1A 3DM3A 5IYDG 3AEVA 2HT1A 1L1OA 2KCTA 2K52A 1E7ZA 5M5WH 1VQMA 4NXNL 2VQFL 4DR4L 4JI5L 4JG2A 1HNZQ 4PZ6A 5IYCH 3S16H 3NBHB 3STBC 4HIDA 3RNUA 1VQJA 4DV4L 2R92H 3ER0A 3T1YQ 3A5UA 4A76A 1P16A 1Q8KA 3KOJA 4C3IH 4HJ7A 1XPRA 1ASYA 4A3CG 2YTVA 4L5SA 2ASBA 3S15H 2R7DA 2RHSB 4JI1Q 4APVA 4QGUA 1VQHA 1PYBA 4GNXB 1X3GA 3STBD 1YI2A 2JK8A 2WAQG 3NELA 5ELNA 3CC7A 4UP7A 1XMOQ 1E1OA 1K73C 1M1KC 1GM5A 1V43A 4IOAA 2VL6A 3KJPA 1OXUA 3DLLA 1IBML 2AKWB 4A3DG 2PMZE 2D0PA 3J7ZC 2HQLA 2PQAA 4JI5Q 3I2ZA 1XMQL 3M4OH 1L1OB 2OQKA 2C35B 3OTOL 4C3HH 5IP7H 3CMEA 4OX9L 1PHJA 2I5MX 5IY0A 2CCZA 4YWLA 3L0OA 3CD6A 4IPCA 3L2PA 1WJJA 2PI2E 1QUQA 3AFPA 4GLVB 1Q81C 2E2IH 1OXXK 1A62A 3A5ZB 4LFCL 4R4OA 4DAYB 1T9HA 1WCMH 4JI3L 1NMGA 3G48A 2BA0A 4A3IG 4GN4B 3SGIA 1Y1WH 4JBMA 4JI0Q 1NE3A 5M3FG 3HOZH 3F8TA 4IJHA 4NB3A 5IP9H 3RZOH 1UWVA 1HNXL 1NY4A 3JAMc 1IBMQ 1MJCA 4IO9A 4DR7Q 4HJAA 1HZBA 2E2HH 3UDIA 4AYBG 3ULJA 1VQ4A 2YU9H 2KENA 3JC66 4K0KL 4DV3Q 4OONA 2K5NA 4A3KG 3OTOQ 1I5FA 5LMNL 1D8LA 4NPSA 4JOIA 1J5EL 2NVTH 2YTXA 4A3FH 2F3IA 4B3TL 4OX9Q 1BVSA 1XPUA 4A3EH 2ALYB 1VQ6A 2R7ZG 4LFCQ 3A0JA 1DGSA 1CSPA 2EIFA 4HIKA 1HR0L 3PUZA 4BY7G 1GKHA 3D31A 1QUQB 3M4PA 4PG3A 4RMFA 4A4IA 1VQ7A 1Y1WG 4QJFA 5GAGC 1BKBA 3M85A 1X3FA 2RCNA 1PH3A 1HNXQ 2GN5A 1CKNA 2E2JH 4LF6L 2CWAA 1KIXA 4LUOA 4GKKL 1V1QA 4K0KQ 5GAEC 3GTJH 1CUKA 2IT1A 2NN6I 3KJOA 3CCJA 1YJNA 2ZTDA 5GROA 4A3JH 5LMNQ 2R93G 1K8GA 5E7NA 3RZDH 4B3TQ 1KL9A 4TVAB 4LF7L 4MZ9A 4A3EG 2K50A 4DR2L 2YV5A 1Y14B 4LF5Q 3CCVA 3CW2C 4BA2I 3HKZE 1X9NA 2XGTA 3HOYH 3E9IA 3K81C 5GAHC 1HR0Q 1UE1A 1E22A 4DR1L 2IX0A 3PIOA 1IZ6A 1X65A 4WJ3M 2HIXA 1X56A 1CSQA 3GTQH 4IPGA 3CP0A 2YTYA 4JC0A 1NTGA 1FVIA 3PF5A 4LF6Q 4GKJL 4BXXH 1GD7A 4KHPQ 1C0AA 2Q2TA 4A93H 5EAYA 2VUMH 3PUWA 1G291 3J81c 2HHHQ 4B3RL 1CKNB 3CF5A 1JMCA 3I55A 4A3JG 3PO3H 4X66L 3ERSX 2UU9Q 3TS0A 4YCVA 1N32Q 1Q12A 2K5HA 2RHQB 3J81j 1ASZA 1BBWA 4EQ5A 3CCRA 1OXTA 4POFA 4QY7A 3H0GH 2JA6H 1B8AA 1JT8A 2EXDA 3EIVA 5FJ8H 1EIYB 1SLJA 1TWAH 4R4TA 1QZGA 1PH5A 1I50H 2D62A 1XNQL 1SMXA 3HOUH 4KHZA 3GO5A 5C0XI 1PH1A 1I94L 1NMFA 3ULLA 3CC2A 4GKJQ 1YHQA 4JI2L 4JI6Q 1WI5A 4MNOA 1KHIA 3RLNA 3HOVG 4A93G 4DV6Q 3FKIH 2ZTEA 4DV2L 2ZJPA 4DR3L 1EOVA 3U58A 3PUYA 4YCUA 3J80i 2B3GA 3U4VA 4GOPC 1U5KA 1TXYA 3CC4A 3U50C 1IL2A 3PO3G 4JYAL 4AIMA 3T1HQ 4QQBX 2YYZA 2KBNA 4DV1L 2AMCB 2UXCL 1IBKL 1EWIA 3HOXG 4A3MG 4BBRH 3ICEA 4YWMA 4RG1A 3KLWA 2KCMA 4A3GH 4DV0L 1XNRQ 4R4QA 1NBWA 4BA1I 1XNQQ 1HH2P 3UE0A 2IX1A 2CFMA 2MQHA 1I94Q 2VNUD 3FP9A 2V1CC 2Q2HA 3WWVA 2F4VQ 3GTLH 4B3SL 4HIOA 2RF4A 4JI2Q 3U4ZA 2ZM6L 4DV2Q 1SROA 2VUMG 2H5XA 3W1GA 4DR6L 1S3OA 4P72A 3PGZA 4XTCS 3MEFA 3HKZG 1N34L 4JYAQ 4B3ML 2OTJA 3BU2A 4IJLA 2VY3A 4P74A 4DR4Q 4NXNQ 2VQFQ 1YNXA 2A19A 2K14A 5IYCG 5LMNW 1YIJA 2R92G 4DV4Q 5M5XH 5GADC 4A3GG 3RLOA 4UY8C 4DV0Q 1QVFA 2E8GA 3BJUA 1IXRA 1VQCA 1I3QH 1L0WA 1K8AC 2N78A 1Z47A 3CCSA 1KRSA 4DR5L 3I4OA 1QZHA 4YY3L 2D0OA 1W2BA 3IRBA 1JJ2A 1YEZA 4Y7NH 1HR0W 3Q8DA 3PCOB 2ZTCA 5IT9c 3KDFA 2ZM6Q 2LXJA 1Q86C 1VQ5A 2Q2UA 3GD7A 2WB1G 1FL0A 4POGA 4IFDI 2UUCL 1SE8A 3TQYA 5IE8A 1D7QA 1VQKA 1N34Q 3PO2H 4B3MQ 3GTKH 1PFSA 4XIGS 4IOCA 2MO0A 1MIUA 1K0RA 1N9WA 1HZCA 1XMQQ 1VS0A 3EBEA 4HJ5A 3I4NH 4X65L 1QVGA 3AFQA 5DLQE 4LFAL 4UPAA 5IP7G 2VZAA 3S2HH 2B29A 2PQAB 2VW9A 4DNIA 1LUZA 3HOWH 4WJ4A 1L2FA 5M3MH 4DR5Q 4YY3Q 1VQFA 4L5QA 1VQLA 2NVQH 1IYJB 4OO1I 4J15A 5C0XJ 1IBLL 1X55A 2UXDL 1W3SA 2K4KA 3F2BA 3UDGA 1WCMG 1VQGA 1S40A 4X64L 4JI3Q 4ALPA 1VQDA 3HOZG 5K36G 2NVXH 3H3VI 5IP9G 1PVOA 4LUVA 2LSSA 2IY5B 1YHBA 3KDFB 3G71A 4OXPA 4YHHL 2PNHA 1Q46A 1EFWA 3PO2G 2JQOA 3A74A 3TREA 2CKZB 4BY1H 4EX5A 1PH8A 5C3EH 5C4JH 4DV7L 4IPDA 4X65Q 1N36L 1J5EQ 2Z6KC 3KF6A 4LFAQ 2NN6G 4O0AA 1K9MC 4A3FG 1AE2A 4GN3B 5AJ3L 5BR8L 1VQ9A 4JI8L 1I6HH 3HOWG 1VQOA 2AHOB 4HJ8A 2B63H 4PZ7A 5FLMH 1G51A 1SN8A 5JEAJ 1VCIA 4DPGA 3F2CA 2N49A 2K5VA 4DV5L 2UUBL 4X64Q 1A63A 2JA7H 3JAMi 3S14H 1UE7A 2IHFA 1VQIA 4X62L 5JJIA 1C9OA 3NEMA 4DK3C 2XTIA 1V9PA 1Y1VH 4YHHQ 1QVCA 4GOPA 5GQOA 4OWTB 4GKKQ 2UXBL 4TQUS 2NVYH 3F2DA 3K7UC 3UDFA 5C3EG 4DV7Q 5H1SE 4JI0L 3B6YA 4LF8L 1N36Q 3OW2A 1YHAA 4PZ8A 2QGQA 4JOIC 1K3RA 1Q1EA 4JCVE 2WB1E 4JI8Q 1KD1C 1EYGA 4LF7Q 1HNWL 4DR2Q 2B63G 1UEBA 4DUZL 3M7NA 2Z0SA 3I7FA 3HOYG 3FHWA 2AWNA 3M4QA 3L7ZC 1SR3A 1UE5A 5IYBH 4DR1Q 2DGYA 5IWAL 2MNAA 2JA7G 3RR5A 3W5OA 3ULPA 3K7AH 1XPOA 1PH4A 5C0XG 4IPHA 5HGQA 1VQ8A 4BXXG 3CMAA 3M9BA 4GS3A 2ZJRA 2BH2A 4A3LH 4B3RQ 3CCEA 3LGJA 2K75A 4GOPB 4ME3A 1EQQA 4LF8Q 1A8VA 1OTCA 4X66Q 1P8LA 4LUZA 4LW1A 4MTNA 1YZ6A 5FLXc 5JJKA 1HNZL 1LM0A 2LXKA 1VQBA 4JBJA 4QIWE 1KQSA 1JB7A 4LF9Q 1HNWQ 4DUYL 3GTPH 1FGUA 3VDYA 4DUZQ 3H0GG 4KI0A 2AWOA 2I5HA 4R1JA 3T1YL 4C2MH 2JA6G 5FJ8G 3D0FA 3GTOH 1E24A 3EN2A 5ELOA 4YWKA 1TWFH 1WYDA 2OWOA 5IYBG 2OTLA 4JI1L 1FJGL 3G6EA 5IWAQ 1N33L 1C7YA 3HOUG 2JA5H 3KFUA 1YBYA 1HJPA 4GN5A 1A0IA 2GVBA 1CKMA 1VQAA 5JEAG 3RLFA 1AH9A 2Q2IA 3J81i 2KHIA 3ZJYC 4HIMA 1LTLA 3FKIG 4DR3Q 4A3LG 1K83H 2CQOA 4AQYL 4A3DH 1G6PA 1HZAA 1Q7YC 2VQEL 4GLAC 4DV1Q 1J6QA 2ES2A 2UXCQ 1IBKQ 4DUYQ 2HIVA 4DAMA 3G4SA 2UUAL 4BBRG 4HJ9A 3CPFA 3F1ZA 2Y0SE 2WFWA 1SFOH 3AYHB 4LF9L 1Q82C 2QEXA 1PA6A 3M3YH 3AQQA 1Z9FA 1FJGQ 4Y52H 1N33Q 2JA5G 3I4MH 1VQPA 4A3IH 4GNXC 3TS2A 4OWXB 5M3FH 4B3SQ 4JI7L 3BZKA 3H15A 3PF4A 2VS1A 2NZOA 3RN5A 3PUVA 4AQYQ 4DR7L 4DR6Q 1YJWA 1JJGA 3NENA 3CQZH 3H3VH 3K0XA 4DV3L 2VQEQ 4IFDG 1X54A 3W1BA 2Z6KA 4A3KH 1L1OC 2R7FA 3CCMA 1JE5A 4R4IA 4JI4L 4L5TA 2UUAQ 2BH8A 1BBUA 4O2DA 4YCWA 3BZCA 2CWPA 4P71A 3PIPA 1X3EA 1X6OA 4IFDJ 2R7ZH 4JV5L 2JE6I 1WFQA 2JEBI 2DUDA 3E0EA 2GVAA 2ATWA 1R9TH 2N8NA 4BY7H 4A3BH 3GDEA 3I4MG 4DK6C 4JBKA 1SRUA 3S1QH 2N3SA 3HFZB 2R93H 1OXSC 1VQNA 4GLXA 4JI7Q 4OO1G 3S17H 1PH9A 4AH6A 4PMWA 5LMUL 1Q1BA 3TEHB 2KHJA 2UUCQ 1XTDA 1GO3E 1N8RC 1M90C 3CCQA 1JJCB 3S1MH 2F52A 2E5LL 1GVPA 1B7YB 4JI4Q 3UDXA 1KRTA 3I4NG
chains in the Genus database with same CATH superfamily
1HTPA 2CHBD 4J6HA 4CDFC 3I56A 3IFTA 4JV5Q 1MHWC 2EYMA 4R4CA 1TWCH 2XVSA 4U68A 2NZ1D 1IBLQ 1CTMA 1S5CD 1WTXA 5EPLA 3S1RH 1RJTA 2O2LD 4UP9A 2MGSA 4OWWB 3QIAA 2E2HB 4M8AA 3T16A 2DNEA 1TS4A 2LFNA 2F0VA 5CMDA 3E9HA 3HKSA 4A3EB 3S1NH 3TSSA 1DJRD 2OCEA 2CW0C 2L15A 4DKAC 1SYGA 1ENAA 4JI6L 3MVVA 3GTGH 3I73A 5IYDH 1A15A 1JQYD 2B39A 1PH2A 3T53B 4LF4Q 3CU7A 5FK9C 3HOXH 1O7IA 2A8VA 2AQ2B 2MFIA 4IZ8A 5HY6A 2A1AA 2K03A 4A3CH 1EEFD 1H95A 2F4VL 4JBWA 3BVMA 3MFGA 3VYUA 1YJ9A 4BBSG 4A93B 1D5MC 4NXMQ 2F0LA 4WFN3 4RH6A 2K52A 5M5WH 2E74C 4JG2A 3RD4A 4PZ6A 3STBC 4HIDA 1SDFA 3NXWA 1XPRA 4K6DA 2K28A 4JI1Q 1UEAB 1ENFA 2NUCA 2KOLA 1KAAA 1PYBA 1X3GA 4JI0L 2WAQG 4UP7A 4XDXA 1V43A 1UUPA 4IOAA 5D3DA 5FLXE 4MTKA 2EY5A 2AKWB 2E2DC 3DM1A 2D0PA 1KLGD 2A6EC 4B9XA 5CR3A 1L1OB 2C35B 5IP7H 4J1MA 1GUWA 3CMEA 2L9HA 3EA6A 2KUMA 3CD6A 4IPCA 2E2IH 1WJJA 2PI2E 3AFPA 4LF9Q 4LFCL 4C3IB 2FJ2A 4R4OA 1WCMH 2OXPA 2XRSD 1Y1WH 2F0WA 4GN4B 3HZXA 1NE3A 5M3FG 3MZ5A 4NB3A 3D4RA 1NY4A 2WB1B 3JAMc 1IBMQ 1HZBA 4AYBG 1F2ZA 1XTCD 2KENA 2MJ8A 3JC66 3QG1A 1I4RA 1J5EL 4NPSA 4HCEA 3M4OB 1ZYRC 2B2YC 1B3AA 1FGBD 3A56A 1DGSA 2EYPA 2EIFA 1HR0L 4BY7G 1GKHA 4PG3A 4A4IA 1SYBA 1SE3A 1VQ7A 3BZDB 4QJFA 1BKBA 2VB3X 5LHY1 4HTHA 1PH3A 2GN5A 3H6MA 1CKNA 4LF6L 1KIXA 3RZOB 1CUKA 2HDLA 4I7AA 1ILQA 4A3JH 3I4NB 1JB3A 1DZ1A 1KL9A 4JK1C 4TVAB 4LF7L 1D1KA 4A3EG 1M4VA 2K50A 4CDCC 5C3XA 4ZYSA 3EROA 3HOYH 2F0KA 3K81C 2NVQB 1IZ6A 1BF4A 4WJ3M 2HIXA 3V96A 4F87A 1Z7TA 4IPGA 5JPNC 1NTGA 3PF5A 1JOQA 4GKJL 2NVXB 5FO9B 5E1FA 1LT6D 2LS01 3PUWA 1CA5A 2L0CA 4ID6A 4CDDC 2UU9Q 1SNCA 4YCVA 4FO2A 3K0YA 3MHBA 1B44D 4K2LA 1E2WA 2JA6H 1I6HB 1I4PA 3I4LA 3EIVA 1SLJA 1TWAH 2N55A 1PH5A 3O13A 1I50H 3HOUH 1JORA 1X3QA 3T4AC 2KQ3A 2L4NA 5JEAH 1HPCA 2E76C 4A93G 4DV6Q 3FKIH 1PVOA 3J80E 2ZJPA 1Y1VB 2VUMH 3PUYA 2RVLA 3U9OA 2BDOA 1TXYA 3U50C 4JYAL 3T1HQ 2J0TD 2KBNA 1F2YA 1TS2A 2ZT9C 1II3A 1BCPC 2B2UA 1SMYD 1LTSD 3KLWA 2QCPX 3UE0A 1I94Q 3NUCA 1K28A 1A3TA 5CV4A 2EPBA 5CV7A 1RHPA 2JN4A 2RDFA 1QJOA 5EBDA 4FNFA 2PW5A 2OTJA 1KNEA 2VY3A 3FPUB 4NXNQ 2VQFQ 1XX8A 4H13C 1PTOD 2CVRA 1QVFA 3HG9A 4DV0Q 4ZCKA 1VQCA 1I3QH 4C2MB 3LX0A 2N78A 4C3IG 4DR5L 3OPOA 1QZHA 4YY3L 1W2BA 5A2QL 4PNYA 2JA5B 3Q8DA 1CZWA 1PFMA 2ZTCA 1FYCA 2LXJA 3KLSX 2WB1G 1FL0A 4POGA 2UUCL 1ET9A 1V1OA 2Q8RE 5IE8A 1RTNA 4A3DB 4XIGS 4K5VA 5COYA 1SBBB 4X65L 1AEXA 1Y8OB 2NN6H 1TKWB 2H1EA 2PQAB 3DEPA 3HOWH 4WJ4A 1SFOB 4QUFA 1UNSA 2F0GA 2V4DA 4OO1I 2NBFA 4JPBW 1TR5A 1X55A 4K8JA 1W3SA 3F2BA 3TBIB 4XQJA 4JI3Q 1U9RA 4ALPA 4Y7NB 1VQDA 1X32A 3H91A 4QIWB 5IP9G 2KA7A 3KDFB 4OXPA 2F0FA 2I46A 3CQZB 3FMCA 4EQPA 2JP1A 1TQOA 4DV7L 2CH4W 4XXEA 3KF6A 2RQXA 1K9MC 4A3FG 1AE2A 2PPBC 1LTBD 3V05A 4HJ8A 3DWAA 2B63H 2DJFC 5JEAJ 1VCIA 5ELCA 3F2CA 4A3BB 3R8BA 1CZGA 5BN4A 1STHA 1UE7A 1RCVD 1B9NA 4ME5A 4OEMB 3S17B 4DK3C 4GOPA 1W6JA 3IFDA 5GQOA 4GKKQ 2Y0SB 4TQUS 3BVZA 2QW7A 3R2IA 2DJGC 4BY1B 4HEDA 3ZYYX 4PZ8A 2O5JC 3VA7A 4JCVE 1GHKA 1SYFA 4DUZL 3M7NA 2Z0SA 3ERQA 2EXZA 2KCNA 4IALA 1F9QA 2AWNA 2RBMA 3L7ZC 5IYBH 4DR1Q 1ESRA 1CQFA 3NQTA 3RR5A 4RKBA 4RFBA 1XPOA 3D4WA 1Q90A 4IFDJ 1TWHB 5C0XG 1PH4A 2JA8B 2EYFA 4I65A 4GS3A 4B3RQ 3CCEA 4ME3A 5IOCA 5FLXc 3H94A 3KLRA 3OWEB 1U4LA 5EGTA 2F0OA 1LM0A 2X6LA 3PMFA 1JB7A 1BCPB 3W3AA 4LK1C 3H0GG 3IL8A 4H0LC 5FJ8G 3TP8A 3D0FA 5C4XB 1N33L 1G2TA 3GTMB 1HJPA 4JW0A 1JE4A 2J7ZA 3AMUA 4HAEA 3RLFA 3J81i 1FD7D 1E2ZA 4DR3Q 2B2TC 4A3LG 4U673 1J8IA 1CHPD 1Q7YC 2F0MA 2ZXOA 3PIO3 4DV1Q 3C46A 4X3TA 4C3JB 5CYUA 1IBKQ 2B8FA 3G4SA 4BBRG 5DM73 1GHJA 3AYHB 1ET6A 1PA6A 3AQQA 2K5DA 1O7ZA 2SOBA 1PFBA 2JA5G 4FF1A 1ZXTA 4OWXB 1YNJD 5M3FH 2D9UA 2VS1A 2NZOA 4AQYQ 1QE6A 3NENA 3K0XA 4L6TB 2VQEQ 1WTQA 2FMCA 3MXNA 4O2DA 2CWPA 5IGFA 1GOZA 1X3EA 3PIPA 2A6HD 3KUPA 4BY7H 1VF5C 2OF1A 3GDEA 4DK6C 2IX3A 3S1QH 2L5TA 4KY7A 2EJGC 3URYA 4JI7Q 2Z8LA 5IGDA 4PMWA 3TEHB 1NSNS 1XTDA 5CV9A 3CCQA 4CKEA 2E5LL 1GVPA 3MTSA 3UDXA 1LTTD 4C56C 1WOCA 1DXMA 3OIPA 5FKAC 3BDCA 4LF5L 5J3BA 1STAA 2QA4A 5IT9E 4A3BG 4LFBL 4P73A 1EEID 3T56B 4KY6A 3HOZB 2ZJQA 5LMUQ 1RIPA 3VR3A 1IHZA 2X69A 2PI2A 4PMCA 2Y0SG 3I3CA 4E6IA 2HHHL 3HRZC 2YU9B 3PUXA 2OT2A 2P5ZX 2WIIB 4QL5A 4BY1G 3CCUA 2XWBB 3J80c 5IGEA 3CPWA 1IYUA 2QDBA 1LO5D 1JICA 5BR8Q 1KC8C 5HGTA 5M5YH 3K57A 1JCKB 2XNAC 3NWSA 5FLMG 1LYLA 1EU3A 1CKOA 5C44H 3D8GA 5G3LD 2F0IA 2UUBQ 1G2SA 1KXLA 1U4MA 2JA8G 3J7A5 1ZEQX 1B70B 2UXBQ 5TSSA 3K8AA 3PV0A 1WTWA 1QG7A 2CW0D 3NBHA 5IIFA 3RZDB 2ID0A 1K8MA 1KLUD 4KD3A 1LT3D 1A2UA 3S2DH 4X6AH 4FDBA 1XNRL 5C4XG 4LNQA 3EQLC 3RN2A 2PCFB 3GTQB 1PTOB 2SNMA 1PV4A 1EIFA 1PTOF 1WTPA 2SNSA 3DM3A 3AEVA 2KCTA 1VQMA 4DR4L 1DOLA 1H9SA 2OEOA 5CORA 2FINB 4C3JG 5A35A 3PO3B 3MXGA 2EVBA 3LNNA 4DV4L 5L37A 3T1YQ 2HDMA 1Q8KA 3KOJA 4C3IH 1PDQA 4DK0A 2EJFC 3S15H 2RHSB 2F3WA 4KK7A 2J4XA 1S4ZA 3STBD 1K73C 3NELA 1GM5A 3CC7A 5K36G 4S3SA 3UI2A 1M1KC 3MEHA 2VL6A 2ZXRA 3E5SA 2A6HC 2PMZE 1SNMA 3D6WA 3NTKA 3J7ZC 2HQLA 4DNTB 4F7XA 3I2ZA 3X3MA 3M4OH 5BN3A 3OTOL 3S16B 3E3XA 4OX9L 1B2TA 5IY0A 2CCZA 4RGNA 4YWLA 5EKKA 4RCOA 3L2PA 1A62A 1MI2A 3A5ZB 1EIHA 2A6ED 2EY1A 4KY5A 5EJWA 4JBMA 3SGIA 3C3LA 1EY7A 4JI0Q 4IJHA 2EDGA 2EY2A 5IP9H 1HNXL 3RZOH 4IO9A 4HJAA 5EBCA 4DV3Q 2K5NA 5CV6A 3I8ZA 1HA5A 1I5FA 5LMNL 1D8LA 2R93H 2NVTH 1KNAA 2YTXA 4A3FH 2C9OA 5JVG3 4C3HB 3M7GA 4DFAA 2ALYB 2M00A 4LFCQ 5I9PA 1TS3A 1CSPA 5EQ0A 3PUZA 3MAQA 1H9JA 4MHEA 5DM63 1ZYRD 2E2JH 3P7JA 2CWAA 4LUOA 1V1QA 4H44C 5E4XA 3GTJH 3KJOA 2NN6I 3GTKB 3K6OA 2ZTDA 4XQQA 2PYKA 4ZQ3A 1S5BD 5E7NA 1L0XB 3A8JE 4ZKCB 5EPKA 3S2HB 2KVMA 1K3BC 2YV5A 3KBXA 1WD0A 3HKZE 3PQIA 2XGTA 3E9IA 3GV6A 4FF3A 1HR0Q 2IX0A 3PIOA 3SDZA 2QKIC 2WKDA 1WTRA 2YTYA 1FVIA 4LF6Q 4KHPQ 1GD7A 1LACA 2Q2TA 2B2TA 1STBA 1CKNB 3NE5B 4X66L 5C3EB 2GA4B 1N32Q 2K5HA 2RHQB 1CFMA 3GP7A 3TP5A 1BBWA 1F9SA 4POFA 3H0GH 1B8AA 3OIQA 5FJ8H 1EIYB 4R4TA 2MUYA 4X3SA 1H9MA 1XNQL 3Q23A 4Q0FA 3ULLA 1SE2A 4GKJQ 5E4WC 2EY6A 5JOBA 3RLNA 1KHIA 3HOVG 4K14A 4KKTA 2EYLA 1MSHA 2DY7A 4DV2L 1ASYA 3U58A 3U4VA 2B3GA 4GOPC 5T1GA 3QOJA 3VR4A 3CC4A 3PO3G 4QQBX 5D65A 3HGBA 1D2BA 3EFXD 4A3MG 4BBRH 3ICEA 2B8GA 4YWMA 1S5ED 4DXFA 4A3GH 1EYAA 3TN2A 1NBWA 4BA1I 1HH2P 3ONAB 1EZ6A 2IX1A 2MQHA 2VNUD 3VR6A 2V1CC 2Q2HA 3GTLH 1BCPD 4HIOA 2RF4A 3K7AB 2EYHA 1SROA 1SJHD 1VMCA 1ZKOA 3W1GA 3Q0AA 1S3OA 4P72A 4DR6L 4KN7C 3MEFA 4XTCS 1N34L 4JYAQ 1PLFA 2HD3A 3T51B 3EJIA 2K14A 5IYCG 1YIJA 2R92G 5M5XH 5GADC 4KTAA 3RLOA 4UY8C 3BJUA 1L0WA 1EQVA 1K8AC 3HS0C 2KCCA 1JJ2A 1R4PB 2AUJD 1YEZA 4Y7NH 3PCOB 5IT9c 1Q86C 1WTHA 1VQ5A 4RHRA 2QDLA 4ZAIA 3TQYA 4RA8A 3KLSA 3PO2H 3AB9A 4IOCA 2EE1A 1RD9D 1XMQQ 3MWYW 4HJ5A 5NUCA 1G6ZA 1QVGA 3AFQA 4LFAL 4C3HG 2RA4A 2B29A 4DNIA 4DR5Q 4YY3Q 4M1UB 1B53A 1F2MA 1VQFA 1BXTA 1VQLA 1IYJB 1EWHA 5C0XJ 1IBLL 1S40A 3UDGA 1LABA 3I4MB 1EZ8A 1SAPA 4X64L 4A3IB 1HCZA 2WV6D 4V190 4ZKBB 2HCCA 5JPMC 4WJWA 2LSSA 2E75C 2VXWA 2IY5B 1YHBA 1EFWA 1Q46A 2ENBA 1NR4A 1CI3M 3TREA 4BY1H 3LWEA 5C4JH 4IPDA 4X65Q 1N36L 5CBAE 1VQ9A 4GN3B 5G3LF 4JI8L 1VQOA 2R7ZB 5FLMH 1G51A 1SN8A 5M3MB 2N49A 2M2LA 3J81L 2F0JA 3AU7A 1A63A 2JA7H 4RGTA 3JAMi 3EVQA 1EY0A 1MSGA 3S14H 2IHFA 5A2QE 1VQIA 3NEMA 2XTIA 1V9PA 1PZJD 2NVYH 5C3EG 4DV7Q 3B6YA 4LF8L 1JWMD 4Z9CB 1EYGA 1HNWL 2LMCB 4DR2Q 1TWCB 3I7FA 3DXJC 3FHWA 3A54A 3M4QA 1SR3A 4ODGA 2BCOA 4R9WA 2PMZB 5IWAL 2MNAA 5FLXL 4RAUC 3S1RB 3S9WA 3ULPA 1X3PA 4IPHA 3VYRA 1VQ8A 4BXXG 1EL0A 1I4XA 1D6EC 1LLRD 1RKNA 2ZJRA 3C1EA 4HSPA 2R61A 2BH2A 2K75A 4GOPB 1EQQA 4LW1A 1GJXA 1YZ6A 3BDOA 2EOTA 2LXKA 1KQSA 2TMPA 1JWUD 3OWFA 3GTPH 3VDYA 3E6ZX 4DUZQ 2I5HA 4R1JA 1SJED 3S1NB 5C6AA 3EN2A 1Y69U 3K5OA 1TWFH 1EQTA 4JI1L 3G6EA 1C7YA 1YBYA 4GN5A 1A0IA 2G9DA 4R8NA 5K36H 2KHIA 2A73B 3GTGB 4HIMA 3HP3A 1HHVA 1HZAA 5E3FA 3VR2A 4IFDH 1J6QA 2ES2A 2UXCQ 1RF2D 3HOXB 2UUAL 1SNDA 4HJ9A 1E0BA 3F1ZA 2JYOA 4LF9L 1O7YA 3ITPA 1Q82C 3TDQA 1Z9FA 1N33Q 3GTOB 1KABA 1DOMA 1TY0A 3TS2A 4B3SQ 3BZKA 3H15A 1AFPA 3RN5A 1IW7D 1TIID 2RDGA 3HKZB 2G5DA 4KKUA 3NQIA 1W6KA 5IGCA 2Z6KA 3VA5A 5M5WB 2R7FA 3CCMA 1JE5A 2XWJB 3KF8A 4R4IA 4JI4L 3BG3A 4P71A 1QOHA 1LTID 2JE6I 2ATWA 1R9TH 4HR7B 3I4MG 1EY5A 1QILA 3HFZB 1VQNA 4OO1G 1FR3A 1TVXA 1Q1BA 3KBGA 1IKLA 1HUMA 2NTTA 4XYQA 1NAPA 3S1MH 2F52A 4KJNA 2IPKD 1B7YB 1ILPA 1DONA 1KRTA 3I4NG 4A3KB 4G4KA 1FNWA 3MXNB 1DM0B 5KNBA 5KEEA 5M3MG 2WACA 2WP8J 2UXDQ 1ICFB 4JVZA 1S72A 1PH7A 1Y1WB 4KHVA 4J8QA 2IL8A 1VQEA 1TWGH 2PNRC 4PV1C 5I2YA 4FYDA 1V1PA 4F88A 2TSSA 1DD2A 2E5LQ 3RUZA 4P75A 1EQRA 2Q8TA 2UU9L 4N8FA 4R8IA 3MXUA 2WAQE 3A8KE 1HXYD 5AJ3Q 1STGA 1UE6A 1PH6A 4LFBQ 4DV5Q 2F03A 2F0UA 2R6GA 4UAIA 1H9RA 3CCLA 3HOVH 4X62Q 1BNZA 3FDTA 4DV6L 4BBSH 2FXQA 1Y1VG 3CKIB 3CXCA 1XJVA 1PYWD 1LV9A 4O42A 3T1HL 3NTIA 4A3JB 1I4QA 5I4DA 1EY8A 4A3MH 3CAMA 4LWCA 1HZ9A 5IGBA 1T5EA 4AYBE 4I7ZC 1BCPF 2JJQA 5C3WA 3KYHC 4DNRB 4GNXA 1NJIC 4FF4A 3TRZA 2NWGA 1XMOL 1PZID 3T13A 4FP5D 1L0YB 4ILWA 5IYDG 3C2PA 1J9OA 4CKBA 1GUTA 2JXMB 1E7ZA 4NXNL 2VQFL 4JI5L 1HNZQ 5IYCH 3S16H 3NBHB 3RNUA 2LKVA 2R92H 1VQJA 3ER0A 4N8X1 2JA6B 3A5UA 1IW7C 4DAYA 1P16A 4HJ7A 4A3CG 2F0PA 1TWAB 4L5SA 1I50B 2ASBA 3HOUB 2R7DA 4APVA 2D2CC 4G7OC 2K33A 4RHSA 1YI2A 1E1OA 1O78A 4QB4A 3P20A 2F1MA 3FKIB 5IODA 3KJPA 2VUMB 1D5ZC 1XWEA 4A3DG 1HFGA 2PQAA 3SK6A 2OQKA 4C3HH 3QWNA 1H9SB 1Q3LA 1PHJA 2I5MX 3L0OA 1Q81C 1QUQA 5C5LA 1T9HA 1TY2A 4JI3L 2BA0A 3F8TA 3SHLA 1MJCA 4DR7Q 3FVQA 2E2HH 1F77A 4K0KL 3NK9A 2DN8A 5KNDA 3TP7A 1ENCA 4A3KG 1MGSA 3OTOQ 2F3IA 4TSSA 4B3TL 4OX9Q 1BVSA 1XPUA 3R93A 4A3EH 3J7YW 1I3QB 2RSNA 3A0JA 2FFKB 4HIKA 2HCIA 5ELDA 2ZXPA 3D31A 3M4PA 4RMFA 1Y1WG 5GAGC 1PRTC 3M85A 1X3FA 2PQEA 2RCNA 4HMIA 1HNXQ 3BYTB 1G8ZD 5KGUA 4GKKL 3D3RA 3TMEA 1O7LA 2K1BA 5GAEC 2IT1A 1YJNA 2BE5C 5GROA 3MXPA 5EKIA 5ELEA 5LMNQ 2K5WA 1K8GA 4HMJA 4MZ9A 3K59A 2A5HA 3CCVA 3CW2C 3HOWB 4BA2I 1X9NA 1KDBA 5GAHC 4X3UA 1UE1A 1E22A 4DR1L 4DGZA 1X65A 1CSQA 2DNCA 1AZQA 3CP0A 4JC0A 3F2UA 4BXXH 4A93H 3L3OC 4B3RL 5HURA 3I55A 4A3JG 3SK5A 3QOLA 2A69C 3R2TA 2L1BA 4EVOA 4EQ5A 1SNPA 2AUKA 1JT8A 1AW7A 2EXDA 3DMUA 2B63B 4ULLA 1RDPD 3VYSA 4X3KA 2D62A 1K8OA 2M9VA 1SMXA 3ND9A 4KHZA 3GO5A 4EQOA 1PH1A 3CHBD 1EY6A 3QJYA 4N9PA 3CC2A 1YHQA 4JI2L 4JI6Q 4KN4C 2ZTEA 4DR3L 1C48A 1EOVA 3J80i 2D5DA 1IL2A 4AIMA 4DV1L 2AMCB 3NP8A 1IBKL 4FVMA 3K5LA 1EWIA 3VR5A 3D6CA 4ABNA 2N88A 4RG1A 4R4QA 4RKLA 1EIGA 1XNQQ 4L63B 2PZTA 2AQ1B 2CFMA 2KEEA 2IJ0A 1C4QA 2F4VQ 2NYZD 3U4ZA 2ZM6L 5ISRA 4DV2Q 2VUMG 2H5XA 1SSOA 1A3VA 1F2LA 2FMMA 4B3ML 4IJLA 4ZUIA 1F9RA 2K5QA 1CA6A 1STYA 2E8GA 1IXRA 1Z47A 3CCSA 1KRSA 1SYCA 3I4OA 3JAML 2D0OA 1HR0W 2K05A 3I70A 3GD7A 4IFDI 1TS5A 1D7QA 1DYQA 1N34Q 4LJZC 1PFSA 1HQRD 1QNUA 2MO0A 3DUZA 3I4NH 1VS0A 4EQNA 5CC4A 1RTOA 4DA2A 2VW9A 3TZDA 1LTRD 1L2FA 5M3MH 4DXGA 3W2DA 1D1IA 4L5QA 2NVQH 4J15A 4UHVA 1AZPA 4RGMA 3WOEA 2HQEA 3H09A 3HOZG 2Z9HA 3NWTA 5M3FB 3K5MA 3TZUA 5DEHA 2RKSA 1PZKD 2NVXH 4LUVA 4QF4A 4YHHL 2PNHA 3A74A 4IURA 2CKZB 4EX5A 1PH8A 1Z6HA 1B3QA 1J5EQ 2Z6KC 4LFAQ 2NN6G 2VB2X 5BR8L 1I6HH 3HOWG 2AHOB 5I6WA 3QB3A 4PZ7A 1A6XA 4CJ2C 5CGKA 4DPGA 2K5VA 3CRKC 1GUSA 2UUBL 4BY7B 1FNUA 1IL8A 4X64Q 1YNNC 1Y8NB 4OIKA 3S1QB 1U4RA 4G57A 4TRDA 2Z6BA 4DU9A 5JJIA 5C0XH 1JOKA 2UXBL 1Y1VH 4ZRZA 4NDXA 1STNA 4GZYC 2Z1CA 1TT2A 1GXDC 1N36Q 1YHAA 1G91A 4JOIC 1Q1EA 4JI8Q 2F0SA 4LF7Q 1BO0A 2B63G 1UEBA 2MPMA 3QR8A 2XN9C 4FXGC 1UE5A 1XXGA 2DGYA 4YIJA 2EYJA 3W5OA 3CMAA 3M9BA 1JC7A 1O80A 4KV6A 1IYVA 1GUGA 4B08A 4A3LH 3SK8A 3MC0B 3LGJA 4LF8Q 1D5XC 1P8LA 3MFYA 4QIWE 1VQBA 4JBJA 1HNWQ 4DUYL 1FGUA 3T1YL 2C5CA 3A8IE 2AWOA 4KI0A 4C2MH 5M5YB 3GTOH 5ELOA 5C44B 4YWKA 5IYBG 2OTLA 2CQAA 3KFUA 1FJGL 5IWAQ 2JA5H 5KRUA 4NKLA 4H7BA 1VQAA 1ESFA 1KTKA 4DAPA 3J81E 3OW7A 1AH9A 5M9OA 3ZJYC 2FHTA 3CRLC 3J7AV 2CQOA 4A3DH 3N52A 3SEBA 3IKJA 4GLAC 4DAVA 2K7VA 2HIVA 3Q24A 3A55A 1QWYA 3CPFA 2Y0SE 4KKSA 3S2DB 3V2TA 1SFOH 1PFNA 4O1NA 4KMUC 3K58A 4ZK9B 4Y52H 1UAPA 1VQPA 4GNXC 4OL7A 4XT3B 3PF4A 3PUVA 5KNCA 1YJWA 3BS1A 4IQZA 1K83B 3CQZH 3H3VH 4DV3L 3W1BA 3E0JA 3I72A 4A3KH 4L5TA 2JSOA 2UUAQ 2B2WC 2BH8A 1BBUA 1IKMA 2IW3A 3BZCA 4YCWA 2WINB 4IUQA 4CBVA 4JV5L 5F2DA 3NTHA 2SDFA 2JEBI 2DUDA 3E0EA 3KK7A 2ICIA 4A3BH 3S15B 3M3YB 1SRUA 2AQ3B 2K01A 1OXSC 5C5MA 1B9MA 5KIXA 3S17H 4RCNA 2KHJA 2UUCQ 1HA6A 2A68D 3FRPB 3D4DA 1GUNA 4C1NI 4JI4Q 4LMQD 3DHQA 4K6LA 3KF8B 3UE1A 1E3PA 1SYEA 5JJLA 4OELB 1A2TA 2H4OA 3SE0A 2CH4A 1I4HA 1MBYA 1AE3A 1TWHH 2JA8H 4KHPL 3QO2A 1HUNA 1HTLD 5FO8B 3H3VC 3K80C 4H02A 1T5XD 3OYYA 1MJEA 2EQSA 2B2VA 3OMGA 1N32L 2R93B 4LF4L 2NVTB 4A3FB 1HRJA 5ELBA 4IUTA 4FF2A 2IHEA 1I6VC 2OQ0A 1RL2A 3KF6B 2F0DA 3OSOA 5C4XH 1YVCA 5AFWA 1EUJA 3GTMH 2I0QA 1OXVA 3NHHA 2RDHA 2WKCA 2I5LX 3PIP3 1E1TA 2E2JB 3S24A 3WOFA 1QNKA 1HQMC 2BA1A 3P1HA 2HUGA 4NXML 4DF7A 3GTJB 4A75A 4L5RC 1JOOA 1U0LA 1V1PB 4KLKA 4BWGB 1HFNA 4C3JH 4K5WA 3N6RA 3PSIA 1E2VA 2JA9A 2JEAI 4QUCA 4UP8A 1H9KA 5C44G 2L12A 1YITA 1BOSA 1CT1D 5JJZA 1MKHA 2NTSA 2KEDA 3WDNA 2K6AA 2XRQD 2PO4A 1KAWA 5I6YA 1CK1A 2NZHA 1PYSB 2MO1A 1EY4A 5EPJA 2HT1A 1L1OA 2KECA 5CBEE 4IUPA 2RSOA 3ND8A 3NSWA 4KJOA 1PMRA 4MIUA 3H0GB 4A76A 5JVH3 3DEOA 2EJMA 4DN4M 2YTVA 2DY8A 1VMPA 4V0BA 1PXUA 3I91A 4QGUA 1VQHA 4CDEC 4GNXB 2JK8A 1XMOQ 5C4HA 5ELNA 2EZVA 1EWCA 1OXUA 3DLLA 1IBML 1C8CA 4F8MA 4RWSC 4JI5Q 1XMQL 1CQVA 4BBRB 4A3GB 4GLVB 1OXXK 2MHVA 2A68C 3OMCA 5KYLA 4DAYB 2MP1A 1NMGA 3G48A 4A3IG 4K2KA 3HOZH 3GTLB 2F4IA 4OHJA 1UWVA 1BBXC 1Y8PB 2XSCA 1S5DD 3K5NA 3UDIA 4WORA 3ULJA 1VQ4A 2YU9H 3M4YA 4XT1B 4OONA 3L9AX 4IUVA 4JOIA 4CGYB 5DNFA 5M5XB 2QF7A 1VQ6A 2R7ZG 2X6GA 3G6JB 1BQQT 4TKOB 2E2IB 2ICEC 1QUQB 1SE4A 1WCMB 3J80L 1OO9B 4OGQC 3IAYA 3BVGA 3NBIA 5LL6S 1SNOA 4OIJA 4K0KQ 3PO2B 1M8AA 3CCJA 5I9OA 2R93G 1PRTD 3RZDH 4B3TQ 4DR2L 1Y14B 4LF5Q 3NPPA 3C1FA 3U9SA 2BE5D 1X56A 3GTQH 2K04A 1PTOH 1WVLA 1C0AA 5FOBB 2Q8IB 5EAYA 1G291 4B9WA 3J81c 2HHHQ 3I90A 4PQXA 3CF5A 1JMCA 4G7ZC 3PO3H 3ERSX 5K5PA 5C4JB 3TS0A 1Q12A 2PZWA 1SYDA 3J81j 1ASZA 3CCRA 5EKLA 1OXTA 4QY7A 1QZGA 1LT5D 3A7AB 3J7AF 3HOYB 1S5FD 5C0XI 3DWPA 3OOCA 1I94L 1NMFA 2A69D 2JA7B 1SMYC 4IUUA 3S14B 5CV8A 1WI5A 4MNOA 2PW7A 4YCUA 5FO7B 1U5KA 5ELFA 2NVYB 3SR1A 2YYZA 2A74C 2UXCL 2B2WA 2F0HA 1BUVT 1CM9A 1EYCA 3HOXG 1XYIA 1LT4D 4FXKC 2KCMA 4DV0L 1KDAA 1XNRQ 2XIWA 5IGGA 1B1ZA 4P2CB 2KJXA 1PTOC 3FP9A 3WWVA 4B3SL 4JI2Q 4WRDA 5C4ZA 3PGZA 3HEJA 3HKZG 1STEA 3X3NA 3BU2A 3RMHA 4P74A 5I2XA 4DR4Q 1YNXA 2A19A 2F3VA 2B2YA 4HCSA 5LMNW 1BR9A 4DV4Q 3GTPB 4A3GG 5JAVA 1SXTA 1NUCA 3FEWX 2F0TA 1TWFB 3IRBA 1DCZA 2Z4IA 4NMZA 3KDFA 2ZM6Q 2Q2UA 3OHXC 1QB5D 1SE8A 1VQKA 4IN3A 4B3MQ 3GTKH 4RGOS 1MIUA 1K0RA 1HZCA 1N9WA 4KD4A 3EBEA 3Q22A 5DLQE 4UPAA 5IP7G 2VZAA 3S2HH 1LUZA 1JR0D 3A7LA 4MN3A 2F0QA 2UXDL 2K4KA 1WCMG 1VQGA 2IWHA 3TP6A 1FNVA 5CV5A 3H3VI 4NP5A 1NR2A 3G71A 3PO2G 2JQOA 1JWSD 5D3IB 5C3EH 1CHQD 2RCFA 3MA2B 4O0AA 1GUOA 5AJ3L 1LTAD 2QEJC 4XQNA 4K8IA 4XYOA 4DV5L 1RODA 1R9TB 1I4GA 2F0EA 3SXHA 3JAME 5KYIA 4CJ0B 3SK4A 4X62L 1C9OA 5T1IA 2QILA 2BDNA 4YHHQ 1QVCA 2O5IC 4OWTB 3BYYB 4UDUC 2F0NA 3F2DA 3S1MB 3K7UC 3UDFA 5H1SE 4HN7A 1YNND 3OW2A 2PZUA 1LTGD 2BOSA 1NCVA 2QGQA 3FPPA 1K3RA 1KD1C 2WB1E 4K5XA 1DOKA 1ML0D 3HOYG 1BDOA 4Q5VA 1F9PA 2JA7G 4BS9A 3SVMA 2KHSA 3K7AH 5HGQA 4L8JA 1K0SA 1TWGB 1VF7A 2O4XA 1A8VA 1OTCA 4X66Q 4LUZA 4MTNA 4N9TA 5JJKA 1HNZL 1R4QB 2B2VC 2G9HD 2JA6G 4PMBA 1QCBD 3GQBA 1EFID 1E24A 3VYTA 2OWOA 1WYDA 1A3UA 1SNQA 3HOUG 1Q8IA 4LAAA 3DWQA 2GVBA 1CKMA 5LL6X 5JEAG 4G7HC 2Q2IA 3HOVB 4CHTB 1EYDA 1LTLA 3FKIG 3G7LA 4BBSB 1K83H 4AQYL 3GV3A 1G6PA 4NW2A 5J39A 2VQEL 4CJ1B 1AN8A 5BN5A 1YNJC 1TU2B 4DUYQ 4DAMA 4QCLA 4A3MB 4C1NK 2Z4HA 2R3ZA 4HSVA 5IT9L 2WFWA 1B50A 1NNXA 2QEXA 5DAUA 3M3YH 3BDLA 1WTOA 1FJGQ 2SEBD 3I4MH 4A3IH 3P75A 4DK1A 4OO1H 4JI7L 2WAQB 3Q6SA 4CKCA 1JJGA 4DR7L 2EYOA 1WD1A 4DR6Q 1B4OA 2I07B 4QMGA 2K32A 4IFDG 1AP0A 1X54A 5J22A 1L1OC 1MD2D 5J1ZA 5D14A 2B2UC 1EU4A 1ICWA 2R92B 4FXDA 1KDCA 1ONLA 1X6OA 2R7ZH 4EGVA 1WFQA 2GVAA 2LY7A 2N8NA 3R3OA 2NB0A 4JBKA 3LWUA 2N3SA 2L11A 4GLXA 1V8QA 4IUNA 1PRTB 4ZUJA 4AH6A 4ZLTF 5LMUL 1PH9A 1EY9A 1VDZA 1WTVA 1EOTA 1GO3E 1PRTF 1N8RC 1SEBD 1M90C 1JJCB 4AYBB 1U4PA 2L55A
chains in the Genus database with same CATH topology
1WOCA 3I56A 3UE1A 3KF8B 1E3PA 3MXNB 4JV5Q 4LF5L 4R4CA 5JJLA 1TWCH 5J3BA 5M3MG 2QA4A 4A3BG 4LFBL 4P73A 2WP8J 1IBLQ 2UXDQ 1S72A 1PH7A 2ZJQA 3S1RH 1AE3A 1TWHH 5LMUQ 1RIPA 2JA8H 4KHPL 1VQEA 1TWGH 2PI2A 4UP9A 4OWWB 2Y0SG 3K80C 2HHHL 4H02A 3OYYA 2E5LQ 3PUXA 4P75A 1EQRA 4QL5A 1MJEA 4BY1G 2EQSA 3CCUA 3J80c 2UU9L 1N32L 2WAQE 3CPWA 4LF4L 5AJ3Q 5BR8Q 1KC8C 3E9HA 2IHEA 3HKSA 5M5YH 3S1NH 2OQ0A 1RL2A 1UE6A 3KF6B 5FLMG 1LYLA 5C44H 1CKOA 1PH6A 4LFBQ 2OCEA 5C4XH 1YVCA 4DV5Q 2UUBQ 1EUJA 2L15A 3GTMH 4DKAC 2I0QA 1OXVA 1KXLA 2R6GA 2JA8G 3J7A5 3CCLA 2I5LX 4X62Q 4JI6L 3HOVH 4DV6L 3GTGH 1B70B 1E1TA 3S24A 2UXBQ 4BBSH 2FXQA 1Y1VG 3K8AA 2BA1A 3PV0A 3CXCA 4NXML 1XJVA 4L5RC 4A75A 5IYDH 3T1HL 1U0LA 4KLKA 1PH2A 4C3JH 4LF4Q 3HOXH 1O7IA 2A8VA 4A3MH 3PSIA 2ID0A 2MFIA 3CAMA 5HY6A 4LWCA 1HZ9A 3S2DH 2JA9A 2JEAI 4FDBA 4X6AH 2A1AA 4UP8A 4AYBE 1XNRL 5C44G 1YITA 4A3CH 5C4XG 2JJQA 4LNQA 3KYHC 3RN2A 1MKHA 4GNXA 1NJIC 1H95A 2F4VL 3TRZA 4JBWA 1KAWA 1PV4A 1XMOL 1YJ9A 1EIFA 4BBSG 2NZHA 1PYSB 4NXMQ 2MO1A 3DM3A 5IYDG 3AEVA 2HT1A 1L1OA 2KCTA 2K52A 1E7ZA 5M5WH 1VQMA 4NXNL 2VQFL 4DR4L 4JI5L 4JG2A 1HNZQ 4PZ6A 5IYCH 3S16H 3NBHB 3STBC 4HIDA 3RNUA 1VQJA 4DV4L 2R92H 3ER0A 3T1YQ 3A5UA 4A76A 1P16A 1Q8KA 3KOJA 4C3IH 4HJ7A 1XPRA 1ASYA 4A3CG 2YTVA 4L5SA 2ASBA 3S15H 2R7DA 2RHSB 4JI1Q 4APVA 4QGUA 1VQHA 1PYBA 4GNXB 1X3GA 3STBD 1YI2A 2JK8A 2WAQG 3NELA 5ELNA 3CC7A 4UP7A 1XMOQ 1E1OA 1K73C 1M1KC 1GM5A 1V43A 4IOAA 2VL6A 3KJPA 1OXUA 3DLLA 1IBML 2AKWB 4A3DG 2PMZE 2D0PA 3J7ZC 2HQLA 2PQAA 4JI5Q 3I2ZA 1XMQL 3M4OH 1L1OB 2OQKA 2C35B 3OTOL 4C3HH 5IP7H 3CMEA 4OX9L 1PHJA 2I5MX 5IY0A 2CCZA 4YWLA 3L0OA 3CD6A 4IPCA 3L2PA 1WJJA 2PI2E 1QUQA 3AFPA 4GLVB 1Q81C 2E2IH 1OXXK 1A62A 3A5ZB 4LFCL 4R4OA 4DAYB 1T9HA 1WCMH 4JI3L 1NMGA 3G48A 2BA0A 4A3IG 4GN4B 3SGIA 1Y1WH 4JBMA 4JI0Q 1NE3A 5M3FG 3HOZH 3F8TA 4IJHA 4NB3A 5IP9H 3RZOH 1UWVA 1HNXL 1NY4A 3JAMc 1IBMQ 1MJCA 4IO9A 4DR7Q 4HJAA 1HZBA 2E2HH 3UDIA 4AYBG 3ULJA 1VQ4A 2YU9H 2KENA 3JC66 4K0KL 4DV3Q 4OONA 2K5NA 4A3KG 3OTOQ 1I5FA 5LMNL 1D8LA 4NPSA 4JOIA 1J5EL 2NVTH 2YTXA 4A3FH 2F3IA 4B3TL 4OX9Q 1BVSA 1XPUA 4A3EH 2ALYB 1VQ6A 2R7ZG 4LFCQ 3A0JA 1DGSA 1CSPA 2EIFA 4HIKA 1HR0L 3PUZA 4BY7G 1GKHA 3D31A 1QUQB 3M4PA 4PG3A 4RMFA 4A4IA 1VQ7A 1Y1WG 4QJFA 5GAGC 1BKBA 3M85A 1X3FA 2RCNA 1PH3A 1HNXQ 2GN5A 1CKNA 2E2JH 4LF6L 2CWAA 1KIXA 4LUOA 4GKKL 1V1QA 4K0KQ 5GAEC 3GTJH 1CUKA 2IT1A 2NN6I 3KJOA 3CCJA 1YJNA 2ZTDA 5GROA 4A3JH 5LMNQ 2R93G 1K8GA 5E7NA 3RZDH 4B3TQ 1KL9A 4TVAB 4LF7L 4MZ9A 4A3EG 2K50A 4DR2L 2YV5A 1Y14B 4LF5Q 3CCVA 3CW2C 4BA2I 3HKZE 1X9NA 2XGTA 3HOYH 3E9IA 3K81C 5GAHC 1HR0Q 1UE1A 1E22A 4DR1L 2IX0A 3PIOA 1IZ6A 1X65A 4WJ3M 2HIXA 1X56A 1CSQA 3GTQH 4IPGA 3CP0A 2YTYA 4JC0A 1NTGA 1FVIA 3PF5A 4LF6Q 4GKJL 4BXXH 1GD7A 4KHPQ 1C0AA 2Q2TA 4A93H 5EAYA 2VUMH 3PUWA 1G291 3J81c 2HHHQ 4B3RL 1CKNB 3CF5A 1JMCA 3I55A 4A3JG 3PO3H 4X66L 3ERSX 2UU9Q 3TS0A 4YCVA 1N32Q 1Q12A 2K5HA 2RHQB 3J81j 1ASZA 1BBWA 4EQ5A 3CCRA 1OXTA 4POFA 4QY7A 3H0GH 2JA6H 1B8AA 1JT8A 2EXDA 3EIVA 5FJ8H 1EIYB 1SLJA 1TWAH 4R4TA 1QZGA 1PH5A 1I50H 2D62A 1XNQL 1SMXA 3HOUH 4KHZA 3GO5A 5C0XI 1PH1A 1I94L 1NMFA 3ULLA 3CC2A 4GKJQ 1YHQA 4JI2L 4JI6Q 1WI5A 4MNOA 1KHIA 3RLNA 3HOVG 4A93G 4DV6Q 3FKIH 2ZTEA 4DV2L 2ZJPA 4DR3L 1EOVA 3U58A 3PUYA 4YCUA 3J80i 2B3GA 3U4VA 4GOPC 1U5KA 1TXYA 3CC4A 3U50C 1IL2A 3PO3G 4JYAL 4AIMA 3T1HQ 4QQBX 2YYZA 2KBNA 4DV1L 2AMCB 2UXCL 1IBKL 1EWIA 3HOXG 4A3MG 4BBRH 3ICEA 4YWMA 4RG1A 3KLWA 2KCMA 4A3GH 4DV0L 1XNRQ 4R4QA 1NBWA 4BA1I 1XNQQ 1HH2P 3UE0A 2IX1A 2CFMA 2MQHA 1I94Q 2VNUD 3FP9A 2V1CC 2Q2HA 3WWVA 2F4VQ 3GTLH 4B3SL 4HIOA 2RF4A 4JI2Q 3U4ZA 2ZM6L 4DV2Q 1SROA 2VUMG 2H5XA 3W1GA 4DR6L 1S3OA 4P72A 3PGZA 4XTCS 3MEFA 3HKZG 1N34L 4JYAQ 4B3ML 2OTJA 3BU2A 4IJLA 2VY3A 4P74A 4DR4Q 4NXNQ 2VQFQ 1YNXA 2A19A 2K14A 5IYCG 5LMNW 1YIJA 2R92G 4DV4Q 5M5XH 5GADC 4A3GG 3RLOA 4UY8C 4DV0Q 1QVFA 2E8GA 3BJUA 1IXRA 1VQCA 1I3QH 1L0WA 1K8AC 2N78A 1Z47A 3CCSA 1KRSA 4DR5L 3I4OA 1QZHA 4YY3L 2D0OA 1W2BA 3IRBA 1JJ2A 1YEZA 4Y7NH 1HR0W 3Q8DA 3PCOB 2ZTCA 5IT9c 3KDFA 2ZM6Q 2LXJA 1Q86C 1VQ5A 2Q2UA 3GD7A 2WB1G 1FL0A 4POGA 4IFDI 2UUCL 1SE8A 3TQYA 5IE8A 1D7QA 1VQKA 1N34Q 3PO2H 4B3MQ 3GTKH 1PFSA 4XIGS 4IOCA 2MO0A 1MIUA 1K0RA 1N9WA 1HZCA 1XMQQ 1VS0A 3EBEA 4HJ5A 3I4NH 4X65L 1QVGA 3AFQA 5DLQE 4LFAL 4UPAA 5IP7G 2VZAA 3S2HH 2B29A 2PQAB 2VW9A 4DNIA 1LUZA 3HOWH 4WJ4A 1L2FA 5M3MH 4DR5Q 4YY3Q 1VQFA 4L5QA 1VQLA 2NVQH 1IYJB 4OO1I 4J15A 5C0XJ 1IBLL 1X55A 2UXDL 1W3SA 2K4KA 3F2BA 3UDGA 1WCMG 1VQGA 1S40A 4X64L 4JI3Q 4ALPA 1VQDA 3HOZG 5K36G 2NVXH 3H3VI 5IP9G 1PVOA 4LUVA 2LSSA 2IY5B 1YHBA 3KDFB 3G71A 4OXPA 4YHHL 2PNHA 1Q46A 1EFWA 3PO2G 2JQOA 3A74A 3TREA 2CKZB 4BY1H 4EX5A 1PH8A 5C3EH 5C4JH 4DV7L 4IPDA 4X65Q 1N36L 1J5EQ 2Z6KC 3KF6A 4LFAQ 2NN6G 4O0AA 1K9MC 4A3FG 1AE2A 4GN3B 5AJ3L 5BR8L 1VQ9A 4JI8L 1I6HH 3HOWG 1VQOA 2AHOB 4HJ8A 2B63H 4PZ7A 5FLMH 1G51A 1SN8A 5JEAJ 1VCIA 4DPGA 3F2CA 2N49A 2K5VA 4DV5L 2UUBL 4X64Q 1A63A 2JA7H 3JAMi 3S14H 1UE7A 2IHFA 1VQIA 4X62L 5JJIA 1C9OA 3NEMA 4DK3C 2XTIA 1V9PA 1Y1VH 4YHHQ 1QVCA 4GOPA 5GQOA 4OWTB 4GKKQ 2UXBL 4TQUS 2NVYH 3F2DA 3K7UC 3UDFA 5C3EG 4DV7Q 5H1SE 4JI0L 3B6YA 4LF8L 1N36Q 3OW2A 1YHAA 4PZ8A 2QGQA 4JOIC 1K3RA 1Q1EA 4JCVE 2WB1E 4JI8Q 1KD1C 1EYGA 4LF7Q 1HNWL 4DR2Q 2B63G 1UEBA 4DUZL 3M7NA 2Z0SA 3I7FA 3HOYG 3FHWA 2AWNA 3M4QA 3L7ZC 1SR3A 1UE5A 5IYBH 4DR1Q 2DGYA 5IWAL 2MNAA 2JA7G 3RR5A 3W5OA 3ULPA 3K7AH 1XPOA 1PH4A 5C0XG 4IPHA 5HGQA 1VQ8A 4BXXG 3CMAA 3M9BA 4GS3A 2ZJRA 2BH2A 4A3LH 4B3RQ 3CCEA 3LGJA 2K75A 4GOPB 4ME3A 1EQQA 4LF8Q 1A8VA 1OTCA 4X66Q 1P8LA 4LUZA 4LW1A 4MTNA 1YZ6A 5FLXc 5JJKA 1HNZL 1LM0A 2LXKA 1VQBA 4JBJA 4QIWE 1KQSA 1JB7A 4LF9Q 1HNWQ 4DUYL 3GTPH 1FGUA 3VDYA 4DUZQ 3H0GG 4KI0A 2AWOA 2I5HA 4R1JA 3T1YL 4C2MH 2JA6G 5FJ8G 3D0FA 3GTOH 1E24A 3EN2A 5ELOA 4YWKA 1TWFH 1WYDA 2OWOA 5IYBG 2OTLA 4JI1L 1FJGL 3G6EA 5IWAQ 1N33L 1C7YA 3HOUG 2JA5H 3KFUA 1YBYA 1HJPA 4GN5A 1A0IA 2GVBA 1CKMA 1VQAA 5JEAG 3RLFA 1AH9A 2Q2IA 3J81i 2KHIA 3ZJYC 4HIMA 1LTLA 3FKIG 4DR3Q 4A3LG 1K83H 2CQOA 4AQYL 4A3DH 1G6PA 1HZAA 1Q7YC 2VQEL 4GLAC 4DV1Q 1J6QA 2ES2A 2UXCQ 1IBKQ 4DUYQ 2HIVA 4DAMA 3G4SA 2UUAL 4BBRG 4HJ9A 3CPFA 3F1ZA 2Y0SE 2WFWA 1SFOH 3AYHB 4LF9L 1Q82C 2QEXA 1PA6A 3M3YH 3AQQA 1Z9FA 1FJGQ 4Y52H 1N33Q 2JA5G 3I4MH 1VQPA 4A3IH 4GNXC 3TS2A 4OWXB 5M3FH 4B3SQ 4JI7L 3BZKA 3H15A 3PF4A 2VS1A 2NZOA 3RN5A 3PUVA 4AQYQ 4DR7L 4DR6Q 1YJWA 1JJGA 3NENA 3CQZH 3H3VH 3K0XA 4DV3L 2VQEQ 4IFDG 1X54A 3W1BA 2Z6KA 4A3KH 1L1OC 2R7FA 3CCMA 1JE5A 4R4IA 4JI4L 4L5TA 2UUAQ 2BH8A 1BBUA 4O2DA 4YCWA 3BZCA 2CWPA 4P71A 3PIPA 1X3EA 1X6OA 4IFDJ 2R7ZH 4JV5L 2JE6I 1WFQA 2JEBI 2DUDA 3E0EA 2GVAA 2ATWA 1R9TH 2N8NA 4BY7H 4A3BH 3GDEA 3I4MG 4DK6C 4JBKA 1SRUA 3S1QH 2N3SA 3HFZB 2R93H 1OXSC 1VQNA 4GLXA 4JI7Q 4OO1G 3S17H 1PH9A 4AH6A 4PMWA 5LMUL 1Q1BA 3TEHB 2KHJA 2UUCQ 1XTDA 1GO3E 1N8RC 1M90C 3CCQA 1JJCB 3S1MH 2F52A 2E5LL 1GVPA 1B7YB 4JI4Q 3UDXA 1KRTA 3I4NG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOC A;  3I56 A;  3UE1 A;  3KF8 B;  1E3P A;  3MXN B;  4JV5 Q;  4LF5 L;  4R4C A;  5JJL A;  1TWC H;  5J3B A;  5M3M G;  2QA4 A;  4A3B G;  4LFB L;  4P73 A;  2WP8 J;  1IBL Q;  2UXD Q;  1S72 A;  1PH7 A;  2ZJQ A;  3S1R H;  1AE3 A;  1TWH H;  5LMU Q;  1RIP A;  2JA8 H;  4KHP L;  1VQE A;  1TWG H;  2PI2 A;  4UP9 A;  4OWW B;  2Y0S G;  3K80 C;  2HHH L;  4H02 A;  3OYY A;  2E5L Q;  3PUX A;  4P75 A;  1EQR A;  4QL5 A;  1MJE A;  4BY1 G;  2EQS A;  3CCU A;  3J80 c;  2UU9 L;  1N32 L;  2WAQ E;  3CPW A;  4LF4 L;  5AJ3 Q;  5BR8 Q;  1KC8 C;  3E9H A;  2IHE A;  3HKS A;  5M5Y H;  3S1N H;  2OQ0 A;  1RL2 A;  1UE6 A;  3KF6 B;  5FLM G;  1LYL A;  5C44 H;  1CKO A;  1PH6 A;  4LFB Q;  2OCE A;  5C4X H;  1YVC A;  4DV5 Q;  2UUB Q;  1EUJ A;  2L15 A;  3GTM H;  4DKA C;  2I0Q A;  1OXV A;  1KXL A;  2R6G A;  2JA8 G;  3J7A 5;  3CCL A;  2I5L X;  4X62 Q;  4JI6 L;  3HOV H;  4DV6 L;  3GTG H;  1B70 B;  1E1T A;  3S24 A;  2UXB Q;  4BBS H;  2FXQ A;  1Y1V G;  3K8A A;  2BA1 A;  3PV0 A;  3CXC A;  4NXM L;  1XJV A;  4L5R C;  4A75 A;  5IYD H;  3T1H L;  1U0L A;  4KLK A;  1PH2 A;  4C3J H;  4LF4 Q;  3HOX H;  1O7I A;  2A8V A;  4A3M H;  3PSI A;  2ID0 A;  2MFI A;  3CAM A;  5HY6 A;  4LWC A;  1HZ9 A;  3S2D H;  2JA9 A;  2JEA I;  4FDB A;  4X6A H;  2A1A A;  4UP8 A;  4AYB E;  1XNR L;  5C44 G;  1YIT A;  4A3C H;  5C4X G;  2JJQ A;  4LNQ A;  3KYH C;  3RN2 A;  1MKH A;  4GNX A;  1NJI C;  1H95 A;  2F4V L;  3TRZ A;  4JBW A;  1KAW A;  1PV4 A;  1XMO L;  1YJ9 A;  1EIF A;  4BBS G;  2NZH A;  1PYS B;  4NXM Q;  2MO1 A;  3DM3 A;  5IYD G;  3AEV A;  2HT1 A;  1L1O A;  2KCT A;  2K52 A;  1E7Z A;  5M5W H;  1VQM A;  4NXN L;  2VQF L;  4DR4 L;  4JI5 L;  4JG2 A;  1HNZ Q;  4PZ6 A;  5IYC H;  3S16 H;  3NBH B;  3STB C;  4HID A;  3RNU A;  1VQJ A;  4DV4 L;  2R92 H;  3ER0 A;  3T1Y Q;  3A5U A;  4A76 A;  1P16 A;  1Q8K A;  3KOJ A;  4C3I H;  4HJ7 A;  1XPR A;  1ASY A;  4A3C G;  2YTV A;  4L5S A;  2ASB A;  3S15 H;  2R7D A;  2RHS B;  4JI1 Q;  4APV A;  4QGU A;  1VQH A;  1PYB A;  4GNX B;  1X3G A;  3STB D;  1YI2 A;  2JK8 A;  2WAQ G;  3NEL A;  5ELN A;  3CC7 A;  4UP7 A;  1XMO Q;  1E1O A;  1K73 C;  1M1K C;  1GM5 A;  1V43 A;  4IOA A;  2VL6 A;  3KJP A;  1OXU A;  3DLL A;  1IBM L;  2AKW B;  4A3D G;  2PMZ E;  2D0P A;  3J7Z C;  2HQL A;  2PQA A;  4JI5 Q;  3I2Z A;  1XMQ L;  3M4O H;  1L1O B;  2OQK A;  2C35 B;  3OTO L;  4C3H H;  5IP7 H;  3CME A;  4OX9 L;  1PHJ A;  2I5M X;  5IY0 A;  2CCZ A;  4YWL A;  3L0O A;  3CD6 A;  4IPC A;  3L2P A;  1WJJ A;  2PI2 E;  1QUQ A;  3AFP A;  4GLV B;  1Q81 C;  2E2I H;  1OXX K;  1A62 A;  3A5Z B;  4LFC L;  4R4O A;  4DAY B;  1T9H A;  1WCM H;  4JI3 L;  1NMG A;  3G48 A;  2BA0 A;  4A3I G;  4GN4 B;  3SGI A;  1Y1W H;  4JBM A;  4JI0 Q;  1NE3 A;  5M3F G;  3HOZ H;  3F8T A;  4IJH A;  4NB3 A;  5IP9 H;  3RZO H;  1UWV A;  1HNX L;  1NY4 A;  3JAM c;  1IBM Q;  1MJC A;  4IO9 A;  4DR7 Q;  4HJA A;  1HZB A;  2E2H H;  3UDI A;  4AYB G;  3ULJ A;  1VQ4 A;  2YU9 H;  2KEN A;  3JC6 6;  4K0K L;  4DV3 Q;  4OON A;  2K5N A;  4A3K G;  3OTO Q;  1I5F A;  5LMN L;  1D8L A;  4NPS A;  4JOI A;  1J5E L;  2NVT H;  2YTX A;  4A3F H;  2F3I A;  4B3T L;  4OX9 Q;  1BVS A;  1XPU A;  4A3E H;  2ALY B;  1VQ6 A;  2R7Z G;  4LFC Q;  3A0J A;  1DGS A;  1CSP A;  2EIF A;  4HIK A;  1HR0 L;  3PUZ A;  4BY7 G;  1GKH A;  3D31 A;  1QUQ B;  3M4P A;  4PG3 A;  4RMF A;  4A4I A;  1VQ7 A;  1Y1W G;  4QJF A;  5GAG C;  1BKB A;  3M85 A;  1X3F A;  2RCN A;  1PH3 A;  1HNX Q;  2GN5 A;  1CKN A;  2E2J H;  4LF6 L;  2CWA A;  1KIX A;  4LUO A;  4GKK L;  1V1Q A;  4K0K Q;  5GAE C;  3GTJ H;  1CUK A;  2IT1 A;  2NN6 I;  3KJO A;  3CCJ A;  1YJN A;  2ZTD A;  5GRO A;  4A3J H;  5LMN Q;  2R93 G;  1K8G A;  5E7N A;  3RZD H;  4B3T Q;  1KL9 A;  4TVA B;  4LF7 L;  4MZ9 A;  4A3E G;  2K50 A;  4DR2 L;  2YV5 A;  1Y14 B;  4LF5 Q;  3CCV A;  3CW2 C;  4BA2 I;  3HKZ E;  1X9N A;  2XGT A;  3HOY H;  3E9I A;  3K81 C;  5GAH C;  1HR0 Q;  1UE1 A;  1E22 A;  4DR1 L;  2IX0 A;  3PIO A;  1IZ6 A;  1X65 A;  4WJ3 M;  2HIX A;  1X56 A;  1CSQ A;  3GTQ H;  4IPG A;  3CP0 A;  2YTY A;  4JC0 A;  1NTG A;  1FVI A;  3PF5 A;  4LF6 Q;  4GKJ L;  4BXX H;  1GD7 A;  4KHP Q;  1C0A A;  2Q2T A;  4A93 H;  5EAY A;  2VUM H;  3PUW A;  1G29 1;  3J81 c;  2HHH Q;  4B3R L;  1CKN B;  3CF5 A;  1JMC A;  3I55 A;  4A3J G;  3PO3 H;  4X66 L;  3ERS X;  2UU9 Q;  3TS0 A;  4YCV A;  1N32 Q;  1Q12 A;  2K5H A;  2RHQ B;  3J81 j;  1ASZ A;  1BBW A;  4EQ5 A;  3CCR A;  1OXT A;  4POF A;  4QY7 A;  3H0G H;  2JA6 H;  1B8A A;  1JT8 A;  2EXD A;  3EIV A;  5FJ8 H;  1EIY B;  1SLJ A;  1TWA H;  4R4T A;  1QZG A;  1PH5 A;  1I50 H;  2D62 A;  1XNQ L;  1SMX A;  3HOU H;  4KHZ A;  3GO5 A;  5C0X I;  1PH1 A;  1I94 L;  1NMF A;  3ULL A;  3CC2 A;  4GKJ Q;  1YHQ A;  4JI2 L;  4JI6 Q;  1WI5 A;  4MNO A;  1KHI A;  3RLN A;  3HOV G;  4A93 G;  4DV6 Q;  3FKI H;  2ZTE A;  4DV2 L;  2ZJP A;  4DR3 L;  1EOV A;  3U58 A;  3PUY A;  4YCU A;  3J80 i;  2B3G A;  3U4V A;  4GOP C;  1U5K A;  1TXY A;  3CC4 A;  3U50 C;  1IL2 A;  3PO3 G;  4JYA L;  4AIM A;  3T1H Q;  4QQB X;  2YYZ A;  2KBN A;  4DV1 L;  2AMC B;  2UXC L;  1IBK L;  1EWI A;  3HOX G;  4A3M G;  4BBR H;  3ICE A;  4YWM A;  4RG1 A;  3KLW A;  2KCM A;  4A3G H;  4DV0 L;  1XNR Q;  4R4Q A;  1NBW A;  4BA1 I;  1XNQ Q;  1HH2 P;  3UE0 A;  2IX1 A;  2CFM A;  2MQH A;  1I94 Q;  2VNU D;  3FP9 A;  2V1C C;  2Q2H A;  3WWV A;  2F4V Q;  3GTL H;  4B3S L;  4HIO A;  2RF4 A;  4JI2 Q;  3U4Z A;  2ZM6 L;  4DV2 Q;  1SRO A;  2VUM G;  2H5X A;  3W1G A;  4DR6 L;  1S3O A;  4P72 A;  3PGZ A;  4XTC S;  3MEF A;  3HKZ G;  1N34 L;  4JYA Q;  4B3M L;  2OTJ A;  3BU2 A;  4IJL A;  2VY3 A;  4P74 A;  4DR4 Q;  4NXN Q;  2VQF Q;  1YNX A;  2A19 A;  2K14 A;  5IYC G;  5LMN W;  1YIJ A;  2R92 G;  4DV4 Q;  5M5X H;  5GAD C;  4A3G G;  3RLO A;  4UY8 C;  4DV0 Q;  1QVF A;  2E8G A;  3BJU A;  1IXR A;  1VQC A;  1I3Q H;  1L0W A;  1K8A C;  2N78 A;  1Z47 A;  3CCS A;  1KRS A;  4DR5 L;  3I4O A;  1QZH A;  4YY3 L;  2D0O A;  1W2B A;  3IRB A;  1JJ2 A;  1YEZ A;  4Y7N H;  1HR0 W;  3Q8D A;  3PCO B;  2ZTC A;  5IT9 c;  3KDF A;  2ZM6 Q;  2LXJ A;  1Q86 C;  1VQ5 A;  2Q2U A;  3GD7 A;  2WB1 G;  1FL0 A;  4POG A;  4IFD I;  2UUC L;  1SE8 A;  3TQY A;  5IE8 A;  1D7Q A;  1VQK A;  1N34 Q;  3PO2 H;  4B3M Q;  3GTK H;  1PFS A;  4XIG S;  4IOC A;  2MO0 A;  1MIU A;  1K0R A;  1N9W A;  1HZC A;  1XMQ Q;  1VS0 A;  3EBE A;  4HJ5 A;  3I4N H;  4X65 L;  1QVG A;  3AFQ A;  5DLQ E;  4LFA L;  4UPA A;  5IP7 G;  2VZA A;  3S2H H;  2B29 A;  2PQA B;  2VW9 A;  4DNI A;  1LUZ A;  3HOW H;  4WJ4 A;  1L2F A;  5M3M H;  4DR5 Q;  4YY3 Q;  1VQF A;  4L5Q A;  1VQL A;  2NVQ H;  1IYJ B;  4OO1 I;  4J15 A;  5C0X J;  1IBL L;  1X55 A;  2UXD L;  1W3S A;  2K4K A;  3F2B A;  3UDG A;  1WCM G;  1VQG A;  1S40 A;  4X64 L;  4JI3 Q;  4ALP A;  1VQD A;  3HOZ G;  5K36 G;  2NVX H;  3H3V I;  5IP9 G;  1PVO A;  4LUV A;  2LSS A;  2IY5 B;  1YHB A;  3KDF B;  3G71 A;  4OXP A;  4YHH L;  2PNH A;  1Q46 A;  1EFW A;  3PO2 G;  2JQO A;  3A74 A;  3TRE A;  2CKZ B;  4BY1 H;  4EX5 A;  1PH8 A;  5C3E H;  5C4J H;  4DV7 L;  4IPD A;  4X65 Q;  1N36 L;  1J5E Q;  2Z6K C;  3KF6 A;  4LFA Q;  2NN6 G;  4O0A A;  1K9M C;  4A3F G;  1AE2 A;  4GN3 B;  5AJ3 L;  5BR8 L;  1VQ9 A;  4JI8 L;  1I6H H;  3HOW G;  1VQO A;  2AHO B;  4HJ8 A;  2B63 H;  4PZ7 A;  5FLM H;  1G51 A;  1SN8 A;  5JEA J;  1VCI A;  4DPG A;  3F2C A;  2N49 A;  2K5V A;  4DV5 L;  2UUB L;  4X64 Q;  1A63 A;  2JA7 H;  3JAM i;  3S14 H;  1UE7 A;  2IHF A;  1VQI A;  4X62 L;  5JJI A;  1C9O A;  3NEM A;  4DK3 C;  2XTI A;  1V9P A;  1Y1V H;  4YHH Q;  1QVC A;  4GOP A;  5GQO A;  4OWT B;  4GKK Q;  2UXB L;  4TQU S;  2NVY H;  3F2D A;  3K7U C;  3UDF A;  5C3E G;  4DV7 Q;  5H1S E;  4JI0 L;  3B6Y A;  4LF8 L;  1N36 Q;  3OW2 A;  1YHA A;  4PZ8 A;  2QGQ A;  4JOI C;  1K3R A;  1Q1E A;  4JCV E;  2WB1 E;  4JI8 Q;  1KD1 C;  1EYG A;  4LF7 Q;  1HNW L;  4DR2 Q;  2B63 G;  1UEB A;  4DUZ L;  3M7N A;  2Z0S A;  3I7F A;  3HOY G;  3FHW A;  2AWN A;  3M4Q A;  3L7Z C;  1SR3 A;  1UE5 A;  5IYB H;  4DR1 Q;  2DGY A;  5IWA L;  2MNA A;  2JA7 G;  3RR5 A;  3W5O A;  3ULP A;  3K7A H;  1XPO A;  1PH4 A;  5C0X G;  4IPH A;  5HGQ A;  1VQ8 A;  4BXX G;  3CMA A;  3M9B A;  4GS3 A;  2ZJR A;  2BH2 A;  4A3L H;  4B3R Q;  3CCE A;  3LGJ A;  2K75 A;  4GOP B;  4ME3 A;  1EQQ A;  4LF8 Q;  1A8V A;  1OTC A;  4X66 Q;  1P8L A;  4LUZ A;  4LW1 A;  4MTN A;  1YZ6 A;  5FLX c;  5JJK A;  1HNZ L;  1LM0 A;  2LXK A;  1VQB A;  4JBJ A;  4QIW E;  1KQS A;  1JB7 A;  4LF9 Q;  1HNW Q;  4DUY L;  3GTP H;  1FGU A;  3VDY A;  4DUZ Q;  3H0G G;  4KI0 A;  2AWO A;  2I5H A;  4R1J A;  3T1Y L;  4C2M H;  2JA6 G;  5FJ8 G;  3D0F A;  3GTO H;  1E24 A;  3EN2 A;  5ELO A;  4YWK A;  1TWF H;  1WYD A;  2OWO A;  5IYB G;  2OTL A;  4JI1 L;  1FJG L;  3G6E A;  5IWA Q;  1N33 L;  1C7Y A;  3HOU G;  2JA5 H;  3KFU A;  1YBY A;  1HJP A;  4GN5 A;  1A0I A;  2GVB A;  1CKM A;  1VQA A;  5JEA G;  3RLF A;  1AH9 A;  2Q2I A;  3J81 i;  2KHI A;  3ZJY C;  4HIM A;  1LTL A;  3FKI G;  4DR3 Q;  4A3L G;  1K83 H;  2CQO A;  4AQY L;  4A3D H;  1G6P A;  1HZA A;  1Q7Y C;  2VQE L;  4GLA C;  4DV1 Q;  1J6Q A;  2ES2 A;  2UXC Q;  1IBK Q;  4DUY Q;  2HIV A;  4DAM A;  3G4S A;  2UUA L;  4BBR G;  4HJ9 A;  3CPF A;  3F1Z A;  2Y0S E;  2WFW A;  1SFO H;  3AYH B;  4LF9 L;  1Q82 C;  2QEX A;  1PA6 A;  3M3Y H;  3AQQ A;  1Z9F A;  1FJG Q;  4Y52 H;  1N33 Q;  2JA5 G;  3I4M H;  1VQP A;  4A3I H;  4GNX C;  3TS2 A;  4OWX B;  5M3F H;  4B3S Q;  4JI7 L;  3BZK A;  3H15 A;  3PF4 A;  2VS1 A;  2NZO A;  3RN5 A;  3PUV A;  4AQY Q;  4DR7 L;  4DR6 Q;  1YJW A;  1JJG A;  3NEN A;  3CQZ H;  3H3V H;  3K0X A;  4DV3 L;  2VQE Q;  4IFD G;  1X54 A;  3W1B A;  2Z6K A;  4A3K H;  1L1O C;  2R7F A;  3CCM A;  1JE5 A;  4R4I A;  4JI4 L;  4L5T A;  2UUA Q;  2BH8 A;  1BBU A;  4O2D A;  4YCW A;  3BZC A;  2CWP A;  4P71 A;  3PIP A;  1X3E A;  1X6O A;  4IFD J;  2R7Z H;  4JV5 L;  2JE6 I;  1WFQ A;  2JEB I;  2DUD A;  3E0E A;  2GVA A;  2ATW A;  1R9T H;  2N8N A;  4BY7 H;  4A3B H;  3GDE A;  3I4M G;  4DK6 C;  4JBK A;  1SRU A;  3S1Q H;  2N3S A;  3HFZ B;  2R93 H;  1OXS C;  1VQN A;  4GLX A;  4JI7 Q;  4OO1 G;  3S17 H;  1PH9 A;  4AH6 A;  4PMW A;  5LMU L;  1Q1B A;  3TEH B;  2KHJ A;  2UUC Q;  1XTD A;  1GO3 E;  1N8R C;  1M90 C;  3CCQ A;  1JJC B;  3S1M H;  2F52 A;  2E5L L;  1GVP A;  1B7Y B;  4JI4 Q;  3UDX A;  1KRT A;  3I4N G; 
#chains in the Genus database with same CATH topology
 1HTP A;  2CHB D;  4J6H A;  4CDF C;  3I56 A;  3IFT A;  4JV5 Q;  1MHW C;  2EYM A;  4R4C A;  1TWC H;  2XVS A;  4U68 A;  2NZ1 D;  1IBL Q;  1CTM A;  1S5C D;  1WTX A;  5EPL A;  3S1R H;  1RJT A;  2O2L D;  4UP9 A;  2MGS A;  4OWW B;  3QIA A;  2E2H B;  4M8A A;  3T16 A;  2DNE A;  1TS4 A;  2LFN A;  2F0V A;  5CMD A;  3E9H A;  3HKS A;  4A3E B;  3S1N H;  3TSS A;  1DJR D;  2OCE A;  2CW0 C;  2L15 A;  4DKA C;  1SYG A;  1ENA A;  4JI6 L;  3MVV A;  3GTG H;  3I73 A;  5IYD H;  1A15 A;  1JQY D;  2B39 A;  1PH2 A;  3T53 B;  4LF4 Q;  3CU7 A;  5FK9 C;  3HOX H;  1O7I A;  2A8V A;  2AQ2 B;  2MFI A;  4IZ8 A;  5HY6 A;  2A1A A;  2K03 A;  4A3C H;  1EEF D;  1H95 A;  2F4V L;  4JBW A;  3BVM A;  3MFG A;  3VYU A;  1YJ9 A;  4BBS G;  4A93 B;  1D5M C;  4NXM Q;  2F0L A;  4WFN 3;  4RH6 A;  2K52 A;  5M5W H;  2E74 C;  4JG2 A;  3RD4 A;  4PZ6 A;  3STB C;  4HID A;  1SDF A;  3NXW A;  1XPR A;  4K6D A;  2K28 A;  4JI1 Q;  1UEA B;  1ENF A;  2NUC A;  2KOL A;  1KAA A;  1PYB A;  1X3G A;  4JI0 L;  2WAQ G;  4UP7 A;  4XDX A;  1V43 A;  1UUP A;  4IOA A;  5D3D A;  5FLX E;  4MTK A;  2EY5 A;  2AKW B;  2E2D C;  3DM1 A;  2D0P A;  1KLG D;  2A6E C;  4B9X A;  5CR3 A;  1L1O B;  2C35 B;  5IP7 H;  4J1M A;  1GUW A;  3CME A;  2L9H A;  3EA6 A;  2KUM A;  3CD6 A;  4IPC A;  2E2I H;  1WJJ A;  2PI2 E;  3AFP A;  4LF9 Q;  4LFC L;  4C3I B;  2FJ2 A;  4R4O A;  1WCM H;  2OXP A;  2XRS D;  1Y1W H;  2F0W A;  4GN4 B;  3HZX A;  1NE3 A;  5M3F G;  3MZ5 A;  4NB3 A;  3D4R A;  1NY4 A;  2WB1 B;  3JAM c;  1IBM Q;  1HZB A;  4AYB G;  1F2Z A;  1XTC D;  2KEN A;  2MJ8 A;  3JC6 6;  3QG1 A;  1I4R A;  1J5E L;  4NPS A;  4HCE A;  3M4O B;  1ZYR C;  2B2Y C;  1B3A A;  1FGB D;  3A56 A;  1DGS A;  2EYP A;  2EIF A;  1HR0 L;  4BY7 G;  1GKH A;  4PG3 A;  4A4I A;  1SYB A;  1SE3 A;  1VQ7 A;  3BZD B;  4QJF A;  1BKB A;  2VB3 X;  5LHY 1;  4HTH A;  1PH3 A;  2GN5 A;  3H6M A;  1CKN A;  4LF6 L;  1KIX A;  3RZO B;  1CUK A;  2HDL A;  4I7A A;  1ILQ A;  4A3J H;  3I4N B;  1JB3 A;  1DZ1 A;  1KL9 A;  4JK1 C;  4TVA B;  4LF7 L;  1D1K A;  4A3E G;  1M4V A;  2K50 A;  4CDC C;  5C3X A;  4ZYS A;  3ERO A;  3HOY H;  2F0K A;  3K81 C;  2NVQ B;  1IZ6 A;  1BF4 A;  4WJ3 M;  2HIX A;  3V96 A;  4F87 A;  1Z7T A;  4IPG A;  5JPN C;  1NTG A;  3PF5 A;  1JOQ A;  4GKJ L;  2NVX B;  5FO9 B;  5E1F A;  1LT6 D;  2LS0 1;  3PUW A;  1CA5 A;  2L0C A;  4ID6 A;  4CDD C;  2UU9 Q;  1SNC A;  4YCV A;  4FO2 A;  3K0Y A;  3MHB A;  1B44 D;  4K2L A;  1E2W A;  2JA6 H;  1I6H B;  1I4P A;  3I4L A;  3EIV A;  1SLJ A;  1TWA H;  2N55 A;  1PH5 A;  3O13 A;  1I50 H;  3HOU H;  1JOR A;  1X3Q A;  3T4A C;  2KQ3 A;  2L4N A;  5JEA H;  1HPC A;  2E76 C;  4A93 G;  4DV6 Q;  3FKI H;  1PVO A;  3J80 E;  2ZJP A;  1Y1V B;  2VUM H;  3PUY A;  2RVL A;  3U9O A;  2BDO A;  1TXY A;  3U50 C;  4JYA L;  3T1H Q;  2J0T D;  2KBN A;  1F2Y A;  1TS2 A;  2ZT9 C;  1II3 A;  1BCP C;  2B2U A;  1SMY D;  1LTS D;  3KLW A;  2QCP X;  3UE0 A;  1I94 Q;  3NUC A;  1K28 A;  1A3T A;  5CV4 A;  2EPB A;  5CV7 A;  1RHP A;  2JN4 A;  2RDF A;  1QJO A;  5EBD A;  4FNF A;  2PW5 A;  2OTJ A;  1KNE A;  2VY3 A;  3FPU B;  4NXN Q;  2VQF Q;  1XX8 A;  4H13 C;  1PTO D;  2CVR A;  1QVF A;  3HG9 A;  4DV0 Q;  4ZCK A;  1VQC A;  1I3Q H;  4C2M B;  3LX0 A;  2N78 A;  4C3I G;  4DR5 L;  3OPO A;  1QZH A;  4YY3 L;  1W2B A;  5A2Q L;  4PNY A;  2JA5 B;  3Q8D A;  1CZW A;  1PFM A;  2ZTC A;  1FYC A;  2LXJ A;  3KLS X;  2WB1 G;  1FL0 A;  4POG A;  2UUC L;  1ET9 A;  1V1O A;  2Q8R E;  5IE8 A;  1RTN A;  4A3D B;  4XIG S;  4K5V A;  5COY A;  1SBB B;  4X65 L;  1AEX A;  1Y8O B;  2NN6 H;  1TKW B;  2H1E A;  2PQA B;  3DEP A;  3HOW H;  4WJ4 A;  1SFO B;  4QUF A;  1UNS A;  2F0G A;  2V4D A;  4OO1 I;  2NBF A;  4JPB W;  1TR5 A;  1X55 A;  4K8J A;  1W3S A;  3F2B A;  3TBI B;  4XQJ A;  4JI3 Q;  1U9R A;  4ALP A;  4Y7N B;  1VQD A;  1X32 A;  3H91 A;  4QIW B;  5IP9 G;  2KA7 A;  3KDF B;  4OXP A;  2F0F A;  2I46 A;  3CQZ B;  3FMC A;  4EQP A;  2JP1 A;  1TQO A;  4DV7 L;  2CH4 W;  4XXE A;  3KF6 A;  2RQX A;  1K9M C;  4A3F G;  1AE2 A;  2PPB C;  1LTB D;  3V05 A;  4HJ8 A;  3DWA A;  2B63 H;  2DJF C;  5JEA J;  1VCI A;  5ELC A;  3F2C A;  4A3B B;  3R8B A;  1CZG A;  5BN4 A;  1STH A;  1UE7 A;  1RCV D;  1B9N A;  4ME5 A;  4OEM B;  3S17 B;  4DK3 C;  4GOP A;  1W6J A;  3IFD A;  5GQO A;  4GKK Q;  2Y0S B;  4TQU S;  3BVZ A;  2QW7 A;  3R2I A;  2DJG C;  4BY1 B;  4HED A;  3ZYY X;  4PZ8 A;  2O5J C;  3VA7 A;  4JCV E;  1GHK A;  1SYF A;  4DUZ L;  3M7N A;  2Z0S A;  3ERQ A;  2EXZ A;  2KCN A;  4IAL A;  1F9Q A;  2AWN A;  2RBM A;  3L7Z C;  5IYB H;  4DR1 Q;  1ESR A;  1CQF A;  3NQT A;  3RR5 A;  4RKB A;  4RFB A;  1XPO A;  3D4W A;  1Q90 A;  4IFD J;  1TWH B;  5C0X G;  1PH4 A;  2JA8 B;  2EYF A;  4I65 A;  4GS3 A;  4B3R Q;  3CCE A;  4ME3 A;  5IOC A;  5FLX c;  3H94 A;  3KLR A;  3OWE B;  1U4L A;  5EGT A;  2F0O A;  1LM0 A;  2X6L A;  3PMF A;  1JB7 A;  1BCP B;  3W3A A;  4LK1 C;  3H0G G;  3IL8 A;  4H0L C;  5FJ8 G;  3TP8 A;  3D0F A;  5C4X B;  1N33 L;  1G2T A;  3GTM B;  1HJP A;  4JW0 A;  1JE4 A;  2J7Z A;  3AMU A;  4HAE A;  3RLF A;  3J81 i;  1FD7 D;  1E2Z A;  4DR3 Q;  2B2T C;  4A3L G;  4U67 3;  1J8I A;  1CHP D;  1Q7Y C;  2F0M A;  2ZXO A;  3PIO 3;  4DV1 Q;  3C46 A;  4X3T A;  4C3J B;  5CYU A;  1IBK Q;  2B8F A;  3G4S A;  4BBR G;  5DM7 3;  1GHJ A;  3AYH B;  1ET6 A;  1PA6 A;  3AQQ A;  2K5D A;  1O7Z A;  2SOB A;  1PFB A;  2JA5 G;  4FF1 A;  1ZXT A;  4OWX B;  1YNJ D;  5M3F H;  2D9U A;  2VS1 A;  2NZO A;  4AQY Q;  1QE6 A;  3NEN A;  3K0X A;  4L6T B;  2VQE Q;  1WTQ A;  2FMC A;  3MXN A;  4O2D A;  2CWP A;  5IGF A;  1GOZ A;  1X3E A;  3PIP A;  2A6H D;  3KUP A;  4BY7 H;  1VF5 C;  2OF1 A;  3GDE A;  4DK6 C;  2IX3 A;  3S1Q H;  2L5T A;  4KY7 A;  2EJG C;  3URY A;  4JI7 Q;  2Z8L A;  5IGD A;  4PMW A;  3TEH B;  1NSN S;  1XTD A;  5CV9 A;  3CCQ A;  4CKE A;  2E5L L;  1GVP A;  3MTS A;  3UDX A;  1LTT D;  4C56 C;  1WOC A;  1DXM A;  3OIP A;  5FKA C;  3BDC A;  4LF5 L;  5J3B A;  1STA A;  2QA4 A;  5IT9 E;  4A3B G;  4LFB L;  4P73 A;  1EEI D;  3T56 B;  4KY6 A;  3HOZ B;  2ZJQ A;  5LMU Q;  1RIP A;  3VR3 A;  1IHZ A;  2X69 A;  2PI2 A;  4PMC A;  2Y0S G;  3I3C A;  4E6I A;  2HHH L;  3HRZ C;  2YU9 B;  3PUX A;  2OT2 A;  2P5Z X;  2WII B;  4QL5 A;  4BY1 G;  3CCU A;  2XWB B;  3J80 c;  5IGE A;  3CPW A;  1IYU A;  2QDB A;  1LO5 D;  1JIC A;  5BR8 Q;  1KC8 C;  5HGT A;  5M5Y H;  3K57 A;  1JCK B;  2XNA C;  3NWS A;  5FLM G;  1LYL A;  1EU3 A;  1CKO A;  5C44 H;  3D8G A;  5G3L D;  2F0I A;  2UUB Q;  1G2S A;  1KXL A;  1U4M A;  2JA8 G;  3J7A 5;  1ZEQ X;  1B70 B;  2UXB Q;  5TSS A;  3K8A A;  3PV0 A;  1WTW A;  1QG7 A;  2CW0 D;  3NBH A;  5IIF A;  3RZD B;  2ID0 A;  1K8M A;  1KLU D;  4KD3 A;  1LT3 D;  1A2U A;  3S2D H;  4X6A H;  4FDB A;  1XNR L;  5C4X G;  4LNQ A;  3EQL C;  3RN2 A;  2PCF B;  3GTQ B;  1PTO B;  2SNM A;  1PV4 A;  1EIF A;  1PTO F;  1WTP A;  2SNS A;  3DM3 A;  3AEV A;  2KCT A;  1VQM A;  4DR4 L;  1DOL A;  1H9S A;  2OEO A;  5COR A;  2FIN B;  4C3J G;  5A35 A;  3PO3 B;  3MXG A;  2EVB A;  3LNN A;  4DV4 L;  5L37 A;  3T1Y Q;  2HDM A;  1Q8K A;  3KOJ A;  4C3I H;  1PDQ A;  4DK0 A;  2EJF C;  3S15 H;  2RHS B;  2F3W A;  4KK7 A;  2J4X A;  1S4Z A;  3STB D;  1K73 C;  3NEL A;  1GM5 A;  3CC7 A;  5K36 G;  4S3S A;  3UI2 A;  1M1K C;  3MEH A;  2VL6 A;  2ZXR A;  3E5S A;  2A6H C;  2PMZ E;  1SNM A;  3D6W A;  3NTK A;  3J7Z C;  2HQL A;  4DNT B;  4F7X A;  3I2Z A;  3X3M A;  3M4O H;  5BN3 A;  3OTO L;  3S16 B;  3E3X A;  4OX9 L;  1B2T A;  5IY0 A;  2CCZ A;  4RGN A;  4YWL A;  5EKK A;  4RCO A;  3L2P A;  1A62 A;  1MI2 A;  3A5Z B;  1EIH A;  2A6E D;  2EY1 A;  4KY5 A;  5EJW A;  4JBM A;  3SGI A;  3C3L A;  1EY7 A;  4JI0 Q;  4IJH A;  2EDG A;  2EY2 A;  5IP9 H;  1HNX L;  3RZO H;  4IO9 A;  4HJA A;  5EBC A;  4DV3 Q;  2K5N A;  5CV6 A;  3I8Z A;  1HA5 A;  1I5F A;  5LMN L;  1D8L A;  2R93 H;  2NVT H;  1KNA A;  2YTX A;  4A3F H;  2C9O A;  5JVG 3;  4C3H B;  3M7G A;  4DFA A;  2ALY B;  2M00 A;  4LFC Q;  5I9P A;  1TS3 A;  1CSP A;  5EQ0 A;  3PUZ A;  3MAQ A;  1H9J A;  4MHE A;  5DM6 3;  1ZYR D;  2E2J H;  3P7J A;  2CWA A;  4LUO A;  1V1Q A;  4H44 C;  5E4X A;  3GTJ H;  3KJO A;  2NN6 I;  3GTK B;  3K6O A;  2ZTD A;  4XQQ A;  2PYK A;  4ZQ3 A;  1S5B D;  5E7N A;  1L0X B;  3A8J E;  4ZKC B;  5EPK A;  3S2H B;  2KVM A;  1K3B C;  2YV5 A;  3KBX A;  1WD0 A;  3HKZ E;  3PQI A;  2XGT A;  3E9I A;  3GV6 A;  4FF3 A;  1HR0 Q;  2IX0 A;  3PIO A;  3SDZ A;  2QKI C;  2WKD A;  1WTR A;  2YTY A;  1FVI A;  4LF6 Q;  4KHP Q;  1GD7 A;  1LAC A;  2Q2T A;  2B2T A;  1STB A;  1CKN B;  3NE5 B;  4X66 L;  5C3E B;  2GA4 B;  1N32 Q;  2K5H A;  2RHQ B;  1CFM A;  3GP7 A;  3TP5 A;  1BBW A;  1F9S A;  4POF A;  3H0G H;  1B8A A;  3OIQ A;  5FJ8 H;  1EIY B;  4R4T A;  2MUY A;  4X3S A;  1H9M A;  1XNQ L;  3Q23 A;  4Q0F A;  3ULL A;  1SE2 A;  4GKJ Q;  5E4W C;  2EY6 A;  5JOB A;  3RLN A;  1KHI A;  3HOV G;  4K14 A;  4KKT A;  2EYL A;  1MSH A;  2DY7 A;  4DV2 L;  1ASY A;  3U58 A;  3U4V A;  2B3G A;  4GOP C;  5T1G A;  3QOJ A;  3VR4 A;  3CC4 A;  3PO3 G;  4QQB X;  5D65 A;  3HGB A;  1D2B A;  3EFX D;  4A3M G;  4BBR H;  3ICE A;  2B8G A;  4YWM A;  1S5E D;  4DXF A;  4A3G H;  1EYA A;  3TN2 A;  1NBW A;  4BA1 I;  1HH2 P;  3ONA B;  1EZ6 A;  2IX1 A;  2MQH A;  2VNU D;  3VR6 A;  2V1C C;  2Q2H A;  3GTL H;  1BCP D;  4HIO A;  2RF4 A;  3K7A B;  2EYH A;  1SRO A;  1SJH D;  1VMC A;  1ZKO A;  3W1G A;  3Q0A A;  1S3O A;  4P72 A;  4DR6 L;  4KN7 C;  3MEF A;  4XTC S;  1N34 L;  4JYA Q;  1PLF A;  2HD3 A;  3T51 B;  3EJI A;  2K14 A;  5IYC G;  1YIJ A;  2R92 G;  5M5X H;  5GAD C;  4KTA A;  3RLO A;  4UY8 C;  3BJU A;  1L0W A;  1EQV A;  1K8A C;  3HS0 C;  2KCC A;  1JJ2 A;  1R4P B;  2AUJ D;  1YEZ A;  4Y7N H;  3PCO B;  5IT9 c;  1Q86 C;  1WTH A;  1VQ5 A;  4RHR A;  2QDL A;  4ZAI A;  3TQY A;  4RA8 A;  3KLS A;  3PO2 H;  3AB9 A;  4IOC A;  2EE1 A;  1RD9 D;  1XMQ Q;  3MWY W;  4HJ5 A;  5NUC A;  1G6Z A;  1QVG A;  3AFQ A;  4LFA L;  4C3H G;  2RA4 A;  2B29 A;  4DNI A;  4DR5 Q;  4YY3 Q;  4M1U B;  1B53 A;  1F2M A;  1VQF A;  1BXT A;  1VQL A;  1IYJ B;  1EWH A;  5C0X J;  1IBL L;  1S40 A;  3UDG A;  1LAB A;  3I4M B;  1EZ8 A;  1SAP A;  4X64 L;  4A3I B;  1HCZ A;  2WV6 D;  4V19 0;  4ZKB B;  2HCC A;  5JPM C;  4WJW A;  2LSS A;  2E75 C;  2VXW A;  2IY5 B;  1YHB A;  1EFW A;  1Q46 A;  2ENB A;  1NR4 A;  1CI3 M;  3TRE A;  4BY1 H;  3LWE A;  5C4J H;  4IPD A;  4X65 Q;  1N36 L;  5CBA E;  1VQ9 A;  4GN3 B;  5G3L F;  4JI8 L;  1VQO A;  2R7Z B;  5FLM H;  1G51 A;  1SN8 A;  5M3M B;  2N49 A;  2M2L A;  3J81 L;  2F0J A;  3AU7 A;  1A63 A;  2JA7 H;  4RGT A;  3JAM i;  3EVQ A;  1EY0 A;  1MSG A;  3S14 H;  2IHF A;  5A2Q E;  1VQI A;  3NEM A;  2XTI A;  1V9P A;  1PZJ D;  2NVY H;  5C3E G;  4DV7 Q;  3B6Y A;  4LF8 L;  1JWM D;  4Z9C B;  1EYG A;  1HNW L;  2LMC B;  4DR2 Q;  1TWC B;  3I7F A;  3DXJ C;  3FHW A;  3A54 A;  3M4Q A;  1SR3 A;  4ODG A;  2BCO A;  4R9W A;  2PMZ B;  5IWA L;  2MNA A;  5FLX L;  4RAU C;  3S1R B;  3S9W A;  3ULP A;  1X3P A;  4IPH A;  3VYR A;  1VQ8 A;  4BXX G;  1EL0 A;  1I4X A;  1D6E C;  1LLR D;  1RKN A;  2ZJR A;  3C1E A;  4HSP A;  2R61 A;  2BH2 A;  2K75 A;  4GOP B;  1EQQ A;  4LW1 A;  1GJX A;  1YZ6 A;  3BDO A;  2EOT A;  2LXK A;  1KQS A;  2TMP A;  1JWU D;  3OWF A;  3GTP H;  3VDY A;  3E6Z X;  4DUZ Q;  2I5H A;  4R1J A;  1SJE D;  3S1N B;  5C6A A;  3EN2 A;  1Y69 U;  3K5O A;  1TWF H;  1EQT A;  4JI1 L;  3G6E A;  1C7Y A;  1YBY A;  4GN5 A;  1A0I A;  2G9D A;  4R8N A;  5K36 H;  2KHI A;  2A73 B;  3GTG B;  4HIM A;  3HP3 A;  1HHV A;  1HZA A;  5E3F A;  3VR2 A;  4IFD H;  1J6Q A;  2ES2 A;  2UXC Q;  1RF2 D;  3HOX B;  2UUA L;  1SND A;  4HJ9 A;  1E0B A;  3F1Z A;  2JYO A;  4LF9 L;  1O7Y A;  3ITP A;  1Q82 C;  3TDQ A;  1Z9F A;  1N33 Q;  3GTO B;  1KAB A;  1DOM A;  1TY0 A;  3TS2 A;  4B3S Q;  3BZK A;  3H15 A;  1AFP A;  3RN5 A;  1IW7 D;  1TII D;  2RDG A;  3HKZ B;  2G5D A;  4KKU A;  3NQI A;  1W6K A;  5IGC A;  2Z6K A;  3VA5 A;  5M5W B;  2R7F A;  3CCM A;  1JE5 A;  2XWJ B;  3KF8 A;  4R4I A;  4JI4 L;  3BG3 A;  4P71 A;  1QOH A;  1LTI D;  2JE6 I;  2ATW A;  1R9T H;  4HR7 B;  3I4M G;  1EY5 A;  1QIL A;  3HFZ B;  1VQN A;  4OO1 G;  1FR3 A;  1TVX A;  1Q1B A;  3KBG A;  1IKL A;  1HUM A;  2NTT A;  4XYQ A;  1NAP A;  3S1M H;  2F52 A;  4KJN A;  2IPK D;  1B7Y B;  1ILP A;  1DON A;  1KRT A;  3I4N G;  4A3K B;  4G4K A;  1FNW A;  3MXN B;  1DM0 B;  5KNB A;  5KEE A;  5M3M G;  2WAC A;  2WP8 J;  2UXD Q;  1ICF B;  4JVZ A;  1S72 A;  1PH7 A;  1Y1W B;  4KHV A;  4J8Q A;  2IL8 A;  1VQE A;  1TWG H;  2PNR C;  4PV1 C;  5I2Y A;  4FYD A;  1V1P A;  4F88 A;  2TSS A;  1DD2 A;  2E5L Q;  3RUZ A;  4P75 A;  1EQR A;  2Q8T A;  2UU9 L;  4N8F A;  4R8I A;  3MXU A;  2WAQ E;  3A8K E;  1HXY D;  5AJ3 Q;  1STG A;  1UE6 A;  1PH6 A;  4LFB Q;  4DV5 Q;  2F03 A;  2F0U A;  2R6G A;  4UAI A;  1H9R A;  3CCL A;  3HOV H;  4X62 Q;  1BNZ A;  3FDT A;  4DV6 L;  4BBS H;  2FXQ A;  1Y1V G;  3CKI B;  3CXC A;  1XJV A;  1PYW D;  1LV9 A;  4O42 A;  3T1H L;  3NTI A;  4A3J B;  1I4Q A;  5I4D A;  1EY8 A;  4A3M H;  3CAM A;  4LWC A;  1HZ9 A;  5IGB A;  1T5E A;  4AYB E;  4I7Z C;  1BCP F;  2JJQ A;  5C3W A;  3KYH C;  4DNR B;  4GNX A;  1NJI C;  4FF4 A;  3TRZ A;  2NWG A;  1XMO L;  1PZI D;  3T13 A;  4FP5 D;  1L0Y B;  4ILW A;  5IYD G;  3C2P A;  1J9O A;  4CKB A;  1GUT A;  2JXM B;  1E7Z A;  4NXN L;  2VQF L;  4JI5 L;  1HNZ Q;  5IYC H;  3S16 H;  3NBH B;  3RNU A;  2LKV A;  2R92 H;  1VQJ A;  3ER0 A;  4N8X 1;  2JA6 B;  3A5U A;  1IW7 C;  4DAY A;  1P16 A;  4HJ7 A;  4A3C G;  2F0P A;  1TWA B;  4L5S A;  1I50 B;  2ASB A;  3HOU B;  2R7D A;  4APV A;  2D2C C;  4G7O C;  2K33 A;  4RHS A;  1YI2 A;  1E1O A;  1O78 A;  4QB4 A;  3P20 A;  2F1M A;  3FKI B;  5IOD A;  3KJP A;  2VUM B;  1D5Z C;  1XWE A;  4A3D G;  1HFG A;  2PQA A;  3SK6 A;  2OQK A;  4C3H H;  3QWN A;  1H9S B;  1Q3L A;  1PHJ A;  2I5M X;  3L0O A;  1Q81 C;  1QUQ A;  5C5L A;  1T9H A;  1TY2 A;  4JI3 L;  2BA0 A;  3F8T A;  3SHL A;  1MJC A;  4DR7 Q;  3FVQ A;  2E2H H;  1F77 A;  4K0K L;  3NK9 A;  2DN8 A;  5KND A;  3TP7 A;  1ENC A;  4A3K G;  1MGS A;  3OTO Q;  2F3I A;  4TSS A;  4B3T L;  4OX9 Q;  1BVS A;  1XPU A;  3R93 A;  4A3E H;  3J7Y W;  1I3Q B;  2RSN A;  3A0J A;  2FFK B;  4HIK A;  2HCI A;  5ELD A;  2ZXP A;  3D31 A;  3M4P A;  4RMF A;  1Y1W G;  5GAG C;  1PRT C;  3M85 A;  1X3F A;  2PQE A;  2RCN A;  4HMI A;  1HNX Q;  3BYT B;  1G8Z D;  5KGU A;  4GKK L;  3D3R A;  3TME A;  1O7L A;  2K1B A;  5GAE C;  2IT1 A;  1YJN A;  2BE5 C;  5GRO A;  3MXP A;  5EKI A;  5ELE A;  5LMN Q;  2K5W A;  1K8G A;  4HMJ A;  4MZ9 A;  3K59 A;  2A5H A;  3CCV A;  3CW2 C;  3HOW B;  4BA2 I;  1X9N A;  1KDB A;  5GAH C;  4X3U A;  1UE1 A;  1E22 A;  4DR1 L;  4DGZ A;  1X65 A;  1CSQ A;  2DNC A;  1AZQ A;  3CP0 A;  4JC0 A;  3F2U A;  4BXX H;  4A93 H;  3L3O C;  4B3R L;  5HUR A;  3I55 A;  4A3J G;  3SK5 A;  3QOL A;  2A69 C;  3R2T A;  2L1B A;  4EVO A;  4EQ5 A;  1SNP A;  2AUK A;  1JT8 A;  1AW7 A;  2EXD A;  3DMU A;  2B63 B;  4ULL A;  1RDP D;  3VYS A;  4X3K A;  2D62 A;  1K8O A;  2M9V A;  1SMX A;  3ND9 A;  4KHZ A;  3GO5 A;  4EQO A;  1PH1 A;  3CHB D;  1EY6 A;  3QJY A;  4N9P A;  3CC2 A;  1YHQ A;  4JI2 L;  4JI6 Q;  4KN4 C;  2ZTE A;  4DR3 L;  1C48 A;  1EOV A;  3J80 i;  2D5D A;  1IL2 A;  4AIM A;  4DV1 L;  2AMC B;  3NP8 A;  1IBK L;  4FVM A;  3K5L A;  1EWI A;  3VR5 A;  3D6C A;  4ABN A;  2N88 A;  4RG1 A;  4R4Q A;  4RKL A;  1EIG A;  1XNQ Q;  4L63 B;  2PZT A;  2AQ1 B;  2CFM A;  2KEE A;  2IJ0 A;  1C4Q A;  2F4V Q;  2NYZ D;  3U4Z A;  2ZM6 L;  5ISR A;  4DV2 Q;  2VUM G;  2H5X A;  1SSO A;  1A3V A;  1F2L A;  2FMM A;  4B3M L;  4IJL A;  4ZUI A;  1F9R A;  2K5Q A;  1CA6 A;  1STY A;  2E8G A;  1IXR A;  1Z47 A;  3CCS A;  1KRS A;  1SYC A;  3I4O A;  3JAM L;  2D0O A;  1HR0 W;  2K05 A;  3I70 A;  3GD7 A;  4IFD I;  1TS5 A;  1D7Q A;  1DYQ A;  1N34 Q;  4LJZ C;  1PFS A;  1HQR D;  1QNU A;  2MO0 A;  3DUZ A;  3I4N H;  1VS0 A;  4EQN A;  5CC4 A;  1RTO A;  4DA2 A;  2VW9 A;  3TZD A;  1LTR D;  1L2F A;  5M3M H;  4DXG A;  3W2D A;  1D1I A;  4L5Q A;  2NVQ H;  4J15 A;  4UHV A;  1AZP A;  4RGM A;  3WOE A;  2HQE A;  3H09 A;  3HOZ G;  2Z9H A;  3NWT A;  5M3F B;  3K5M A;  3TZU A;  5DEH A;  2RKS A;  1PZK D;  2NVX H;  4LUV A;  4QF4 A;  4YHH L;  2PNH A;  3A74 A;  4IUR A;  2CKZ B;  4EX5 A;  1PH8 A;  1Z6H A;  1B3Q A;  1J5E Q;  2Z6K C;  4LFA Q;  2NN6 G;  2VB2 X;  5BR8 L;  1I6H H;  3HOW G;  2AHO B;  5I6W A;  3QB3 A;  4PZ7 A;  1A6X A;  4CJ2 C;  5CGK A;  4DPG A;  2K5V A;  3CRK C;  1GUS A;  2UUB L;  4BY7 B;  1FNU A;  1IL8 A;  4X64 Q;  1YNN C;  1Y8N B;  4OIK A;  3S1Q B;  1U4R A;  4G57 A;  4TRD A;  2Z6B A;  4DU9 A;  5JJI A;  5C0X H;  1JOK A;  2UXB L;  1Y1V H;  4ZRZ A;  4NDX A;  1STN A;  4GZY C;  2Z1C A;  1TT2 A;  1GXD C;  1N36 Q;  1YHA A;  1G91 A;  4JOI C;  1Q1E A;  4JI8 Q;  2F0S A;  4LF7 Q;  1BO0 A;  2B63 G;  1UEB A;  2MPM A;  3QR8 A;  2XN9 C;  4FXG C;  1UE5 A;  1XXG A;  2DGY A;  4YIJ A;  2EYJ A;  3W5O A;  3CMA A;  3M9B A;  1JC7 A;  1O80 A;  4KV6 A;  1IYV A;  1GUG A;  4B08 A;  4A3L H;  3SK8 A;  3MC0 B;  3LGJ A;  4LF8 Q;  1D5X C;  1P8L A;  3MFY A;  4QIW E;  1VQB A;  4JBJ A;  1HNW Q;  4DUY L;  1FGU A;  3T1Y L;  2C5C A;  3A8I E;  2AWO A;  4KI0 A;  4C2M H;  5M5Y B;  3GTO H;  5ELO A;  5C44 B;  4YWK A;  5IYB G;  2OTL A;  2CQA A;  3KFU A;  1FJG L;  5IWA Q;  2JA5 H;  5KRU A;  4NKL A;  4H7B A;  1VQA A;  1ESF A;  1KTK A;  4DAP A;  3J81 E;  3OW7 A;  1AH9 A;  5M9O A;  3ZJY C;  2FHT A;  3CRL C;  3J7A V;  2CQO A;  4A3D H;  3N52 A;  3SEB A;  3IKJ A;  4GLA C;  4DAV A;  2K7V A;  2HIV A;  3Q24 A;  3A55 A;  1QWY A;  3CPF A;  2Y0S E;  4KKS A;  3S2D B;  3V2T A;  1SFO H;  1PFN A;  4O1N A;  4KMU C;  3K58 A;  4ZK9 B;  4Y52 H;  1UAP A;  1VQP A;  4GNX C;  4OL7 A;  4XT3 B;  3PF4 A;  3PUV A;  5KNC A;  1YJW A;  3BS1 A;  4IQZ A;  1K83 B;  3CQZ H;  3H3V H;  4DV3 L;  3W1B A;  3E0J A;  3I72 A;  4A3K H;  4L5T A;  2JSO A;  2UUA Q;  2B2W C;  2BH8 A;  1BBU A;  1IKM A;  2IW3 A;  3BZC A;  4YCW A;  2WIN B;  4IUQ A;  4CBV A;  4JV5 L;  5F2D A;  3NTH A;  2SDF A;  2JEB I;  2DUD A;  3E0E A;  3KK7 A;  2ICI A;  4A3B H;  3S15 B;  3M3Y B;  1SRU A;  2AQ3 B;  2K01 A;  1OXS C;  5C5M A;  1B9M A;  5KIX A;  3S17 H;  4RCN A;  2KHJ A;  2UUC Q;  1HA6 A;  2A68 D;  3FRP B;  3D4D A;  1GUN A;  4C1N I;  4JI4 Q;  4LMQ D;  3DHQ A;  4K6L A;  3KF8 B;  3UE1 A;  1E3P A;  1SYE A;  5JJL A;  4OEL B;  1A2T A;  2H4O A;  3SE0 A;  2CH4 A;  1I4H A;  1MBY A;  1AE3 A;  1TWH H;  2JA8 H;  4KHP L;  3QO2 A;  1HUN A;  1HTL D;  5FO8 B;  3H3V C;  3K80 C;  4H02 A;  1T5X D;  3OYY A;  1MJE A;  2EQS A;  2B2V A;  3OMG A;  1N32 L;  2R93 B;  4LF4 L;  2NVT B;  4A3F B;  1HRJ A;  5ELB A;  4IUT A;  4FF2 A;  2IHE A;  1I6V C;  2OQ0 A;  1RL2 A;  3KF6 B;  2F0D A;  3OSO A;  5C4X H;  1YVC A;  5AFW A;  1EUJ A;  3GTM H;  2I0Q A;  1OXV A;  3NHH A;  2RDH A;  2WKC A;  2I5L X;  3PIP 3;  1E1T A;  2E2J B;  3S24 A;  3WOF A;  1QNK A;  1HQM C;  2BA1 A;  3P1H A;  2HUG A;  4NXM L;  4DF7 A;  3GTJ B;  4A75 A;  4L5R C;  1JOO A;  1U0L A;  1V1P B;  4KLK A;  4BWG B;  1HFN A;  4C3J H;  4K5W A;  3N6R A;  3PSI A;  1E2V A;  2JA9 A;  2JEA I;  4QUC A;  4UP8 A;  1H9K A;  5C44 G;  2L12 A;  1YIT A;  1BOS A;  1CT1 D;  5JJZ A;  1MKH A;  2NTS A;  2KED A;  3WDN A;  2K6A A;  2XRQ D;  2PO4 A;  1KAW A;  5I6Y A;  1CK1 A;  2NZH A;  1PYS B;  2MO1 A;  1EY4 A;  5EPJ A;  2HT1 A;  1L1O A;  2KEC A;  5CBE E;  4IUP A;  2RSO A;  3ND8 A;  3NSW A;  4KJO A;  1PMR A;  4MIU A;  3H0G B;  4A76 A;  5JVH 3;  3DEO A;  2EJM A;  4DN4 M;  2YTV A;  2DY8 A;  1VMP A;  4V0B A;  1PXU A;  3I91 A;  4QGU A;  1VQH A;  4CDE C;  4GNX B;  2JK8 A;  1XMO Q;  5C4H A;  5ELN A;  2EZV A;  1EWC A;  1OXU A;  3DLL A;  1IBM L;  1C8C A;  4F8M A;  4RWS C;  4JI5 Q;  1XMQ L;  1CQV A;  4BBR B;  4A3G B;  4GLV B;  1OXX K;  2MHV A;  2A68 C;  3OMC A;  5KYL A;  4DAY B;  2MP1 A;  1NMG A;  3G48 A;  4A3I G;  4K2K A;  3HOZ H;  3GTL B;  2F4I A;  4OHJ A;  1UWV A;  1BBX C;  1Y8P B;  2XSC A;  1S5D D;  3K5N A;  3UDI A;  4WOR A;  3ULJ A;  1VQ4 A;  2YU9 H;  3M4Y A;  4XT1 B;  4OON A;  3L9A X;  4IUV A;  4JOI A;  4CGY B;  5DNF A;  5M5X B;  2QF7 A;  1VQ6 A;  2R7Z G;  2X6G A;  3G6J B;  1BQQ T;  4TKO B;  2E2I B;  2ICE C;  1QUQ B;  1SE4 A;  1WCM B;  3J80 L;  1OO9 B;  4OGQ C;  3IAY A;  3BVG A;  3NBI A;  5LL6 S;  1SNO A;  4OIJ A;  4K0K Q;  3PO2 B;  1M8A A;  3CCJ A;  5I9O A;  2R93 G;  1PRT D;  3RZD H;  4B3T Q;  4DR2 L;  1Y14 B;  4LF5 Q;  3NPP A;  3C1F A;  3U9S A;  2BE5 D;  1X56 A;  3GTQ H;  2K04 A;  1PTO H;  1WVL A;  1C0A A;  5FOB B;  2Q8I B;  5EAY A;  1G29 1;  4B9W A;  3J81 c;  2HHH Q;  3I90 A;  4PQX A;  3CF5 A;  1JMC A;  4G7Z C;  3PO3 H;  3ERS X;  5K5P A;  5C4J B;  3TS0 A;  1Q12 A;  2PZW A;  1SYD A;  3J81 j;  1ASZ A;  3CCR A;  5EKL A;  1OXT A;  4QY7 A;  1QZG A;  1LT5 D;  3A7A B;  3J7A F;  3HOY B;  1S5F D;  5C0X I;  3DWP A;  3OOC A;  1I94 L;  1NMF A;  2A69 D;  2JA7 B;  1SMY C;  4IUU A;  3S14 B;  5CV8 A;  1WI5 A;  4MNO A;  2PW7 A;  4YCU A;  5FO7 B;  1U5K A;  5ELF A;  2NVY B;  3SR1 A;  2YYZ A;  2A74 C;  2UXC L;  2B2W A;  2F0H A;  1BUV T;  1CM9 A;  1EYC A;  3HOX G;  1XYI A;  1LT4 D;  4FXK C;  2KCM A;  4DV0 L;  1KDA A;  1XNR Q;  2XIW A;  5IGG A;  1B1Z A;  4P2C B;  2KJX A;  1PTO C;  3FP9 A;  3WWV A;  4B3S L;  4JI2 Q;  4WRD A;  5C4Z A;  3PGZ A;  3HEJ A;  3HKZ G;  1STE A;  3X3N A;  3BU2 A;  3RMH A;  4P74 A;  5I2X A;  4DR4 Q;  1YNX A;  2A19 A;  2F3V A;  2B2Y A;  4HCS A;  5LMN W;  1BR9 A;  4DV4 Q;  3GTP B;  4A3G G;  5JAV A;  1SXT A;  1NUC A;  3FEW X;  2F0T A;  1TWF B;  3IRB A;  1DCZ A;  2Z4I A;  4NMZ A;  3KDF A;  2ZM6 Q;  2Q2U A;  3OHX C;  1QB5 D;  1SE8 A;  1VQK A;  4IN3 A;  4B3M Q;  3GTK H;  4RGO S;  1MIU A;  1K0R A;  1HZC A;  1N9W A;  4KD4 A;  3EBE A;  3Q22 A;  5DLQ E;  4UPA A;  5IP7 G;  2VZA A;  3S2H H;  1LUZ A;  1JR0 D;  3A7L A;  4MN3 A;  2F0Q A;  2UXD L;  2K4K A;  1WCM G;  1VQG A;  2IWH A;  3TP6 A;  1FNV A;  5CV5 A;  3H3V I;  4NP5 A;  1NR2 A;  3G71 A;  3PO2 G;  2JQO A;  1JWS D;  5D3I B;  5C3E H;  1CHQ D;  2RCF A;  3MA2 B;  4O0A A;  1GUO A;  5AJ3 L;  1LTA D;  2QEJ C;  4XQN A;  4K8I A;  4XYO A;  4DV5 L;  1ROD A;  1R9T B;  1I4G A;  2F0E A;  3SXH A;  3JAM E;  5KYI A;  4CJ0 B;  3SK4 A;  4X62 L;  1C9O A;  5T1I A;  2QIL A;  2BDN A;  4YHH Q;  1QVC A;  2O5I C;  4OWT B;  3BYY B;  4UDU C;  2F0N A;  3F2D A;  3S1M B;  3K7U C;  3UDF A;  5H1S E;  4HN7 A;  1YNN D;  3OW2 A;  2PZU A;  1LTG D;  2BOS A;  1NCV A;  2QGQ A;  3FPP A;  1K3R A;  1KD1 C;  2WB1 E;  4K5X A;  1DOK A;  1ML0 D;  3HOY G;  1BDO A;  4Q5V A;  1F9P A;  2JA7 G;  4BS9 A;  3SVM A;  2KHS A;  3K7A H;  5HGQ A;  4L8J A;  1K0S A;  1TWG B;  1VF7 A;  2O4X A;  1A8V A;  1OTC A;  4X66 Q;  4LUZ A;  4MTN A;  4N9T A;  5JJK A;  1HNZ L;  1R4Q B;  2B2V C;  2G9H D;  2JA6 G;  4PMB A;  1QCB D;  3GQB A;  1EFI D;  1E24 A;  3VYT A;  2OWO A;  1WYD A;  1A3U A;  1SNQ A;  3HOU G;  1Q8I A;  4LAA A;  3DWQ A;  2GVB A;  1CKM A;  5LL6 X;  5JEA G;  4G7H C;  2Q2I A;  3HOV B;  4CHT B;  1EYD A;  1LTL A;  3FKI G;  3G7L A;  4BBS B;  1K83 H;  4AQY L;  3GV3 A;  1G6P A;  4NW2 A;  5J39 A;  2VQE L;  4CJ1 B;  1AN8 A;  5BN5 A;  1YNJ C;  1TU2 B;  4DUY Q;  4DAM A;  4QCL A;  4A3M B;  4C1N K;  2Z4H A;  2R3Z A;  4HSV A;  5IT9 L;  2WFW A;  1B50 A;  1NNX A;  2QEX A;  5DAU A;  3M3Y H;  3BDL A;  1WTO A;  1FJG Q;  2SEB D;  3I4M H;  4A3I H;  3P75 A;  4DK1 A;  4OO1 H;  4JI7 L;  2WAQ B;  3Q6S A;  4CKC A;  1JJG A;  4DR7 L;  2EYO A;  1WD1 A;  4DR6 Q;  1B4O A;  2I07 B;  4QMG A;  2K32 A;  4IFD G;  1AP0 A;  1X54 A;  5J22 A;  1L1O C;  1MD2 D;  5J1Z A;  5D14 A;  2B2U C;  1EU4 A;  1ICW A;  2R92 B;  4FXD A;  1KDC A;  1ONL A;  1X6O A;  2R7Z H;  4EGV A;  1WFQ A;  2GVA A;  2LY7 A;  2N8N A;  3R3O A;  2NB0 A;  4JBK A;  3LWU A;  2N3S A;  2L11 A;  4GLX A;  1V8Q A;  4IUN A;  1PRT B;  4ZUJ A;  4AH6 A;  4ZLT F;  5LMU L;  1PH9 A;  1EY9 A;  1VDZ A;  1WTV A;  1EOT A;  1GO3 E;  1PRT F;  1N8R C;  1SEB D;  1M90 C;  1JJC B;  4AYB B;  1U4P A;  2L55 A; 
#chains in the Genus database with same CATH homology
 1WOC A;  3I56 A;  3UE1 A;  3KF8 B;  1E3P A;  3MXN B;  4JV5 Q;  4LF5 L;  4R4C A;  5JJL A;  1TWC H;  5J3B A;  5M3M G;  2QA4 A;  4A3B G;  4LFB L;  4P73 A;  2WP8 J;  1IBL Q;  2UXD Q;  1S72 A;  1PH7 A;  2ZJQ A;  3S1R H;  1AE3 A;  1TWH H;  5LMU Q;  1RIP A;  2JA8 H;  4KHP L;  1VQE A;  1TWG H;  2PI2 A;  4UP9 A;  4OWW B;  2Y0S G;  3K80 C;  2HHH L;  4H02 A;  3OYY A;  2E5L Q;  3PUX A;  4P75 A;  1EQR A;  4QL5 A;  1MJE A;  4BY1 G;  2EQS A;  3CCU A;  3J80 c;  2UU9 L;  1N32 L;  2WAQ E;  3CPW A;  4LF4 L;  5AJ3 Q;  5BR8 Q;  1KC8 C;  3E9H A;  2IHE A;  3HKS A;  5M5Y H;  3S1N H;  2OQ0 A;  1RL2 A;  1UE6 A;  3KF6 B;  5FLM G;  1LYL A;  5C44 H;  1CKO A;  1PH6 A;  4LFB Q;  2OCE A;  5C4X H;  1YVC A;  4DV5 Q;  2UUB Q;  1EUJ A;  2L15 A;  3GTM H;  4DKA C;  2I0Q A;  1OXV A;  1KXL A;  2R6G A;  2JA8 G;  3J7A 5;  3CCL A;  2I5L X;  4X62 Q;  4JI6 L;  3HOV H;  4DV6 L;  3GTG H;  1B70 B;  1E1T A;  3S24 A;  2UXB Q;  4BBS H;  2FXQ A;  1Y1V G;  3K8A A;  2BA1 A;  3PV0 A;  3CXC A;  4NXM L;  1XJV A;  4L5R C;  4A75 A;  5IYD H;  3T1H L;  1U0L A;  4KLK A;  1PH2 A;  4C3J H;  4LF4 Q;  3HOX H;  1O7I A;  2A8V A;  4A3M H;  3PSI A;  2ID0 A;  2MFI A;  3CAM A;  5HY6 A;  4LWC A;  1HZ9 A;  3S2D H;  2JA9 A;  2JEA I;  4FDB A;  4X6A H;  2A1A A;  4UP8 A;  4AYB E;  1XNR L;  5C44 G;  1YIT A;  4A3C H;  5C4X G;  2JJQ A;  4LNQ A;  3KYH C;  3RN2 A;  1MKH A;  4GNX A;  1NJI C;  1H95 A;  2F4V L;  3TRZ A;  4JBW A;  1KAW A;  1PV4 A;  1XMO L;  1YJ9 A;  1EIF A;  4BBS G;  2NZH A;  1PYS B;  4NXM Q;  2MO1 A;  3DM3 A;  5IYD G;  3AEV A;  2HT1 A;  1L1O A;  2KCT A;  2K52 A;  1E7Z A;  5M5W H;  1VQM A;  4NXN L;  2VQF L;  4DR4 L;  4JI5 L;  4JG2 A;  1HNZ Q;  4PZ6 A;  5IYC H;  3S16 H;  3NBH B;  3STB C;  4HID A;  3RNU A;  1VQJ A;  4DV4 L;  2R92 H;  3ER0 A;  3T1Y Q;  3A5U A;  4A76 A;  1P16 A;  1Q8K A;  3KOJ A;  4C3I H;  4HJ7 A;  1XPR A;  1ASY A;  4A3C G;  2YTV A;  4L5S A;  2ASB A;  3S15 H;  2R7D A;  2RHS B;  4JI1 Q;  4APV A;  4QGU A;  1VQH A;  1PYB A;  4GNX B;  1X3G A;  3STB D;  1YI2 A;  2JK8 A;  2WAQ G;  3NEL A;  5ELN A;  3CC7 A;  4UP7 A;  1XMO Q;  1E1O A;  1K73 C;  1M1K C;  1GM5 A;  1V43 A;  4IOA A;  2VL6 A;  3KJP A;  1OXU A;  3DLL A;  1IBM L;  2AKW B;  4A3D G;  2PMZ E;  2D0P A;  3J7Z C;  2HQL A;  2PQA A;  4JI5 Q;  3I2Z A;  1XMQ L;  3M4O H;  1L1O B;  2OQK A;  2C35 B;  3OTO L;  4C3H H;  5IP7 H;  3CME A;  4OX9 L;  1PHJ A;  2I5M X;  5IY0 A;  2CCZ A;  4YWL A;  3L0O A;  3CD6 A;  4IPC A;  3L2P A;  1WJJ A;  2PI2 E;  1QUQ A;  3AFP A;  4GLV B;  1Q81 C;  2E2I H;  1OXX K;  1A62 A;  3A5Z B;  4LFC L;  4R4O A;  4DAY B;  1T9H A;  1WCM H;  4JI3 L;  1NMG A;  3G48 A;  2BA0 A;  4A3I G;  4GN4 B;  3SGI A;  1Y1W H;  4JBM A;  4JI0 Q;  1NE3 A;  5M3F G;  3HOZ H;  3F8T A;  4IJH A;  4NB3 A;  5IP9 H;  3RZO H;  1UWV A;  1HNX L;  1NY4 A;  3JAM c;  1IBM Q;  1MJC A;  4IO9 A;  4DR7 Q;  4HJA A;  1HZB A;  2E2H H;  3UDI A;  4AYB G;  3ULJ A;  1VQ4 A;  2YU9 H;  2KEN A;  3JC6 6;  4K0K L;  4DV3 Q;  4OON A;  2K5N A;  4A3K G;  3OTO Q;  1I5F A;  5LMN L;  1D8L A;  4NPS A;  4JOI A;  1J5E L;  2NVT H;  2YTX A;  4A3F H;  2F3I A;  4B3T L;  4OX9 Q;  1BVS A;  1XPU A;  4A3E H;  2ALY B;  1VQ6 A;  2R7Z G;  4LFC Q;  3A0J A;  1DGS A;  1CSP A;  2EIF A;  4HIK A;  1HR0 L;  3PUZ A;  4BY7 G;  1GKH A;  3D31 A;  1QUQ B;  3M4P A;  4PG3 A;  4RMF A;  4A4I A;  1VQ7 A;  1Y1W G;  4QJF A;  5GAG C;  1BKB A;  3M85 A;  1X3F A;  2RCN A;  1PH3 A;  1HNX Q;  2GN5 A;  1CKN A;  2E2J H;  4LF6 L;  2CWA A;  1KIX A;  4LUO A;  4GKK L;  1V1Q A;  4K0K Q;  5GAE C;  3GTJ H;  1CUK A;  2IT1 A;  2NN6 I;  3KJO A;  3CCJ A;  1YJN A;  2ZTD A;  5GRO A;  4A3J H;  5LMN Q;  2R93 G;  1K8G A;  5E7N A;  3RZD H;  4B3T Q;  1KL9 A;  4TVA B;  4LF7 L;  4MZ9 A;  4A3E G;  2K50 A;  4DR2 L;  2YV5 A;  1Y14 B;  4LF5 Q;  3CCV A;  3CW2 C;  4BA2 I;  3HKZ E;  1X9N A;  2XGT A;  3HOY H;  3E9I A;  3K81 C;  5GAH C;  1HR0 Q;  1UE1 A;  1E22 A;  4DR1 L;  2IX0 A;  3PIO A;  1IZ6 A;  1X65 A;  4WJ3 M;  2HIX A;  1X56 A;  1CSQ A;  3GTQ H;  4IPG A;  3CP0 A;  2YTY A;  4JC0 A;  1NTG A;  1FVI A;  3PF5 A;  4LF6 Q;  4GKJ L;  4BXX H;  1GD7 A;  4KHP Q;  1C0A A;  2Q2T A;  4A93 H;  5EAY A;  2VUM H;  3PUW A;  1G29 1;  3J81 c;  2HHH Q;  4B3R L;  1CKN B;  3CF5 A;  1JMC A;  3I55 A;  4A3J G;  3PO3 H;  4X66 L;  3ERS X;  2UU9 Q;  3TS0 A;  4YCV A;  1N32 Q;  1Q12 A;  2K5H A;  2RHQ B;  3J81 j;  1ASZ A;  1BBW A;  4EQ5 A;  3CCR A;  1OXT A;  4POF A;  4QY7 A;  3H0G H;  2JA6 H;  1B8A A;  1JT8 A;  2EXD A;  3EIV A;  5FJ8 H;  1EIY B;  1SLJ A;  1TWA H;  4R4T A;  1QZG A;  1PH5 A;  1I50 H;  2D62 A;  1XNQ L;  1SMX A;  3HOU H;  4KHZ A;  3GO5 A;  5C0X I;  1PH1 A;  1I94 L;  1NMF A;  3ULL A;  3CC2 A;  4GKJ Q;  1YHQ A;  4JI2 L;  4JI6 Q;  1WI5 A;  4MNO A;  1KHI A;  3RLN A;  3HOV G;  4A93 G;  4DV6 Q;  3FKI H;  2ZTE A;  4DV2 L;  2ZJP A;  4DR3 L;  1EOV A;  3U58 A;  3PUY A;  4YCU A;  3J80 i;  2B3G A;  3U4V A;  4GOP C;  1U5K A;  1TXY A;  3CC4 A;  3U50 C;  1IL2 A;  3PO3 G;  4JYA L;  4AIM A;  3T1H Q;  4QQB X;  2YYZ A;  2KBN A;  4DV1 L;  2AMC B;  2UXC L;  1IBK L;  1EWI A;  3HOX G;  4A3M G;  4BBR H;  3ICE A;  4YWM A;  4RG1 A;  3KLW A;  2KCM A;  4A3G H;  4DV0 L;  1XNR Q;  4R4Q A;  1NBW A;  4BA1 I;  1XNQ Q;  1HH2 P;  3UE0 A;  2IX1 A;  2CFM A;  2MQH A;  1I94 Q;  2VNU D;  3FP9 A;  2V1C C;  2Q2H A;  3WWV A;  2F4V Q;  3GTL H;  4B3S L;  4HIO A;  2RF4 A;  4JI2 Q;  3U4Z A;  2ZM6 L;  4DV2 Q;  1SRO A;  2VUM G;  2H5X A;  3W1G A;  4DR6 L;  1S3O A;  4P72 A;  3PGZ A;  4XTC S;  3MEF A;  3HKZ G;  1N34 L;  4JYA Q;  4B3M L;  2OTJ A;  3BU2 A;  4IJL A;  2VY3 A;  4P74 A;  4DR4 Q;  4NXN Q;  2VQF Q;  1YNX A;  2A19 A;  2K14 A;  5IYC G;  5LMN W;  1YIJ A;  2R92 G;  4DV4 Q;  5M5X H;  5GAD C;  4A3G G;  3RLO A;  4UY8 C;  4DV0 Q;  1QVF A;  2E8G A;  3BJU A;  1IXR A;  1VQC A;  1I3Q H;  1L0W A;  1K8A C;  2N78 A;  1Z47 A;  3CCS A;  1KRS A;  4DR5 L;  3I4O A;  1QZH A;  4YY3 L;  2D0O A;  1W2B A;  3IRB A;  1JJ2 A;  1YEZ A;  4Y7N H;  1HR0 W;  3Q8D A;  3PCO B;  2ZTC A;  5IT9 c;  3KDF A;  2ZM6 Q;  2LXJ A;  1Q86 C;  1VQ5 A;  2Q2U A;  3GD7 A;  2WB1 G;  1FL0 A;  4POG A;  4IFD I;  2UUC L;  1SE8 A;  3TQY A;  5IE8 A;  1D7Q A;  1VQK A;  1N34 Q;  3PO2 H;  4B3M Q;  3GTK H;  1PFS A;  4XIG S;  4IOC A;  2MO0 A;  1MIU A;  1K0R A;  1N9W A;  1HZC A;  1XMQ Q;  1VS0 A;  3EBE A;  4HJ5 A;  3I4N H;  4X65 L;  1QVG A;  3AFQ A;  5DLQ E;  4LFA L;  4UPA A;  5IP7 G;  2VZA A;  3S2H H;  2B29 A;  2PQA B;  2VW9 A;  4DNI A;  1LUZ A;  3HOW H;  4WJ4 A;  1L2F A;  5M3M H;  4DR5 Q;  4YY3 Q;  1VQF A;  4L5Q A;  1VQL A;  2NVQ H;  1IYJ B;  4OO1 I;  4J15 A;  5C0X J;  1IBL L;  1X55 A;  2UXD L;  1W3S A;  2K4K A;  3F2B A;  3UDG A;  1WCM G;  1VQG A;  1S40 A;  4X64 L;  4JI3 Q;  4ALP A;  1VQD A;  3HOZ G;  5K36 G;  2NVX H;  3H3V I;  5IP9 G;  1PVO A;  4LUV A;  2LSS A;  2IY5 B;  1YHB A;  3KDF B;  3G71 A;  4OXP A;  4YHH L;  2PNH A;  1Q46 A;  1EFW A;  3PO2 G;  2JQO A;  3A74 A;  3TRE A;  2CKZ B;  4BY1 H;  4EX5 A;  1PH8 A;  5C3E H;  5C4J H;  4DV7 L;  4IPD A;  4X65 Q;  1N36 L;  1J5E Q;  2Z6K C;  3KF6 A;  4LFA Q;  2NN6 G;  4O0A A;  1K9M C;  4A3F G;  1AE2 A;  4GN3 B;  5AJ3 L;  5BR8 L;  1VQ9 A;  4JI8 L;  1I6H H;  3HOW G;  1VQO A;  2AHO B;  4HJ8 A;  2B63 H;  4PZ7 A;  5FLM H;  1G51 A;  1SN8 A;  5JEA J;  1VCI A;  4DPG A;  3F2C A;  2N49 A;  2K5V A;  4DV5 L;  2UUB L;  4X64 Q;  1A63 A;  2JA7 H;  3JAM i;  3S14 H;  1UE7 A;  2IHF A;  1VQI A;  4X62 L;  5JJI A;  1C9O A;  3NEM A;  4DK3 C;  2XTI A;  1V9P A;  1Y1V H;  4YHH Q;  1QVC A;  4GOP A;  5GQO A;  4OWT B;  4GKK Q;  2UXB L;  4TQU S;  2NVY H;  3F2D A;  3K7U C;  3UDF A;  5C3E G;  4DV7 Q;  5H1S E;  4JI0 L;  3B6Y A;  4LF8 L;  1N36 Q;  3OW2 A;  1YHA A;  4PZ8 A;  2QGQ A;  4JOI C;  1K3R A;  1Q1E A;  4JCV E;  2WB1 E;  4JI8 Q;  1KD1 C;  1EYG A;  4LF7 Q;  1HNW L;  4DR2 Q;  2B63 G;  1UEB A;  4DUZ L;  3M7N A;  2Z0S A;  3I7F A;  3HOY G;  3FHW A;  2AWN A;  3M4Q A;  3L7Z C;  1SR3 A;  1UE5 A;  5IYB H;  4DR1 Q;  2DGY A;  5IWA L;  2MNA A;  2JA7 G;  3RR5 A;  3W5O A;  3ULP A;  3K7A H;  1XPO A;  1PH4 A;  5C0X G;  4IPH A;  5HGQ A;  1VQ8 A;  4BXX G;  3CMA A;  3M9B A;  4GS3 A;  2ZJR A;  2BH2 A;  4A3L H;  4B3R Q;  3CCE A;  3LGJ A;  2K75 A;  4GOP B;  4ME3 A;  1EQQ A;  4LF8 Q;  1A8V A;  1OTC A;  4X66 Q;  1P8L A;  4LUZ A;  4LW1 A;  4MTN A;  1YZ6 A;  5FLX c;  5JJK A;  1HNZ L;  1LM0 A;  2LXK A;  1VQB A;  4JBJ A;  4QIW E;  1KQS A;  1JB7 A;  4LF9 Q;  1HNW Q;  4DUY L;  3GTP H;  1FGU A;  3VDY A;  4DUZ Q;  3H0G G;  4KI0 A;  2AWO A;  2I5H A;  4R1J A;  3T1Y L;  4C2M H;  2JA6 G;  5FJ8 G;  3D0F A;  3GTO H;  1E24 A;  3EN2 A;  5ELO A;  4YWK A;  1TWF H;  1WYD A;  2OWO A;  5IYB G;  2OTL A;  4JI1 L;  1FJG L;  3G6E A;  5IWA Q;  1N33 L;  1C7Y A;  3HOU G;  2JA5 H;  3KFU A;  1YBY A;  1HJP A;  4GN5 A;  1A0I A;  2GVB A;  1CKM A;  1VQA A;  5JEA G;  3RLF A;  1AH9 A;  2Q2I A;  3J81 i;  2KHI A;  3ZJY C;  4HIM A;  1LTL A;  3FKI G;  4DR3 Q;  4A3L G;  1K83 H;  2CQO A;  4AQY L;  4A3D H;  1G6P A;  1HZA A;  1Q7Y C;  2VQE L;  4GLA C;  4DV1 Q;  1J6Q A;  2ES2 A;  2UXC Q;  1IBK Q;  4DUY Q;  2HIV A;  4DAM A;  3G4S A;  2UUA L;  4BBR G;  4HJ9 A;  3CPF A;  3F1Z A;  2Y0S E;  2WFW A;  1SFO H;  3AYH B;  4LF9 L;  1Q82 C;  2QEX A;  1PA6 A;  3M3Y H;  3AQQ A;  1Z9F A;  1FJG Q;  4Y52 H;  1N33 Q;  2JA5 G;  3I4M H;  1VQP A;  4A3I H;  4GNX C;  3TS2 A;  4OWX B;  5M3F H;  4B3S Q;  4JI7 L;  3BZK A;  3H15 A;  3PF4 A;  2VS1 A;  2NZO A;  3RN5 A;  3PUV A;  4AQY Q;  4DR7 L;  4DR6 Q;  1YJW A;  1JJG A;  3NEN A;  3CQZ H;  3H3V H;  3K0X A;  4DV3 L;  2VQE Q;  4IFD G;  1X54 A;  3W1B A;  2Z6K A;  4A3K H;  1L1O C;  2R7F A;  3CCM A;  1JE5 A;  4R4I A;  4JI4 L;  4L5T A;  2UUA Q;  2BH8 A;  1BBU A;  4O2D A;  4YCW A;  3BZC A;  2CWP A;  4P71 A;  3PIP A;  1X3E A;  1X6O A;  4IFD J;  2R7Z H;  4JV5 L;  2JE6 I;  1WFQ A;  2JEB I;  2DUD A;  3E0E A;  2GVA A;  2ATW A;  1R9T H;  2N8N A;  4BY7 H;  4A3B H;  3GDE A;  3I4M G;  4DK6 C;  4JBK A;  1SRU A;  3S1Q H;  2N3S A;  3HFZ B;  2R93 H;  1OXS C;  1VQN A;  4GLX A;  4JI7 Q;  4OO1 G;  3S17 H;  1PH9 A;  4AH6 A;  4PMW A;  5LMU L;  1Q1B A;  3TEH B;  2KHJ A;  2UUC Q;  1XTD A;  1GO3 E;  1N8R C;  1M90 C;  3CCQ A;  1JJC B;  3S1M H;  2F52 A;  2E5L L;  1GVP A;  1B7Y B;  4JI4 Q;  3UDX A;  1KRT A;  3I4N G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...