4AQ8A

Crystal structure of mouse cadherin-23 ec1-2 and protocadherin-15 ec1- 2 form ii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
208
structure length
208
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Force-Conveying Cadherin Bond Essential for Inner-Ear Mechanotransduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords CADHERIN-23
total genus 46
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aq8A01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aq8A02
3FF7A 4APXB 1OP4A 4XXWA 3LNIA 5JYMA 4XXWC 4AQ8C 2OMWB 4ZMNA 3LNEA 2OMVB 4ZMZA 1ZVNA 4AQ8A 4ZTEA 4ZMLA 2QVFB 2OMTB 3FF8A 4AQEA 1ZXKA 2QVIA 4ZMWA 4AXWA 2V37A 3QRBA 1NCHA 4QD2E 4AQAA 5JYLA 3UBFA 3K5RA 2EE0A 2WD0A 5KJ4A 2A4CA 2O72A 3LNGA 2WHVA 4OY9A 4ZT1A 2A4EA 3Q2WA 3Q2LA 2OMXB 4NUPA 2YQGA 1SUHA 4AXWB 4NUMA 5CZRA 4ZMTA 4ZMVA 4ZMOA 3MVSA 1NCGA 2OMZB 2OMUB 4ZMQA 3K6FA 2WCPA 4ZMXA 1NCJA 1L3WA 2YSTA 4ZI8A 3UBGA 4AQAB 4APXA 1NCIA 1EDHA 3LNDA 5CO1A 4AQEB 4NUQA 1WUZA 1O6SB 3K6DA 3LNHA 3K5SA 5DZVA 2WBXA 4ZMPA 1WYJA 3PPEA 4NQQA 1Q1PA 2X2UA 3K6IA 3UBHA 3LNFA 3Q2VA 4AK1A 2OMYB 3Q2NA 4ZMYA 1FF5A
chains in the Genus database with same CATH superfamily
1FORL 3ZHKA 5D1ZA 1NGYB 4XPTL 1UM6H 5CLZA 2V17H 4U6HB 1BQLL 2OMTA 5BZXA 1EO7A 1P7KB 2GIYA 5KYWA 3BRFA 1LEGA 4A7SA 2QLVB 3ZGIA 1P6AB 5EZOL 4R7VA 4XOEA 3SDXF 2R2BA 3DXAB 3PNRB 5JO5A 4PRPE 5BO1H 2AXJA 1PW3A 5AVSB 2NY4B 4P46C 5T1DH 2OLDA 1U8PA 1RZ7L 2WYZA 3UTOA 3WIIH 3NPSC 3KLHC 4FTDA 4G7RB 1E43A 5B3NA 4BSVA 1BAWA 1GW0A 3P4NB 4AENB 1GGCL 1CT8A 2QGEA 2C9XA 3HNSL 3O6FA 1PKQB 3TCTA 1QQDB 3RUGB 1EFXA 1G7LB 3Q9PA 4XC1H 3BSZA 1BQSA 1KN2L 4B9CA 4NHUB 4NPJA 5I6XC 4OM1L 2MKWA 4X7TA 1QR4A 1JWUA 2CKBL 2DBJA 4TQIA 5ABDE 1GMEA 3WKMH 3O0RL 3DHJA 1I7UB 3VI4B 43CAB 3JVFC 5EDXA 1GXEA 1D5MA 3FK3A 1OP3H 3LRLA 3NCJH 4S1DC 5D7LE 4WUKH 1Z1WA 4J4PC 1HT6A 5EPMB 2OQJB 4AZUA 4KJQD 4P2RA 3PQYE 4ZAKA 5D71L 3QZWB 3STZA 2OCJA 5IVXA 4Y5YA 2R1YB 2D8KA 3H4FA 4M4PA 4W9LC 3WLBA 2V2WB 3D07A 2WLIA 3HI5H 4LSVH 4Z5RA 3X1BA 4M7LH 2C7FA 4G1MA 4Z7UE 3O4LA 3OX8A 3CLWA 3K7UA 2J44A 3ZRFC 2JI2A 4M56A 4HMCA 4KQ0A 4OI8A 1IX2A 3VRLF 3VFVB 4HFWB 5E2VH 4ESKA 2FWLB 1WUZA 4DVRL 2Y9RT 2Y1AA 4NNYA 1HSAA 1QABA 4K23H 5DJZA 3E1ZA 3KLAB 3PCYA 2Y7NA 4U0QB 4HULB 3WNLA 1FZKA 5LAXA 4DK3A 5T5FH 2NY1D 4ZFFB 1CLYL 1ZANL 4IGBA 1K72A 4JZJB 1FO0H 5AB9A 1J1PL 3FO1B 2ARJA 1LDPL 1U6AL 4G7QB 4G8EA 4RSVA 3WS6C 4PBXA 4TULH 4LL1A 4PJGA 1D7BA 1NDMB 4AL8H 3DX8B 3PWNA 5CLXA 3ARBA 3W9EA 1IEBA 1NBZB 2WLYA 2NY1B 4HD9A 4Z7WA 4Y7OC 4CN4A 1HILA 2GEEA 1FZMB 2OR9H 3FMGL 3KWWA 4K2UL 4L1DA 5F7DA 3EO0A 5E5MA 1FC1A 2Z31C 4PP1C 2IGFL 5I6OA 2JFCA 2BY3A 5D2LF 5TQ0H 2UXFA 3ARBD 2DQJH 1RZGB 4F7PA 2YGOA 1FBIL 1QR1A 4O2FA 5B3SB 1NOLA 3E6FB 1RUAH 1Q94B 1V54B 2AGJH 5ITFA 5DMGD 1FE8H 3DHMA 4YSDA 2X3BA 3K74B 3O6LL 1KTDA 2BY2A 2XWBB 5I71B 4PD4K 3GSRB 1S7TA 1CFNB 1MLCB 3U46B 5KBLA 2WGNB 2Z92B 5E03A 4DPRA 2BWIA 3ARSA 3DK2A 4X8CA 1WP6A 1NEZG 3FCBA 2GIXA 3IT8D 4HWBA 4U6YA 3SB3A 3TBSB 4ZSOE 3KH4A 3AU1A 1WH0A 3GWJA 6PCYA 1DN0B 1IBBA 1A8JH 2QT6A 2R2EB 5T1LA 3HE7C 3QIBB 4OKDA 3CFBA 4NZUL 4ONHB 3VFUA 1ZLVK 5AD0A 5ES4B 1VKXA 1IT9H 5JUEL 1XGQB 5GGRY 3Q2WA 4JFDD 1DUZA 3D2UB 2O4EA 3ETBF 2KKQA 3JYBA 4MDJB 4JKMA 5KS9A 1TNMA 1Y7VA 3PWVB 4JREC 1B0IA 5IB4B 3LN5A 1D9KC 4XBGA 4DP9X 4Y5YB 3F7VB 4V1DB 1JIBA 2BSTA 5JXED 3MXWL 4L4TB 2NY3D 3DO7B 1CZ8L 3GUFA 4XMWA 3WELA 1UFUA 3VDBA 1MF2H 4FP8H 4WWPA 4LCWE 1X5LA 2GTWA 4U1HA 4X6DF 3N41F 3NEOA 4Y8DC 3OV6A 3RVXD 3PV6B 3Q06A 3D51A 3MX0A 3SPVB 3GMNB 3VXQA 5EEYA 4P3WA 1KTRL 2OTWA 3H6AA 3RWIB 4Y5VA 2DWDA 3KR3L 5HYFA 4LOEA 4ISVB 1XF1A 5HY9B 2ALWA 1FP5A 1AMXA 3ESVF 1FUNA 5DHVA 4RZKA 5F7LB 3MLPA 4OH2A 4P5TC 2BVTA 3RG1C 4FG2A 4OM0L 5C0CE 2IQ9H 1R3KB 2L7EA 4WHTB 3GHBH 4XB8A 4EO5A 3ZTCC 3UZEC 1I4FA 4KMLB 3UJTL 4QRRE 2VDML 4FXKC 3ZYIA 1ZS2A 2CO1A 3B2UD 3NJNA 2C3GA 1G6RH 1IGYB 3LKRA 5J13B 3TFBA 4Y4FA 4MQ7B 4PG9A 1MJJA 2OZ4L 5E9AA 4N3TA 1W0YT 1XH3A 3MRMB 4XC3L 1S8DB 3GBDA 3LQMA 4J3WA 5D70L 3RB7A 3SODB 3TJEL 3OPZL 4QYOA 4ZMYA 3ARDB 2VIRB 5C0FA 5IGXL 3W37A 1BIIB 3FUFA 4K94L 5E4IA 1R3JA 5BV7H 2VLLB 4UTBH 5DD5L 3GSXB 3X3GL 4NI3A 5IUSA 4I87A 4OCSL 5DMKA 1NCCL 4FFYL 1LO5A 3NACL 3O6KH 1KC5H 1V3MA 2CUIA 2ZCHH 4LSDA 5F3BB 4JS7A 4JHZA 1NGWB 3OLDA 4NNPL 4KTDL 3LXAA 3B9KC 4A38A 5I71C 3MGAA 4NQSB 3I6SA 1FCCA 2X4NB 2DQ6A 1ZLUH 1XEDA 4HLZH 2VDOL 2Z4QB 3BRGC 4NHCH 1QI5A 1BEYL 5EEUA 4JO4H 5KBMA 3S98A 1NAMH 4IMLA 1BAFH 3PHQB 1KJVA 3KLHD 2C9AA 4FI6A 1UM5H 3EG9B 1MCOL 1H5BB 3BMVA 3I85A 3QPKA 1B0RA 4FQJH 4LHQB 4NO0D 5IMOB 4RMTA 4NJ9H 3L3GA 1BW8A 3HHMA 5T3XH 3MA7A 4U3CA 3W38A 2EDKA 4LSRL 5JR1H 5CSZA 2OJEA 4YQXH 2EXWD 1FFQA 3WTUA 3APFA 4PSRA 3AGWA 3L8QA 3GIZL 4YN3A 1IRAY 1FVDA 3HI1A 2YA2A 1ZSDB 3HJEA 5AVZB 4ZW5A 1S78D 4Y5YC 4U1LA 3FJTA 3B9VA 3TTYA 1P2CB 2Y5QA 3PIQA 2H6PA 3P2BA 1GJWA 2VZTA 3UO1H 5DD5H 3UYPA 3S8WA 1GKOA 3S4SA 5I66A 3RVTC 4LF3B 3W81A 2R83A 4I77H 2A83A 1SJEB 2CJUL 4JO1H 4NFCA 4Y9BA 5F6HJ 5HHPB 4QJ4B 1PTZA 2YK1H 4MD4B 2H3KA 2HG5A 5MP6H 4HS3A 4OAWA 3UZEA 2Q3XA 2V5SA 1RJYA 2FYVA 1J1OH 2X9ZA 3AS1A 4U6XA 5TGBB 2NW3A 1E5ZA 1RY7B 4PRDB 5ACZA 1A66A 3QJQB 2VL4A 1DBJH 1E7UA 4DGUA 8FABA 4ZFOB 5TF0A 3MI6A 2OMNA 2XETA 3QYCA 3VD0A 3OAZH 3JWNC 2HLFD 3C08H 4OUOA 4PN6A 2Z1KA 3UTTB 1BM3H 1NGYA 5FYKH 1GTFA 4DKFL 3H8NA 5EUOA 3F64A 1QSZA 1MKFA 3GHBL 4MZ2A 3ARVA 3BH8B 2YD8A 1H8SA 1KGJA 1TTCA 2VXTH 3EH4B 5D7IA 2O5YL 4L1SA 4B60A 4EI5D 4ZDHB 4ZDHA 4QJ5B 4ABWA 5F3BA 4HIEA 1HHKB 1PG7W 1HHKA 2GK2A 3Q48A 2XC8A 3QEQB 3K4DA 3P0GB 4RRPM 4K5MA 4WSGA 1L6XA 5HI4C 4C4UA 3WDHA 2HTLD 5EF2A 4WGWB 4R8WL 3WUZA 4CSTA 3JWDH 2EIZB 4CN1A 2HKAA 3U7YH 4V33A 1S7WA 1OCZB 2ZCLH 2CM6A 3QEQD 3BUTA 4NKMB 2EECA 4AQ8C 2FDBP 2C8NA 5E5LA 3VFPA 1B4TA 1R5VB 2HJKB 2G5BB 2OMVB 1OLLA 3QIUD 4TNVK 2M83A 1DSYA 4O2CB 4JAMB 5T3ZH 4KKLD 3FRUA 4QXUL 4JQIH 4G8GA 2H32B 3UPRA 1I8MA 3LSOB 4N0UB 3OXRB 4M5YH 1LE9B 3H7LA 4PJHF 5E00A 2RHEA 3AB0B 4X4XB 2JKNA 1JI2A 2A7BA 3DX9B 4QJ3B 2IFGA 1FJ1A 4YEEA 5E9DE 3EBIA 4QWWD 2A4CA 2EH7H 4Y5XC 1FVDB 3HI1B 5C0EA 1QBLH 4R4FH 1KTJA 4M7JL 5EA0H 2EP6A 1G7MA 1FRGL 3MJWA 4ELMB 3L3HB 2EDMA 2MOQA 4MMYA 5CZRA 1JNNL 5D93B 3UAFA 2AEPH 4N3UA 1ZTXL 1FE8L 2KPWA 5EIIB 5KS9E 1VFAB 1R47A 1D9KD 4PGEB 3MV8E 4ADJA 3FHQA 5EU4A 3CN0A 4XMTA 4ZW6A 1UUNA 4OD2A 4ZODA 3BVTA 4RAVA 2BHUA 2E56A 4PB0L 1F4YH 1KV7A 4NO0A 1UH3A 4FS0A 1RK7A 3T4YB 1EDHA 1UWYA 3BGFB 3DO3A 2WXFA 4QRPE 1ZKAA 4D0CA 5SWZD 2D31B 4WO4C 2X4PA 3NFPB 3KXFB 3NIDE 1N26A 4PRPB 1M7DB 3DX7A 4XX1G 5EBLA 4AL8L 3BFWA 5EDSA 4UU9B 1MLBB 2G3NA 1EO8H 5DZJA 5GS0C 4JFXA 4H7VA 4GW1A 1WG3A 3UADA 1WZ1H 3KS0J 4GKSA 5IVOA 3QDJA 1NFDA 4PUBH 3FUJA 5FK9B 2VAAA 2QPUA 5B1CA 2EIBA 2DMGA 2I7OA 2DI7A 2VIRA 2EYSB 3BSZL 5C0FB 3CFCH 1YCSA 5ECGA 5IB3A 1F42A 2J2ZA 2A74C 4UZUA 2VKWA 5KN5B 5IK3A 4ODTH 3BAEL 2ITCA 5FW8A 5GGTA 2D9QB 4WW1A 3D52A 5IF0B 1R9FA 1OE2A 1D3CA 1KJ2A 1T2XA 3I6GB 4IBYA 4GUPB 4HPYH 3U0WH 4X5WB 2FD6L 4YBLC 4LFHG 2CDEA 2YSSA 1PPIA 2QTVA 3FFCB 4LEXL 2KZ1B 5FW7A 3GDBA 4BXSV 4P2QD 3VG9B 2IMMA 5D55A 5D71H 5C09E 1JDCA 3WEBA 3WHXB 5I66B 5BQ7A 2GT9A 2Z4TA 4PY8J 1UOWA 4NYLA 5CFHA 2DM4A 5I1JH 5HHMB 3VXUD 3PAYA 3BUQA 4RAHA 3VXTB 3FFCD 4CUCA 3W9EB 3HMWL 4XWOD 1M6OA 1THAA 4ODBD 3F7YB 1LK3H 1UD6A 2OTWB 2UUDK 3HNVL 5KSAC 4PJEE 2DQHL 5TTRA 3QPQC 5DJ8B 1MXDA 3CLEH 5CZKA 3TJPA 4D3CH 4FFVC 5B1KA 4HIJA 3S34H 4KTEL 1A7RH 1E7VA 3QWRD 2F54B 1AOHA 3TF7C 2NUTB 4CADB 2J6EA 4Y19D 1HNFA 2HYMA 4NQUA 3ARYA 2EH8L 2HMIC 2DYPB 3C5JB 1MCJA 4CW1B 1AS6A 3QDMD 1Z9MA 3NCCB 4W4NA 4XMUA 5GS1B 5JZ7D 5E2UH 4YX2L 3KPMB 4P8QA 2AJVL 3W9DB 1RZQA 5J3HD 3HI6L 2DY2A 4A04A 1QW8A 1XGQA 1WFNA 4OLWH 4RAVB 1RZ8A 4OZGB 2Y07L 4GT0A 5DO8A 2I24N 2HG0A 4N8VB 3D05A 4BFJA 4XXDA 1Z0NA 1KXHA 3K6FA 3S88H 2J73A 2DQTL 4HKBA 2PW2B 2V17L 1IC5H 3D18A 3LEVH 3UTSD 1XGYL 2ICWJ 4UNIA 3WE6B 3HLAB 4U1IA 2BDNL 5MEOB 4JY6B 1SM3L 3DX3A 3GMMB 5I6LA 1QBMH 1DCLA 1QASA 3KYOB 3MSPA 2N7SA 3FU8A 3Q6FB 5I1AA 3D39E 1XCTB 3ZE0B 3MLXH 4KRPC 3GI8H 3P11L 4IOFC 4LVHC 5F89A 3QC6X 5DURB 1ZD6A 1IKFL 3E0GA 3GSOB 2P5ED 4XWGL 3MRGB 4F7TB 4JZOA 4AGLA 2EEXA 2XWZA 1YG9A 4J1UA 4KFMA 3CTTA 2AABH 2DIJA 4FNPA 4R7LA 1P4UA 5IF0A 3SPJA 3V0AC 2VM4A 4FQCH 3NSCA 5I6PA 4P23B 4PBWD 2HJFB 1EZVX 5DJXA 3WN5A 4ZJ9A 2P5EB 5EC2B 3WJLC 1JF1A 1ZWIB 4LAQH 3GK8L 4F2FA 4KJQC 3UTQA 5ADPH 1U2HA 3PE9A 1HJCA 4N0YH 3WNNA 3HZKA 2DLTA 3APDA 4KROC 4ZOBA 5DI8A 5EEZA 3GI8L 3P11H 4F80A 1ZE3C 5HYIA 2EUXA 2WWMC 4FADA 1MOEA 4IGBC 1E5YA 4M6NH 1U3HB 2UWEA 2WP3O 4OFIA 3F7KA 4G8FA 2WXKA 2ZD0A 4I5BA 1AH1A 3ARGC 3BPNB 2V4LA 4MDRA 5DZAA 4G1MB 4J2QA 2EDXA 5EEWA 4OF5A 5GGVY 3EJPA 4HYTB 4Q0XL 4LARH 3IJSB 3S88L 1NOFA 3MNWB 5CNHA 3I9AA 4MXQD 1ZV2A 5KSAB 4OI9A 3RTQB 2P8LB 4OB5H 4Y9GA 4PYGA 8FABB 5IESL 4LSSH 5T1KA 5AW4B 1SLWA 4MBOA 5L2JA 2UY7A 2BVPA 4X5PA 3WIHL 4FLQA 2JCCB 4O9HL 4GSDH 4XVSH 3T2LA 1DSFL 2N0KA 5E24E 1RHHA 3VXMD 3TJHC 4FQHA 5F93C 3TBWA 4F7EA 4DEWA 2QPEB 2WUCL 2H26B 1PD6A 3ULVL 1L9PA 2LAGB 2ZP9A 3FU7B 5D7SH 1BZ9A 1UWGH 3QW9A 3REVB 2Z0BA 4WLCA 5K1JA 2HRPH 1E4XI 1XTMA 1AKJD 4RLDA 5DVLA 2XKNA 4PCYA 4KK8D 4UQ2A 1FSKC 3IETA 3QUXC 2F8IA 2IDTA 3FCGA 3UZVA 4AENA 1OTTD 1G9NL 2Z64C 3QNXA 1OGAB 3BH9A 5HVWA 4PREA 3GS4A 1RIUL 3OQRA 2P80A 1LM8V 3DMMC 5GRYA 2DAVA 1JXKA 3X1GA 2BIIA 5J9PA 3GSOA 5L8KB 4GUQA 1KFAH 3IN2A 3BJ91 3M6DA 4AEIH 4WFGE 4NS0A 1ZHBA 5FA3A 4M6ML 3SKNB 3CMOH 3QDJD 2VABA 1HWWA 4PLJC 3MJ9A 1RURH 4FQXA 2BP3A 1Q72L 2D7TH 1IEBB 2HT2D 2OMBA 3L54A 4WNSA 4C83A 4Z7WB 1PYWB 2BP0B 2CPCA 3E80A 4ELKA 1DQQA 1X5MA 4HGWB 3EOBA 3QUMB 1GY2A 2Z6FA 4OLUH 3DOHA 2X4NA 2XWJA 1IEHA 5DRZA 1RFDH 1TETH 1YSOA 4P23C 4J3BA 3NSYA 4DGYL 2OMUA 5ANME 5EIVA 2F2HA 2JKIS 2A9AA 2C4FT 2R2CA 2WQUA 1Q1PA 3ATFA 4UMGA 4L23A 2X1QA 4OLYH 1DJIA 3BCDA 3TIDB 2WLMA 1N4XH 3MOAL 5JW4N 1TCMA 3GXTA 4ODVH 4YPGB 5AB1A 2FQEA 4EVNB 3DX6A 1SLUA 2QQQA 3QDAA 2H0JA 1Y0LB 3Q1SL 5L4IA 2BM3A 2WVVA 3BZDA 4JG1H 1KEMH 1Y6NR 4TSCH 1PSKL 3QI9D 3RWHB 3I74A 1O0VA 2X3CA 4LP5A 1QKZL 5IFJA 5INDA 1D6EB 5HDOA 5J7CC 3QO0B 2R0ZH 1ZDSA 1E4HA 3IFLL 5JXAL 4E42A 1ET7A 2W1NA 2CR6A 1D6VH 5IMLA 2Y24A 5C0RH 5L88L 1DLFL 2V37A 1U93A 3GS0A 3HAEB 3QH3B 1QNZL 4RWYL 2AF2A 3PJNA 3E8UL 4ATTA 4PJ8A 1RAMA 1A3LH 1JWUB 4N5ED 5FO7B 4BKLB 4NC0B 4JRYE 1R3KA 5IFHH 3S9DB 4JB9H 1E9OB 5T33H 1HESA 1BPLB 3O8XC 3PP4H 4FZEL 1YY9D 1USQA 3E9TA 3WDIA 4QIRA 5GS0L 4FMVA 5C0AD 1K2DB 3NCBB 2NTFB 2DLFH 3CBJB 4I3RL 4JLRB 5TE4L 2H32A 5EN3A 4QT5A 3WE6A 2VYRE 1MREH 2AJXH 3BN9D 3HC3L 1CYWA 1DHKA 2QTEA 5G5DB 3CMGA 2VE6A 4TTDD 2P4AB 2HRHA 4J8QA 3AS3A 2GSIA 2NXZD 1EH9A 1L3WA 5E8DL 2YSTA 3LN5B 3L9BA 5IB1A 5C0BD 5FM8A 1FFPB 1BF5A 5C7ZA 4QF1B 3U1PA 5JIHA 4KTGA 4RGMB 3EO1B 4PI2A 1T03H 1CL7H 3IJHB 5AW8B 3IDMB 4WI7A 2NXZB 2XYCA 4DEPC 2C9SA 3JWDL 5CCHE 2C4FU 4PJCF 3BAIA 4XCYB 3BP5A 5JHDD 3TESA 1R5IB 2BJMH 5B7MA 3GKWH 1S9YB 4FQQA 3RHWF 4POZC 1HXYA 2B4CH 4IOFD 3WFEL 5C6TH 1DEEA 3EDFA 1T04A 3PP3H 4N90D 2F5BL 4MKTA 5FOBA 4WK2B 3POCA 1UT9A 1C16A 1F4WH 4KH9A 5IV2A 5IKCA 4GRWH 3TBYB 3NPZB 5FYKL 3MLUH 4XPHH 1ETZA 4G43B 4J4PA 5CN3A 2FT8A 1YPZA 4ZAKD 1B2WL 1BXVA 1MRFL 3KYNA 4X0KA 2CO4A 1IIKA 4MD4A 2ZXWB 4Z7VF 2LGNA 3SBQA 3T4AB 3WD5H 1NCDL 3IDYB 3WXVL 5TDOA 4N2BA 1E65A 4MQSB 4CC0A 2FB4L 4JO1L 4TL5A 1G0XA 4HISA 4XHQA 2B7DT 4Q9RH 4MXWH 2EO9A 1E6OL 2FEDD 3N1QC 4W9CC 1IU1A 4IW4C 1NCBL 3VU1A 3H3PH 3MLYH 5ANMB 3QUYC 4LRIA 1U2YA 1MRDL 1SMDA 4FEIA 4WGVB 4R2GC 3OJVC 4APQB 5C09B 3FHEA 5B22A 1MFAH 3IXTA 4G8AC 4MA7L 4DSYA 4HG4J 4URKA 3OMIB 1NA8A 2Q86A 1QO3A 3I6LD 4RRPA 1BBDL 5T3ZE 1G1OA 3ESNA 1DBBL 3WUWB 4J3VA 3OKNA 3KGRA 2HVJB 4KNSA 1V3LA 4OZFG 5AENA 5C0IA 3Q2LA 3QUMH 5C0IB 3RNQA 1P4BL 4PI0A 5E2TL 1H0DB 1SYVB 3OR6B 3ZTNH 5F6IB 1N19A 1D2OA 2I07B 3BZEA 3GI9L 2NX5A 1G7QB 5T1LB 5SWSB 1OARL 2G3XA 3WLBB 5I0XA 3PWPA 3PWUA 1GJUA 4BFGA 3I6KA 4KV5E 4NHCL 4HIIA 2HX7A 5I1CH 1RZJL 1UM4H 2AQ1A 2EUZA 3KM2A 5DD0L 3C09C 3VG0L 2X6AA 3OGOE 4FFZH 2X4RA 4MNQD 1UJ3B 2YUVA 5I8KH 4AWJC 2VDNH 2YWZA 4X6DA 4YAQA 4CRPA 5A6LA 3NACH 3JWOH 4ZFOA 3B6SB 1IUZA 1JPEA 4OIIH 4LK4A 2A2QT 2NSXA 3KNBA 3V4PB 4ODWB 1YMHA 3MNDA 2APSA 3ML9A 3S3DB 2UZPA 3JT0A 3ZUNC 3NIGE 4GG8A 3VM7A 5TK4A 1ZS8A 3ETTA 1GPOH 1XR9B 3JTBA 4NUGL 4WNJA 4GW4B 4B9YA 4TUKL 3BHBA 3WN6A 3INOA 4TQEL 4UZGA 4XCFL 1CD1A 1OCRB 1RK1B 3I9GH 1H6FA 3OKOB 1I7TA 1I1YA 3VGEA 4G43A 3SYCA 3DTDA 4GW5B 2VXQA 1U8PB 2CMRH 1BG1A 4TQHA 1SDDB 5D7JD 1VDGA 1NKGA 5LAPA 2E27L 3IETB 4TS6A 1UXWA 1ZT1B 2L4OA 1OP5H 4YO0B 2VDMH 4N1EA 2YQBA 3VD7A 3H9SA 3JV4A 4DWHA 2X40A 1E4JA 1T4KB 1CLOL 1U41A 4UCFA 3SKJL 3VXSD 1QG3A 1WD8A 4N2CA 4K8RL 4OM0H 4YNYA 4UUJB 1VCAA 4DP6X 2X12A 3B83A 4L3CA 2XIIA 4QRUA 2ZOLB 2NPLX 1DE4A 3RIFF 4OJFL 1AHMA 5A6IA 1GYWA 3JTTB 2QVTA 4PJ7E 2D31A 1HS6A 2BIPA 2BVPB 5HHOA 4DW2L 4DOHB 4PLNC 3FUIA 1XGPB 4JG5A 5I6NA 1JFQL 1JOIA 2DJUA 3I2CH 3KPRB 1BMWA 4JRXE 3L4XA 2A74A 3II3A 1HE8A 2IH3B 5DR5H 3I3EA 2N56A 4N9OB 4EE2A 4ACTA 2B9AA 3KWUA 5I5MA 1R34A 4J6RL 3S35X 1DQTA 5T1MA 2R0KH 1S9KC 1GYCA 3IF1A 4Z7OB 1IM9A 1S7SA 4CNIA 2P3YA 1RJLB 4OLXH 4AIEA 2PYEA 2WBJB 2HSIA 4MQXD 5CEXA 3QC5X 4PGDB 2A9ML 3EJRA 1UB5A 5TPWL 2G9HB 1TCRB 3N2JA 1ZK9A 2ISDA 2EDJA 5JLZB 1TVHB 3RJOA 4JPIB 3A67H 2VLJE 3ZE1F 2IF7A 1ECYA 1OAUL 4KK6C 2Y4SA 3PHAA 4M48L 4JX0A 3B8SA 3QHTC 2GUOA 2HKFL 4B53A 3RZCD 2DL9A 3UBXA 2F61A 2FUTA 4KBPA 1G1YA 3M07A 4N68A 1XF4B 1P2CA 1P84J 2DMBA 3QQ9D 3VXSA 5GZND 3ULVE 3EOTL 1Q94A 4GW5A 1ET5A 5TDOB 1BAGA 4TTDC 2OZ4A 1JVOA 1ZSDA 4PG2A 4GRLD 4R9HA 4ZUUB 2G75B 4P59L 4IDJL 5CR8A 5FCSH 4XH2B 2BXZA 4CVWA 2B08A 1CD1B 4JGMA 4L5FL 2R2HA 1AQKL 4G5ZH 2AKRB 4AE0A 4JZNB 1U8CB 1O6SB 4NKDA 1NMBH 4LCCC 4XXCC 5EU6B 1JK8B 3B8YA 5GRVK 1MQ8A 2FRGP 4RMRA 2F1AA 1DEEB 3HZYB 3CWGA 2LFGA 4AJ0A 1LWJA 4YDLB 1U8QA 5J3HC 5TPWH 1OCWH 5FIEA 4TL4A 3S3JA 3MFGB 1NGWA 4MB4A 2R8SL 1NZRA 3D3VA 3P4OB 5JIPA 4OCRL 3VI3A 1G9EA 3EFOA 3MV11 5JHAA 3UBHA 4PLKD 2XWJB 2NX5B 1BFOA 2BX5A 3QXAB 4LSQH 5DMIL 4LPCA 4A2HA 4AC4A 3T3MF 1IKNA 1V8HA 5ALCL 1Q9LB 2Y36L 1C7TA 3H9SD 4QHMA 4N8UA 3CZGA 3O4OC 4M5ZH 5E1GA 1DDTA 4JMXA 2VSDA 2YRLA 3FF7A 3PG2A 3F6LA 4PGBB 1F0LA 5E2VL 1YPZE 1U8NA 1FVCB 4N1HB 4OZGF 4PWIA 5DD0H 5I82A 3VG0H 2NX5D 4NRZA 3CAFA 5IVXB 1XH3B 4ZMNA 4CMMB 3UTTE 4C54A 4GP5B 4JVWA 5E6SB 3HN5A 5EU4B 5F7KC 1P6WA 3RDJA 4EDWH 3O3UN 4F7CA 4XZUB 1ZAGA 5D1QC 4PV8A 1CL7I 2WIMA 3HHRB 3W0WD 1CIDA 5IP4A 5DUJA 1EZLA 1GZQA 2GSGA 1MI5E 2WAHA 3S35H 1IILE 1K9TA 3DOIA 3FQNB 3QUML 4XP9H 1IC0A 3L5IA 1MVUA 5B38G 3CLFL 4PJHA 4MJ6A 3MODH 1M3IA 2PWHA 1PLBA 1G7MB 2EDWA 3EOAA 3UBFA 4AC2A 5CIPB 2KERA 1I1AB 2PN5A 3O0RH 4CKQA 4PJDE 5IQLA 4Y1AE 4JPSA 1BFVH 1FJ1B 3VGAC 3G3LA 2OTPA 4JDZA 1CICC 1QLFB 5AOKA 3MJ9L 1T21B 5B1AB 1RZIA 3GXNA 1PZDA 2BW5A 2F53B 4E42B 1RIVL 4R4BA 2F74B 4BSWA 1G9MH 3MLRL 4N2NA 2EDBA 1G5GA 4JN2B 1LO0H 5KN5A 4C4BA 1GJIA 1BJ8A 4Z7VA 4GOSA 5D2LB 3M17A 1NCDH 3KPTA 5DJ6B 1I7ZB 1CXKA 4Z0BL 4AW4A 1KYOJ 5E8PB 1DZBA 4QLWA 5HDWA 1AKPA 4YGAB 4JFZL 4O02B 4RETB 3MLUL 3WTXA 3EFOB 1A6UL 2FH8A 4GAYA 4KHXH 1FGVH 4AMKH 1CF1A 1A4CA 3A6OA 4FLRA 3CFBB 3IDUA 2JCWA 4KGLA 1TMQA 2OJZH 1E4XH 1U8QB 3M1BA 3ZE1B 3QULA 3KL0A 1MFEH 3GI9H 3FW6A 1X6NA 3TJHD 5SX5H 5CWSA 4YE0A 4CVZA 2XIDA 4N8CL 1SFHA 3PJSA 4NUJB 4KMTL 3WIHA 4ZUSA 1Z32X 2G0LA 2V2WA 2J4WL 5C6TL 3TCLB 3OF6A 4KKAC 3LV3B 5DQDH 3OKDB 4YDLC 3AADB 5AZUA 1AHWA 1QBBA 1O9VA 3HS0A 4LCIH 3CU1A 2GJRA 3KDMB 2VL5A 3PFUA 4YFLI 3WIAA 3JVGA 4AMXA 4ENEC 3VRJB 4FDWA 3KJ4C 3ZDXF 4HHWA 3TPUA 4H88H 3SDCA 1P7QA 3HB3B 5K39B 3AUVA 1EHNA 3VFOB 5K1NA 5C0DA 5ICXA 1WAEA 5I0DA 5C0EB 3UZVB 4DGWC 4LF3A 7FABL 2AJUH 5KSVA 3D0AA 4QTIL 4IEFB 1N59A 4WTZA 1LO4H 5L2KD 3PIQB 1JWSB 1V5JA 3RE0A 3PV6A 4ONFH 5HHOE 1HXKA 4A2LA 2BOBA 2OP4H 4YUEH 3P3SA 2CHXA 1QSFD 2F58H 3NZSA 5D5MF 4Z0XA 1RULL 4WKZA 5FECB 4ODHL 4XN9A 1T22B 3PL6D 5DSCA 5CXPA 3T3ME 3WGUB 4QGYA 3OMZA 5L2KB 5DHXB 4PTTB 3OAYK 4GYBA 4AVHA 1RJLA 1A9BA 3MLZH 5H37A 1DLHA 4NN6B 4LLMA 4L4VD 2Z91A 1HC1A 4HFWA 1CJYA 1PJWA 4J8RA 2NY0B 3SJVB 4HKZA 5GS1A 3GBEA 4H8PA 4HUUB 3BEVA 3VJ6B 5FO8B 1MFCH 5IJKC 1OSPH 3TN0B 4O5LL 3HG5A 1S7RA 4HP5A 2F5AL 3IN0A 2WWOA 2DQIL 3UIYA 2VDLB 3RLSA 3RZCC 1QKZH 1N6UA 1XDTT 1U8MB 2CRYA 5D2NC 3BIKB 1XB6A 2NY2D 2DPKA 4H0LC 4YGVB 4K55A 4HA1A 5B3JE 3RUGF 4LASH 4PRAA 4UIKL 3UBGA 4N6QA 2AW2A 2X44D 2LOEA 2MQCA 4PJXE 5IHHA 4FFWD 4MNHB 4MNQE 2WKOA 4X7CC 4JW3A 2NDGA 3AT0A 3A4FA 3EJQA 1ZIAA 3L2LA 2YXFA 4RMUA 4TSBL 2Q8BL 2VR6A 3VTTA 4E41B 4K9EC 3W3BA 4F5CA 4MA8H 2AP2A 4O2FB 3VFNB 2O1AA 4P23A 5D7HA 5ESQB 4FQPA 1RKRA 4I3RH 1D5ZA 1E5AA 1ZLSH 3FB5B 4IBVA 2RGSA 2XXGA 1F6AA 1F6AB 3TA4D 1BZOA 4DEUA 5EN2B 1UFGA 1JGUH 1MCSA 2BHFA 4I0PD 4AH2A 3CUPB 3NIDF 3K6SB 1UACL 2QR0A 5IQMA 3P9MA 4UT6A 4JZOB 1WWWX 2H2SD 3FQ1A 3N55A 1DJXA 4WY7H 2Q7AA 4O02L 1KIPB 2ZWYA 1O9ZA 3BWUF 4U33A 5D7LD 4WGKA 4S2SB 1CXEA 5GSRB 1DLFH 1XO8A 4NP9A 1K8IA 2NYYC 3RUGE 1F18A 5LAXB 2TAAA 4M7KH 2OXGA 2P42B 4BUQA 2C3XA 4DKDC 4X6FB 1NWOA 7PCYA 4BRJA 3IFNL 1J86A 5G4NA 5I1GL 2GJ6B 2EVHA 1I8KB 4JR9L 1UQSB 4KQ3L 3QO1A 1XSIA 1MHEA 5ENWB 2DQEL 2XQBL 4QRRA 2EVGA 2QKIA 5E70A 3S96B 3W9DA 3RX7A 4CVUA 1KEML 2VC2L 1CU4L 4HQQL 2DBLH 2F1EA 3HVNA 5HDBF 3CHQA 3TV8A 5LWYL 5A2JH 3KPRA 3WKPA 1PD1A 2B15A 4P2RB 4U1JB 2J88H 2YGVA 3MOAH 1J9RA 3G6JE 1W8EA 4ERSL 4X98B 1HSBB 3W0WE 1N18A 1NAKH 4YPJA 4O5LH 5DD3H 2W9DL 3VFUB 4Q56A 4JN1L 3MREB 3MDJA 4HDIA 2CPUA 4WV1A 4YDNA 4HAKA 5GZNA 1TJIH 2K78A 4JRXB 2B5IB 4ZUTB 1Q9WA 4P2RD 2HX9A 3NFSH 5J12C 4WFEE 3W2DL 2JH2A 3MLZL 4PVNA 4PJCB 4W6XB 3MRMA 3QEGL 4KDVA 4M93C 2D7TL 5KVEE 2DMKA 4AEEA 4P9HH 1RURL 1KZQA 2PKDA 5AOZA 2VDQH 4H0IA 1PVHA 3MOQA 3WLWD 2I60H 1U8CA 35C8L 3BVXA 4XPBH 5E94A 4N9GA 2PW1A 3D39D 2R39A 2Y6SD 2EDOA 1KFAL 5D96B 3AS2A 1VF5C 5HTSA 3VGGA 3CPLA 1MEXL 4FNTA 4PW4A 2O6EA 1PQZB 1PKQE 4GSRA 4X5WA 1PD0A 2AJ3A 5T8IA 4KQ4H 3DTUB 4F7TA 5JW3L 1MH5A 5F8QC 2ZWNA 3MTRA 1UT2A 3KMDA 4LKCA 3X12B 2Z31D 4PP1D 2W0FA 3L7EA 1XGRA 4QRTB 3TZVC 1DTUA 2GTZB 5IMKA 5AWNH 5IV2B 3DOSA 1MCKA 2J8UA 1YNTA 3HKFA 5CKGA 1BD2D 3COOA 4MMZC 3DUHA 2V7NB 5AOMA 2W38A 1MNNA 5DMGC 4ONGL 2FHFA 4Z7QE 3H7BA 4I88A 3FUNA 2P49B 3QEQA 4Y4KB 4JFDE 4UILL 1R5IA 2YAQA 4WHYG 1J9TA 3N42B 1ZGLA 2IAND 3WIHH 4TVSa 3NIFB 1YEHL 2ITFA 3V52H 1A2YA 4FYSA 4PJIF 5AZ2L 1FNHA 1QBML 2G4GA 4MD0B 4Q6YA 5E8PA 2WLNA 3LZNA 4NO0B 1SM3H 1KCSH 3N5AA 4MA3B 2GAZB 2YC1B 3DYPA 3NK4A 1MUJB 4UT9A 2KLSA 1RZJC 1SJXA 2Q7YB 4XODA 4C56D 4PU2A 5ELIA 1MIEH 3S96A 3V0WL 4ONHA 5EC1B 3HG1A 4U1KA 2CXGA 2EEBA 4JFEA 5BZDA 1CFQB 1ZEAL 3O6ML 3LYRA 4P5RA 2DH2A 1XXDC 1CICA 4JFFB 4W9FC 2E6JA 2IC2A 3HI6H 2KZBA 1VHPA 4XO9A 4B9GA 5DTFA 5JDSA 2Y23A 4O4YH 3ETSA 2JIXB 1QNIA 3LD8B 2X42A 5CJOH 4JREB 1KG0A 2CA3A 3AQXA 4LAQL 1FNLA 3ERXA 5IIEA 2FO4A 3PL6C 4GXVH 1RIVH 2QMJA 3LY6A 1S6NA 1EFXB 1G7LA 3TT1H 1EBAA 1FZOB 3CVIL 1LDSA 3QH3A 5EU6E 4YDJA 4LLDA 5K9JH 4IM8A 1WITA 2PWFA 4OV5B 2DQHH 2VJ0A 3B1TA 3FRUB 1X5HA 4B50A 2O6DA 4GKZA 4NQVB 4XWGH 4ZMOA 4WW1B 2V5RA 5D1XA 2NDFA 1A7NH 5DMJB 4LIQH 4HBCL 3QR2A 2DYSB 5HGAB 4GG8B 1WBZA 4E5XB 1S7WB 5K33A 4ZQTA 5GGRA 4XVUC 2OSYA 1FO0A 1KF9B 1U30A 4LP4A 2CCLA 3AW5A 2VJXA 2DLIA 4ZSOB 3SBRA 3OAWA 1CURA 4P3DB 3OHXC 4MX7B 4L8BA 3WO4C 2FD6H 2DWYA 1XGYH 3EYUL 2R23A 4GBXA 2C1OB 5CSGA 4FXKB 4M7ZB 4N2AA 3TIDA 1A2YB 3MNVB 1XCXA 5ISZA 1W9XA 4JFQA 2Y3AA 5BJTA 3VFVA 1GTNA 4PJ8C 4ILDA 3TZVB 3P54A 2MNUA 3K46A 3EGDB 1FGNL 2W80C 3ME0A 3TH3T 5IQ9B 1MFDH 1VCBC 1LP9B 2WV3A 3B2DC 4OQ1A 3LQAH 1LO2H 2CSPA 5HYSA 2VQTA 3Q5OA 5DZPA 3C9NB 3QBTB 2B16A 1WUNT 4HEPG 4BWUA 1A6AB 2NY7L 4JRXA 1BCIA 3LIZL 1QHQA 4LCYA 5FV2A 3T77A 1IFGA 6CGTA 5I28A 2CUAA 4BCYA 1AZVA 2JLPA 3DTXA 5EFIB 2WXIA 3L4CA 2HVKA 3BXNA 4K7FB 1QMUA 4KTEH 4NC2B 3S34L 3TO4C 1XIWD 2DV6A 4D3CL 1PJ9A 2FWSA 2Z8VC 4DZBB 4YWGH 4M43H 5K59F 2VXVH 2XA8L 3AREB 1F45A 4GRMA 4BUHA 1G94A 4LLQB 1KV3A 1HIML 1OAQH 3TU6A 1QUNB 4KKNA 2DBLL 1OAKL 3II1A 4PWFA 5DK0A 1SN5A 5H4ZA 1DVYA 3V4UL 2NYYD 1XF4A 2QJDA 3VFTB 1QQDA 3RUGA 1YEWA 5IW1A 2KH2B 2X70A 4HWEH 5EZPA 2K70A 4QHLA 2RIKA 4N85A 2KS0A 4BSVB 4ZW8A 3I3BA 2Y1VA 3QZPA 1L0XA 2OCCB 4BK8A 3C2AH 5C08D 1I8MB 4NZRH 1MIML 3LZQA 4MHHG 3S2AA 3NA9L 4NWTH 4PY8I 3B43A 4KFZC 2WQVA 3ZVVA 3ECQA 1NH6A 5JYLA 4XE0A 1KBPA 2HKFH 3BAEH 4L5FE 3V6OA 2NY6C 1CE6A 1FIGH 1HSBA 3W56A 4JY5L 4PVMA 1KXQE 2LTQB 3BSZH 4KVNL 4FFTA 3VD4A 1CD8A 2X4QB 1XHHA 2R29L 1WICA 2CBQA 1KJVB 2IDCA 4AOFA 4PUBL 4MD5A 1DUZB 3NSDA 4PV9B 1T1XB 5JQHC 2J8HA 2H3NA 3ISWA 1WZ1L 3SDXB 4F9LA 1PFCA 3PQYD 3L3OB 3LKQB 4F37K 3QQ4B 1QEWA 5DHVH 3TA3C 4BK5A 3C5XA 2ZOKA 2J20A 2R0KL 3EJYD 1HX0A 2OMUB 3M8OL 3NIFF 4UANA 5KWYC 3MNVA 1JFHA 2VQ4A 1ODAA 2VDLH 2YUXA 3FB6A 3IJHA 4OGYL 2Q8BH 5KBDA 1Q38A 3D1MC 4FXKA 5EF0A 4QXTB 1WPCA 2AS5M 4E9YA 5F70A 3R06B 4EI5C 3ESOA 3LXCA 3L5XH 1EO5A 3HC0A 3FU9A 3NSFA 4X4KA 1QYGH 4Q9BA 3O6FD 3OSKA 2WTPA 2HT4C 2N7BA 3NSXA 3IGUA 4YZFE 4GJTB 1KGUA 2Z7ZA 2X0WA 3C5ZC 3BN3B 3FULA 5D8JL 3IJYB 4OJFH 1GOGA 1AO7D 1I9IH 3MRCB 3QPXH 1NJ9B 1T0MB 3X3FH 1L9SA 4ATWA 4MXVE 4TLUA 1YJDH 1UVQB 1CICD 4BFEA 1X7QB 3SE4C 4GSQA 3B3IA 1OZTG 2D2CC 1P6FA 1XL4A 3F01A 5F1KC 3DI2B 3ILPB 1WQVT 4Q6IA 2APWA 1FZMA 5ESQA 2O6CA 1UH4A 1QBLL 4M9OA 5KVDL 1JD7A 2XBZA 4UQ2B 4WI6A 4LQ1A 5CU9A 4FL4B 2FO4B 1CBVH 3Q6FA 1ML0A 4HC1H 1AR1C 5LGHL 5EHFA 1F90H 4KUZH 4MYPA 3IWVA 1HYRC 2WQSA 4KAQH 3EGSA 2RBLA 4WTZG 2HWZH 4YVNA 3FU6A 1BF8A 3NTCH 2YD1A 4HIHA 4LHJB 3QJUB 3DIFA 3L4WA 4RX4A 2QQKH 4HKBB 4HJ0C 3ZTJH 1WT5A 2Q76A 3QFJB 3UO1L 3U0PA 3D6GA 4R7DA 4PRIB 4E36A 3QHFL 2ZX6A 1BPVA 1CFSA 2GCYA 4JHWL 4PWJA 2VUYA 3Q3GB 1VACA 3HCVB 1SQMA 4CU6A 1JGVL 1AHKA 4PJDF 5KS9B 3IXAA 1P1ZA 1PLGH 3MYJA 3KWTA 4G8IB 3L4ZA 3WEOA 5HYJB 1AI1H 1A64A 4AYDC 3VWJA 4Y2DC 2Q0ZX 3TWYA 3B5TA 4U2YA 1JNLH 2OMXA 2C7UA 3KPOB 4J7RA 3K2UL 4WI0B 1ZPUA 5HBBA 4XMZA 2FJSA 3O81A 4H88L 3TPUB 25C8H 4GRLA 1P4BH 4N22A 3C60A 4XOAA 2FCBA 4EN3A 1JHKL 1CK0L 1J8HD 5C7XL 2LTQC 5F9AC 2TRHA 5FWRA 3UDWA 1I9RH 1MN4A 3I75A 3OZLA 5E08H 4C57C 1FLTX 4R84A 4PRNA 4N0UE 4AXWB 1DBJL 4N8CH 3M1OA 4ZQKA 1SXSA 5E4EB 1UD5A 2IOOA 5D4QA 1N59B 2LR4A 3EGDA 1YNLL 3ME0B 4M8QB 4XPGL 3QXTA 3KDPB 3MLYL 3E1F1 3CBRA 1YHPA 2JKTM 3POHA 3K80A 4NZDA 4ACPA 5ICYB 4P05A 1FGVL 4AMKL 3X3GH 2CHWA 4J4PD 3NQKA 3E6FA 3BP4B 2QQLL 1U2CA 3L1OL 4LEEA 1XB8A 4R7NB 4R7NA 5CUSH 4Y4FD 1RZGA 2ZYHA 4P3DA 1N5AA 1X5IA 2GKIA 3UMNA 3D34A 4RGOL 1OL0A 3KM1A 1OT1A 3ARGA 4XPGH 1MWOA 5D1QA 3TO2A 2ZUWA 3LKOA 4HFUH 1AHWC 1Y07A 1LO0L 1I8IA 3U4BL 3U9UA 2XZCH 2AK4B 3CSGA 4B7LA 3QJHB 1AOZA 3ULUC 4GKZB 2R56L 4HG4K 5KVFH 4EEEA 1YNKL 1KLFA 4FG4A 1KSRA 2IXQA 4Z7WE 4HIHB 2Z8RA 3G6JB 5T3XL 2JJSA 3NCFB 5ID1A 5C7XH 4YDJB 2YHGA 2YQ2A 1JGDB 4IMKC 3FTXA 4YK4B 1OAZH 4NENB 3IK2A 4P5TB 3WTVA 1U8IA 3ZRSA 3T8XB 4YHNA 4NKIH 3P40A 3QAQA 1W8NA 4FFVD 3RGBA 1UKQA 1JNLL 4EUPG 5T1MB 2GJPA 2XZZA 3FKUS 2VDOH 1MHHB 2DWXA 2DDQH 3D2UA 3L4YA 2VLRB 4LQFH 4HCFA 1X7TA 1LO3H 3GBLA 2VDMB 1JGVH 1XZWA 1KIQB 1P5UA 5IQOA 3FHAA 2Y1ZA 1KC5L 4G8FB 5F1IB 1WC7B 2DB8A 1Q9OB 4RIRA 4WK4B 4I7ZC 1VEMA 2FBRA 2KLTA 3R0MA 4CMMA 5JPNA 4WHYH 4GS7B 2VLRD 4UOZA 5HYSG 2FR4A 3NT0A 3RJDA 2GBTA 5IWLC 4OZ4A 1Z5LA 4HIXH 2ZOLA 1U8NB 2L7UA 4HEPA 5EULV 5EZIH 5BV7C 5F0JB 1P5VA 4P2OB 3SPIA 3CU7A 1I7UA 1CLZL 1MJUL 3HZKB 5GS1C 5F0MB 4KAQL 3VA2C 1NIFA 4JO2L 4Z95L 1V10A 4X4YB 4AYMC 1AQDB 3CCHA 3OMNB 2A38A 5JPMC 1ZJBA 1WLHA 2LU7A 4V2CB 5CJ8A 2DLFL 2X4OA 1U8OB 3H42H 3FL7A 4G8GD 3QYMA 1IGFL 2VITB 2O72A 2BWDA 3GPSA 3GJEA 2ZOKB 1MVUB 4KJWD 3FUHA 1D9KB 3BAXA 4FZEH 2OAAA 1II4E 4U1SA 4AY0A 3OKOA 4XX1E 5T33L 5I19H 1ORSA 3ESMA 4M3KB 4R0LA 3MV8D 5A43C 5F1SA 2YOAA 2J7LA 4U7KA 5BO0D 2BS71 1GZHC 4J6IA 2WZAA 4LHUA 4GPVA 1AS8A 1N68A 2YLKA 1CTOA 5IEKA 4M00A 3CVHA 4MCNA 4UTAL 5D8JH 5DHYB 5LLIC 4HUVA 1DYZA 3N44B 4L5FH 4L4VA 4WU7A 5LBSH 1TJXA 3DBSA 3SE8L 3ZDZF 1HI6A 5I0VA 2X89A 3NJXA 5E7BA 5G4MA 3SO5A 3ZBMA 2WNKA 2K8QA 4OGYH 1TQCB 4RFNC 3EOTH 4AQEB 4BE5A 3ULVF 4KO7A 3X1NA 2LW3A 1YECL 5JORB 3S2CA 3QI9B 1V7MH 3DC0A 1QVOB 4TULL 2JKWA 3FSOA 2HZHA 4OQTA 3QUMA 2VSCA 1H0DA 4UDUB 1ULVA 2DOCA 4XCNB 3EYOB 1T1ZB 4H26A 2D2OA 1WRFA 3ARGD 3C75A 5C0JA 4FX5A 4GFTB 2HAZA 4DPCX 3I75B 3FSAA 2CBMA 2IBZX 1T5XA 3GBNH 1OCOB 2EEDA 4FG6C 4KX8A 5DJCB 4OF6A 4YK4C 1C12B 4MXQC 3D85B 3IAQA 4LSPL 4OTXH 4MAYD 3OHMB 4UQAA 5EZJB 5MEQB 1QA9A 2ZOUA 3B37A 3ULVC 3U1QA 4GRWE 3T77B 4YR6A 4KV5F 3QNFA 3ROOB 4PJAB 4WI3A 4M6MH 2ICWI 4HJ1A 4JJHA 2YGQA 4XNUH 3VD3A 3RZCA 2XI9A 2ATKA 4HXAL 3L2NA 4XT1C 4MMXB 2DIAA 3DV6A 2VLRE 1MZZA 4NYLB 5LBSL 2VH5H 2Z3FA 4XN4A 4GO8A 3RL2B 3VXPA 3MLVL 1NCNA 3EJZC 3MV9B 4L2LA 1DL7H 2X4UB 4UDTB 3FB7B 5DK2A 1F3JB 3BC9A 5CILH 2LAAA 3GMRA 1RV6X 4HV8A 1HDMB 4XPAH 5EO1B 5D5MA 5KSUB 1RH8A 4P2OC 1ETJA 3IGLA 1OTTC 4Q9CA 1NM4A 4MX7A 1T7YA 2G2RA 2HRPL 2BSSA 4YHOL 2OSWA 2YPLE 3O4LD 1IARB 2B1HH 1KXVC 4AKQA 4YZFF 5CLWA 2RQEA 3HS0C 4ZPVA 5DHMC 4HUXA 5LDUA 2IJ0C 2VN5A 5HVFB 2ADGB 1RU9H 2E27H 2MCMA 3MNWA 2JQZA 2WSPA 1ZXQA 1RSYA 2H45A 1XB3A 4GIOA 2XNAB 2CZNA 2CXKA 2NY4C 4WJ5B 4Z7UB 2JB5L 2ICEB 1O7DE 1L9MA 3E2HC 3I9GL 5DEJA 1VFOA 4JY4A 3CHXA 4OZFA 3OGCB 3UFIA 2YKLH 1R3LB 2IPKB 3IAGC 1TJHL 4JFVA 1DE4B 3K2KA 3OXSB 4PYHA 3GMOA 4I1NB 4FFYA 5DA4A 5JW4M 1U36A 4ZBJA 3MRFB 3MRFA 5D93C 1EIBA 1ID2A 3OB0K 3VI4E 1HH6A 2BNRE 3IDIB 4WEUD 3G5VA 1Z5LB 2DLHA 4ZUWA 3U36A 3EZJB 5AW7B 1CMOA 4EBQH 2KPNA 3MLSH 5BXFA 1JPFB 4RNRA 1OF0A 4C47A 2N3JA 3L6FB 1A4AA 1KYDA 1OAZL 3GK8H 3BVWA 4D7PA 1OIOA 2GITA 3P73B 4PMEA 3D9AL 4FHJA 1W6WA 5CCJA 1IZKA 4QHPA 4ZFOL 4GG6B 1G7JB 3KGTA 4UI2A 1NC4A 4WO4B 3BLKA 2N7AA 1SEBA 4JDEB 2PF6A 2YPVL 2YAPA 4TLTA 3AZUA 3MRNA 4XX5A 1RPKA 3RWIA 3I02B 3ZDXE 1MRCH 1MCQA 2ZKYA 1GGCH 4IOSA 3QWOA 1H3WM 4N0UA 4O4YL 5K1VA 3FFDA 2G2RB 4OUUB 4YHLH 5CGMA 5HHXH 1EVTC 2EXYD 1IE5A 2J5LB 3MLXL 4BD4A 1T1WB 2PCPB 4HV8B 5EO1A 2PPAA 1SQ2N 5LUMA 1WIPA 4UDTA 3KEDA 3CVCA 3BP6A 4Q9RL 3D50A 3LCYA 1K8DB 1M6UA 1NLDH 4Q4IA 3L1OH 1HEJC 1FFNB 3SGKC 1DVFB 3VD2A 3PGCA 4NN7B 1M71B 4FNRA 4F1ZA 2VXQL 3KPMA 2BP5M 1ACYH 2NY1C 1U91A 4I3GA 1ZE3H 1B0GA 4P07A 4FA7B 1BGXH 1UCBH 4JQVA 3STLB 1UD8A 4I18B 4Z7NB 2IPTH 1VEPA 2J55A 2FH6A 3DX6B 2KDYA 2ZOTA 2E7CA 5FS5A 1B4LA 4XPHL 2WD0A 1SXAA 3O2VL 5ICYA 2A6KA 4RMWA 2J56A 2FLRT 2NNAB 3HS0B 3M88A 4LLWB 4UILH 4U31A 1DBMH 3V0EA 4WZ9A 1HQ4B 4EXPX 1JMZA 4XPFL 25C8L 1EGJA 3C6SA 3OWRA 1OW0C 3CD4A 2VT0A 2E0PA 3G7TA 3JBG7 3MCKA 4ZMTA 4WNQA 4WW2B 3MVSA 5JHDE 3GKWL 2DQUH 4K73A 1KCVL 1ZVYA 2O61B 4Y1AB 5LGJA 3N91A 3EGXA 2CNZA 4PG2C 3P4LA 4IRJB 2CJSA 2AV1B 2BVUA 4F7PB 2IADA 5CM1A 1YN6B 2CDEB 2YSSB 4F93B 3NJIA 4AYFA 2NT0A 1PQZA 4HOMA 2AJZB 4FD0A 2RH0A 1CGUA 1BJ1J 4LVNB 2BHYA 3TNNA 3EHBB 2FX7H 2EDDA 1HHGB 1FO0B 3EUDA 4KXZH 5KTEH 5HY9A 3L3IB 1DUYA 1NDMA 3DV4A 4F2ME 1CFSB 1TTAA 3UYOD 5F7UA 2ZX5A 4UM8B 3E6HB 3GMQA 4I3SH 1I9EA 2F7OA 3NCMA 2BSSB 5DQJA 3VWKA 4JVPA 3SDAD 4P4KD 5D1ZI 2K6WA 5TE4H 2TSAA 4A1RA 3TL5A 5CD5C 2WC7A 3W39A 5C0AE 2HH0L 2JF1A 2NY5C 1S9YA 1JPGA 4PRHB 3G9AB 3SY6A 2WQ8A 4L4TA 5EU5A 3DO7A 2DQGH 2W5PA 3K8KA 5KSBF 1OGSA 3MLWH 4XOBA 2R4RH 3IS0X 5T5NF 2EXSA 1EEQA 2VCOA 5KYXB 4A2EA 3E8VA 3DV6B 2YD4A 5AVYB 1C1EL 3GJFA 2QKSA 4ODUB 4ZS7H 3KPLB 2ZXCA 4AH2B 4G9DB 3CSYB 4DZ8B 5IB2B 3RVXC 5F1NB 3CSPA 1ZHKA 4HMEA 5HHVL 1V7NH 2DQEH 2XQBH 3ABLB 4GXUM 4OJYA 4AT6B 3EJCA 1RUQH 4IRSA 4KK5D 2ZTBA 1HJBC 4JFEB 3DDFA 4GFXA 4OLEA 5CJQH 4MJ2A 4OGXH 4MJ5A 3MJGX 5EUKB 4E41A 3EFDL 3NA4A 1V7NL 4EI0A 3WJMA 2WMPB 3MV7D 2I69A 5C0JB 3TLRA 1L7TL 4JEGB 3QNYA 3NJLA 4ADGA 4DGYH 3LHPL 4ZXBB 3EDJA 3QAZC 2X05A 1WBYA 2AEPL 3MRBB 1MJJB 3CN3A 1F3DJ 4J3UA 2ZZUT 5BMFL 2BIMA 3MV7B 1E5UI 1ES0A 2EKSA 2IWKA 5E00B 3QS2A 4XO5A 6TAAA 1MWAB 2IFFL 3ZTJG 1UJ3C 3FQXA 4C55A 3QHZH 3T0WA 1PZAA 5IFAL 4XVTH 1ZLSL 2P5WE 4HJ0D 1UEMA 4MA1B 5C0BB 3M1CA 4PWEA 4Y4HA 3NZ8B 4PIBA 1AANA 3L4VA 3GM0A 1CLCA 4QHKI 3T0EB 4JFDA 1HL9A 4DPBX 3WV0A 1R0AH 2UX6A 4QXUH 5JA8B 3CFEA 3UAJD 5TE6H 1LLAA 4K71B 3ZUCA 2WTRA 4QXVA 3MYZA 4XVJH 3V6ZB 1DQKA 1S7UB 5A2AA 1TUPA 4B9PA 4K7PH 1T22A 3I3DA 3HVDA 3UOAB 3US1A 2W60A 1GVIA 2HLEB 1ORQB 2FK9A 4OT1H 3QWRA 3ZKMC 5F9OL 1MAMH 5HHNA 5I74C 4LNRA 4RGND 2IAAC 2ZOOA 2UZYA 2Q20A 4MS8D 5FYLD 1ZT4A 3R1GL 2VXVL 4R8WH 4K3JH 2DQIH 2YXMA 5ICZA 3SE4A 3V4PH 5F71A 5DZOA 4A68A 1G9MC 2C3HA 4EZJA 4EZKA 1VESA 2B59A 3TN0A 3QP3A 5AVRB 1FNSL 4PRNB 2ICES 1PIFA 1MELA 4LCCA 1JXJA 3OAUH 4B3EA 1C1EH 1RHHB 1YC7A 4OVUA 5DFTA 2GJZB 3VTMA 3WTSA 5LHDA 1NGPH 1BM3L 2I26N 1AZZC 2M2DA 4UF7C 1IM3A 5MEPB 2NUPA 1XH1A 5I1DB 5J6SA 5FUZL 1DEDA 3IF1B 4ELMF 3RVTD 3MUJA 2R1WB 1RZFL 2OR8A 3OKLA 3DIDA 3FO2B 3B9KA 2XWBA 3BT2L 3QZWG 3QNXB 4LMQE 1ZA3A 4D0BB 2EXYC 5JQIB 3EBAA 2TRYA 3I9IA 1WCBA 2YMXH 4XMLL 4YSOA 3SGEH 2V2XB 5DJYB 4IGBD 5H8DA 5DO2C 3SGJA 4F8OA 1HKFA 4Z7QF 1ZVNA 3BWAA 7FABH 1PCSA 2IIJA 2WKOF 3VGBA 3VA6A 5KTEL 2UYLB 3IYLW 2VLMD 1IVLA 2A9CA 3QFJA 3ASWA 2HLFC 3C5ZA 3IKCA 5CLTA 2ADFL 2IXQB 4LIQL 4UWQB 2QQNL 1WS8A 3BP7A 1KCUL 2YD0A 2D9CA 1VGEL 3PHOB 3VWKB 2GJ6E 1CXIA 5FO2A 4W6WB 2QMKA 4NQDD 1TFPA 4BH7A 3AABA 3QJSB 5K9JL 4LHUG 4Y4HB 1N3NB 3RIFK 1E4KA 5B3JF 2MIZA 5HI4D 4FYRA 1K5WA 1Z9OA 4AVJA 1WAAF 1YEEL 2A73A 1O7VA 4TUUA 4G6FD 4EPSA 1FZOA 3RKDD 4OGQC 3WNKA 4Z18A 3MRHA 3RY5A 5CIPA 4B7IA 1NL0L 4JFZH 1FN4B 4IQHA 4AV4A 2V8LA 1B4JL 5C9JA 4O58H 1T6VN 3PDOB 1A6ZB 2EDNA 4ZW7A 4PCSA 4XAKD 2DZEA 4J3XA 2NNAA 4LLWA 2NUPB 3S0PA 3QIWC 3VXRA 3WS3B 2K7PA 2R7EA 3J2PA 4WUUB 3MLRH 3NZHH 2ZAIA 5IB2A 1S3RA 5DJ0A 3T09A 4DP2X 4V1DD 1MW3A 5FR3A 3SDDD 4ZX5A 3EIFA 4LCUA 3D30A 3GXFA 4TNWK 2WZ0A 1X4XA 2QFRA 3KPLA 1RU9L 1QSFB 4K07A 3VB9A 1JHLL 1ACZA 3QZLA 4XAWH 3WKNA 5HD8C 3UJTH 2SEBB 2J43A 3UTZA 4PTTA 1BXAA 3LRMA 1EMTL 1KLUB 4YHOH 3DGCR 5AAPA 3ZOAA 1QRNE 2AQ2A 4GQQA 4L9LA 4X6CA 3HS8A 4P2YA 4MCZB 5T3XD 4E0RB 4DP0X 4E0RA 4EI5A 1OAJA 1U95A 3Q7JA 1LK3L 4F24A 5KYNA 2WLKA 5L0QC 5D4HA 3SCMD 1DL7L 2YPLB 4XXWC 4OBRA 5B4MD 4UM8A 1KXTB 1FYHB 1MCBA 2OFQA 2J8UB 3P9LA 4G3YH 2Q8AL 1HWHB 5J6HB 5IFJB 2E6PA 5FUOL 3AM8A 4QAMB 4OGZA 3ZMEA 4GRWB 5AQ0A 4JDEA 1FVCA 3ZMNA 3FO0L 5DXWA 4XNUL 4KK5C 1DVTA 1SXZA 2WXPA 1W6LA 4OCXH 4XPBL 2I60L 1MCFA 3AS0A 1Q9LA 5F97E 1DANT 1KELL 1ZVSA 4X5XA 3HHSB 1QTPA 3O8XB 2IAMD 1JZ8A 1QZ1A 1XGUB 4Q6IC 4OTXL 3VG9C 4CGUB 1T5KA 1BLNA 3IDJA 4IBLT 2JLLA 5EZLA 3QXWA 1A1MA 2J1ZA 2JB5H 4N2MA 1C16B 4U3HA 4XCCL 5DD3L 5ESVB 5BRZB 3UTTA 1KB9J 1NAKL 5CP7B 3OR7B 5FGSA 1I3UA 3TVMA 1XMEB 4LL4A 1ECZA 4OV6F 1KBVA 3QDGB 1U3JA 4NM4L 5E1IA 3KYMA 4K9EH 5BRZD 3V4VA 3A4EA 2AEQL 2DM7A 2M8XA 4KKAD 1OPOA 4R26L 3OTTA 2O6FA 1XIWA 2XFXA 4Y16B 4YHIB 2LT9A 2Z93A 2XSKA 2WQAA 3PWJB 3L3OA 2BS8A 4KDWA 4AYSA 4PJDA 2NXZC 4WI5A 3CG8A 4RZCB 4PB0H 4ZUVA 3QDGD 3TC9A 1YDPA 3BUPA 3NFNB 5CILL 5JNYA 2AC0A 1JXGA 3C6LD 2ENPA 3GM8A 1FBIH 4ODXB 3ES6B 4F58L 3A21A 3BP6B 4ZPVB 1IC4H 3QIWB 1QPPA 4H44C 4MMZA 1XR8A 3V6FB 1A02N 3JV6B 5GRUH 1A7PL 4X4ZA 5AAMA 3V2AR 3K5SA 4G42B 2X6VA 3U0PB 2WN2A 3MMEA 3N41B 3GRWH 4WW2F 5B8CC 4DP4X 4L48A 4L9LC 4PRPA 3GBML 1FG2A 3BPCB 2WY3B 4WV1C 3FCSB 3MROA 2EH7L 1J1PH 3H9HA 1MPAH 2BHZA 3S8GB 1NFAA 2DWEB 3L3IA 4LLVA 3WXWH 1MW2A 4UBDC 1OTSC 4JO2H 2CRIA 4HU8A 5LNGA 2MOGA 3UP1A 1IGTA 1E4WH 4MA8L 2ZQKA 4PB9L 1U9KA 1KGCD 4TSBH 1KCLA 3QUKB 4Z3IA 5DR5L 4PJ9C 5E1QA 4W9EC 4JRXD 4H0GA 5D7JA 4I0CC 2AMUA 5JYMA 4AQOA 2BC4B 1CS6A 1CQKA 5GXBB 1B3IA 1HOEA 1KGYE 4KRPD 3B7SA 2CO7B 1A6ZA 4LB8A 3SE9H 1KPUB 2ZCLL 4PJFB 4AQZA 1R3JB 5GZOA 1ZXKA 5DJDB 3KCWA 3O3EB 1GYAA 2ALAA 1AXTH 3SKJH 5DYFA 3RPKA 3WNIA 2DDQL 2D4DA 3UGUA 4YSCA 4TN9A 5K9OB 4BRVA 2VLME 4UQ3B 3WE1A 2B39A 4AEFA 1Q1JH 5SWQA 3RJQB 5AG9A 2FEEI 1M9WA 1SVZA 4JY4B 1YMMB 1SDDA 4WEBL 3H55A 4KOBA 2O5YH 1MDAA 2Y5TA 3EUUA 3KL5A 1DBAH 1KENH 4F27A 4KGJA 2WWMD 4JANA 1KGWA 1NFIA 4WDIA 5FYKD 3C09B 3F5WB 3BSGA 1CBJA 3BHBB 3SE3C 4NKDB 1F3RB 5K59E 1AE6L 2XVGA 5I1LA 2JQMA 5DHYA 1XTLA 1RK0B 1Z66A 3P2DA 1R6VA 5F6HI 4YHZL 2IANB 1LO4L 4RGOH 4MLIA 5KOMC 2NOYA 4JFHE 2VSMB 32C2A 4JKPL 1WBXB 1UZ8B 1QFWL 4NN5C 4NWUL 5I8KL 3C8DA 2AJUL 3DX2A 5IOPA 4G9FD 1NCAL 4HIXL 5EZIL 5AB2A 3EADA 4HCGA 4BFRA 4G80A 5ERWB 3K0YA 4QHNB 2R4SL 5D2NA 1GYVA 1ZK5A 2R0LH 3N9GL 1KLUA 5E6YA 5CLYA 4J3OH 3VXPB 2WYTA 3SDAA 3ZY7A 2UZXA 5JHBA 2YGPA 1I1FB 3QZMA 4BHUA 4K4KA 3QUXB 4MDJA 4NXKA 1JN6B 5IBTH 1NANI 1QA9B 5CSZB 3WUWA 4J39A 4YR6B 3SDDC 1I9RL 3DMMB 1TU2A 2J4WH 1JPFA 3ARUA 3AGVA 5FYJD 4YEFA 1T66D 5D7JC 4BK4A 7TAAA 4MA7H 1B0RB 4X83A 4QXWA 5I75B 3DBXB 1ZHNA 2ADYA 2XWXA 3HRZC 3K2UH 3RFRA 4B0MB 1OO2A 3TM6A 1BEYH 4YSQA 4KPHH 4PR5B 5SWZB 2GBVA 3DMMD 9CGTA 2R4SH 5CN2A 4JFWA 4BZ1H 4GMTL 1N6QH 3DPBA 4NNPH 4O2EA 5G2NA 1KNOB 2WOBA 2VDRB 3Q6GL 5ALBH 2V2TB 3X2QB 4YIQA 2BOCB 4PLJD 2GT9B 1T6WA 1ZA6A 3U9WA 1UADC 2AJYL 1MCEA 2M1KA 1S7XB 3WD5L 3OLIA 3MZGB 4JQVC 5HVHB 3D69A 5IROD 3WG7B 3RRQA 1TEFA 2BFGA 1AE6H 5FKAA 3VD9A 4M61A 3WOVA 2Y6SC 2PYEE 4K7PX 1NEPA 3VXRE 4GLRI 3FTGA 1N8ZB 2UXVA 2EE0A 4LDOB 4PRIE 3JV4B 2A1WL 4FLSA 2L7JA 5C6PB 4JNXA 4KKQA 3DURA 3JZYA 3F5WA 1KDIA 2JI3A 5IW3A 3MJ7A 3NZUA 4DN3L 4HPHA 1Z3GL 3LNGA 1B6UA 3O45A 4Z3JA 4KK9D 2KYIA 5K9QI 4KKZA 2VN4A 2ZIDA 1SBBA 3WJJA 1TKWA 3HN3A 3JWNG 1OWRM 4NZ8A 3TZVD 3IWUA 1MHCB 2VLKE 1SEQH 5HHMD 3VXUB 1SZNA 3IKCB 1M57B 1YJDL 4KK6D 1CK0H 1JHKH 1UKTA 5KBPA 4XRCA 1KYAA 5M95B 5C2BL 3R4RA 3W82A 4ZMXA 5IIEB 3CFQA 1OQXA 4IK7A 4BYHA 1S2EA 4WNQB 4JG0H 4L4TE 2ZUQC 3WEXB 5I2IB 3IGKA 3ZKSD 1AJ7H 5JDSB 1WISA 4XMVA 4ZNEE 4X42A 2MH4A 1UJ3A 2XTJE 2PW2A 4BZ2H 3QDMB 4M5ZL 3C60B 4EN3B 4POYA 3KW8A 3SDDA 4F15B 1Q9OA 3EJUA 3JZ7A 4RIRB 1YY9C 1BQHA 4DK6A 4AEHH 3T6QC 1MPAL 3O2DA 3SKUD 2ZAGA 2C7UB 1QSFE 1K2DA 4OCRH 1CFTB 1UXSB 2VN6A 2CLVB 2EUVA 2DWEA 4ZFZB 1Y0LA 2XWEA 2P24A 5C08B 3UGXA 1IT9L 2R29H 1EAPB 2PO6C 1JVLA 3H9YA 3A4AA 3UPCA 3G5YA 4J28A 1NBVH 3B2XA 3VI3B 5C8JB 2BNRB 5INCB 1RUPL 1XX9C 4HSCX 1J5OH 1CTMA 4UQEA 4DCQB 2OXGB 3O2DH 4HK3J 1COBA 3LKSA 1Y6KR 3T65B 3NN8A 4WU7B 2BOBB 3MJ7B 5K5YA 5D1QB 1U58A 1RZKH 2X3AA 3UL4A 4MYWB 5DVOA 1NDGB 1IAKA 5GGVH 1RK0A 4L2YA 4WTQA 4R97B 4KTYA 1TQTA 3L2MA 1LEKA 2QVFB 2PO6A 5E8OA 5L9DL 4S0SD 1A1OB 2CGRH 3H0TA 1SN0A 3GXMA 2NQ3A 2ZWKA 1XH2A 2DQJL 3VXRD 5D1QD 3QCVH 3ZGHA 2FX8H 2WNXA 3X11A 1IGMH 3RFZB 4XNDA 2QGDA 3VH8B 5IB5A 4MB3A 4WCYL 1HEHC 2VDLL 4UQBA 5KVEH 3BJLA 4DO6A 3BVNB 1FPTL 4OF3A 5E2JA 3A67L 4C58B 1HCFX 3VXRB 1O75A 5IROA 5I6XB 3DDGA 3LIZH 5C1MB 2A9MH 3AG4B 1J88A 4HGWA 1JPSH 2B0SL 5HI3D 4AJYV 2IDQA 1J1XH 4NCDA 2Q87A 2YJLA 2H0PA 3NIGF 3PJSB 3DBXA 2A6KB 4TLKA 5JLZA 3QG6B 4TVPH 3EF7A 2A5UA 1FGNH 4IOIB 4OLZL 3R8BB 3FB6B 3ZQXA 4F3FA 5FM5O 2PYEB 2KT6A 1VFBB 5D7IE 4EUPB 1M53A 2FEDC 3CH1B 1FVEB 1MFMA 2NQDA 4BV1A 1P5UB 3GSUB 3MRKB 1JZIA 3ARRA 2UZXB 2VM3A 5D72L 2IAMA 1ASQA 4YSEA 1IEAA 5CP3A 3CBKB 3IXAB 3FT3B 4QEGA 1PU0A 2Y06L 4XBEL 5D2NB 4Y4KD 2FE0A 1K6QL 1ADQL 2XN9A 2R69H 3QFJD 3GB7B 4F37F 1ORQA 4F91B 2MOVA 4IS6A 2VDPB 2DI9A 4IU3A 1OAKH 2PWEA 4KXBA 1XSKA 5DJAB 4QMEA 4JO5A 1F02I 5C8JA 4YWGL 1DSFH 5GSVB 1K4CA 5E4AA 4ETQA 3HOGA 2VRAA 4JDZB 2HP4A 4XOCA 4X8GA 1QTYT 5GSRA 4NXSA 1W0VA 2EABA 4WHDA 4YDVB 3T0BA 3TT1L 1JS4A 1SVBA 3QNZB 2WXMA 4KZ0A 1NGQL 3GHEH 1KCRH 1N0LB 2A6JB 4BGDA 2EVIA 1MCWM 2P8LA 1HVXA 4PS3A 5EORL 3SOBL 3OKEB 5LVEA 3DXAD 2JCCE 2VAJA 4XP1H 4X8JA 2FZ3A 1BWWA 1U8JA 5DCCA 1VERA 1WFIA 3LNIA 4HUMB 5DRNA 2F68X 1FFOA 1B4JH 1LO5B 1ZPLA 4M1DL 5E56A 3V4VL 2GEQA 3DNKA 5EOCL 2VDNL 5I76B 3G5VB 2WW8A 1WBYB 4Q9QH 1LD9B 5JHLH 5EBMB 4FTVA 5I1AB 4R97C 2VLLA 2XHNA 4Y7MA 1BQLH 1UM6L 4WIQA 3ARFA 3ARFB 2F7IA 3GMOB 4NRXB 4N1CA 4U4IA 3WJMB 4FRWA 5E1AA 2EVJA 3H53A 4P4RA 3HS9A 4PJIA 4MAZA 4ENZA 3WCYA 2X9XA 1SJHB 5AZ2H 4G2AA 4QXTA 4NZFA 4Y4FB 2W07A 2HB0A 3RX5A 3ZT6A 3TN0C 1MWAL 5DJXB 1LP9E 3CDGB 2JKLA 1SOQA 1YEKL 1DQIA 2B9BA 3N06B 4FQCL 1PNCA 2NY3C 4HIIB 2BIQA 4OY9A 1FCGA 2AABL 4PJ5E 1T0PB 1JHTA 3L3JA 4J1UB 3UX9B 4HAFA 3CZEA 3ULUH 3WL9B 4NUMA 3OKMB 1EAQA 4N6RA 1WFJA 4JHBA 3L1GA 4A6YL 4Z9KB 3KVQA 4WJG3 3Q3GA 3SYQA 4A7QA 5IEHA 1LWRA 4H20L 3T65A 5CGTA 1BOGA 1SHSA 4IYKA 1OTUC 4TQPA 3BRDA 4WENB 1U58B 3BIAX 4A2DA 2FB4H 4GQPH 3QT2A 1P5UC 3IU4L 4HXBH 4XGZB 4X7DC 2ITDB 2J25A 1IC5L 1RZIB 2WP3T 2XJLA 2DQTH 2FL5B 5J11C 2Y2YA 4Z3GA 4D7BA 3HZVB 1M6OB 2E9IA 4X80L 4CJ0A 4L3EA 1DVSA 4MFHA 3CFKB 1SPDA 4G71B 3CDYA 2P24B 3F7VA 5D6DC 5C08A 4AIXA 4LOFA 3HUJB 3LX9A 1P84K 1AQDA 3CCHB 4P9HL 1FYTA 5JQ6H 4RDQF 1BP3B 3SHSA 1AQ8A 4JRYA 5MEPA 4LPTA 4CVXB 2D7QA 5GS2D 4H1LH 3PS6A 5CF3A 3BGMA 5J13C 2ORBH 2CD0A 2XCMC 5IUCA 3B9KD 1TCRA 2G9HA 1QPKA 4Y19E 4RVBA 2WIIB 4XNQA 1UWXH 4U1MB 5CZVL 4Y2DD 2UY7B 3TBYA 2VLKA 1ONQA 1K85A 3OZ9L 1B6DA 2EYSA 3VSVA 1JXFA 3OJ2C 4IRZH 3FYEB 4EZLA 3QUZB 3LVTA 1HH6B 3D3VD 3AXLA 4APXB 1Z7JA 2VO8A 3GO1L 1KYUA 2FSEB 3S5LA 1CU4H 2VC2H 4HQQH 4HUWA 2VW7A 5CBAB 4KDTA 1FL5B 1RPQA 2QSCL 3QQXA 4CBZA 1QX1A 4U0RC 1J8HE 3KLKA 5IB5B 5TE6L 3VH8A 1JZHA 2AERT 4HF5H 4ELDA 2CRZA 5I1GH 1XGTA 1L7IL 4MJIB 3R18A 3T71A 5I73B 3MAWA 3QIBD 3GTTA 3N0PB 4TSAL 2V9TA 1LMIA 1KJ3H 5DQ9B 4HPYL 5T1JA 1T7WA 2EXWC 3T0EA 3WAKA 1M42A 1YPZF 4XN8A 1GS7A 2X89D 5GGRB 1AZBA 4FXLA 3ATDA 4Y4FC 1CDUA 3QRGL 5J12B 1DUYB 4TVPL 4EIGB 3VGDA 1IV8A 1INQB 5HP5A 5CN1A 5HGHA 2NY3B 5KAQF 1H8NA 3H9ZA 3FUEA 4QR7A 5E2WH 3CQQA 3D39A 4MMYB 3CDZB 2GQHA 4YDKH 2D3NA 5CINH 5FHAL 3VCLB 1A3LL 1DQML 3BYYA 1JRHL 1TT6A 2DEYX 3H2WA 2WXHA 1EEZB 2AQQA 3MUZ1 4RWYH 5HI3C 1EHLH 1L7TH 2P8PB 1MZYA 2D0FA 1RJZB 4X4YA 4ZG1A 1S7QB 1AG6A 2PW1B 5CJBA 2W0KA 5AVXB 5FUCE 1XCQB 1I7RA 1TJMA 2F19L 3WFHB 2NCMA 5DJDA 4GO6B 2CLVA 2J71A 2UXGA 3AG3B 1QLEH 2W9LA 2QSQA 3RBGA 4MJ5B 5EUKA 4Z7NE 1RCYA 1CICB 4B27A 5BXFB 3LB6D 3WKYA 4V1DE 2E86A 3NJGA 4JPIA 1G4RA 4TSCL 4EUPH 1P4IH 2QV4A 3T6VA 5I1DA 3PXHA 1J0JA 3FS9A 3FQ2A 3SQOH 1QLEL 3ZDXB 4JM4H 3B56A 2VQ1B 2GJZA 2F5AH 4F8LA 4NPKA 1QSEA 2EICA 3B5HA 3MLWL 2EILB 3AT9A 1GL4B 4MWFA 5HHOD 1PG7L 2WBXA 1HHHB 5ETUA 4NSKB 4PRBB 4AITA 4G8GE 3F12B 1IAIM 4K3DL 1ZGLB 3AJ7A 5I8EB 5ENWA 4AZ8A 1KJMA 2P28B 2X1PA 3U2JA 1N64L 3RWDB 4Z7UA 5PAZA 4Z3TA 5HHOB 1LE9A 1U92B 1UACH 5F3HA 4APQA 1WBXA 3OLEA 4LGPB 3T1WA 4N5UA 3MGOB 3BH8A 3N6YA 4I9XA 5F9WB 5H2BA 1TKWB 2CDGA 2UVFA 2Q1EA 5IOPB 2QZQA 4AEIL 1MI5D 1A14L 3PWPD 4YUEL 2BERA 1CXHA 2BK8A 4M02A 1IAIL 2A0LC 1KJ3L 4ZO7A 4B6ZA 4ZMZA 4H0HB 3TO4B 3LKNB 1TFHA 4LRNH 2NNRA 3IJ9A 4BQCA 1UD4A 1Y18B 2EIZA 2FO1A 3T4AA 3ZYJA 3FOLB 2YEZB 4P0DA 4XH2A 5I5IA 4A6YB 1UWGL 4FJZA 2QADB 1T1YB 1UENA 3PLYA 2X6MA 2YA0A 1CGTA 3ULVH 1G6VK 4XNAA 2XN9E 3F84A 3HR5A 4ENED 2BRQA 4LU5H 2H47C 2H2PD 4IBTA 3VXSB 4BKSC 3GIVB 4LSUL 3G5XB 5GZOD 3U36B 2CO6A 5IKCB 1OPGL 1V3JA 1NEZA 2JNZA 3ZX1A 2Q3ZA 2MSPA 4KJPC 5D9SA 5CEYB 3UMTA 4OR1A 4DFIA 1UYWL 1NSNL 1KB5H 2XG5A 1YJDC 1P5VB 4JGNA 3RYMA 2MJWA 1NBQA 3R06A 4ZUTA 5AVTB 2V3FA 3WENA 3KLAA 2WIIA 4XNQB 3WTWA 1YEGH 1QW9A 4BKTC 2JTYA 2VXQH 3T8VA 3S3SA 3VXOB 2X7LA 3N0AA 5GISL 3U9PH 3T5WA 1GH7A 5JQ6L 4D0CB 1A6UH 2BIOA 4WFED 4HOWA 3ZIMA 3LHAA 4UM9A 4AQAB 2XG4B 1I1FA 1VGKA 3MRIB 1YN7A 3VSQA 4F8TA 1N70A 3KXFE 1KWKA 3Q8FA 2EDRA 1EA9C 3FRPB 1HYSD 4IJTA 4XO4A 3HZVA 1LWHA 2Z91B 3CVBA 4X2UA 3IU4H 3FOMA 4P5MA 5DD1L 4ZD3H 5C0CD 5TQ2L 4OFPA 3SSGA 3DIFB 1L9OA 4EQ3A 3GIZH 3SJVE 2P1YA 3QWQB 1NCWH 1WSST 1Z5HA 2X4SA 5DSCB 2X4SB 5JHDA 1DQVA 3T2NL 4A6YH 1TSRA 1KLFB 2H32H 1PGRB 2BY0A 2AI0L 3A3YB 5IMMA 5SX4H 1XV8A 3GSWA 4PJEA 5F88B 3KLDA 5GRWA 5KSAD 3BMWA 3NAAL 3Q44A 2W0LA 3RTQD 5CCKH 4JDVB 4TVUA 1F11A 4JO4L 2NY2C 3X1FA 4LCIL 3QSKB 2F18A 1N67A 2Z4QA 4WWKD 4KDTC 1HKLH 2XPGA 3FU5A 1E67A 1R3IH 3HW7A 4BFKA 1KLGA 2ZXBA 1IJ9A 1XIWC 3B2VH 5C3TA 1I4FB 5F1OB 5EF1A 4U7SA 3VXMB 2RMNA 3ZR6A 2KQNA 2XZQH 1EJOH 3D06A 2LVCA 1EJ8A 4HLJA 4D9QD 2DEWX 3S36L 3S7GA 2HJKA 4NAJA 1SXCA 2ZKXA 4RAUA 1Q0XL 1HWGB 1X5FA 2LHAA 1LP9F 5EEXA 3CFNA 4YS4A 1KPVB 2OMTB 3PU7A 1ADWA 3O3EA 1A6AA 2XXCB 3ZO0A 2DL2A 3WDJA 1HINL 2NY6B 3FAWA 5DRXB 1XF5A 3DRQA 4GP4B 4GXUN 4M1DH 3V4VH 1AZRA 4UT6H 2IPKA 2PTUA 3FZUD 5ESVA 2ADJA 5EO9B 3PAUA 2OZ4H 1PEWA 4Y9EA 2GUYA 1OSZA 3FPXA 1M1XA 3IE4A 2WTOA 3AMLA 2JCCF 3N44F 3KPNB 3CX5J 5LBGA 3FT0A 1JGEA 1NMAL 2NY6D 5LBSA 3HE6D 4NFDA 4KNQA 3RWJB 5TQ2H 1XEUA 1G9ML 4PTUB 1AYOA 4MTMA 1AQHA 4O02A 4F57L 1KCWA 3QIUA 2R23B 1N7MH 4HKJA 3PGDB 3S5LG 3IKKA 3ZMRA 1G1CA 4WFFE 4V11A 4N87A 4JJ5A 1B9KA 1QAWA 4JPKH 4ZMVA 1P1VA 1HL8A 1U3NA 5MERA 1BXUA 3PUCA 4GKNB 1NDGA 2IH1A 3DK0A 1D5BA 2H9GA 2ZUVA 3KH3A 4QRRB 3M86A 4FZ8H 1NKRA 4ZX4A 1JG9A 1ZLDA 3RL1B 5C9KA 2HKHH 4W4OC 1AQKH 4G5ZL 4OAWB 3MODL 3C5ZB 3CLFH 5I1JL 1YEGL 3FNKA 3KXFD 3P0YH 4I4WA 5AKVA 2WJ5A 5I1EL 2X88A 1EEYA 2NLJA 4XBEH 3VFRA 1A4KA 4FXGB 4HXAH 1PCXA 2VOTA 2WXNA 3BAJA 3KD4A 3PL6A 4XHJC 2J21A 4PH8A 4DP5X 4H2AA 3HG3A 1OGAA 4LCWD 3NIFE 4OZHA 3QJRB 4LEXH 4NOBA 3NYKA 4BJLA 3C5ZD 4UOQA 3P0VL 4V1DA 1W8OA 1LHZA 2HRLA 2P5WA 2CALA 4FHKA 4BKLA 2ERJC 3ASOB 4LSUH 5TDNA 4JFPB 2IADB 4LSTH 2NNFA 4PB9H 5E6ZA 4AW7A 2J5LC 3VFOA 4EKJA 2A9DA 4PV8B 4DO4A 2OX5B 1AHWB 3INUL 5B21A 5ACMA 3MQIA 4F7CB 2CCVA 2ITCB 3K6IA 1FH5L 4XNBA 1EO8L 1LQBC 2YKKA 3GTVA 3HPLA 1DVFC 4L8DA 4EIBA 4NRZB 4XMXA 3BD4A 1PLAA 2F7QA 1OKEA 2FBOJ 4JPQA 5BRZA 1H3GA 1IAIH 1N0XH 3ARPA 2XTLA 4CSZA 3HBQA 3BEWA 1QI3A 4HGKC 5JOPE 5GRXG 2E3VA 5DZLA 1GHFH 1BFOB 3QXAA 3SE8H 1IQDA 4YXKL 1ET8A 1R24B 3SO3C 4Y4KC 4AM0Q 3Q8BA 4Y1SA 3E9UA 4KH2A 5EUOE 3IMVA 4AM0A 3NJMA 4HKXB 1RUKH 2E74C 3IM1A 3MHZA 3PWPE 4Q74A 3D4ZA 5E6IB 3K2MC 5ISZD 1RZKL 4HJGB 5EBGA 5D2LA 1DO5A 3CVHB 2MNWA 3WI9A 3DURB 3QNZA 3FTUA 4G6AD 1IGJA 4ADIA 4Z7NF