4AQ8A

Crystal structure of mouse cadherin-23 ec1-2 and protocadherin-15 ec1- 2 form ii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
208
structure length
208
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords CADHERIN-23
publication title Structure of a Force-Conveying Cadherin Bond Essential for Inner-Ear Mechanotransduction
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aq8A01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aq8A02
3LNIA 3K5RA 4ZMQA 3Q2VA 2OMZB 3FF8A 1NCHA 4ZMYA 3K6IA 4AQAB 3LNEA 4AQEA 1FF5A 4ZMZA 4ZI8A 2QVIA 1NCIA 2V37A 2OMTB 4AQ8A 4AXWA 2WD0A 4ZMTA 4NUMA 5JYLA 4ZMWA 4ZMOA 4APXB 2X2UA 3Q2NA 4ZMLA 4AQ8C 1ZVNA 3FF7A 3UBGA 4AQEB 5KJ4A 4ZT1A 2OMVB 1O6SB 3K6FA 3LNDA 2A4EA 3MVSA 2O72A 3K5SA 4ZMPA 4ZMVA 4ZMNA 2EE0A 1SUHA 4NQQA 4NUQA 2WHVA 4ZTEA 1OP4A 3UBHA 1ZXKA 1WYJA 4AQAA 4ZMXA 3PPEA 1Q1PA 4NUPA 4OY9A 5DZVA 3Q2WA 1EDHA 2WBXA 4AXWB 3QRBA 3K6DA 4APXA 2YSTA 2QVFB 2OMUB 2OMXB 1NCJA 2WCPA 5JYMA 5CO1A 5CZRA 3LNFA 3LNHA 4AK1A 2YQGA 4XXWA 3LNGA 1L3WA 1NCGA 3Q2LA 2OMWB 1WUZA 3UBFA 2A4CA 2OMYB 4QD2E 4XXWC
chains in the Genus database with same CATH superfamily
2J8HA 2GC4C 2V6HA 2AJ3B 4HFUL 2XV0A 1I7RB 1CGTA 2VISA 4WFHD 4DP6X 4NZJA 2E7CA 4PD4J 2G3XA 4A7VA 4FFZL 1PDKB 3K0YA 2YGPA 3N40F 3EO9L 1U2CA 2OR7A 2A3TA 1CXLA 3BKYL 4G9DA 4GINA 1GKOA 3QS3A 4FHKA 5GJTL 5ANMB 4OFPA 5DLML 1MREL 2GJRA 3A67H 3KPLA 5AD0B 4DQAA 1J1XH 2Q7AA 4K3JL 5CJOH 5DUMH 3AU1A 3LDBB 4PJIF 4BCZA 4IBVA 3W1ZA 1KYDA 2UUDK 1FE8H 2BX5A 3CWGA 3IK2A 4IHOB 4UQEA 3L3OB 2FUQA 3LXUX 4ZXBB 3K4AA 4D3CH 4IGBB 4RGOH 4HIIB 4POUB 5IB4B 4H1LG 5LBVA 3WDHA 4YXLL 1GSKA 4CMHB 3VWJB 4Z95L 2WANA 2J8UF 4FFYL 1HILA 4YX2L 4AH2B 4ISVB 1MLCA 2Z6FA 4LSQH 2AHIA 4JQIH 2EDRA 3T9WA 3MV7B 5DMIH 4TUOA 4ADJA 2JSFA 2Q1EA 3UYOD 3K1DA 4LP4A 4YFDB 3TVMD 4DUXA 2YD9A 4X7SL 1YN7B 4DGVH 5D72H 3L1GA 5C09A 1R3KB 4NQDA 5A2FA 1ONQA 5F0PB 1TTFA 5FB8A 1BLIA 5DK2B 3D4CA 2RH0A 3GWJA 3HE7B 4F58H 1JZHA 1YDPB 1EZVX 4D8PA 4DK3A 1N64H 1JV5A 1PKQA 1NMCB 1MW1A 2H7WA 4O51A 5DEFA 1QQDA 4A04A 1VZHA 4K23H 3RNKB 4LCWD 1JCVA 2EUWA 5ID0B 4U1MA 1F90L 1W6WA 3HE6B 4YFLI 5AWNH 5CBEA 1IGTB 3UX9B 3IDXL 1AZUA 3BZEB 4X6FA 1YEFL 4AIZA 4XO9A 1IKOP 4MJ6A 4YBQC 5AZ2H 2VW7A 4BXVA 4QRRA 1QG3A 2OR9L 2W60B 1I1FB 2E86A 2OQJA 4AYBA 4OLYL 1CLZH 3QUKB 3BZDA 4M7LL 5KSUB 5D7KE 3TTYA 2VDPL 3IJ9A 3WFEH 1HZLA 4M5YL 2QT6A 2Q8AL 2W95A 3RAJL 5IFAH 3T0EE 3W5NA 3LKQA 1NGXA 1J1OL 1I8KA 3IMRA 1U6AH 3HZKA 2IAMC 1E30A 1LK2B 2GTZB 3C5ZA 2BZDA 4JCLA 5D93B 5K9JL 5JORA 5KBKA 4L48A 3THML 4JKPH 3NFNB 4X4MA 1KIPA 1MHCB 4MGXA 2MOQA 3FSWA 3KBPA 3BN9C 2F61A 5FUOL 3VW3H 1TTGA 4OJFH 1HFUA 3UO8B 4Q56A 3U0TB 4F3FB 3UPCA 2VH5L 4WAFA 3DRTA 5HYJE 1PLBA 3OWEA 4HJJH 3JVGC 4ZTPH 5DYFA 4B3EA 3A24A 3OPZL 4ABUA 2VERA 1ROCA 1U8LA 4NZTH 1R33A 5JMOC 2EDEA 2E59A 4AY0A 3GSRA 1G6RH 4HK3J 4JR9H 2FJGA 1SRDA 4Y4HC 1KB9K 3KH4A 3V0WH 2GCYA 2WD0A 4FQ1L 4JJOA 4OCNC 5D1ZC 3WTWA 4Z0XA 1QRND 5IVXB 1DJGA 3ILQD 3KLSA 3MKKA 3EH1A 2D7OA 4AKQA 1RL1A 4DK5A 4RQQA 4MAYD 3P30L 3IETA 3FH8A 4LHUD 4WI4A 3MJ9A 4ZS7H 4C56B 5LGHL 2Q3ZA 4I88A 1MRFL 2OXHB 3EW3B 3T6ZA 2ZUYA 5FECA 1MCFA 5BV7L 2EEXA 1OAZH 2NY6D 2V17L 1QTYT 4MB3A 2HT4D 4G8GB 2HVBA 2M1KA 5I5RA 4LLAA 3ATEA 1CTMA 5EZIH 1KELH 5BZXA 3V4LA 1JZEA 4JFEA 4KVCL 1RMFL 3S5LB 2R0ZL 1G7IB 1FNSL 3ZYJA 4OLXL 3FTVA 3QUXB 4PUBH 4GRMA 8FABA 3ARZA 3SBWA 2DMKA 1LEGA 2DH3A 2ORBL 3L17A 4PWGA 4L3CA 4ONGH 3WTTA 1H9VA 1OP4A 4P9HL 4Y16A 2VISB 4CN4A 2CBMA 2A9NH 1GIGL 2BNUA 3H55A 2AF2A 4QHMA 4FLQA 4JJ5A 4JPWH 4PJ6A 3QWRD 1T6WA 2BNRE 3DYMA 2ZX9A 5I1JH 3VUAA 2GIXA 1S5IL 3BPLC 4N2DA 4NO2A 1GS7A 2J44A 1NMAL 1YJDC 2QPSA 2X7LA 3QHZL 4JFFA 1OZUA 1BF2A 1ZTMA 4FQPA 2HPTA 4G9DB 2JB5H 1F4YL 2LOEA 3KPLB 3BPOB 4NAMA 4CNIA 3CFCL 1KJ3H 4AEHH 5GZOD 4DIXA 1MI5A 3HNVH 2GQHA 1AGBA 4H26A 3HHMA 2PYEE 4YHIA 4JHZA 1CT8A 3LZOA 4TNVK 3PRZA 3TLRA 4EJ1C 3NZSA 4NO3B 4QXUL 2F54D 1B6DA 3FS9A 2CHXA 2K0RA 1IC7L 1CB4A 2CO7A 1KXHA 2Y7LA 3EBHA 4CVXB 3FCTB 5TGBA 4OF8A 4Z8FL 3FTZA 1FAIL 2CNYA 4R97B 5B1CA 2D03L 3WJJC 1MLCB 1FGVH 2CK2A 4L29A 4J8RB 1IL1A 1NCAH 5F7EL 2VLJA 2WVUA 2Y5EA 1PS3A 2XN9E 4DJMA 1FVCA 2XKNA 4JE4B 2VERN 4TUOB 4GKOA 3TXAA 1U42A 3CFNA 4WFED 4OD3L 1P6FA 2LHAA 5E6ID 3A4AA 5EU6A 5DXWA 1KYFA 4XX1G 5FYKD 5C09B 2E8ZA 4XAKE 4BFJA 1R9FA 1T04A 2JQZA 5FB8B 3O4LB 1IGYA 4EQ3A 2B7DT 1E9QB 4WWID 1QTPA 1TF4A 1TSHA 3HOGA 5T5FA 1W8EA 3K2UH 1JV5B 4R83A 4O51B 5DEFB 2W1NA 1LDPL 2CO3A 4ZQKA 4ABVA 4DN4H 5I8OH 5KS9E 3NEEA 3CZKA 3MLYL 4U1MB 3RX7A 3GMLA 2JK5A 3VXSD 5CBEB 5LBSL 4M03A 4U1LB 5ISZE 5GPRA 1A3LL 2QL1A 3LD8B 3RP1A 1OM3L 2WVVA 4P59L 3BO8A 3KW8A 4MJ6B 5GIRA 1J48A 4K8RC 3V6OE 4ZFFA 4R6UA 2X6BA 4LFHD 1GZPB 1QSFB 1Y6NR 5EZJB 1DCLA 4IKKA 1Z9NA 3RWDA 2LU3A 2NNAA 1OM9A 3WJMB 4NT6A 1CFNA 2QHLA 5J12C 3MLRH 3LKQB 5SX4I 1ZTXH 2WJ5A 5BS0D 1NOAA 3O6ML 4X8GA 1YAIA 3K2MC 1KIPB 2VDRB 2LLNA 1WGVA 2F8OA 4JDZB 2W9EH 3UTSE 1SXNA 1ETZA 3UYRH 2EE6A 4HKJB 3T2PA 3CVHA 3LH2L 3DRTB 4P46B 1MCRA 1N70A 2G75A 3AS1A 4Q6KA 1F18A 5LQBL 1P5UB 3TOPA 1Z3RA 3ZLQC 4WUUB 4NUPA 3CNKA 4NI3A 1ZDSA 5IHZB 4PJHA 1BWMA 1FIEA 3RIFK 3DX8A 5I6NA 1TJIL 5D6DA 2EDQA 4M7ZC 3CZNA 2A74B 1KYAA 1SM3H 3IDIA 2X4QA 4Z0XB 4KMTH 4FQ2L 2J56A 3WY3A 3PUCA 1G7LA 4MJ4A 3GMMB 1NCJA 3B4NA 1EBAA 4GQZA 1UD8A 4RQQB 2Y2TA 3LKOB 1XF2A 3IETB 1EWHA 1FBIH 4ERSL 4BUQA 1SMDA 4ZG1A 4UT7L 5FECB 4HXAL 1S7XA 1KBGL 1C5BH 1RAMA 4K3DL 1UZ6E 1I1AD 4G7RB 1MVYA 1A21A 3LAFA 1A7RL 3NJLA 4Z0BH 3BGAA 4JFEB 1WFNA 2I85A 3CFEA 1TTRA 3EBAA 3EYQD 1MDAA 1FYTD 4L3CB 4KKAC 1KN2L 4Y16B 2BP0A 4FNTA 2PXYD 5DS2A 4CVUA 3IMBA 1AFVH 2XKUA 3B56A 2BNUB 1Q9KA 4QHMB 5I82A 4JJ5B 3BJ91 3AQZA 5FOBB 5B21A 4NO2B 3AGWA 2Z3FA 4JFFB 2X7LB 2WO3B 2RBLA 4HBQA 4G6MH 3S36X 3EFOB 1D7BA 3SE8L 1X5IA 2FHCA 3NCFB 1YEJL 5EN2A 4V1DA 1LEIB 4Y4FC 1X5MA 3TT3H 1BZ9A 1MI5B 3FUDA 3WHE0 4H26B 4OFDA 1MCSA 4YHIB 4B9ZA 4F7EB 5I26A 1U30A 3RU8L 4N0UE 2CO7B 5DEJA 2CJSA 2XY1A 3UZQA 3WXWH 3UAAA 3KLAB 5CN2A 5TGBB 3PS6A 2VQ1A 1B4JL 3GRWA 2OI9B 1NUFA 3EDEA 1L6XA 4UINL 2ENQA 1LP9F 1AH1A 1R34A 4UQ2A 4AMKL 1GGYA 1A7OL 1IL1B 1AG0A 3NCYS 5ACMA 1TJGL 2OTWB 2DLIA 2VXUH 4J3OC 5LAPA 1FVCB 2XKNB 4JCMA 4S1SH 2HVJA 2FWLB 4KKCD 3EDJA 3MUHL 1Q9WB 5EZPA 2ADGA 5EEYA 3LRGA 3SKMB 4CKVX 2H3NA 3D4YA 5DQ9A 1NANI 3AACA 3FMGH 4MQXD 2FEEI 4F5CE 3ULUH 3FH5A 4LSPL 3L3IB 1T04B 4UTBA 5JUEL 1V5JA 1OP3H 3WNOA 3S8WA 4M62L 2IGTA 5BRZB 3A3YB 1DR9A 2XPYA 2CO1A 2DV6A 4WI6A 3FK3A 1M9WA 5K9KA 2CALA 4ZQKB 4KV5E 4QRUB 1U8MB 2GTWA 4Y19E 3IJ8A 1KLGA 2ODIA 3GMLB 2JK5B 3HRPA 4FULA 3EIFA 1MCWW 1X3DA 3NRFA 2J25A 3TM6A 3L7EB 3X2QB 4WSKA 4UF7C 1CXFA 4LSDA 4DW2H 2X1PA 1NKRA 4B9YA 4YGAB 2EIJB 1HT6A 5GIRB 4PTUA 4BUGA 3RG1C 4PIRF 4AL8C 5CZRA 2B4CC 2W81C 4NJ9H 3VYPA 1JTOA 1NGPH 3RWDB 2NNAB 2NY7L 3EF7A 1I4FA 1F4HA 4NT6B 2LGNA 1CFNB 3SCMB 4AE1A 1V10A 4DSYA 1P7KA 4XNXL 2Q6WB 2ZYIA 5CD5D 4MA3A 2DQFA 2IFFL 2IDQA 2WINA 2PPDA 3TC9A 1YMME 4KKZA 2AJYH 5D55A 1MQ8A 1SLVA 1FDLL 5HSFA 3CLFL 1WTGT 4Z7AA 2DWXA 1CN4A 1SEQL 5JPNA 1BZ8A 5SWSD 2JKNA 2WUCL 1OP5K 3CVHB 1U92A 5CP7A 5F1NA 1KXTA 3R4RA 4ZMYA 4P48A 4MA8L 4HJEA 3ENEA 1ZLSL 2VO5A 2HA1A 2VR8A 4D0CA 1J0JA 1S3RA 2XN2A 3ZTJH 4PJHB 4GO9A 1YNLH 4F8TA 3U9WA 3DX8B 3BAEH 4E2OA 1T2XA 1GAFH 1OT4A 3G9AB 2H0EA 4UV7L 1KGUA 5D96B 1WK0A 2FL5A 1PY9A 3ECQA 3L4TA 4K2UL 5FFOA 3IDIB 4YHNA 3ZR6A 1NPJA 2X4QB 1JVOA 3RX8A 1HSAA 1J9RA 5TE6L 1GGIL 3PXLA 1F1DA 2ZONA 2HH0L 2X2UA 1MCPH 2CCLA 1HWHB 3QFDA 1TZGH 3CSFA 3PP4H 2ICWA 4TPRH 4JQVC 1XF2B 1U0QA 3ARXA 2A73A 2QDWA 5HHMB 4GAAA 3T0EA 2EP6A 1HHKA 4NLHA 4DGWC 2AQ3A 3U7AA 5JXED 4CADB 2GBVA 1KBPA 1T83A 2KH2B 1S7XB 3P11L 1KF9B 1WAAF 4KDTC 4XTRC 3FU9A 5CKGA 3MRKA 5JOEA 4J2QA 3CFEB 1N7ML 1UTDA 5IJCC 3N42B 1MN4A 5JW5A 2CDGB 4KX7A 4L37A 4NQQA 4L1TA 2WIMA 2HTLD 4L5FL 2HWZH 1U33A 2ZOLA 3NCJL 4UWQB 1GGBL 3AUWB 4OGAC 4X7DC 5HYJA 4G8FA 4RISH 3H1ZA 2IQ9L 3MDJA 4I0PA 4XCFL 3GEWB 1OP3K 3U83A 1Q9KB 1CR9H 1AKJB 1TZIA 4ZK8A 4UILH 1Z0NA 2UWEB 4XPGL 3JTSA 3VI3B 3ZE0F 3VFWB 2IIJA 2I07A 2Y1AA 3NIDB 1ICTA 4B9JA 1YNTA 4JG5A 3CMOH 2ERJC 3BQUC 1JFQH 1ZHKB 3QARA 1D2PA 5CCHE 1BZ9B 1NIBA 1LO5A 1E9OA 1NCTA 3HMWL 3B2XA 1KPUA 1YEHL 1N9PA 3ARUA 1MIML 4TVPL 2H45A 2MQ0A 2PLTA 3UZQB 4ES8A 1TEFA 5FOJA 4DN3L 3RIAF 3TV3H 1QZ1A 5GZNA 4XVTL 5AW3B 2R69A 2VQ1B 3G5ZA 5D1QD 3BMWA 5F0LB 1S9VA 4JO2H 1G0DA 1NCCH 4UQ2B 3ZR5A 3A4FA 3FFCD 5T33L 4S11A 3K2KA 2DJMA 4YAQA 5I19H 4K73A 4RRPA 1QNZL 5C0GB 2NXZC 4NZRH 1TYEB 3GHEH 4TL5A 5D5ME 2XPGB 2H3NB 2JVUA 2A9ML 2Z4QA 4QXGL 3T2NH 3VU1A 1YJDL 2B3RA 3ARGA 2W0KA 1QBLH 4Z7QB 4TQHA 3NQKA 1AR1C 3ABLB 2BW5A 1RXLA 4GQ9H 5MHSD 1CO1A 2UZIH 4B97A 1K4CB 15C8L 4CAGA 3FB6B 1WA1X 2NY0C 1SPDA 1BQLH 2JFCA 2XICA 1E4XL 5K9KB 3V5HA 3CZUB 4OF6A 3H54A 3QQ3A 3W9EA 2F8XC 1KLGB 2PYEA 3B8YA 4XZ4A 4AOFA 2VT0A 1JNHA 4HXBH 2A2QT 3WO4B 4H8WC 3DDFA 4TULH 1MFBL 2YD4A 4PTUB 3S2AA 4KZCA 5IVXF 1OAKL 2X4NA 4JFHD 6TAAA 1XCXA 3JWOH 1FH2A 5DJAA 4JRYD 4HHAA 4HS3B 2B5IB 3U48A 1I4FB 3LRHA 3QORA 4DGYL 4JRLA 4PHZA 3KAAA 3LZNA 3T1FA 1DYZA 1NUNB 4DUWA 3BKJL 2XN9A 4TNFA 4MA3B 4XNZC 4OCYL 5DD1L 4X50A 1A9VA 1JRHH 2ZWLT 2ADIA 4LSVH 2YZ8A 3WE6A 4IDJH 3MJ6A 1O6TA 4JS7A 3QDME 4WI5A 5CJ5A 3WEXA 1U92B 4LK4A 5CP7B 5F1NB 1M7IA 1KIQA 4GW1A 3JWDH 1N0XL 3M07A 4AQOA 1DJSA 3L9RA 4XXCC 5J57B 1DBMH 2Y7SA 3C9NA 3MRGA 3TZVB 4H5SA 3T8VA 4D0CB 5KS9A 3KPSD 3MFFB 4IDLA 3IVKA 4FDWA 2FT8A 4LCCC 3U4BH 1UWGL 1AHWA 2FL5B 1YYCA 5JW4M 5ISZA 2BOCA 4K8RL 5AAWC 3MNWB 4YHNB 2Q7YB 2XTJC 1EO7A 4BSVA 3V6OA 1TEYA 4JUSA 3U2SA 4U0RC 3U7WH 5CCJA 1XH0A 4WF7A 3ARPA 3OD3A 3N85L 5I1LB 2A1WL 2ICWB 2X9ZA 5D8JH 3DK2A 4K5NA 4PB9L 4FLSA 1R3IH 5ACLA 3T0EB 4KXCA 4I3GA 5AZEH 4PJFB 3VFGL 2WKLA 1O7DC 3VQMA 3PY9A 3ARBA 1EFXA 3HIZA 3RLSA 2BZCA 1A47A 3DPDA 5T8IA 3S8FB 3EKCA 3MRKB 5BQ7A 5AAMA 3W9DA 3L8QA 4P99A 3UTSA 3D69A 2CRYA 3A22A 5JW5B 3GJFK 3HTLX 4L37B 1F2QA 4HIXL 1YPZE 3NJXA 2LE9A 4LFHG 5F0JB 3E8UL 1AO7D 4G8FB 4I0PB 4IRSA 4P23D 4F80A 5E08L 3GIZL 1E5ZA 2ZKMX 1PYWB 1TZIB 1DEEB 1QLEB 1GCYA 2OZ4H 3EOAB 3JTSB 1DQTA 1HNFA 2NRDA 4JM4H 4L4VD 3WD5H 1YNTB 3EO1B 3C87A 1A3RL 5JXAH 4EIGB 4HSAC 1LO5B 4PQXA 4CJ0A 1T89A 1XF4A 4H4NA 4WKZB 1N18A 3DGGA 3ROOB 1Q8MA 4FQXA 2V3DA 1GL4B 2WNGA 3NT0A 4L3EE 5DS1A 1NEUA 3OXRA 1KSRA 2L7JA 3OF6D 1FSKC 2VDML 1SHMA 2FBJL 2VRAA 2DJUA 4XNQA 5AYTA 3TT1H 3G5ZB 4ZT1A 3HPLA 1S9VB 1D5XA 1LMIA 3SYQA 4GPVA 4JFWA 5KW9L 4BINA 1L4IA 1CF1A 1AY1L 2X9YA 3F6JA 1OXYA 4YAQB 4P05A 1LGVA 4Y9GA 4TOYL 5FA4A 5GGTL 2YWZA 3W11C 1JWUA 1EJ8A 2BJMH 2O6PA 3MSPA 3H53A 3H42L 3PAZA 5IFHH 1ND0A 2Z4QB 4UZUA 3VNZA 5HI4C 1T6BX 4HMEA 1MCIA 1Y6KR 4R4FL 4JZJB 2FT7A 3G04A 4Y5VA 1FFTB 2DLTA 2ZX6A 1S8DB 5E00B 4CJ1A 5D4IA 3SPHA 3IAQA 2EE2A 1MFCH 2Y2YA 3BXNA 5DZJA 4PG9B 1L3NA 1M7DA 1P5VA 5F9DC 1Z0MA 3ZJAA 3SDCA 2B1HH 1BPVA 1TQCC 3IDGA 2N7BA 4NQCD 2O6FA 1R3LA 5JLZA 3QIBD 4LOUC 1VIWA 4N0UA 1W0YT 4P2OA 2WTOA 1EZUA 1AC0A 5MEND 2X4NB 3QI9A 4FA8A 2NQ3A 3ABZA 3PV7A 3WMSA 3VI4E 5M94B 3EG9A 3FU6A 3QORB 2WBJD 4X4KA 3H4FA 5ESVA 4KJWC 4ZUSB 2XN9B 1CZ8H 1MZZA 1UYWH 4TTDD 5T1KB 5DMYA 2YHGA 1IO4C 4H2CA 1GC1H 4PLKD 3FO1A 1WEJL 4Y4KC 2QMKA 3K4ZA 4HUKB 5T3XE 1RZFL 2ADIB 1XB6A 3EAKA 4NCDA 3WE6B 3ASWA 4F5CA 4OR1A 4JUTA 1PCSA 4WO4C 4IOFC 3CD4A 3BCFA 1MELA 4PRBB 3WEXB 4LCVA 5AB2A 1JNNH 1M7IB 1SMAA 2I25N 1NC4D 2MKLC 4GW1B 4X7FC 1P9MC 3S7GA 3AB0B 4HETA 4KMQA 4EQ2A 2CAKA 3L9RB 2NY5C 4D94A 1EXHA 1VPOH 4QCIA 3FFDB 4Y19A 3C2AH 3C8HA 2IFGA 4MNGE 3LYRA 5E99H 1MPAH 1NBYA 5C7ZA 4A6YA 5IBUG 1MFEH 2VL5A 3PQYE 2AXWA 3KXFE 3KYMA 4ZOCA 5C0BD 3GRBA 2ADJA 3ZKMC 2BOCB 1IC5H 1XR9B 1DN2A 4RIRA 2V8MA 4BSVB 3GKZA 4AL8L 1M6OB 2GFBB 1LO2L 3GO1L 2EXWC 4DF9A 4PYGA 4DZ8A 1F58H 2APFA 3LKPB 2JJTA 4YDJA 1CGSL 1D2OA 5HDBB 4DKEL 2YRPA 2WXGA 4LSTL 3GTVA 1I3UA 4MCNA 5CSZB 1OSYA 2W65B 1JHLH 3CHOA 3RWIA 4RX4A 4N20A 2ICEA 1YMMA 3SODB 3ARFD 4ZXBD 3ARBB 3CLWA 1H8LA 4IGBD 5F89A 3I02A 3FUFA 3VWJD 3UTSB 2X4RA 1X9LA 5CLZA 2BIQA 2VWEC 3EUUA 3LEYL 3E8VA 1TZOA 4WJKB 5J4MA 1HDMA 2CGZA 1MFUA 3BP5B 2FYYB 4HCRL 1JE6A 4IRSB 4XMPH 3RUGE 1ETB1 3BKMH 3RDJA 1NLBH 1JGLH 43CAB 2RAMA 2AV7B 3DMMC 4EVNA 1FWXA 3UZEA 3QDJD 1BBJA 5E7BA 1GS6X 3OQRA 1JWSA 4JG9A 1CDGA 3CZSA 4EDXB 5BNXD 2KDGA 1J8HE 2I26N 5C71A 3HE7D 1NCDL 1BJMA 2VDLH 3LIZL 3FW6A 3V4UL 1GYVA 2OK0H 5CJXA 1QPXA 3D3VD 1XF4B 3KR3L 1HOCB 3AY4A 4FQXB 4JZOA 2WO2B 2YS4A 4QHPA 3OXRB 5D7JB 5KBDA 1OCWL 3HE6D 2DYRB 2PF6A 1W8NA 4XNQB 4OTXH 4U1KB 1FZJA 2YEZA 3Q1SH 2VR9A 2ICWJ 2VDQB 1D5XB 2DBJA 3HPLB 5AYUH 4BDVB 3L7FB 5IB3A 1WLHA 4PJ8D 2OSXA 2R1WB 3HS8A 4FOMA 3ZKNC 4EDWL 1PZUB 2Z0BA 5EO0A 1SBBA 5FYLL 2FBRA 2MPAL 4M48H 1OSPH 2UVEA 5FA4B 1NKGA 2Y25A 3VG9B 4W4OA 1UH4A 1QWUA 3S3JA 3MRRB 3ARDB 4HIHB 2VDMB 2F58L 1ND0B 1OLZA 4FLRA 4XO8A 4XB7A 5DWUH 4IHBA 5BO1H 3QDGE 1YC8A 2WM0A 3G04B 4Y5VB 2M26A 2UY7B 2LW3A 2BSTB 3C5JA 1A7NL 4ZW8A 1CLYH 4X9YA 4P5SA 3BXNB 3KYAA 1AG6A 2J71A 4X9GA 1M7DB 4GG8B 2QFRA 3LN5A 2OW6A 5FFLA 1JZ5A 4J2XA 1K5WA 1HWWA 4PJHF 1CFBA 1USZA 1R3LB 2VM3A 5JLZB 3I50L 2CDFB 4N0UB 4YOKA 4UIKH 5DZ9A 4FXGC 2CQVA 4QF1B 4F91B 2DH2A 2G0LA 2ICWI 3QI9B 2ZNWA 1MY7A 5AW5B 1PZ2A 5JHAA 3P3YA 2Q76A 3EG9B 1PF3A 2EVJA 1G94A 1XMEB 1FZKA 2WNWA 5KVDL 1UT2A 4HD5A 2QPFA 3QEQB 4C56D 5D5MA 3IM1A 4LVOC 4BWWA 1P84K 4NC0B 5DJYB 4PBWD 4O02H 2BVTA 5L2KE 3DI3B 4LNRA 5E1HB 3UBHA 3UABA 4G8EA 2OL3B 4JFQB 4KROB 4PG2C 3U25A 4FFWD 3QIUB 1DQML 1UOVA 4RWYH 3QUXD 4ZFGL 1SY6H 4RVBA 5ERWA 3WO3B 5I15L 4L9LC 4NWTH 3LV3A 3UCRA 1QR1B 1M3IA 3FN3A 2F6AA 3PWUA 4P3WA 4QCIB 4OU3A 4XBEL 1GZHA 2WQSA 2XRAH 3BUPA 3O6LL 1SF3A 2EAEA 5CCKH 2VL5B 5DVOA 2NUTA 2OJEA 5JHLA 3KYMB 4P04A 5CR8A 2ADJB 5DEGB 3WEAA 1XGYL 1T20A 2R0KH 3AQXA 4YPJA 3NIDF 3D18A 3CFIC 2Z93B 3IPBA 4HUWB 4DZ8B 2KZBA 4UNUA 4IS6A 4NBXB 3PWPB 4YDJB 4A63A 2O93L 3SDAC 4URTB 3PWLA 2G2RA 3RTQC 3DWTA 4A7TA 3EHBC 2R2EA 5J6GA 3L1FA 1YEEH 3KDPB 3QUMA 5HGHA 2VDNB 2H6PA 1X4YA 2C3GA 2FB4H 4I9WD 3D8MA 3E6HA 1CFTA 1YMMB 2MFNA 3I6LD 4Z3GA 1WA2X 5F89B 1JZ8A 3DJZA 3MLVL 4Z7NF 3G08B 2NY1B 1BAWA 2X4RB 1C9SA 3QDMA 3ARYA 2ZXBA 2G5UA 4FXTA 2NQCA 4P5TD 4GUPB 5DTFA 5IK3A 1AXSA 1UUSA 5D7HA 3LRMA 4P06A 1NCHA 5EWIL 1HDMB 3LEXA 4RFNC 5KSAC 2EDYA 4KQ4L 5E5LA 3ALWA 3BE1L 5T3ZL 4RSVA 3EYOB 1BBJB 4TNWK 4APQB 5KSVA 2H2PD 4M1GH 4OQTA 1IAOA 5KJRL 4O4YL 3OBAA 3O4LD 3H9SE 1L9PA 1XH2A 1DL7L 3DKHA 4NDMB 4ZFFB 2FX8H 3FN0L 1WE5A 4TUJB 4ZMTA 1QMUA 5E9AA 2IH1A 3VFVB 4FABL 4JG1L 5DGQA 3K1KC 3G6JB 2DQUH 1JP5A 2UYLA 1NL0L 3RPKA 2AZUA 1RZ7L 2Z91A 3NYKA 1Z1WA 4WEBH 2E7DA 1G4MA 1UOLA 3NP3A 3RKDD 5EG6C 5HGDA 3GNML 2RACA 4FLHA 5DJ6B 4DPRA 3VAEA 2YEZB 1T0OA 2OMWA 4NQUA 4UTAL 1LNUB 4JW3A 4JVUA 1JZ3A 1DQLH 3HZ3A 3D0AA 1QSFD 2JF1A 4EUPB 2YRZA 3BSZA 3CZFA 4CC4A 1YPZA 3GI9H 3LIUA 1FZOB 4LKCB 3AABA 4B95C 4BE5A 2Y1VA 3QG7L 1TO5A 1DVFA 1QFPA 3ZIYA 3MXWH 4XP1H 5DUPL 5I8KL 2EZ0D 2IADA 4IRZH 1H5BC 2AXJA 4I48B 4HUUA 4U49A 3D6GA 1UVQA 2CJUH 4BZ2A 2OCCB 3ZQWA 3SE6A 1PIGA 1M4KA 2YA0A 2K78A 4GXUN 2XYBA 3C5JB 4HSQA 3ZQ9A 3B2VL 3D2UA 4KKBD 4A39A 3IDYC 4P46D 1I31A 2Q86A 3LN5B 3KPRB 1JV2A 3ILPB 4EPSA 3CG8A 3M1BB 4LAQL 5FHBL 4WUUD 1RUMH 2DD8L 3X17A 4FG6C 3TIEB 4L3EA 5GHWH 3QJXA 5FDYA 3W82A 5TQ0L 3ZL1A 4ZNEE 1Z9MA 4HKXA 1XSOA 3LX9A 3QZWG 3ZHDA 1ZLDA 4XVJL 5F7MC 3WS3B 4AYFA 2X10A 5JOFA 3MLTB 2YUVA 2AGJL 1UA7A 4GW5B 1FZKB 1WFJA 1SHWA 1E6JL 2NT0A 4U6TA 4MDJA 3V52H 5D5MB 4OD2B 4XXWC 5FEBA 4AIEA 3DIFA 5AVZB 1KWKA 2MQCA 4HWNA 2G3MA 2XTSA 2WXOA 4G8EB 1E8YA 4PRHA 3NK3A 4JPKL 2YN3A 3KLDA 2OTUA 1BEYH 3T71A 3X12A 2NLJB 1TITA 5CZVL 3BRDA 2DM7A 5CGYC 3ML9A 4OH2A 3MXVH 2G5BA 3LV3B 5F6HJ 4R4BB 2X3BA 4FNLH 3ME0B 3SYPA 4FL4B 1QASA 3BAIA 3G6DL 2NQDA 1YVLA 2HTKD 3HS0B 3VH8B 1EEZB 2DKUA 4ZMWA 3O41A 2G3NA 4JFFD 1D5RA 1AXIB 4LHJB 2Z1PA 1YNTF 4WHDA 4IS6B 5ESQB 3L2NA 3SO3C 2R1YB 1P4LA 3EADA 2TAAA 2IQAA 2G2RB 4O9HL 3RL1A 3UAJD 1TETH 3VI4A 2C3VA 1UD4A 2IG2H 3L1EA 1V7NH 2I9TB 5HGHB 5C9KA 3I9PA 1N0LB 3E6HB 3L2MA 1QFWM 1IILE 1ZCRA 1SXBA 1A22B 4MJ5A 4KZDL 3P4NA 1E65A 3RZWA 3TH4T 4H44C 4NYLB 3QDMB 4ONFH 4X4YA 3T0VA 5DTFB 5IK3B 5KANG 1FVEB 4YHOL 4LRNH 4W4NA 4OI7A 5EFIB 2BVEA 1IAIL 3LEXB 1ZT1A 1NGQH 4XC3L 4C4UA 4OZGE 2R56H 4A7SA 2WYZA 4MNGA 4ECNA 2R8SL 3SOTA 5C0CE 4JKLA 3PQYA 4I0CC 5EF0A 2A6IA 1BF8A 3KXFA 1IAOB 4G6FB 1BFOB 3OTTA 3QJOA 2H9GB 5ANHA 5KEZA 1AAJA 4PJEE 3CQQA 5BRZD 4C8XA 4NERA 2VE6A 3IKCA 1VGEL 4ZTOH 4X8XA 5IEKA 4AVJA 3QAZB 4PIBA 2YUZA 2QSTA 4IRJB 4E9XA 2ZSWB 4MVBD 2ZXEB 5DUML 4GJTB 2Z91B 4Z3EA 1O9WA 1A8ZA 1RZGA 1FE8L 1I9EA 5CSBA 3LH9A 5FYJU 2W0FA 5IQ7H 2YK1H 3R7RA 1OCCB 4OLVL 2OMWB 3U6RA 2K6WA 5FF6A 2Z35A 4NBYB 4YMPA 1PZ5A 3FCGA 4JGNA 5K1NA 1QFWH 3KJ4B 3FPXA 3II1A 3RBGA 1YPZB 4PBDA 3VXPA 3SCMD 5HHOB 1T3FA 3NBNA 1JBJA 2UV3A 4HKZB 1IE5A 4HJGA 4OM0H 4PMEA 5HD8D 3KLHC 1DVFB 2Y7MA 3QXWA 5IQ9A 5FLVA 4BELD 4POYA 3RUGA 2DQCH 4ODHH 4HUUB 1RUAL 3I9GH 3PGFL 3S35H 3A6BL 1TOXA 4J6RH 1WBYA 1U58A 1EH9A 1B2WH 3RDTB 1ID2A 4PJ7A 1KGWA 3AG3B 1J8HA 1J9CT 1SOSA 1TJHH 3JQOB 4ENZA 3D2UB 3FCSA 4YDLC 1X5KA 2BXZA 5J1SC 3GGWB 4WKXA 2Q86B 3SEPA 1JV2B 5KS9F 2PP7A 3GMQB 4WWKD 5C08B 2CKNA 3LZLA 4FA7B 5DJ2A 5DK3A 2GC7C 1II4E 2F1BA 3JTBA 2QPDB 3VMOA 2Z7UA 2PO6A 1EQWA 1D5BB 4HKXB 3O8XC 1KCVH 2K45A 3ETSA 3R4DA 2DRUA 4S0SD 2YPLE 1TDQA 4BSWB 5AOLA 3O2DH 5AZ2L 3AREA 3GSVA 4UIMA 4JFDD 2XZCL 4C4BA 4BK5C 2C1OA 1CLZL 5HHMD 3BPNC 4MDJB 2BY3A 4BXSV 4UTCA 1JMXA 3DIFB 4H0IA 4OBSA 1U8PB 3HB3B 1U6AL 1EGJA 5ECJE 2D7PA 2Q2EB 3L4CA 1MVFA 2R4SH 1M1XA 4Y7MA 3QDGA 4PRHB 3MLZL 2OTUB 3X12B 4A2DA 3UERA 4AGMA 5GGQL 2G5BB 4P2AA 4U6XA 4JFVA 2F7RA 3VW3L 1TVHA 3CBRA 4ZX4A 3GQFA 2P5PA 4LP5A 4HULB 3NZ8A 1AKJD 1L9SA 4TS6A 1UASA 4CSZA 3ARWA 4JKMA 3H0TA 3O41B 4NZTL 2VAAA 3VTAA 4HOZA 4NNPH 1M53A 2PNDA 2VZVA 5A2JH 3V0WL 3S37H 1JUFA 3CDFA 1R3JA 4MA7H 4GSUA 4Q6IA 3RL1B 3VI4B 2C3VB 5CJQH 1TQTA 3RVUC 3L5HA 1F00I 1FNLA 4DQOH 3IEAA 5E8PA 2X4OA 4U1IA 3PFUA 2EDWA 3WIFB 3KPQA 1JGEA 3QPQD 4U3XA 2XA3A 4ZS7L 3CSTA 1G6RA 1SYSA 3S3PA 1UZ6F 4EKJA 4U6HA 4MD5A 4WHTA 5L2KA 5JQIB 3L5JA 4R3SA 4RA3A 4CVWA 4K3GA 3NABH 5GS1B 1SOKA 3IJSB 1PEWA 3JWNH 1JPSH 1T7VA 2ZAHA 3A47A 5EZIL 5TQ2L 1G84A 3TF7C 1ZT1B 5CFHA 2HRGA 3QISA 2YQ3A 2JKRM 4X7CC 2P80D 2A9NL 3PQYB 3UP1A 2A6IB 2EIDA 1RJLA 5F1KC 1OV8A 4JPWL 3V5DB 1X5JA 2XQYA 4IEFB 3FQXA 2PMZA 1U9KA 2YEQA 4L8SC 3FCUB 4MYWB 1B9ZA 2J1YA 1EVUA 1R4XA 3IKCB 3FRPB 1OB0A 2C9RA 2FNWA 1MWAL 3SDDA 4AEHL 1KJ3L 1Y07A 4NN5C 3ZGIA 3QYMA 4YDKL 3ZKXB 4AQEB 1MCCA 4NQVB 1K85A 1YQVL 2P8MA 2W0FB 3GI8L 5FCUH 3MZTA 5I0XA 2Y5QA 2FRGP 4YDMA 1RUPL 3FQYA 1LO0L 5DFAA 3O4OB 2CHDA 3VVVA 1SDAB 2OMYA 1SVCP 1PZ5B 4QIRA 2CA4A 1GKEA 3DX4A 3FFOA 3QPXL 4ZMVA 4TF4A 4GT7A 4ZD3H 1T3FB 1FGVL 5ESAA 2WXKA 4HJGB 3IFPA 4M4PA 4NN7B 5LAXA 4CC1A 5IQ9B 4PJCE 4XI5D 4WO0A 4K4KA 1HZKA 1X5XA 2ZXGA 3OR7A 1T66C 2CHWA 3PDDA 5DC0A 2Y6SD 1WBYB 2XWEA 3MACL 3VGAB 4PJ7B 5FXCH 3KL5A 3H9SA 2GPZA 1OD9A 4YN3A 3L1OL 3FCSB 4MCMA 3DO3A 4HMCA 4AGNA 2I7SA 3IWVA 4KVNL 4KV5F 4YXKH 1WFUA 5I16A 3K2UL 2WWNA 5KANI 2CUAA 1NEPA 2ZCHH 1IAKA 1JFHA 2CGRH 2DMBA 4UAOB 3TZVD 5DJ2B 3JWDC 5I8OL 4DN4L 3VXMB 3CSGA 1T5XB 1Q0YL 3L3JB 1BBDH 5TE4L 2H47C 3TA3A 5BZDB 2PO6B 4UI2A 1MAMH 1QYGH 5LB1A 3LZRA 3QO0A 3VXRB 5D4QA 1AZVA 1E9PA 3CVBA 4N28A 3MV8E 4LLDA 3Q13A 4KQ3L 1E3FA 4FQCH 3AREB 3GSVB 2YQBA 2EECA 1JPGA 4UIMB 5IJDC 5JZ7C 2BS9A 4KHXL 3MGOA 2C1OB 3UIYA 3ZYIA 5SWZE 3ZKQD 3OKDA 4S1QH 3GUFA 4HWBH 4GUOA 2HJLA 1ZTXL 4BGLA 4PLNC 4Q6YA 4Z3JA 1WITA 1QI3A 3C6LA 3BVVA 3VGFA 1N4XH 4MFHA 5EUOE 2XWJA 3QDGB 3H9HB 1WFTA 4HW6A 4MXVE 2VZ1A 1U8IB 5BPPA 4G83A 3NJMA 3U1SH 3ZL2A 2B16A 1GPOH 1G1KA 4HC1A 4U6XB 1NCBH 1H6TA 1TVHB 4BCXA 2Y1ZA 3D30A 4Z6AT 3TNMA 4HJ0C 1IFRA 2LVEA 4NO0A 4CA4A 1EJOH 1T1WA 1GA2A 3ZY7A 3B7UX 5LHDA 2ENPA 3BN9D 4K3EH 3KGUA 5CIPA 5EH1A 5FDWA 5FX3A 3CIQA 4ZNEA 5C0EA 3HG0A 3NRQA 1BM3H 4K7PH 4MZ2A 1SM3L 4A67A 4E41B 4IW4C 1JUFB 3L2LA 3LRKA 1T1ZA 4JL1A 2CE6A 3VRJA 4Q6IB 5K93A 2PR4H 1DTUA 3CN1A 3NFSH 4XT1C 4DPBX 4N5EC 1KCLA 2I5YL 1E28A 5E8PB 2X4OB 2GSIA 1CLVA 1KNOA 1Z66A 2YKLH 1UB5A 4U1IB 3H7BB 4LHQB 4Y4HD 2E47A 1JGEB 4X6DE 3RNQB 3MBEC 2P48B 2APVA 4B50A 1G6RB 5D1ZD 2OTPA 4U6HB 1FFOB 5GZND 5L2KB 2F5AH 3DRQA 4MCYB 2VQ4A 1EHLH 3T2QA 5J1TC 2DYPD 3QNFA 1H3XA 1ZXKA 3GRGA 4G1MA 3MFGB 3K81A 4OF7A 1ZXQA 1CTOA 4ZPTA 2E9IA 1WTLA 4TVPD 2J6EH 3BGFB 4OY9A 2OYKA 4HBCH 2YLKA 3B2MA 3BSHA 1P69B 1AFVL 1CL7H 3HBZA 4PU2A 1I7TA 4AEFA 3FQXB 3J27A 4ZAKC 3MJ7A 2FWSA 2JTDA 2YSTA 4G6ML 3CN2A 4U1GC 4J1UA 4B9FA 2ZKHL 3PGDB 4PGEB 1C1EH 3CFBA 3SDDB 4MS6A 1FIGL 4KNQA 2L7QA 1DBKH 3NVQA 3MJWA 3ZTNH 3CHPA 3OKEA 1ZPLA 2OP4H 1WUZA 4FJ6A 3D06A 3VSQA 2X89A 4FFVD 3WXWL 5LNDA 2OMYB 4TV3A 1G0YR 1IM3A 2GY5A 3APMA 3BWUC 3TL5A 1NBVH 4LLQB 2OW7A 2BCMA 1UWEL 3UJJH 3QORD 4YWGL 3QUYC 5I1EL 2XQYG 1QKZL 2VXQL 4KTEL 5ESAB 2X9XA 3H85A 3T6XA 4LBEA 3IFPB 5D5MF 1G87A 4OD1L 5T1KD 1MY5A 2Z7ZA 4S1SL 4MA1C 4OZGA 3US1A 3FBQA 1OT2A 3OR7B 5DZPA 3FL7A 5C0CA 1YEWA 4BM7A 3GF8A 2AJSH 2NNRA 1NA8A 2PPEA 4GQRA 2D9CA 2VXSL 3OMIB 5EU7C 1SJEA 4RESB 1AIFB 4PJEA 5F3HA 3SE4C 4I3RH 1OVZA 5G5DB 2DMHA 2ZWKA 3AAZA 2ZKYA 4PJGE 2XBTA 1IAKB 4HX1A 1AXTH 5C07E 3QXUA 5SX4H 5E0QA 5C0AE 1VADA 1JOIA 4DFIA 3TA3B 3B83A 1MLBA 2EKSA 4HS6B 4KKRA 2KC0A 3ECWA 2ZCKH 1E9PB 2X6VA 4LLDB 4DW2L 4GUQA 4XP6H 2IOIA 4IOSA 2AJUL 5H35A 4CN6A 1XTLA 4BUHA 1JPGB 4KRNA 5I74C 3QA3A 1NUGA 3CFJA 4KTDH 4H1LH 5C92A 3WKML 5LLIC 2PTVA 2X3CA 2SEBB 4QEGA 1KJVA 4YHZH 2DS4A 2VZ3A 1KB3A 2HJLB 3FPYA 1WFOA 4G43A 4KX9A 4N2OA 1W0WA 1D5MA 4XX5A 3C6LB 4K8RD 3LHPH 2C26A 12E8L 2AJYL 2B2XL 3FUHA 1EEQA 3O0LA 3ES6A 3TO4A 4IIZA 1KB9J 1N67A 4HUXA 4U7SA 3WJLC 3QUZB 1N5AA 5E2VH 3AMLA 4K9JA 5D2LE 4WWOA 4RNRA 3EJZC 4JKNA 4ATWA 3TNMB 1JN6A 2YAQA 4IRSD 2P44B 3EO0A 3KE0A 4K5OA 4NO0B 1JG9A 3VFNA 3TCLA 3MLXL 4YIQA 1E6OH 1T1WB 2HKFH 5ALCL 5FS5A 3HN5A 1YNLL 4PJXE 3BAEL 1ID5I 5C0EB 4RAVA 4LSRH 3FSVA 3RZCC 3VRJB 1T1ZB 1V8HA 2YPLA 2JELH 5FYJE 4E9WA 5B8CA 1RURL 4OF0A 2XHNA 1MCPL 4AV0A 2GIMA 1E28B 3PV6B 2FATL 2MCPL 2GSIB 1KNOB 3M17A 3PP4L 3MRDB 1UB5B 2XG4A 4FQXD 5IUCA 2AXGB 2JMRA 4F24A 1FNEB 5D7JD 2CLVA 1XAKA 3TVMC 35C8L 2DQEL 4L8CA 3SYAA 3TF4A 4LVNB 1G9NC 3O45A 1ZK9A 4C59B 3LH8A 1YEKL 2IAMA 2FCBA 2FECI 4G1MB 1YPZF 2WAHA 4XWGL 2KT6A 4FEMA 4MSWA 4HF5L 1UH3A 5T1DH 1FO0L 5I9QC 2BWQA 4ZPTB 5DCCA 1ACYL 2ODHA 4H0HB 1QSEE 2ED8A 2XV6B 1IGMH 2LR4A 3ARDD 4LEEA 4XGZA 1J05A 5KVFL 4CVZA 2GG1A 5IV2B 1CR9L 2Y5TA 1DFBL 2CPUA 5FGCE 1Q90A 1I7TB 4GSDL 2UXTA 2AMUA 2VCOA 2QV2A 4UILL 3ULVC 1XDTT 1MRCH 2O5ZH 3JVGA 3MJ7B 3RJDA 4IBUA 2NDFA 3OV6A 4BK8A 2BSED 2ZXWB 5EORH 5FW6A 5L4FA 1JI2A 3MI6A 4KI5F 4J1UB 5IR1B 3IDMB 2BFGA 3B43A 5TF0A 4R4NC 5FA3B 4RLDA 3CMOL 1WJ3A 3CFBB 1JFQL 3PL6C 5L4JA 1RQ5A 2FQEA 2V7NA 5E8DH 5IROD 3PDOA 1ZJAA 5GJSH 1SQ2N 3IPFA 3WGVB 5D4JA 5GGSY 3SB3A 2IXQA 4MKMA 4DPAX 3LSOA 2EVIA 1HX0A 5L6YH 2FBOJ 4JB9H 4Y4FD 1IM3B 4EN3A 3EYUL 4QO1B 4JO2L 1NCCL 3UDWC 1KEGH 3VD1A 4I2XE 3FHQA 4ES9A 5EU5B 1SDDA 5F9OL 1KCUL 1BVNT 2Z7WA 3QR1A 4LU5L 3QEQD 1B2YA 4HCGA 5I19L 2WLIA 4OZGB 1QNIA 3T4AB 5I66A 1RJYA 1J12A 2A9DA 3CFDA 4IM8A 3E9UA 4NZRL 3E38A 1JDAA 3OKMA 3MO1A 2CZNA 3N1MC 5B4MD 3SZKC 2BDNH 5F93C 4ODWB 1RVFH 4JZNB 4BD4A 1ZLWK 1C8QA 4KROD 1QBLL 1SJEB 4FTVD 1T0MB 3QIUD 4PJEB 5F3HB 5B38B 5IMOA 5KOVC 3UMNA 2V0AA 3AAZB 5LCVH 4KU1A 3OJMB 4XOEA 1BQLL 1G9MC 2VSCA 4HX1B 4MAYC 2WQWA 3JT2A 4YHPB 1X5ZA 1BLNA 1VADB 5D7LE 3F58L 5E6UB 1TYRA 1ZLUK 5I5JA 4JRXB 4JFUA 2VKWA 1FP5A 2K70A 3MOQA 3NZUA 2HT4C 2V4LA 4WJ5A 4F7PA 4IIQA 4JMXA 4TULL 1HEHC 4LASH 2PWEA 3VI4F 2ATKB 3PWPD 4XOCA 5KBMA 2B14A 4ODSH 5EOTA 4FZ8L 1NOLA 3AG4B 4YDIH 2AANA 1KJVB 4PP1D 5EIVA 3UC0H 2WXPA 1OAYL 1BQHA 3F04A 4G43B 4IMKC 4PJCA 2DEYX 2BC4B 4JGUA 3WFZA 1D5MB 2MIZA 2PKDA 3QH3A 5JIMA 1GY2A 4XRCA 2X4SA 3O3DA 5C7XH 3RJOA 3JTTA 3TO4B 1YEGH 5JR1H 5A16A 1N5AB 1P4IH 4NAJA 3S98A 4PY7A 5E6SB 1NCIA 1GYWA 1W91A 5I6OA 4P57B 3UH8A 5GZOC 5IMLA 1EAPB 2V2TA 3QO1A 3JWDL 4IMLA 1MG3C 1QW9A 3TN0C 1RIVH 2F53E 4PW3A 3VFNB 1X4XA 3QDHA 3TCLB 4YIQB 1JJUA 1M2VA 5ADPL 3QNYA 4APQD 1BGXH 1XB3A 2KLTA 2ENSA 1JGDA 1ZOXA 1Z9OA 1CFSA 2GUOA 4XN4A 4MNQB 2H4EA 4N90D 3MV8A 3D05A 4JO4L 43C9A 1MXDA 4KZEH 1JGVL 3GK8H 1RK1A 1LJMA 2EYTA 4PSRA 2FD6L 2EDOA 3WU1A 4QHKI 4ETQA 2DQIL 2XTJE 4OI8A 1PY4A 5TF1H 1I85A 2MNJB 3ISRA 1ZHBA 5SWZA 2XG4B 2MCG1 1GXEA 4FHJA 4BQ8A 4GAJH 2CLVB 4S0HA 4BFIA 5C3LD 5AZEL 1HKLH 1OCZB 2Y7QB 3AW5A 5E6IC 4L8CB 2DTMH 2SODB 5E7FA 1Q0XL 1MCJA 5EUOA 3O45B 1HINH 3LXBA 1DANT 2VQTA 3VD4A 1Z9LA 1QLRB 3G7TA 4LQ1A 1FH5L 1O7DE 1I75A 5J9PA 2OSLA 1J1PH 4MSWB 3NCEB 3FUMA 4NWUL 1RZPA 4Y2OA 1U8KB 3RUGF 1A7BA 1K9TA 4U1JB 2HLFC 5L0QC 5EEWA 2E7BA 4FEIA 1U36A 4XGZB 1J05B 4YUEL 1YN6B 2Y5TB 3FQ2A 4ALAC 1NGYA 2IDFA 5ABDE 4HUVA 4PJ7F 5IW1B 4U1NB 1YHPA 4KO5A 4JM4L 5F3BA 4RETB 3MNVA 1KXVC 5FYLD 4OGAD 1CU4L 3CHRA 2UZXA 3WD5L 1JTPA 3DJ9A 2XXGA 4PH8A 3BD3A 3X1BA 3WEMA 1WISA 3KPRD 2ZUQC 2IWFA 2V7NB 3MCKA 4XNMA 4FI8A 4K7FA 5IW3A 3TJEH 4XE0A 1D6VL 3PDOB 3W38A 3KPOA 3UAEA 5DRZA 3O2VH 2IH9A 5C6PB 2CIIA 4F33A 4X6DA 1KY6A 2IXQB 2OZ4A 4BFOA 5IW6A 1INQA 1A6AB 1DVYA 1T2QL 2QTVA 3BRGC 1J0YA 3SJVE 3WSQH 3TGXA 5GXBB 2VDKH 5E5MA 3MOBH 3EGDA 3VXUB 4EN3B 4CBPA 2DM2A 1ZY9A 3ZW3A 4DP2X 4M93C 4YK4C 4JY4B 2IDSA 1SDDB 2RCSH 3EYVA 4ZX5A 4O2FA 2QBWA 2WLIB 4X7TB 5I66B 1RJYB 3MUGB 2X53A 2B20A 4PWKA 3OKMB 2ZX8A 3MO1B 3RY6A 4F9LA 2PYFB 5IFHL 5DUBA 4OJDH 1U8NA 2MQGA 1VACB 4XMKH 4AITA 1PY0A 4PJ5D 5CINH 2NXZD 1CD9B 4IJ3B 5IMOB 2V9RA 5ALBL 3DNKA 4MRCA 1MFCL 3WUZA 4KH9A 3KVDD 1HXYA 3HBQA 1QFUH 2Y7OA 5AUMA 4JHBA 4ZMLA 1BLNB 1KULA 4KI1A 2NCEA 1GGUA 4G1EB 5LG1A 4G7VH 3ZRSA 5CGMA 4WK0B 1AR1D 4PB0H 2JKSA 4WFFE 1CDCA 2ZJSH 3BJLA 4IIQB 4F7PB 2NY0D 5HVHC 4J3SA 1I1AC 2YIHA 3QHTC 1UACH 4W9IC 1I9JL 5EOTB 2KQNA 3ABGA 1L6PA 4HQQH 2NW3A 5IQOA 3EYQC 2R0LH 2G2NA 4Z7OE 1KGCE 3H3PH 2WY3B 1XGUA 2IANE 4LOEA 3LXAA 1BQHB 1OT1A 4MMYA 2PXYC 4PJCB 4U1HA 1BJ1H 2ESVE 2DQHH 4W9JC 3GBNL 3V0IA 2VZUA 4PW9A 2X4SB 3O3DB 4F8QA 3JTTB 2MTAA 4GAGH 5JHMA 4OLWL 2P5WE 4B9PA 1E8WA 1Q9LA 5A16B 5CEZH 4G82A 3KWVA 2DLHA 5T5NF 3B3IB 3ZL4H 5CZXD 1NLDL 3Q6FB 5IMLB 1N5YL 2V2TB 3QO1B 4KTGA 1HHJA 4IMLB 4PJGA 3UEQA 2J12B 2NY3B 3DSNB 5C07A 2K9FB 2BVOA 1VPOL 1MFDL 5FUCE 4JM2A 1S7TB 5C0AA 4TLKA 3C2AL 2WNKA 1MPAL 5H37H 5IG7B 1MFEL 3OAZK 1IKNA 1JGDB 4G6FD 1CFSB 2EVGA 3HLAA 4D0DA 3MV8B 2R2CA 5F6IB 43C9B 4QDGA 1DSWA 4KK6C 1F58L 4CILA 1R0AL 2EYTB 3U9UA 2MNUA 5JW4N 3X1EA 2WLLA 4ETQB 2VKXA 3R1GH 2QSCH 3D0LA 4IRJD 4HJSA 5FAAA 3UBFA 4PRAA 5T3ZD 1HEZA 3HKFA 4DH2A 4OGQC 2WXNA 1L7TH 4GRWH 5E95B 5EU3A 5DD0L 4ADGA 1F86A 2W94A 2AQSA 4W6XB 1KGIA 4JMNA 1U8HA 5EUOB 3N04A 5T5FH 4OCWH 4GBXB 1XSKA 3EYSH 3V5KA 3SKJH 3V6ZB 1F56A 3IBEA 5J9PB 2OSLB 4N3TA 3KYKH 1JNLH 5D2LA 1UGNA 2RGSA 3FQ1A 4Y2DC 5DD6A 3I3BA 5HHOD 4KUZL 2IH3B 5TDPA 2XSKA 3RVVC 3FQRA 4LBAA 1DVFD 1UM5L 2QQKH 1NFKA 2BVQA 3AJ7A 4WI2A 4XMPL 3PWJA 5F9WC 5LGJB 1AS7A 3VQ1C 1BXUA 4HUVB 4ODVL 2E75C 3H3BC 4ZYKA 1JGLL 1G7JB 3BH9A 1KJ2H 5E03A 3SGDI 4PJXA 2FJFB 2VC2H 3HNSL 3RDTD 4F15C 1MJ8H 2XIBA 5F3BB 4LPWA 4JVPA 4OFQA 2M2DA 2R51A 2XVLA 3I75B 5AVXB 5EC1A 4Z3HA 4MJIE 5L9DH 4YL4A 2NW2A 4KI5D 1MAKA 2O5YL 1IRAY 2R23A 1L9OA 2L8AA 2V7HA 1SEBB 2XNAB 5I17B 3MCKB 4XNMB 5I6XB 4K7FB 3VGEA 3CN0A 4OT1H 5C08D 2VN3A 3KPOB 1DDHA 3TYGL 5KG9A 5DRZB 3VD2A 4N8VG 2B9AA 2GBAA 2CIIB 4FQQA 3O0RL 4X6DB 3LNDA 1OE2A 2EH7H 4F33B 2P5ED 5IJVA 1OW0C 1G9NL 3OKYA 2YAHA 4YPGA 3A21A 4D0BA 1E7UA 4WU5B 2QVMA 3EGDB 4OTXL 5BUGA 1CI3M 1Y6MR 3Q1SL 4NP9A 1ZK5A 5AYUL 2DIEA 4WUKL 4P4KC 5HYSA 4WV1C 3GBEA 3B2PA 2H32H 2ZOKA 1J86A 1EBPA 2IMMA 3EYVB 4PS7A 4O2FB 4M48L 3DYPA 3NOIA 3RFZC 1R17A 1QSEA 3SPGA 5AOJA 1PFCA 1MXGA 1L6ZA 2FE0A 4LF3A 3ULVL 2QEJA 2VOTA 2XQBH 2ZD0A 2TSBA 3DXAE 5CMAA 4PRHD 5DWUL 5IBLD 1EA9C 3D34A 5DZNA 2BSDA 3W11D 2Y69B 1AGFA 3BAXA 3O9WA 5KWYC 4XZUB 5GISH 1DEDA 1CLYL 2VITA 1HXYB 5AUMB 3DO4A 4M5SA 5HI4D 2YN5A 1DSFL 5CS7A 3BQUA 5DSCA 5J11C 1AJ7H 1FV1A 2WZ6A 4TUUA 4GS7B 3D4ZA 4GI6A 4UIKL 2CRZA 5IGXH 2NW3B 4N87A 2COVD 3CN3A 1YYMH 5F8QC 2QR0A 3PNWB 3OZLA 3RX9A 5D70H 2R7EA 2H3XC 2HTLC 2ZF8A 3DROB 1XGUB 3CUPA 4I2XA 2ZICA 4N86A 2HSIA 5ID1A 4U1HB 4G6KH 4MJJA 5AQ0A 5DRXA 2DLFH 2DWYA 4ZFOA 2UZYA 4AIXA 5AFAA 2Q7NA 1HE8A 3VFRB 4KK9D 4KJYA 4G6AD 1T1YA 1H3GA 2DL2A 3KM1A 4RMQA 5EDSA 3Q6GH 2NT1A 1GMIA 4Q52A 4NXKA 3P3RA 3TBBA 2PWFA 4MMZA 5DC9B 5L4MA 5C6WH 1CYGA 5IJKA 5LWYL 4ZFZB 3GXUB 1ODAA 4LAJH 5C07B 3RWCA 4ESKA 2BVOB 4DEUA 5E8EA 3FHEA 4JM2B 5C0AB 4YHKH 3CFMA 1A4AA 2XRAL 5D7LA 5KSBE 4IOFD 4WNJA 4O02A 3UAFA 3OX8B 4KJPD 2R29A 2Q10A 4NUGH 2R0KL 3HFML 3BDYH 2IPUG 1RHHA 4JY5H 1E5CA 3D50A 3V0VB 1AHKA 5KN5B 5AALA 2IBBA 1O6SB 4ICXA 4Z78A 4J3OG 1SY6A 2WLLB 3K6FA 2IVFC 5CGTA 2VNCA 4BZ1A 1HEZB 4NCC1 4NN6B 3RPIA 1UA3A 1YEEL 2P47B 3EJRA 1F4WH 2EXWD 4XAWL 2NR6A 3P40A 4MXWH 4R7DA 4UTBH 5DJZA 5EOCH 1U8HB 4HUCA 4A55A 2WAQA 4LLMA 5F96H 1R24A 4X7EC 4KZ0A 3V5KB 1ZEAL 2XETA 2YAPA 3INUH 3DX9B 5DD6B 4Y5XB 3UC2A 3F12B 3OAYK 4H8QA 4U7MA 3SPJA 1I1YB 4NZUH 1ZE3C 4OZGF 3AU0A 3AS2A 2VLLA 4Q2ZA 4JO1L 4PGCB 4JX0A 3WBDA 2QKSA 2N1TE 1ZLVK 4GP8B 1CFVH 2NOYA 4ZYKB 3BH9B 4PJXB 4X5PA 1ZVSA 4WI3A 3EH3B 2IGLA 2XPZA 1NGZA 5IHUH 4PFEA 2EE3A 3FRUA 4PJEF 4QOKD 1BIIA 1KG0A 1IFHH 2NW2B 2R23B 3CZLA 5LN8A 3H9ZA 2E3VA 2WGXA 2WV3A 3HNTH 4DO6A 5KG9B 2DQUL 3ROLA 2F08A 3EH5B 3VXMD 4D9LH 3ULUF 4WEBL 3QZMA 4D0BB 1UWXH 1CG9A 3VXRD 1NOFA 3WNNA 1VKXA 2F1AA 4FCHA 3DHUA 3IPEA 1IC0A 2VDLB 5MEQA 2WB7A 1A6VL 5F44A 5HYSB 5K9QG 1MCEA 5B7MA 3R18A 1H9DA 3BQVA 3KGRA 5BQDA 2ZOKB 4G9FD 4RAUA 2IDUA 4NRXA 1FFNB 2PTUA 5FO8A 1AE6L 2CK0L 4GKLA 4DP9X 1JCKA 1IEAA 1H3UA 5K5YA 1KPRA 3T04D 4ALAL 1HVXA 3MXWL 1VSCA 1SQMA 1W2KT 2W92A 4IRZL 1I9IL 3SDYH 4FQJL 3ZKND 3CCHA 3CDGA 3Q06A 1F41A 4P2QE 2APXA 2CJUL 4Y9BA 1V3MA 4YE4H 4AKOA 2NTSP 3R06A 1AGFB 1IIIA 3O9WB 4M29A 1A3QA 4JPIA 4OUUA 1HHIB 1JRHI 4GIOA 2F18A 4K15A 5E4EB 4Y9CA 1LXMA 3VGBA 4UM9A 3BZFB 3CAFA 2VLME 3T8MA 1F3DH 2O5XH 4PJ9C 4OGXH 4XMWA 1GJUA 2EIZA 4PY8I 5AAPA 4OLUL 2E7LC 1MJUL 4ZJ9A 5GHWL 1OARH 4OZFA 3WKQA 2UXGA 6PAZA 3SJVA 5EIIG 3LKNB 4LT7A 3FUIA 4E41D 4OFIA 4AM0A 5HHXL 2DIAA 4AZ8A 3AG2B 2KZ1B 5DHMC 3EBIA 2R7EB 4I2XB 1A6WL 3M8OL 4MYPA 1ILUA 4P23C 2R0WH 2A6DB 2O6CA 3GZQA 5DRXB 3O6FA 5E2WH 3V52L 5JO5B 4ZFOB 1H6EA 5E8OA 1KCSL 1YEDA 3N1FC 2WN3A 2FEJA 3GBLA 5TK4A 3N41B 4G42B 4KJYB 1X5LA 1RERA 5AL8A 4QR7A 4Z7VE 1GR7A 4XBGA 3MTXA 4Q0XH 4GLRI 5SWQA 2BOBB 4MMZB 3GUTB 3MXVL 4N8UA 4L2LA 4YGVA 4WI8A 2AJXL 2ZCZA 1BOGA 2EICA 4WTXA 4Y5YA 3QULB 2KLSA 4W93A 3MKGA 3BVUA 2NYZA 4O02B 2CUMA 5BCAA 4X9BA 1GCFA 3B9AA 1VCAA 3LS4H 2V9UA 3VG0L 3MQIA 4LLYA 4TSAH 3HRZC 2YMXL 3V7AG 5KVEL 2RR3A 4X80H 4JREC 3FU8A 1BX2A 4Z78B 4L4TD 3IGAA 1NMBH 1VERA 2DQGL 1H3PL 1HU8A 2I27N 2AI0L 1RSYA 1UD3A 1TETL 3NACL 4IKNA 5DJCB 4Z7WB 3EDKA 1SJMA 4QRAA 3WFCH 4OGZA 3TH2T 1V7NL 2D3LA 3RPIB 4GXFA 2VZSA 3SYCA 5DZOA 4EXKA 2AEPL 2ESVA 2AQRA 4R7DB 2X4UB 1OGPA 2LU5A 1M05A 4XVSL 2C4FU 2DL9A 3LEVH 5AW1B 1J0IA 4ZX3A 3FQUA 1JPFB 3IFLH 4JK0D 3MYZA 3QYCA 2CKBL 3IMTA 3C2SA 3RTQD 2Z31C 3B9KA 4KRLB 2P5WA 3GPSA 1FYHB 1XZWA 4F2ME 3EFDH 5C0ND 4AW4A 2XV3A 1JPEA 1MFAH 4ODBD 4ONFL 1EIBA 3B3BA 3VWKA 4M9PA 5DD3H 1SFDA 3S9DB 4WO4A 2VLLB 4LRNL 1ITBB 1NJ9A 1K5NA 1NGQL 1Y1DA 1F11A 2R56L 3LJ3A 2YKKA 1INDH 3HC3L 1NAMH 1T5WA 4X6CE 1WPCA 3ZDZE 7CGTA 3IXAA 5IB1B 4ZOEA 1B0GA 2AK4E 1LE9A 1QO3A 4KO7A 1KG0B 3IBOA 3EOYG 3SBQA 2WBJC 4JFYB 2MHAA 5DVNA 1IARB 2PR9A 3RVTC 3C8DA 4ZTOL 4TTDC 5E9DE 3WNMA 5JPMC 3MRCA 1EUTA 4PLKC 2DQDH 1A7QH 4M7JH 3PP3K 2C5DC 5L2JB 3WCYA 4FQLH 4WIQA 3JV0A 4X9IA 1JWMA 3UEZA 3L4VA 3LB6C 1W9XA 1VKXB 3BUYA 3U0WH 2XIDA 2EDNA 2CIKA 2EDLA 2WLYA 4KUCF 4WI0A 2VLRE 3NJKA 1WYJA 2CJ3A 3FTGB 4ZODA 3N1PC 2ATPA 4NQEB 1S9WA 4F1SA 4NRXB 3QCTL 4PJCF 3MCLL 3V4PH 1MW3A 1TKWA 1GMEA 4OM0L 5HXMA 1C12A 3OAUH 1KB5A 4LLVB 2PW2B 2DQCL 4ODHL 3CCHB 3I9GL 1SYVA 3OM3B 1RFDH 1S5HA 1UEYA 2JKTM 4FF9A 3S35L 1WFMA 3HZYA 3WKYA 1XGPB 3R06B 4OIBA 3QUZD 4I3SH 1T22B 3DMMA 1YYLH 4JPIB 4OUUB 3N50A 4MJIA 4MASA 4OM1H 4YSAA 3LDBC 4XHJC 3P2TA 4RMBA 3HI1A 3MBWA 2WC7A 4QWWD 4FQIH 4NC2B 1CURA 3RIKA 5CEXB 1SZNA 1VESA 2F7IA 2EIZB 4FFTA 2NX5E 1OL0A 4R9HA 4O2CA 2GJPA 3L3OC 2WN2A 4ZXBC 4XP9H 1ZT4A 2E6PA 3REWB 2YPKB 4IGBC 3DX6A 4I1NB 3SJVB 2BWDA 3VYNA 3WMQA 1PBYA 4OCLC 2QQQA 4CMHC 3VWJC 1MJJA 4K5MA 1DLFL 4AZ8B 4GI8A 1RD6A 3O2DL 1FVDA 4YO0A 1LEKA 5E94A 3NDYE 3UJIH 4FXKB 3S8GB 1SHXA 2IDTA 4X5WA 2YXMA 3DVNB 3O6FB 2VXVL 2KZWA 1PG7H 2DEWX 4NO5A 1YEDB 1XBRA 1IB5A 5EUOF 3WGUB 1U2YA 1I9RH 1NCWL 1MH5A 1YY9C 4MXVF 3DXAA 1KT2A 4DT2A 5D71L 3HE7C 3GPEA 2CLRB 1P2CA 2QGCA 2WIIA 4OZFG 4IU3A 5SWQB 2YUXA 3H4HA 4A2FA 1NMCC 1XIWB 2VN7A 3KWWB 1E0OB 1C7TA 2XI9A 2VAJA 1HN1A 3FQWA 1BOGB 4UT9H 1PD1A 1R3HA 2AK1H 4Y5YB 3HE6C 4A38A 1OZTG 1X7QB 4OAWA 4I4WA 1WIUA 3MCYA 3REVA 5IFJA 2KS0A 5CGYD 6FABH 1DJHA 2HVKA 5BOPA 2MH4A 1Q1JL 2BVPA 5BVJA 5I1HH 1N6QH 4ZUUB 4PRPA 5GRVK 3S37L 4Z7OB 2OJ1A 4HS8H 4FXGA 2WXJA 4N0YL 3QUGA 1M3JA 5E4IA 3RGVA 5IOKA 4LCYA 2B39A 2YUWA 4I85A 4X6DF 5IUSA 1UKQA 1VB9A 4JE0A 3X3GH 4DQOL 2HRHA 2ESVB 2PCFA 4UT6H 5D93C 5GSRB 1M05B 5C70A 4WCYH 1XH3A 2GIYA 1M42A 4M00A 1GOGA 2BIHA 1RULH 3B9KB 2Z7YA 1IM3D 2P5WB 3OKLB 1U91A 2WK2A 2FX9L 1L5GA 3JZ7A 3NABL 1IBZA 3VWKB 1MF2L 1TCRA 1JPSL 3T4YB 4BKTC 3Q2WA 2K3TA 2YJQA 3OKKA 5GGVH 1MNNA 4GUCA 2WBXA 4R8WH 4D9RD 1NJ9B 1K5NB 4XCNB 1DVTA 1CUOA 5CU5A 4YQXH 5J6HB 1BCIA 5KSBA 5EEVA 1T5WB 4HPYL 4JHWH 4L9LA 4BIKA 2E27H 3MGAA 5I1GH 4NNYA 2VN4A 2OMZA 1D7CA 3IXAB 5EBMB 3ZDYE 1B0GB 4XMLH 3GSXA 1YECH 4PJIB 2CR0A 2MHAB 4J3UA 1CDJA 5HGGS 4LQFH 5EBWA 3K72B 4Z76B 2G9HA 4N1CA 4Z7UE 3MRCB 3SE9H 4BH8A 5E24E 3SDAA 1OGTA 4J3BA 2X4PA 5JNYA 5I30L 1T21A 2GJ6B 4JRXD 1JWMB 4ZW6A 2P9RA 3ABMB 3WIHH 1DBJH 3ULUD 3BUYB 2J8UB 2OJZH 2GK0A 3EBGA 2WYHA 3G5YA 5BUPA 5HYEA 2CHZA 4FFWC 4D7BA 1BFTA 2ATPB 2XVGA 3QUXC 4IJTA 4M1DH 5B22A 1S9WB 1BQRA 4AG4H 1RU9H 2MQ3A 3ATBA 4A6YH 2AQQA 5EBLA 2G5RA 5LJYH 4JFXB 5IESL 4UQBA 1TKWB 3ZBMA 3WEBA 5CUSH 3QQ4A 4L3FA 3IJYB 4AWJC 1KB5B 5FYKU 5D7EA 2ADYA 2TRYA 1SYVB 5KSAA 3QHFL 3HZYB 3OZ9L 3GS0A 3RX5A 3BPOC 4AJYV 4PJGF 1KTDA 5HJ3A 2C9UA 4R0LA 3FQTA 4WWNA 3HI1B 2VLKB 3MBWB 3CXDL 2OULB 1R5WA 2A38A 2Y23A 4JM2F 2NY4B 2YFNA 4F93B 2ZCHL 3DSFL 4UQ9A 2CGRL 4O2CB 2NXYB 2VM9A 1KLUA 1ZT4B 3GTTA 1X5AA 2WXIA 3L45A 5JQHC 4QKXB 5I6PA 3PGCA 1MAML 4MNQD 3TO2B 2X1XR 3BAYA 4R97C 5HYQA 1ZSHA 1FVDB 4YO0B 5ICZB 5BUAA 3OXSB 1I3RA 2YR3A 5E94B 5L8JB 4X5RA 3SBPA 1D6EB 4QXWA 3MR9A 1KCRH 3EOBA 4ODUA 2XWRA 3MRFB 2BNQE 3IN2A 4S1QL 4EBQH 2FNBA 2WQ8A 1OPGL 4M8VA 4UV4H 2H2PC 4IBLT 3SDXB 2EDHA 3O3EA 2C3XA 1KT2B 1N4XL 3FJTA 4X5QA 5MI0B 4P2QA 2I9LB 3DTXA 3V7MA 3CSYA 3DI2B 3X11A 1P2CB 3F7YA 5DT1H 4F7TB 1H5BA 2WIIB 4IU3B 3T09A 3WTUA 5EA0H 3FQWB 5DURD 1AI1H 4HWBA 2HG5A 2F19L 4XPHH 5IQNA 5DQDL 1UADC 4PJXF 4HALA 1J8RA 4W6WB 1Q72L 4N2HA 4DP4X 5A6IA 4X42A 4AEIH 5IFJB 3D39E 3FSAA 3FAWA 4X99B 5DHVH 1GTNA 5AG9A 2HVKB 4UDUB 1BD2E 3MRMA 5JA9A 2BRQA 3C60A 1ZIBA 3ZTCC 4K7PL 1MNUH 4PRPB 1G1YA 2IH8A 1DFXA 5DJ0B 3NFSL 2APSA 3RGVB 4LCYB 3EYFA 2WLZA 3DUHA 5CNHA 3RGHA 2PCFB 2WBWB 2ED6A 4WSJA 1KEMH 1XH3B 2YD3A 3QCVH 3IGUA 4HWZA 3KYOA 1H0DA 1G7HB 4ONOA 1R6VA 1UXSA 5HTSA 5IM7A 3VXUD 1U91B 4ZMZA 4XN2A 1EHLL 3LN4B 5DU7A 3H6AA 4Z7VA 3ULSA 3UXFA 5KTEH 4AK2A 1FC2D 2AEWA 1NDTA 1LL1A 2F0CA 1P5UC 2N3JA 1G6VK 2J6EL 3DA0A 1QSVA 4E9RA 4HBCL 4RFEA 5K9OB 4BFRA 1JXFA 1HE7A 1NPUA 5JHDD 2A74C 3NSYA 3NSDA 4PRNB 3HZMA 1LVEA 3IMSA 1U3YA 4LGRB 4GH7B 1BXVA 2DI7A 3FSOA 1WSST 4R2GB 2J55A 3GSXB 5AYQA 4RFOL 5C2BH 5AVQB 2V3EA 4L1DA 5D1XB 1U93A 5IHWA 4NCC2 4JPVL 2G9HB 5HHVL 4B5EA 3LPFA 4KKQA 2F7QA 4QRSA 5JNYB 4M43L 3BLKA 1DBKL 3IFNH 1ZV5A 3ZTNL 1WG3A 4J3WA 2E46A 2PCPB 3QT2A 2DBLL 2OP4L 1UJ3A 3W0WB 2Q5BA 1HEJC 3G5YB 1HH9A 2BP5M 2YXWA 3MUUA 4XNUH 2ZT9C 2Q87A 1Z32X 5HI3C 4AQAA 5ENWA 4F2MA 4KUCD 2HKHH 1NCUA 5HDRA 2OSWA 3X3FL 3JV6A 4POZD 3S34H 1Q1PA 5EBLB 3SBWC 1OTUD 2WYIA 5A2LH 4Y16C 1OTSC 4G8IA 4URKA 4N68A 2CBQA 3QQ4B 5FHAH 1OLLA 2X12A 3QRBA 3N41F 4X6CA 4G6JH 2VXQA 3FXIC 1ML0A 1CPUA 2R9HD 3M7OA 4AMWA 4YZFE 4RGNC 3FN9A 3ZDXE 3MRLA 5IIEA 3WTYA 4Q58C 2AK4A 4DP7X 2FLBT 3GXIA 4R96B 3QUMH 1QD0A 3UAJC 4U6VL 5HJ3B 4R0LB 4GRLA 3X1NA 5E9NA 1OAQH 5EF1A 3VDAA 1OKEA 1BVLA 2E56A 1R5WB 4FNUA 4R5TA 3ZE2E 5E9DA 5EU7E 3MHZA 3PJLA 1RK7A 1AXTL 4BH7A 2HFGL 4R7NA 1Z7JA 4CGTA 1D9KA 2JWYA 1P7QA 3PGCB 3QFGA 2OI9C 2D3NA 3RHWK 2JI2A 4NENA 5HYQB 3DARA 2VLRA 2EDJA 4PI2A 5AB0A 4PR5A 3ECVA 3DHPA 3FF8A 1PEZA 1NICA 3P9LA 1TJMA 4KTDL 2IBZY 3MR9B 3WIAA 1TQVA 1MCQA 4ODUB 4RDQG 4YBLB 3DVFA 1MHPL 4YHZL 3KD4A 4WGWB 3WIIL 3BGMA 2JJVA 1BAFL 4LRIA 4NKOA 3O3EB 5CZKA 1ZANH 3LHPL 4UQAA 1S9YB 4GBXD 4WFHE 1B9KA 4UQDA 4E9LA 4P2QB 4PJBE 4B9GA 3DTXB 1XVSA 3S3BB 2OX5A 3X11B 4DVRH 4C4KO 4ZDHA 4M8UA 3EGXA 4H8VA 1VFUA 1JK8A 4KTYA 1TEGA 4YBHA 3T0XA 4MVBC 1UH2A 3PCYA 4M61A 3SGKC 3QCUL 2Z4TA 2N56A 2CUHA 1IBDA 1UENA 4FAAB 2JIXA 2NX5A 4OB5H 4BGDA 1K6QH 1JHTA 2ZPKH 5EEXA 3HG3A 1IGCH 3T8XA 2WLMA 3MRMB 3C60B 2DWTA 3EJYD 3GM8A 3L95A 4HJ0D 3GLAA 3PHQA 3HC4L 3SCMC 3O8XA 1UM4L 5AW2B 1XX9C 3EYFB 5DD5L 4QAMB 1DVXA 3OGCA 3F5WA 3I85A 3RL2B 5IB5A 1F97A 3ZYOA 2NY2B 1SDYA 1WP6A 4HWZB 3KYOB 1XL4A 1H0DB 1G7MA 5TH2A 1UT9A 5SV3A 1UXSB 1X9RA 1FL3B 5HHNA 3ZZLA 4EN2A 2FO1A 1CXKA 4N5ED 4GIAA 3FUKA 5GGRY 3T6WA 2QSQA 3CLEL 4Z7VB 3ULSB 5FKAA 5IEHA 3QJFA 1M56B 4KX8A 2B1OA 2V2XA 3SGEH 3QC6X 4PYHA 5DK0A 4YDZA 1IVLA 3KWTA 2C7UA 1VFBB 3OKOA 4RFEB 3BIKA 4LIQL 4F7KA 4BE6A 1QFWI 2ITFA 2P45B 5D96C 5DFVD 1WHPA 3OKNA 4X98A 3PHSA 5D7SL 5CAYB 3L5WA 4X6BB 5E51A 4N85A 4LCWE 2CG9X 1CE6B 3NP4A 2E7HA 2EKJA 2GAZA 2P3YA 4XMTA 3P4MA 2IGFL 3OSKA 3UOAB 4LEBA 2VGLM 1A6TA 3L9EA 4A2GA 2QFPA 3BUIA 4NQSA 4QRSB 4R26H 4XCYA 5E8DL 2RFXA 4MB1A 2ZG1A 1SXSA 3HBPA 2HPOA 1I8AA 4AEEA 3IDNB 4Y1AB 3P69A 4RZCA 4YDVA 4XP5H 5KJ7E 1UJ3B 1LP9B 4W1TA 3LMJH 3FYIB 1HH9B 2FEEL 3MA9L 4C55A 4AQAB 3HMXL 4F2MB 4FADA 5FCSH 3IF1A 3KYNA 4EOWH 3ECBB 5B3JE 1A1NA 1UXMA 4HK0A 3F7KA 1GYUA 1WIOA 4LOVA 3Q7JA 1ZS8B 4FZEH 3DO7A 2HFEB 2XZAL 2ZX5A 2Z31B 5IVOA 4UB0H 5GRWA 3BVDB 4X6CB 4KXZH 4AYDC 3ZDZB 2BDNL 2AJVH 1XFPA 2JB6A 2YD5A 5IIEB 3AROA 4QRBA 3POCA 1CYWA 4JFZH 3OGOE 4JFPA 1AR2A 2OS7A 4ABWA 1J7VR 2Z8RA 3BZ4A 3MRPB 4GRLB 3P9WB 3IAGC 4G7QB 5JIIA 1XR8B 4L8SA 1IT9L 4PRIB 5E9DB 4PGDA 3LZPA 2GHZA 1QRNE 3CVIH 4Z7UA 5AOIA 5C07D 3FZUC 2P8PA 3RB5A 1E4KC 4ANWA 3QPQC 4BH7B 1IKFH 2BK8A 3LRSB 3FOMB 2QQNL 1D9KB 1SJVA 3LQAH 1P7QB 2LTQB 1LWJA 1KIUA 4LESA 4NENB 2RALA 1CK0H 1PD0A 2D2OA 2VLRB 4Z7OF 4PTTA 1G43A 4ONHA 3HAEA 4PR5B 1U8JA 1FLTX 3KNBB 1MVUA 1UFUA 3P9LB 2CBOA 2YGNA 1UXWA 2IMNA 2N01B 3A6CH 2ZSVA 3UC0L 4GNKB 2QADB 4ZQTA 1JF1B 1G4RA 1TYJA 4ANVA 4DP0X 3KBFA 4NKOB 4MHHG 4HFUH 3HG1D 3BX7C 1YC7A 2BLFA 4BKLB 1NFIB 2CU9A 4QJ4B 2OX5B 2DKSA 4ZDHB 2X09A 3EGXB 4H1LB 3EO9H 5IMMB 1P4IL 1JK8B 2HLEB 6PCYA 3BKYH 5GJTH 2JV6A 4Q14A 2XA8L 4M61B 5DLMH 5T1LA 4I9XA 2Z64C 5IVNA 1UFGA 5DC2A 1BREA 3L4XA 1BFSA 1RIVL 2JIXB 2NX5B 4Q9RH 3ZDWA 2BSRB 1JHTB 3WO4C 1KFAL 4WI7A 3T8XB 5I71B 1BGXL 1NAKL 1OGAB 4E5XG 4NKDA 1UM6L 3EJZD 2MOVA 3GMOA 3K7UA 4I77L 1KJMA 3VVWA 2F54E 3JV4B 5AKVA 3GMPB 3L95B 5GRUL 2B5IC 1VFAA 3PHQB 4YXLH 2ZWNA 2UVFA 3WOVA 4KGLA 4Z95H 4FFYH 3S4SA 2CR6A 4YX2H 3OGCB 4S2SB 5IB5B 1K2DA 4XI5C 2PPFA 2WKGA 2BNQA 5F1OB 2CO6A 4HGWB 3RZCD 5DHDA 2LU4A 1G7MB 2Y6SC 1HKLL 5TH2B 5HHNB 4X8JA 1IC4H 2DTML 3GDCA 5DDHB 2WLHA 4WI9A 5GQBA 2A83A 2H26A 4WFEE 3CJJA 4ZI8A 1QR4A 4MDRA 4EMZA 3P3TA 5BJTB 2AXFA 5FKAB 1R5IB 2WZPD 1H19A 3GSWA 1BA9A 3QJFB 4L1LA 1KC5L 1RCYA 5FYKE 3BIBX 1BXAA 3HJ0A 2V2XB 4J23A 3F7RA 1U95A 2L7EA 4HFWB 4HT1H 3WNLA 5DFWH 3TZVC 2C7UB 1ORSA 4FMKA 1YNKH 2OMUA 3OKOB 4ODXA 4GP5B 3BIKB 5ACZB 1EX0A 1IM9A 3BPCA 3GSNA 4RMWA 5SX5K 3ZE0B 3L5WB 2EDXA 1F90H 3V9FA 5HYFA 4IKLA 4QTIL 2IDCA 3FTXA 1BD2A 1ADQL 3B7SA 3VXSE 3FB5A 3P4MB 2FWUA 2NSMA 4DERA 3VFUB 3AS3A 1PG7W 3RWHA 1A6TB 1WWCA 2OR9H 1EGJH 2Z34A 3T0EC 4PGBA 4OLYH 4EZKA 4NQSB 3TJEL 2AKRA 1UCBL 2VDPH 3ULVD 3JZYA 2FH6A 4M5YH 1T83C 3RAJH 2KI6A 1AZZC 3VTMA 4YDVB 4RZCB 1J1OH 2WVSA 4R90L 1U8CB 2VDRL 2A6KB 5JW3H 4QXTB 1TTCA 1A4KA 1E5AA 2XIIA 1M6UA 4KY1L 4R4ND 5AW4B 3UJTL 5BS0E 1YUHB 3THMH 3TBYA 4Q9QH 2VDKL 3MBEA 3PL6D 4A66A 2Q3AA 1EJFA 1ES0B 3N40P 2JQMA 1NM4A 3ESNA 3W3BA 5IKCA 1J9SA 4Y8DC 2F7OA 4MD0A 4EZLA 5FGBC 4I0PC 3ZVVA 2D0GA 7FABH 2VH5H 3P54A 4OLZL 3T0DA 5E8NA 3SDXF 1A5FL 1JPTH 2MCMA 4BFFA 1W6LA 4BWUA 3BAJA 3OPZH 3D4GA 1BVKB 1E40A 2FO4A 1FHNA 3F64A 2PTTA 1OAUL 2GABA 3BZ4B 1QX1A 2XWZA 3UIZA 3BVNA 4FQ1H 2YGOA 1CGUA 3MJ9L 4ZAKA 1DQDL 4PGDB 3MBXL 4YZWA 4EZMA 1QFUL 3K6SA 1ECYA 1NIDA 1URZA 1WZKA 5GZNC 1WFIA 3Q3GA 3PWNA 3QZBA 1MRFH 1JHKL 3BP4A 3P0VL 4PB0L 3NGBB 4R7XA 5BV7H 5E70A 1FL5B 3QIWB 2V17H 2XXCB 4PTTB 5INCA 4ONHB 1HSBA 1UACL 3JUZA 2D7TL 1KZYA 4HQQL 3M45A 2BS8A 1RMFH 1FNSH 1UXWB 3BWAA 2ZSVB 3K8MA 4YSRA 1YEIL 5KVEE 4OZIF 1A1OA 2NR6D 2XLLA 5D9SA 3QUYA 2VMFA 5I1LA 2ORBH 1FYTE 4P9HH 1IU1A 1N6UA 4JZJC 5JOPD 3E3QE 3QJSB 4TVUA 4XP4L 2XN0A 3L08A 2ISDA 5E2JA 3IWUA 1S5IH 1IGFL 1RP9A 4FN0A 5CEZL 3V0FA 1NMAH 1TTBA 5LDUA 2OSYA 4NKQB 3NSXA 5CLXA 3ZL4L 1F4YH 3MREA 3VYOA 3FF7A 2JXMA 3X1GA 1NC2A 5KSBF 3CFCH 4HWEH 3HAEG 4F27A 4LEOA 4N22A 1M7UA 1OHZA 3HUJE 4FFVC 4NKDB 5FPIA 4QXUH 3GMOB 3N9GL 3UG5A 1IC7H 1KJMB 3AU1B 5C0FA 2CXKA 4NS0A