4AQ8A

Crystal structure of mouse cadherin-23 ec1-2 and protocadherin-15 ec1- 2 form ii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
208
structure length
208
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CADHERIN-23
publication title Structure of a Force-Conveying Cadherin Bond Essential for Inner-Ear Mechanotransduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 46
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aq8A01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aq8A02
2WBXA 1NCJA 2OMWB 3LNHA 1Q1PA 2QVFB 1O6SB 2WD0A 4ZMTA 3Q2LA 3K6FA 2OMTB 4ZMVA 1L3WA 2O72A 4QD2E 4ZI8A 1NCHA 4ZMYA 4ZMPA 1ZXKA 1EDHA 1NCGA 2YQGA 4AK1A 4AXWA 2YSTA 4AQEA 4AQ8A 4AQ8C 1NCIA 2OMXB 4AXWB 1OP4A 3Q2VA 4AQAA 4AQEB 4ZMQA 1WUZA 2OMVB 5CZRA 4NUPA 3UBHA 3K5SA 3K5RA 2OMZB 3Q2NA 4AQAB 4ZT1A 4APXA 2A4EA 4ZMLA 2OMUB 4APXB 3K6DA 3LNIA 4NUMA 4ZMOA 5JYMA 2OMYB 3LNDA 5KJ4A 3FF7A 5DZVA 3UBGA 4NUQA 4XXWA 4XXWC 3Q2WA 1FF5A 4ZMNA 3PPEA 4NQQA 3K6IA 3LNGA 2A4CA 1WYJA 5CO1A 2QVIA 2X2UA 3LNEA 2EE0A 3LNFA 3QRBA 2WCPA 2V37A 4OY9A 4ZTEA 3UBFA 1SUHA 1ZVNA 2WHVA 4ZMZA 4ZMXA 5JYLA 3FF8A 3MVSA 4ZMWA
chains in the Genus database with same CATH superfamily
5LDUA 4OGXL 1OCWH 5EU7C 1J87A 3KJ4B 3G04B 3LMJL 5JIDA 3GZKA 4OUOA 1IFHL 4JO4L 2NXYB 5CILH 4BELD 5D70L 1QBBA 1J12A 1OIOA 5F3HA 4N5UA 4X0NA 4BZ1H 4HK3N 5E7BA 5CGYC 3MRQA 4G70B 1A0QH 3D0VB 2BHZA 1AHWB 1YYLL 3KPOA 4LLUA 4LDOB 4FQLH 4YDIL 3C75A 3G5WA 4U1LB 4N2BA 1V3JA 2I7OA 1JHTA 4DEPC 4JUSA 4QRTB 1NL0H 5K39A 3ZKMC 2H2PC 2DLEA 1T4KA 3VXUA 4NKIL 2WZ0A 5E99H 3VXMD 4FQJH 1U2YA 2BIMA 1HHJB 2OBGA 5B1KA 5A2IH 2YPLA 3MJ9L 3QZWB 3T4YB 5I1IH 4AG4H 4PMEA 5B3JE 3OL2A 2WWKO 2ZWSA 3C2SA 3MRKB 3ZTNL 4Q9BA 2DIAA 3MJWA 1LDSA 2EEBA 4F92B 3BQUB 1NAKL 2GK0B 1FGVL 3B7TA 2XN1A 3L4XA 4BDVA 1GC1H 3DURB 4PU2A 1KLGB 4TLUA 5J06A 2E75C 4P07A 3R1GH 2BOCB 4WFHE 2UZXB 1QG3A 1NBYB 4JFEB 2PTTA 5M95B 4KZDH 2P44B 2QVKA 4KY1H 2NY7L 4XAWL 4G1EB 1I9JH 4XPHH 4M48H 1M3IA 4M1DL 3ETBJ 3MGTB 3L5JA 3ZTJH 5T3XH 1K4DB 3L3GA 3QQNA 2KC0A 1AP2B 5T5NF 3TO2A 3K71B 4DP7X 2NDFA 5E2VL 4J3TA 4TLTA 3G6JF 5HYIA 2HUHA 4KTGA 4UNTA 5FGCB 1VKXA 1JV5B 3DX9A 4GAYA 3OGOE 4N2MA 3K6IA 2FVNA 3L3HA 4NHCH 4S2SB 1MREL 5GRUL 2AZUA 2OSWA 2ZP0T 3Q5TA 4OBSA 5EU6D 1L9TA 3EAKA 3QDME 4H20H 3PV7A 4OT1L 5IK3B 4TSBL 4MJ4A 3RWIB 4KHTH 5GS0D 4NP4L 4Y4FA 1LD9B 2ARJQ 1C9SA 4JS7A 2CKBH 2X4OA 2G2PA 3EH4B 1FE8H 1TPXB 4I9WE 1Z9PA 2RACA 3ARFB 5BXFB 1NSNL 4M9OA 1SQMA 4P4RA 1KGCE 1NCAL 2VISB 4G3YL 3MV7B 1DVFD 1I9EA 4K5OA 4PRHE 4GIAA 1PW3A 3SBRA 4I3RL 2EE2A 4UF7C 1IGMH 1MVUB 1TKWB 1D9KC 3W39B 3ARGD 2JI3A 4JY4B 3ZU8A 3O8XB 3A67H 5DHVH 2CZNA 3HN5A 3LXUX 3NTCL 3CFUA 3VW3L 1SEQH 2XN9E 3RBGA 1A47A 1SN2A 2W0FB 3D2UD 4Z95L 2R8SL 3C6EA 5BJTA 1GJIA 4HWZB 1EDHA 1INEH 4ES8A 1NPUA 2D4FA 2APWA 2WINA 1XGPA 4RDBA 3HE6B 4QYOA 4XN4A 3DXAB 3CX2A 4GXVL 1PFOA 5BS0E 2PXYC 1N12A 5K9QI 1MXGA 4HS8H 4N8PA 4W9EC 3U79A 2Q20A 2Z7YA 2V3FA 3O2WH 4NZDA 5D71H 2AQRA 5B22A 3T77A 9PCYA 3HMXA 3QG7L 2IALA 4HSCX 1N6QL 1X4ZA 4XOCA 1J0IA 2AK4A 1IQDA 3DV4A 4EIBA 5IQLA 1EJOL 2UZPA 3BEVA 3IJ9A 1IGTA 3K5RA 4ZX3A 1NIDA 4FRWA 3BIKA 2EEXA 2VN7A 1ZA3B 1G7JB 4KKLC 3BPOC 4W6XB 5KYNA 2VUKA 3PWVA 1FCGA 1GTFA 5FLVA 1XAKA 3LPFA 5AW3B 3RL2B 4DEPB 4LFHG 3AS1A 3LNIA 3R19A 1CFQB 1BLNB 2ISDA 3IMVA 4AIZB 1H6TA 2P8MA 1G1KA 2Q5BA 4N90E 3DWTA 3OB8A 5A16B 2P80D 2GSGA 1DVSA 3RRQA 1XT5A 3N3EA 3PHOA 1G84A 1XWVA 2R0WH 1NMCC 1SY6H 4M93B 4X5LA 4Z7NB 3ZDXF 1IC7L 2C9UA 1WDAA 2A4ZA 5EO9B 4OF5A 1ROCA 4BFGA 2OYPA 4AC4A 5D1XE 2ICWJ 3VRJA 2FR4B 3MJ6A 1E8YA 3EKCA 2V33A 1TVBA 3DHMA 1ETZB 3QWNA 1A4BA 3DVGA 4H2CA 2X70B 4GSDL 3FL7A 5KS9E 5IF0B 3VXQA 4C56D 4LRIA 5DC0A 4GY4A 2E4TA 1NGPL 2JIXB 4TUJA 1E5CA 2CE6A 3TO4D 3VFNA 4K07A 8CGTA 3MX0A 3OX8B 3RIFF 2R27A 2OJEA 5MENE 3WIIL 3DO7A 2BDNL 5EIVA 3APCA 1J0YA 2ZF9A 4PHXA 1RULH 4K2UL 4MQSB 1HJCA 1QSFB 4IHBA 3TNMB 3ZE0E 2WIIB 1SOSA 3MJ8A 4HKXB 4WJ5B 3TBVA 4OZFB 5HGBA 5CP7A 3OJMB 5IQ9B 1QFWI 2HKFL 4LLDB 2G3MA 3WFBL 4G9FB 3QUXC 5LB1A 1LLAA 1XMWA 3STLA 3NSYA 3NIDB 4IGBC 4Y5XC 1NFDE 2FT7A 4CDGC 3O4LD 4TQEH 3EFOB 5TPWL 1TJHH 4BFOA 2PKDA 1A1OB 3RGBA 1MFEL 4O02B 4ZBJA 4QRPA 4HCRH 1BYPA 4KX8A 3L8QA 4YDZA 2Q87A 3HG1A 2ETWA 2DLFL 3L08A 3JVGA 1E9PB 3QDGD 4GKSA 3ULUD 1YEIH 2ILLA 1HXYB 2WXNA 4U1KA 1ACCA 1WCQA 1UZ8B 2NYYC 4J5VA 1RKRA 2AF2A 3UG4A 3FC8A 4N0UB 1UB6B 4HJGB 3HZYB 2PMZA 3EHBC 2DTSA 4TOYH 2IV9A 5D7EA 1F8TL 1VEOA 2YFNA 4X6BA 3RWHB 1SOQA 1P53A 1D9KB 4Y2OB 3QEQE 5MHSD 3ZMRA 3CFEB 2VXTH 4HPOL 4QOKB 5DYOA 1I1FB 4FQ2H 2HXAA 1D6EB 4PS8A 4U1SA 5MERB 3NA9L 2HG0A 1SLUA 4S0SD 2OK0L 3IDUA 3MQIA 1NPNA 1KCBA 4LDEB 3H6AA 4NQSB 2AJSH 1QAWA 3BJLA 3NCJH 2LW3A 4HUVA 4AEFA 3PDGA 3MLTA 3KLQA 4H8WH 4IRJA 4NUMA 4UM8A 2FQDA 3DX1A 1K72A 2L04A 4ZMOA 2Q8BL 2APBA 2GJ6B 4DK5A 1OPGH 5F7KC 1I8IA 4Q4IA 4ANKA 4BH8B 2X4RB 4NKMA 4RIRB 4XP1L 4CN4A 5J8OA 1SVZA 3IU3A 1PCXA 1IAIL 2WLIA 1A25A 4WWKA 4BE6A 3UZVA 2BVQA 3FH8A 3V95A 2OR9L 4NM8L 5D2NB 5IHUL 2W8CA 3IDJB 4HUXB 3S3DB 5EZOH 4CSSA 5SWSB 1F90H 1FLRL 4XPAH 4WKZB 1KGYE 1U95B 4HZLA 4RDQG 5GS2D 4LEOB 4DVRL 2E3VA 4LHJB 4RWHA 1XB8A 2Y3NA 3ABGA 3U7WL 5ICUA 2NTSP 5KYUA 1SYVB 2E7DA 4FA7B 5ETUA 3UMTA 5T1KD 5E1HB 3L81A 1TCMA 1LEGB 3O11B 4EUPB 5MEPB 5KOVC 4F9LA 5D70H 4GW5A 1AZZC 4KI5C 4RMRA 3JV6B 1QFUL 5JO5B 4X8JA 3HLAB 5AYUH 4DGYL 4YLBA 3K4DA 3SBQA 4N1HB 4ZMXA 1JS4A 3GBEA 4G71B 3VXPB 3OWEA 5DLMH 4AX3A 3A6BH 3X3GL 3K74B 3RFZB 4G8IA 2OXGB 1KPVA 2C9PA 2CJUL 2MHAA 2CBPA 4NSKA 4JFZH 3DIVA 3T2PA 3O9WD 1OF2B 4M5TA 4BFNA 1JPTH 2P8LA 3FUIA 3OC5A 1FNAA 1KXTA 4Y1SA 5EN3A 5M94B 1J8HB 2F6AA 1N3NB 3NCYP 2EE6A 2DM7A 1G7QA 5EV7A 3FN9A 5KYYB 3WU1A 1YNTA 3GXUB 1L3WA 5J57B 1OM3L 3WFHA 5D7KE 3FUEA 4ZTPL 4OLUL 4MRBA 3ZTNH 4JREC 4EI6A 5H94B 3FQRB 5I1DB 3IKCB 1PLBA 4GP4B 3ULVD 2XKNB 4DH2A 3INOA 4JPVH 1AGDB 3HAEH 5T1DH 5ACMA 4TVPE 4MS6A 2FYYA 4LF3B 1IBGH 2C3GA 1E6OH 2Z35B 5IQMA 2DQIH 3SDCC 1XSJA 2DYPD 3NJJA 5BZZA 3BZ4A 3FZUD 3B37A 3QSKB 4IEFA 4UINH 4UBDC 5HHOA 5TDPB 4D0DB 3ECUA 4GRWE 1ZA6B 1MHCA 1LWRA 3QUXB 2NR6A 5LAPA 3B5TA 2R4SL 4IGBB 3JBG7 3IJEB 3RA7H 1USQA 1OHZA 3KPSB 4S1DC 4NO0B 1AQHA 1N5AB 1NH6A 1RZKL 3RDTD 3BX7C 5IBTL 4MJJA 1HHHB 1Q0YL 1VGKB 4N0YH 4QTIL 5IB1A 5DJ8A 1ZLVK 4WEMB 5DJCB 1KPRA 5JORA 2WTRA 1LP9E 2R29L 1X5LA 3C8KB 3TF4A 5I6LA 1Z6JT 4JFFA 3LDBC 3S2AA 1YEEL 3Q13A 1I7RB 4MAZA 4IU3B 5CJOL 4KV5F 4M43H 1LEKA 3MCKA 5JW4M 4IOIB 3W11D 4Z6AT 1CE1H 4YSTA 3SE3A 2XACC 4PR5A 3O3BB 1CGXA 1O5DT 3IS0X 5IVXE 4JZOA 5HGDB 1MELA 3MUGA 5T3ZH 2GEEA 5HHNA 2ITDB 3V8OA 1L7IH 1U42A 5DHYA 4H4NA 1IZKA 1RJZA 1U2CA 2V8LA 1G7LA 3L3KB 2DQHL 4K5LA 5HJBA 2AQSA 2EO7A 4D7PA 2CCVA 2ZKYA 1EEYB 3RTQD 1A6WL 5IB4A 1OE3A 4OQ1A 5C07D 3BOVA 4NQVA 3NACH 2X6UA 3B2MA 1SDDA 2PYEB 1QKZH 1PFCA 3FU6A 3T2LA 4XVSH 3ZT7A 1AQMA 3IMSA 4ETQA 1YNTF 2Q6WA 2Y07H 4JDVA 2XVGA 3QHFH 1Q1PA 3QNZB 2M2DA 5E23A 4NGHL 2HRPL 2OZNA 1QMUA 1S8DA 5HJGA 4Z7VB 3QXDA 4AIEA 3V5DB 3CSFA 4W6YB 1MIML 3AY4C 1YDPA 2A6DB 3HC4H 2AXJA 1E3FA 3MN8A 4LIQH 4XBEH 1WFUA 3QA3A 4AKOA 5SWZA 3VG0H 3ZDYB 2KDGA 5TH2A 3NT0A 5CF3A 2IFGA 3D87B 5IKCA 1SLWA 4IHOB 2OR7A 4ENEC 1RMFL 3PLYA 5FDWB 4ZS6C 1K3IA 4L4TB 1KB5B 2A0LD 2X53A 5HVHC 3CFBA 1GW0A 3FH7A 4DP0X 5L6YL 1KCSL 5LLIC 3GK8L 5K5YA 2VXSL 2RD0A 4OH2A 3TJHC 4UTCA 4N2GA 2YGOA 4KPHL 3V10A 1A4CA 3MRDB 4LSRH 2WXLA 4MKTA 2OZ4L 3CDZB 3FRUB 3CFCL 4LSQL 4N8VB 3E8VA 3I50L 1EXUA 2YGPA 3QZWG 4J3UA 4J3OD 3WTUA 2HYMA 1YN7A 2YZ1A 3ULSB 2G5RA 5DC2A 5KS9F 2JK5B 2ID5A 2ZNXA 5D1ZI 4M7KL 5GRXG 5J5EA 4OLYH 2DH2A 2MPVA 2NY3D 1F58L 3MOAH 3KVDD 2E47A 4M7LT 4V2BA 3MRCB 3HZVB 3I75A 2CGYA 4PGZA 4KQ0A 2OMYB 3DYPA 3CXHJ 1NCWH 2WXJA 4F7TB 3RUGB 2F19H 3GZPA 2V9UA 3EJRA 4UM9A 2D0GA 3KDMB 3BUYA 4NPKA 1H3PH 4PG2C 4QRUB 3SDXE 4LLYB 2DQJH 1UD5A 4HQQL 3N42F 3ZE0F 4JFVA 1BEYH 2KDYA 4L8CA 1LO3L 3ARQA 3GMPB 4PJ5D 5IR1A 3D4YA 1Q1JH 3PL6B 4YDMA 1MHPH 2BSEA 2NY6C 3F7QA 1CICB 4FI8A 3BP4A 1NFDF 1YAZA 2ADJB 5L0QC 1WHOA 1YYML 5AD0A 1YSOA 2HKFH 5I1AA 3BISA 3V9EA 2QDWA 3GO1L 2BM3A 5JXEA 2MIZA 4LOUC 4IK6A 4UQ3B 5I16A 1BD2B 2D7PA 1WK0A 3ARDD 5E6IC 5L9DL 3LDBB 4Y4HD 3FF8A 2JSFA 4XNDA 1EGJL 3BVNB 2D9QB 4MXWH 2AQNA 4ZUTA 2HJFA 1SHMA 3HG3A 5KZCB 2X41A 2OMNA 2LAAA 2L7QA 1Q9OB 3GJFA 3Q5OA 5DUPL 3SSGA 2Y7SA 3TZVA 3ARWA 4EI5A 4U3CA 2LFEA 5HHME 1A4KB 5KSBA 3U1QA 2OTWA 4KUZH 2Z4TA 4R4NC 5GZND 2OMTB 5LBSL 3B9KD 4J4PA 3WIHL 3N44B 5F7EH 3VO0A 4UT7H 4WHTA 1C08A 1CGWA 3EDEA 2P5PA 2CO3A 1DQQB 1XR8B 2DICA 2VDRB 3VXSD 3GSOA 4HZAA 2MCAA 4XHJC 4DF9A 3U9PH 5LVEA 4RWYH 3ZDWA 5T3XD 1W8OA 4EIZC 4OD2A 1J0KA 4WEBL 2VLKE 3D2TA 2XWRA 3KBHE 3M7FB 1OD9A 2WXIA 1VRSA 1QFWL 3CVCA 4AGOA 3PWPA 5BRZE 1L0PA 2XOTA 4PJGE 3CXHK 4PJIA 4DIXA 4X6CE 3OXRA 1WUZA 3QFJB 2UVFA 4FZ8H 4XCEB 3SDDC 1MQ8A 1ILUA 3PNWB 1M05B 4C54A 2G9HA 5FX3A 1OCOB 1I8AA 3C5ZA 5EOQH 3HPJA 4PJ9C 1DFBH 3LEVH 3FW6A 1H8SA 1NCBH 2A83B 4BXSV 5IESL 3M88A 5MEQA 3KPNB 2QL1A 5LUMA 2YAOA 4KRPB 1HIMH 2AXGA 3LHPH 4FNTA 3EGXA 3O2VH 4GAAA 4HJUA 1D5MB 4TNWF 4C83A 3MGOA 2C1OB 1JGIA 3NPSC 1T0OA 4L2LA 1KIPB 3W0WD 1IBZA 1Z9NA 2E9JA 1U8IA 4I18A 4ZUSA 1NGWA 4YBLC 4I77L 3IXAB 1JYXA 1P6WA 4J2QA 4JFTA 3TEZA 4MCYB 4E5XA 4LLWA 1RUQH 3REVB 1NAMH 3P3RA 4LE8A 4ZG1A 1IM3B 5SWQA 2NY1D 2PCFB 1O5PA 4DGYH 2A9MH 5HYQA 4C4KT 4OLWH 2QR0A 3D3VB 1T1WA 3FO0L 3LKQA 3MHZA 4M3KB 3FTWA 4MZIA 4XPFL 2UXFA 3SKMB 3Q1SL 4LMQE 4JB9L 1PNCA 1W72A 4ONOA 4Z7WE 2H47C 4X5WA 4G6AD 2F5BL 3BGFC 1PLGH 3B34A 4BINA 1M9SA 3FSVA 4XE5B 2OTUB 1E4KA 5L2KD 2N56A 2H32B 3M17B 1SBSH 5T33H 5DGRA 3SODB 4DETA 3B2XA 3B1UA 1G0DA 4NI6A 3VFOA 2MKLC 3TXAA 1DBML 1UUSA 2WZ5A 5C0CB 4GG6E 2WBXA 1AQ8A 1BVZA 2OP4H 3MV8A 1JGLH 5HDLA 2VDOL 4G6FD 1S6NA 3LJ3A 4GKNB 1BFOA 4XNQB 5DDHA 4GRWF 4QXGL 4IOSA 1T21B 1ZPUA 1FRGH 2DKMA 3ZDZE 4AQOA 4DVBB 1BSIA 4F24A 3F3HA 1CFTA 4RFOH 5KEZA 5ELIA 1K6QH 1ZLEA 4OZFG 3UIZA 1XR9A 1CT8A 4ODVH 1E27B 4YWGH 3MLPA 5C09E 2YC1A 3DGGA 3PAUA 1LEIB 4PJIF 4ZS7H 3PUUA 4ELMB 5C0RH 3P4OB 3NH7H 5IBUB 1LP9F 5DJ6B 1TJIL 4LCCC 5SX4I 1RUKL 4R4BA 3RY5A 1C5BL 1Q0YH 2J55A 3MLWH 1MFAH 1QTSA 4NWUH 4MHHI 5A2KH 4PV8A 2BNRD 1FLTX 4QKXB 5FUZH 5HDBF 2TSBA 4LP5A 3VFUA 3QIBD 3CN2A 3IPFA 3TN0A 2BY0A 5JIPA 1MCNA 4LRNL 5IVXF 3IMUA 1ZJAA 1UA6H 4QHMA 4JKPL 1SGKA 3RZCC 3WNKA 5FIEA 2HA1A 4JO8A 4KJWD 3EOTL 5BRPA 2F8VA 1B0RA 1Y0LA 2ZZUT 4FAAB 4L8DB 2M83A 2ORBH 4I0KA 2CBQA 1Q72H 1QHQA 2A6IA 4LCYB 2LHAA 4XNUL 5CIPA 5DK0A 5EU5B 1MG3C 4CL7A 1D6VH 2J5WA 1HXMB 2DY2A 1LO5A 1ASQA 4FQIH 1FNFA 2QBWA 3QCVL 2BY2A 2OYKA 4XMWA 3U2SA 2BMKB 3RPKA 2C1PB 1DUYA 3QXUA 4FEMA 3UTTE 5E03A 1KFAL 4OW6A 1NFIB 1A2YB 1DL7H 1S9VB 4CVXA 4HIHB 1R3HA 1KUMA 4Y1AD 2EIZA 3SDDB 1UCTA 4O2FB 3JV4B 5B4MD 4JUTA 2PPCA 1GCFA 3LNGA 2VDNH 1M1XA 1JYVA 4PH8A 3D39B 1TCRA 4KHXL 1RZQA 4PJ9B 1JERA 5BOPA 2VLJE 5HPMB 1Q90A 1AY1H 4WLCA 3MBWA 5KYXA 1AO7A 4NUGH 3T0DA 1QBML 2NT0A 3EO1B 1U8NB 3VB9A 5F93C 4FQXC 4AT6B 4PS3A 2MWCA 2WBJA 4UTBH 4WUUB 1BAFL 1K5NA 3SE8H 1CR9H 2NTFA 3FUDA 4LCUB 2A6JA 2V17L 2F7RA 1F97A 1H19A 1PSKL 2RFXA 4KH9A 4J28A 5JW4Q 3WL9A 1C16B 4EUPG 1IGJB 4UQAA 2PLTA 4ODHH 3VFTB 4PJEB 5I1LA 3LN4A 2IH3B 5D6DC 1RZGB 2QJDA 2YKKA 2BNUA 1UM4H 1L6XA 2C26A 1G9MC 3F58L 2VXVL 3KLHD 2OXHA 3KH3A 1E2WA 5F7DB 4G83A 4Y4KA 5EZJB 2Y6SC 2H1PH 4GG8B 1RUAL 1RV6X 2UY6A 4OZ4B 3GK8H 2WJ5A 3INUL 4M6MH 2VDPB 1RZIA 4AEEA 4P4KD 3WTTA 2AV1A 3FQXB 1W0VA 5HSFA 1U58A 4ONFL 4GMTL 2H41A 1JD9A 5D4HA 3FFCB 4UIKL 3BJ91 2F68X 4Z7OB 5E00A 2YGQA 2IO5A 2Q76B 1UTDA 4I5BA 3TBSB 1I1AC 2QZ5A 1N26A 4ZW3A 3JT0A 4AXWA 1BBJB 1F4XL 1ZV5A 1CLCA 4OKVA 4CBZA 5E4OA 1WFIA 5IB5A 3WD5L 5IJKA 5B7FA 1ZHKA 2A1WL 2FHBA 3UTPD 4QJ3B 3TV3H 5TQ0L 2QHLA 3L3DB 3UC0H 2EUVA 3I85A 3ETSA 4ODUB 5DTFA 3K3QA 4OCXL 4HIPA 1IUZA 5ID0A 2VO8A 3HS0B 2XV6B 4Y8DC 2XV3A 4YSPA 1KCLA 3D06A 1OAUH 3IXTA 4M3JA 5C0IB 3GMOB 4QRQA 2Y06L 1C12A 3LOWA 3WTVA 3FYEB 5LGYA 4EF3A 4MWFB 4A63A 1I7ZA 2ENJA 3LIUA 4YHLH 4Z3IA 1MW1A 2OI9C 5ICXA 2H8PA 1V7NH 4LCCB 1E28A 1OGAA 2PTVA 4P2AA 3ZQXA 1FNGB 1Z5LA 1XH0A 3MV9E 4HPYH 4RBPH 5KJRL 2AKRA 4P5TA 4G82A 3HW7A 2NX5D 1A5FH 3GHEL 3NCBB 5J3HC 3DPBA 3TONA 1KTDA 1WLHA 5I8KH 4JNXA 1BMZA 3JTSA 4XTRC 4F93B 3B8YA 5ALBH 3BMVA 3FTXA 2CK0L 3FU3A 4IS6B 3S4SB 1AGEB 1XGRA 2R59A 3NRPA 3GSNL 3DX6B 1BXXA 1CL7I 3LY6A 3ALXA 5C0BE 4G43A 1GGBL 1DQDH 3X13A 4RQQB 3WIHH 4H5SB 5JHLL 4MDJB 1ZHBB 5GSVB 4YIQB 4ODTL 2DQGL 4ZW8A 3OMZA 5CS7A 3VGDA 1UT2A 1B90A 3ATEA 2YRBA 2H3XC 4I2XA 3E0GA 1BAGA 3FQTB 4P2OA 5C0GA 4QXTA 2DL2A 1IM9D 1L9OA 5K9JL 2VQ4A 4U33A 1G7PA 2KT6A 5AZEH 4QRRB 2JELH 2X3BA 2VAAB 2C5DC 2N7SA 1DQKA 1GRWA 2YXFA 3FQNB 3I6GA 4PJBE 4X5PA 2AEWA 4U6VL 5DRWA 2J8UB 4X6CF 3K6NA 1KBKA 1CFSA 4RNRB 5LQBH 2ZOLB 1RIUH 1E9OA 4FQXB 4OGQC 4NQDD 2Z8SA 4KVCH 2WOBA 2ZXWB 3UJIL 3HEIB 3F2LA 4F80A 1A7OH 4LSUH 3EJZC 3NA4A 4M62L 3VVWA 4A37A 4HAKA 3LSOA 1UOLA 4KJPD 4PJAE 2XT1B 4K23H 5GS1C 4GXUM 2WB1A 1QUNB 4KFZC 1MAML 4OZHB 2ZP8A 4UQIM 1N0LB 3FRPB 4LHQB 4ZO7A 4HUUB 2HRGA 1DUZB 4JHAL 1ZD6A 1KXVA 1KDJA 5T3ZD 2VLRB 4OCYL 1HKLH 3M86A 1EFXD 4RDQF 3LRHA 4N2CA 2WZPA 1QYGH 2IPUG 1KJ2H 2YS4A 4JZJC 3RG1C 3DX8A 3OAYK 4XI5D 2XZAH 5BO1L 1Q9LA 1URIA 4XWGH 5CUSH 2BZDA 4NQCD 1RZJC 5ADOL 3G6AB 2VR7A 4WO4A 1ADQA 1WBYA 1XL6A 5AOLA 5TTRA 4UQ2A 4L0YA 3D25B 2COQA 5D6CB 1NINA 2Z4QB 3MA7B 2ED6A 3HPLB 4N8VG 3KLLA 1I1AB 3O0RH 1XXFC 3P3TA 3PABA 4RCAA 1Q9WB 3RWFB 2DQCH 3WS3B 3FO1B 4N24A 5A2CA 3WJMA 1TQCB 3QCUL 3WJLA 4YH6A 3LQMA 2HLAA 3LV3A 2XWJB 4JRXB 5E4IA 3AMLA 4FXTA 4GG6F 2NNFA 3GRBA 4PP1C 5JOFB 4FG4A 3CVHH 1W8NA 5FK9A 1I9RH 4X98B 3NK4A 4XP5H 3GNML 5C0JB 2JLLA 1OY3B 4NC0B 2F7OA 4UCFA 3CC5B 3GIVB 3ZQWA 3TASA 1MLCA 3GLZA 4V1DA 3ZDZF 1CBJA 1OQXA 4FD0A 3VTMA 2ZYRA 4YHOL 4R7DA 3X12B 1TEGA 1FL5A 4Y7OC 4FQCH 3Q2CA 1JI1A 4PJ7B 4XNMA 2WM0A 5F1SA 5TDOA 1TEYA 4OZGE 1T5WB 3G04A 3OR6B 2R0LL 3GQFA 4GBXD 4YE4H 4FG6D 1DBKH 4LHUD 5LCVA 2AI0H 3T6XA 4WTXA 3D0VA 1OP5H 4EIGB 1JE6A 1AHWA 1PEZA 4MA3B 1A8JH 5HD8D 4U1LA 4P46D 3OAUL 1LK2B 4G8EA 1J11A 1A3RL 3NSDA 1EHLL 1IQWL 3GMQB 4L8SC 1CYXA 4QRTA 3WEXB 2AC0A 2VAJA 4MA8H 4DOHB 5CD5D 3I02A 4DKFL 3N43B 3BVUA 3LVEA 3SKUD 1FO0B 1K9TA 2LR4A 2WXMA 3AG2B 3UAJD 4A2DA 4E9TA 4CW1B 1HEHC 2JJSC 1ZGLM 1OT2A 3T4YA 4BQ6A 4FFZH 2DQDH 4P3CL 3L5HA 3MRKA 4AQ8A 3TCXA 4X5XB 1Q38A 4UZUA 3BQUA 3VSQA 2GK0A 3T2NH 3UTSE 1MJJB 4FTVE 2YBRB 3DURA 1OAXH 2QSQA 1KLGA 1UD3A 4N0UE 2JKSA 2BOCA 2UZXA 1NBYA 4JFEA 2CHNA 1SMOA 2P5WE 3BSZL 3N85L 3NIFE 1KFAH 2VABB 3B5HA 2VDMH 4ZT1A 1NC2A 5TJWK 3P0YL 5CLXA 4G1EA 3GMLB 4QOKE 2X0VA 3BH9B 1CC3A 3MGTA 1AFVL 1JHKH 2X6CA 2CBTA 1MRDH 2VR6A 1K4DA 2BVPB 3BLBA 4TMPA 3DDFA 1AP2A 5AW6B 3K71A 3VXMB 4MAYC 4U05A 1IU1A 2H0FA 3KH4A 4JLRA 2FCBA 4W9IC 3FF7A 1HHKB 4J7RA 1OSZB 1JV5A 4HOMA 2CRIA 4LNVA 5E9DD 3ECQA 3IDXH 3T3ME 1UOWA 1O0VA 4S2SA 1MWAB 1PY4A 1QSED 3I9IA 4FXGC 4M1GL 2V17H 2W9DH 4ZD3L 3UYPB 4UAOB 4WHDA 1IC5L 2CLZB 3CHQA 4AKPA 5C9KA 3HRZC 3DHJA 4JZJB 5IK3A 4N6RB 4UT6L 3LKNB 5AW2B 2P8PB 2ZT9C 4GH7B 2WUBL 3HN3A 4L4VD 3RWIA 3W82A 3ZL2A 4HMEA 3QORD 3LX9A 1LD9A 2C9RA 1WUNT 2VLLB 3ETBF 3TO4C 5IMLA 3P4NB 1SZNA 4K15A 2MOVA 2CSPA 2MCPH 3ILQD 3ARFA 5E08L 4EDXB 5ANMB 5BXFA 4G9DB 4AYEC 3PCYA 1PD6A 2VISA 3TP4A 4FABH 3MV7A 2YSSB 1ZMYA 5JW5B 2G0KA 4YSUA 2WBWB 2QTVA 2QELA 2W65B 1TKWA 1MVUA 2Y0SA 3NK3A 5DZNA 2X3CA 3QUGA 4LVOC 3U36B 1EJ8A 3W39A 2YMOA 4JY4A 2VRKA 3O8XA 3RX9A 3EYSH 4K5MA 3RLSA 4FADA 4YSCA 1F3JB 1CFNA 3B9EA 2JI2A 2DDQH 2EDEA 3N04A 2W0FA 2F5AL 2IAAC 3NCWA 5EU6B 4YFEA 3FCUB 5J0BA 1C8PA 1WAPA 2YAEA 1J1OH 1EANA 4AENB 4AVKA 4GMSL 4FHKA 3IMWA 2DBLH 3KYMB 3WELA 3A6CL 4HBQA 3ULUC 3HE6A 5GQBA 3FMGL 1YECL 3DXAA 3QDHA 3JWOH 4Q6IB 2H0EA 3Q9QA 4Q0XL 2R69L 3D12B 3S3JA 1WZAA 4OCXH 5I8OH 1J0HA 2FUQA 2Z65C 4I7ZC 4JPQA 1Z9MA 4JY5L 2BWDA 4XO5A 3GYRA 5JXAH 3HMWH 2LU7A 5E70A 3ARGB 3WDHA 4JO2H 2VXQH 1V7MH 4RMBA 1ZA3A 1G7JA 3DX7B 3ZN6A 5ECGA 1P4BH 1M57B 4N9OB 4Y5VC 1AOZA 5IBUG 1VEMA 5FYJU 3WKNA 3CLEL 5A2FA 3RL2A 2X3AA 5F7HA 1MJ8H 1XL4A 3GSQB 4FQHB 2XPZA 3D2UB 3BFWA 4YUEH 4HS6B 1CFQA 1BLNA 1BYOA 3PUCA 3EJYD 5FYKH 4AIZA 4BE5A 4I13B 1B0GB 2OL3L 4HC1L 3MYJB 3D07A 4UDUB 4TUUA 4YXLH 5A16A 2GJRA 3ZXAC 4JFQA 2OYMA 3P3UA 1WE5A 4DKAA 4L5FE 4B9YA 3GMNB 4UB0L 2B2XL 4YDNA 1JGEB 3AAZB 1TFHA 4U4BA 4M9PA 3LIZL 3AWGA 2Y4SA 3V0HA 2FR4A 1ETZA 1EZVX 2BVTA 1DSWA 2JF1A 1AXSB 3IDMB 4OTXH 2B5IC 2G2RB 2B59B 1XMEB 4LSTL 2X70A 3C6LD 4MMXC 4OFQA 5IF0A 4QI3A 5E9NA 43C9B 2EAEA 3KVQA 1N7ML 2JIXA 2E9BA 3HB3C 4KMTL 5C6TL 3A24A 5J6GB 2NUPB 2BIOA 4WTWA 2UUDK 3OX8A 3ROOB 3NEXA 2BCMA 4ATWA 2KPWA 5EC2B 1HTYA 4AEIL 1AE6H 3A4FA 3V4PH 5AVVB 4EIUA 1N67A 1QSFA 3TNMA 2FT8A 2WIIA 5AUMB 1BXVA 4HKXA 4WJ5A 4OZFA 3C2AL 5E1IA 3F65A 3CFJB 5IQ9A 4LLDA 3V8CA 4G9FA 1AHMA 4Z7AA 3S8GB 1M53A 5FC9A 3AABA 1YLBB 4DN4H 2Y36H 3EFOA 1BZ8A 1A1OA 1E4WH 1M1SA 3ERXA 4BWUA 2J2ZB 4JO1H 2HG5B 4O02A 3OLEA 4PB9L 1NIFA 4C56B 5IGXL 3FQYA 2ZXBA 4JFDE 5F9AC 1LNUB 4RGND 1JJUA 4D2NA 2BXZA 3TO4B 1E9PA 5IM7B 4WWKD 1GKOA 2PWEA 1PKQB 4OFYD 1IGCH 3H7LA 3QS3A 1CN4A 3ULVC 1HXYA 3CU7A 2DM2A 4DEUA 1EAQA 2HFTA 3QXWA 1UZ8A 4HGKC 3NIGB 3FU0A 4OSUH 1T7YA 4ALAH 4EI0A 4N0UA 1CZ8L 1T5XB 4JDEB 5E2TL 3KNBB 4HJGA 3HZYA 5BO1H 5I1HL 5C08E 3S48A 3L1OH 2F74B 2YQBA 3FZUC 4HEMA 3RWHA 4BFFA 1D9KA 3MZTA 2WWNA 4LVOB 4Y2OA 3ZSTA 2XTJE 4EJ1C 4QHNB 4QOKA 4JX0A 1I1FA 1ZANH 3CH8A 5D1QE 1HYSC 3BN9D 1MFNA 1D6EA 1NBVH 2VTFA 3L6FB 3O4LB 5JIQA 3H7BB 4TS6A 5MERA 3TF7C 4I8DA 2JJVA 4NQSA 4LL9A 4YC2C 5EIIB 4JQIA 2H0JA 4HGWB 3SYQA 3V4VH 1N0XL 1Z32X 4BCYA 2DQUH 3QDGB 3SKJL 2GJ6A 3D85D 5F9OH 3CJJA 1BOGB 2X4RA 4RIRA 1VFMA 2OKMA 5C92A 3B2PA 2BK8A 3R4DA 2QHRH 3CLFL 4NZUL 3AG1B 3BYTA 5D2NA 1T2QH 2WTOA 3IDJA 3BKCH 4HUXA 3SPGA 2IWEA 3IBOA 5SWSA 4N6QA 3BWSA 4WKZA 2NLJB 1U95A 4LVEA 3CVIH 4OZGF 4PB0H 3H9SE 4LEOA 3GINA 1KY6A 2V7HB 4UOZA 4Y5VB 1RUPL 3LQAL 2XZQL 1SYVA 3QUYD 3KHQA 3KXFE 4YPGB 4LSVL 1LEGA 1ZV9A 2EH8H 3O11A 4EUPA 5MEPA 1D7DA 2C4XA 3KYAA 2X2HA 3JV6A 5JO5A 3WTYA 3RTQC 3HLAA 1RUML 2VOTA 5FCUL 4LAQH 3NIDF 4PGJA 2VN6A 3VXPA 1E4XI 3RFZA 4MD4B 2OXGA 4Y0GA 3S4SG 2HT4C 4YMPA 2LLGA 5JLZB 5KAQG 4YSQA 1P84J 3I6SA 2EDMA 1BM3H 1OF2A 2J6EH 4DKFH 4FERA 3LPWA 3UTOA 1CF8H 1J8HA 1PPIA 4HFWB 4R2GD 4G7VH 2ZXEB 3TURA 2CIIA 3EYFB 3JWDH 4AMXA 2WGNB 5KYYA 2EC9U 2YRPA 3I2CH 4P5SA 2XI9A 4UZSA 4A38A 4E9QA 4F8NA 2EIKB 2I85A 1EZUA 4G80B 5H94A 3FQRA 5T1KB 4BK5C 4WY7H 5I1DA 2O72A 3IKCA 2XKNA 5LGJB 2QLYA 1AGDA 1E2VA 4GQ9H 3N9GL 4WAFA 1JRHI 1DEEB 1CXFA 2VCOA 3JZYA 5AVSB 2VC2H 4P23D 5BRQA 1FL6B 3SYPA 2Z35A 2Q8AL 3BSZH 3OPZH 1RHFA 1WA1X 3QZOA 1S7VA 4YHZL 2PWGA 4KJYB 4K73A 4M03A 4JKKA 5AAWC 4D0DA 4K3GA 2J12B 4DP8X 1ZA6A 3QUXA 3J7HA 1O6TA 4K8RD 2X4UB 4M8QB 4P59H 3O9WB 5EDXA 4IGBA 3E6FB 1AGFB 5HI4D 3CXFA 3CZGA 3IJEA 3ZQ9A 5DS8B 4BK4A 4OBRA 3KPSA 4NO0A 2VMJA 4G11A 2XCMC 2XIBA 5CEXB 1L0QA 1N5AA 2YAPA 5FR3A 5KSAD 3T0VA 3DTDA 5E1QA 3T3PE 3LKSB 1HHHA 3BE1H 3QZBA 5HYJD 1VGKA 3N0AA 4N2HA 5H35B 3CMGA 1ACYL 1EEZA 1GGUA 1HCZA 2R15A 5DJCA 4JQVA 1U8QB 4W1TA 3C8KA 2NY3C 2R83A 4GIPD 4X6FB 2ZCZA 4LVHB 2JKLA 2ZF8A 1DO5A 3FONB 3QUMH 2IPTL 5I28A 2AEQL 5D72H 2G9KA 2FNBA 1I7RA 2DYPB 2YKLH 4IU3A 3RBSA 1W0WB 5D4QA 4IOIA 2X1OA 3BPLC 3E80A 3O3BA 1RCYA 5HGDA 5F6HI 1K4CB 2IDQA 1A3LL 5EC1B 2YD2A 2ITDA 4Q74A 3EH5B 3FBKA 4H0LC 1P84K 3TT3L 2WP3T 2VDQL 3F7VB 4POZD 2VGLM 1TNNA 4U49A 2X89D 4BCZA 4DQOH 1WZ1H 3RDTB 3WLWD 2CUAA 4KKPA 5E94B 5I1JL 4UT9A 1EEYA 5LO7A 3LNFA 2K9UA 2YPKB 3MLSL 2H6UA 2IDTA 4LLMB 2PYEA 3K8KA 5HJDA 2YPVA 4ZMAT 1X5IA 3ARDC 4ZMZA 5DQJB 2HT3D 4G5ZH 3KWVA 2N1KA 1YZZA 4JCMA 4XO3A 2FX9L 4R0LC 1AOHA 3QNZA 3HMXL 1H3VA 4J6RH 3KL3A 4Z7VA 1ZK5A 3V5DA 1FN4B 1GC1C 2A6DA 4ZYKB 5JOPD 4HJ0D 4Q0XH 2WLMA 4Y8AA 1S7UA 1DVZA 1E42A 3OLIA 5HHVH 3ZX1A 5CM1A 3CPLA 3ETTA 4JY5H 1YC7A 1NC4D 3PFQA 4YS4A 1XF4B 1KXQA 3AMKA 4TTGA 1YY9D 2E7CA 4RGOH 2MTPA 4S1SH 2WVVB 4F9PC 3RTQB 4GS7B 4LESA 4PVMA 5GGRB 1G87A 5I1CH 5C07B 5FDWA 5H37G 1KB5A 2D7MA 3BXNB 2G3ZA 1GR7A 1B4TA 1UOKA 2FATL 1W0YT 2Z0BA 4XB3A 3K72A 4E9VA 1R5VB 2ZX6A 1OQOA 4KJQD 4A2EA 4IKIA 4APQD 3MRDA 4KNTA 2W92A 4UIMB 4TPRL 3CDZA 4GO9A 4HJ1A 4WEUD 3EJSA 4N8VA 2F58L 4XC1L 2O6DA 3EYQC 1XSIA 3ULSA 2OLDA 2JK5A 3BKYL 3QDJB 1M71B 1MCWM 3OJ2C 4MSWB 4OI9A 3MRCA 1FQ9C 3HZVA 3II3A 2P1YA 3V7AG 2JB5H 5AG8A 2IDUA 3SD5A 4LCIH 4F7TA 3RUGA 4UNUA 4Y2DD 2NRDA 2A2QT 2IWKA 3QEHB 2O5YH 3TV8A 2VLME 1TQSA 2Y22A 2HVJB 3KDMA 4W9CC 4KK8D 5JTWA 4X99B 4KAQH 4QRUA 1Y07A 1F3DJ 1DVYA 4LLYA 3CDGB 2R2EB 3JT2A 5EOTB 3ESMA 2DWEB 3IDNB 3ZIYA 1J8KA 5DVOA 3U4BL 2NY1C 1AXTH 1SXBA 3GMPA 1DBJL 4XXWC 1MCIA 1SJEB 1J5OH 1A6UH 1QSZA 3PL6A 4LASL 4NZRH 3BCFA 2HAZA 5CHNA 3MUY1 1CICA 5BV7C 2ADJA 3HZ3A 4G6AC 4ZSOE 1IIIA 2ZWNA 3VD0A 3QJSB 3EYUH 5FYJH 5BOJA 4UQ3A 2ROXA 5IT2H 2NY3B 1OB0A 1BD2A 1EK3A 2JFCA 1PZUB 4GXUN 5JQ6L 4Z7VF 3UEZA 3KPRD 3NJVA 5I0XA 2EIBA 5E8PB 1BQKA 1T7XA 3BVNA 4G8GD 4M7LL 4DT2A 1CL7H 3LRSB 4NWTL 4F8QA 3MTRA 1EDYA 3C5ZD 1FWXA 1Q9OA 4JFSA 4YL4A 3WFDL 4A7GF 1YEKH 1LO0H 3RB7A 1ODUA 1GJUA 1ONQB 2ZUVA 4U7SA 4WHYG 1A4KA 4MYPA 1KYUA 3LNHA 3LRLA 4PCKA 5G5DB 2OMTA 4PJ5B 2IDCA 4JHZA 2Z1KA 5E2TH 5DJ0B 3U0PB 3M8OH 1R6VA 3L4UA 3QGVA 2IPKA 1WBZB 3B7SA 1X44A 5G55A 3K6FA 2Y1ZA 4LEXL 4BQ8A 1XR8A 1TLMA 3ELQA 3BFQG 5FA3B 2CHWA 5IQNA 2BP8B 4A6YH 3W38A 1T03H 2C3VB 3MR9B 1HX0A 3MUZ1 1EVTC 4OGYH 2DI8A 4HK0A 4PP2B 3IFLL 2LV4A 3FS9A 2K4AA 5SV3A 4XP4L 3ARDB 1DDTA 2Z31D 1C5CL 5DQDL 4Y4HB 3NCXA 3GXTA 4PJHE 4R0LB 1ZTXH 5DZ9A 3VXRE 1N0XH 5KVEH 4ZW7A 3QFJA 2E27H 2NXZC 3AY4A 3PNWA 3QRGL 2QMKA 1M05A 3DMMD 4UV7L 3Q2VA 3VGFA 3VGEA 3ME0B 3QIBC 4AQEB 1A4AA 3BUTA 3GWJA 2HRHA 1R46A 2Y24A 3JVFC 1X9LA 4WU7B 5BPPA 2A83A 2UXGA 3QNYB 1TETH 4HXAH 3RUGF 3KPNA 2XQBH 4JKLA 4FI7A 4NC2B 1D5MA 2I27N 2BRRH 3FUKA 5DRNB 3V0VB 1WD9A 2C1OA 5FKAB 5HP5A 3VJ6B 1KIPA 4HHGA 4JG0L 3FN0L 5DWUL 3QQDB 1LK3H 3DETD 3IXAA 1AYRA 2Q2LA 5GGSB 3ZKXC 4MCYA 3ZRCC 5IEHB 1ZS8B 3MKKA 4HV8B 4LSVH 4OCSL 3NZ8B 3REVA 1N70A 4NCC2 1IM3A 1SBBA 5FCUH 2L0DA 4XN9A 4PLKD 3D3VA 4JFOB 3Q3GB 4KO6A 4CKVX 3SKMA 3HUJE 2WAQA 1HWGB 3SZ6A 4L9LC 1MI5E 2OA9A 3K7UA 2C7UB 1BW8A 3P0GB 3SQRA 5D4IA 25C8L 2WLNA 3LHAA 2AJXL 4LSSH 3U7AA 3CIAA 3L48A 1AS8A 2OTUA 2Q7AA 2V6HA 3LVTA 2R0ZH 4LPXA 3OXSB 4LFHD 2H32A 1WA0X 1EZLA 2VZ3A 3M17A 2ODHA 3U7YL 2VMFA 4RLDA 3W0WB 4KKZA 4J3SA 4LCWD 1CE6B 3EJJX 4UV4L 1SPDA 1ZVNA 4JRYE 4OD1L 2VR9A 4TN9A 5TE6L 2LU5A 1WAAA 3C5JB 3N44F 5C0CA 3TN0D 4B9PA 4YDKH 4PG2A 4OF0A 3S97C 1LQBC 4U0RB 1SEBA 2LVCA 3K4AA 2XFGB 4K9EL 5AAMC 4C58B 2G0LA 1MJUH 2NY1B 3TA3D 2QQLL 3BMWA 5ESQB 4GKNA 3H3PL 4XNQA 3AM8C 3RVUC 3VMOA 3O6KH 4PRIE 2B39A 4XN1A 1IBHA 1T21A 3CQQA 3HNVL 4YHZH 2W60B 5E95B 4DVBA 5FYLL 5BVPH 2EXYC 1YJDH 1SMDA 5DD3H 3IE9A 4K3JL 5EB9A 2Q10A 1Z5HA 1E27A 4P4KC 5FYKD 4IOFD 1G5GA 5D7IB 5DEFB 3GS0A 4FC3E 1LEIA 4ELMA 5L2KB 3RAJL 2DLTA 3QULB 3P4OA 4X4XB 3VFVB 1B0WA 4HSAC 3LD8C 1BA9A 5FV2A 3VH8B 1OZTG 4X7FC 5T5FA 1XB6A 5CN1A 4M1CC 4NERA 2B77A 4ERSH 2XWBB 2BLFA 2QFRA 2VWEC 2WC7A 4GI9A 2DQ6A 4G6FB 2BSDA 3BT0A 2BVUA 5HI3D 3JXAA 1CD1B 1NDTA 3EBGA 4JAMB 5LWYL 2X10A 4PYHA 2UWEB 2AEQH 1FAKT 3SJVE 1SFHA 4YSRA 1L0YA 3F6LA 3TH3T 3UBHA 2NMSA 4K8RL 5GGRY 2JJTA 4M00A 2F0CA 3U48A 1AQKL 4L8DA 2XLLA 4BZ2A 4HX1B 1JRHL 3IRCA 5EU5A 4KRNA 2ZJSH 4GFTB 2FBJH 2O30A 1HXMA 3NMEA 1D7BA 4TM9A 3FQ4A 4EVNB 1INDH 1IT9L 4PLJC 5L88H 1Z9SB 4BUGA 1F4YH 1TZOA 1UFGA 2BMKA 4UQCA 2C1PA 4PJ8D 1FDLH 5ISZD 1NFIA 5EIIG 1E7VA 3RWCB 1A2YA 1S9VA 1D5ZB 1NGXB 4HIHA 4XPBL 1GS7A 1T0MB 1NBZB 3SDDA 1WITA 4O2FA 2XZZA 3JV4A 4JANB 4HU2A 4WI4A 2VDKL 3QIBB 1RZ7H 3D39A 1I1YB 1HCVA 1L9MA 4PJ9A 2EXSA 5HPMA 4JE4B 1TJGH 3MRPB 3GT6A 3QWRA 2ZCKH 1U8NA 3EO1A 1WAAF 5D93C 1KCRL 3UBXB 4AT6A 1U3HC 2BSRB 1KEML 4ZX4A 1HL4A 5AOZA 3QO1B 3TPKA 4WUUA 4IBTA 4Y16C 1JP5A 1TENA 1EERB 4JM2A 1Z9OA 4Z3GA 1AJ7H 4KTEL 1SM3L 4N2AA 3QK0A 3RTLA 4HAGA 4TVSa 1C16A 1CTMA 1IGJA 3WKYA 2QVMA 3VFTA 4PJEA 1VAHA 2IH3A 3UOAB 1QPPA 4PWFA 4Y1AB 3V6BR 1BZQK 1T7VA 2J7LA 1A65A 3C5SB 3CK0L 1GOGA 5D7JD 3X1BA 3K4ZA 5F7DA 1FNSH 5EZJA 4GG8A 3JWNH 3EH1A 4OZ4A 3KWTA 4EZJA 4RFNB 3WUWB 1BGXL 1MCDA 3SKNB 5AWNL 5E2WH 5IMKB 4XPGL 3FQXA 3F84A 4XVJH 3GBDA 3FFCA 1UACH 3SN6N 1OAQH 1UXWB 5EBWB 3HI5L 4GSRA 2Q76A 3MODL 1EMTL 3NQIA 3PGFL 1OK0A 1P1VA 1M6UA 3ZGHA 5MI0C 2ZPKH 4Y19D 3TBSA 2IGTA 2NOYA 4CC4A 1BBJA 5KBMA 1CIUA 1BFVH 3PY9A 1YPZB 3SE6A 4DKTA 4HKBB 2XXGA 1RLWA 3IEAA 3QZPA 1EHKB 2X2JA 1H9DA 1LO4H 3QJVB 3S36H 3L3DA 5FHBH 4AUUA 2XA8H 5JA8B 3SPHA 4ODUA 1IIKA 4NBZB 1RAMA 3HFMH 3MBXL 2XJKA 3QEGL 3UJTH 1QLEH 3NP4A 4R84A 1BVNT 3HS0A 1JNLH 3BH8B 4XO9A 3U4BH 4P4KB 1DBAL 1UC6A 2EZ0D 5ICYB 5C0IA 2Q2EB 2YA2A 1BPLB 3M7OA 1E0OB 4R5TA 5IFAL 2X44D 5CLTA 3W81A 3P4LA 5ENWB 4JKMA 5CR8A 5C86A 2B14A 2W91A 4NJ9L 3AXIA 2D73A 3MRGB 5E4EB 1PX3A 4LCCA 5IP4A 4FP8H 3T0AA 1NGQL 1FNGA 2PYFB 1OP9A 2QFPA 3M45A 3Q7JA 4K55A 4N2OA 4TV3A 5DEZA 3DUHA 2V9TA 2HKAA 1H5BC 3QUKB 1F4WL 1IAMA 1ZEAH 4JN1L 4D0CB 3BP5A 3SPIA 1S5IH 1KFGA 5LGKA 4OLZL 2NY2C 3S4SA 1L7TH 5H2BA 1AGEA 4JM2F 3T4AB 2CU9A 3TIDB 1CS6A 2XETA 2F54E 4NO3B 4XHQA 4KITB 3DX6A 5FM8A 3WAJA 1P4IH 4AYID 2J44A 1Q9KB 3OBAA 5GGSY 4FL4C 1Y6NR 4JBSA 4RQQA 5LNEA 4PJEF 4H5SA 4TSCL 5E5UB 4MDJA 3BP6B 1ZHBA 5GSVA 4GW4B 1MQKL 4YIQA 4JFWA 1MWOA 4R4FL 4JG1L 4MJ5B 2EIMB 3FQTA 3QFGA 3CHSA 3WG7B 5I17B 1CDIA 3RP1A 2L3BA 1AD9B 3ZJAA 3GD1C 4NPJA 2NX5B 1KLUB 4QRRA 3PXHA 1HEZB 2VAAA 1JXJA 2OW6A 3AS2A 4H0GA 5E0FA 3WLBB 3FQNA 4NQEE 5PAZA 5DT1H 2CJ3A 4D9LH 2J8UA 2FECI 4HUMB 4RNRA 1HH6B 2ZOLA 4OAWB 4P46C 4X7DC 5D93B 1OAKH 4FQXA 4RZCA 4PBDA 3GSUB 1U3HB 4NCDA 4U6YB 3HAEB 5GGTH 3I9GL 3SO3C 3CSYB 1YO4A 2ERJC 4HHAA 4Y16B 4ZMYA 2GI0A 4PRNB 4LL1A 3GSRB 2DYRB 5EULV 4OZHA 3RHWK 1QUNA 3GJEB 4H88L 4TNGA 3STZB 2Q3AA 3X3FH 4DK6A 4DP4X 4NP9A 4UI2A 1KYFA 4M4PA 1N0LA 3FRPA 2PR4H 1NANH 1J9QA 4HUUA 4LLQB 4ZXBD 4U1HB 1DUZA 1HL8A 1FYTE 4Z18A 5E51A 3KS0H 3NJIA 4PV1C 2VLRA 1IM9B 3SCMC 1NCDH 3BLKA 3N06B 4FQQB 3BAEL 4OV6F 1DSYA 4DZ8A 1ZOXA 3IDGB 2DQFB 4ZMQA 1W72L 2NZ9D 3GTTA 3QISA 3TWCH 1BIHA 3HUJF 4TUKL 1CU4H 1FG2B 2NQDA 3Q5YA 4Q4EA 4P2RE 4RX4D 4B96A 3PDDA 5JNYB 3G6AA 4XAKD 4NQDB 2BSBA 2CWRA 4L3EB 3LXCA 4NLAA 1ILSA 2VITB 3D25A 4OVVA 5D6CA 2Z4QA 4PWHA 3MA7A 5DO2C 5MI0B 3HPLA 3P30H 1I9IH 1DVQA 1I1AA 1RXLA 4LB8A 3RWFA 1Q9WA 3WS3A 3V0DA 2B8OT 3FO1A 1WICA 2KHAA 4E0RA 1PTZA 3I6KB 4LGRB 4M6OH 5EDSA 2DWXA 1PU0A 2Y2TA 4OCRL 4YZWA 3B6SB 2WQAA 2L7JA 2XWJA 3D4ZA 4JRXA 4EN2A 2NUTB 5JOFA 1GHFH 3P9MB 5JHDD 3FTUA 1EFXB 5TE6H 4X98A 1NLDH 3KBPA 3HCVB 3FPYA 4XVOA 5C0JA 1FIGL 4M8VA 4YLQT 4JM0A 3CC5A 3GIVA 3BWAB 1FFTB 1MAJA 3MLYH 5CLYA 3TCLB 3H3PH 3QNFA 3QIUA 3X12A 4EZKA 3IGKA 4PJ7A 1HEJC 1UT9A 2IEPA 3LZRA 4RSVA 5DUJA 5AW7B 3K6SB 1A7QL 1DN0B 1T5WA 2J8UF 4TRPH 4DTGH 3OR6A 1QATA 4JFXB 4J3OG 4P05A 1AI1L 4AJWA 1AG6A 2R23A 1AIZA 5I19L 1C1EL 2A9AA 2W0PA 1H5BB 5B39B 1QASA 1G1CA 1MKFA 5DJDB 4ABVA 2C3HA 1E4XH 2R7EB 5H37A 3VXOB 2V5TA 3GGWB 4OKDA 2ICCA 4MA3A 4OZIE 2JCWA 3BDBA 4M4RB 1LK2A 2NY5L 3LTVA 5FWQA 4OZHF 3GMQA 4JCWA 2ESVE 3WEXA 3QVAA 3X1FA 4P2QD 3ZOAA 4KQ4L 1PZCA 3WXVH 4BM7A 1OGPA 2B1AL 2KH2B 1PIGA 3IU4L 1FO0A 3SDYL 4DUWA 4XX1G 1EBPA 4JFPB 2EO1A 3A22A 4MQXC 4CW1A 1Z5YD 5DSCB 5CINH 5IW6B 1F2QA 4GAJL 4OJCA 4PRDB 4FNRA 3ARBD 4X5XA 5BW7C 3OZLA 2PO6D 1ZKAA 4G8FB 4M02A 3OAZK 2IQ9L 3OB0K 3PE9A 4GBXB 5G2NA 5C0AD 1MJJA 3AS3A 4JE0A 4YXKH 2YBRA 4DQAA 4LHUB 5TDNB 1MN4A 3MBED 1CQKA 1COBA 1F00I 2X0WA 4AEHL 4E41D 3OMIB 1OAZH 1MCWW 5E2UH 2Y5EA 1AMXA 2VABA 1FBIL 3NN8B 2XNAB 2PWHA 3KYKH 4GFXA 4P46B 4TL4A 1DSFH 2IWFA 3GMLA 4XPBH 5FYJD 2DQEL 3VAEA 2APXA 1A3QA 5DD1H 4XPTL 2EVHA 3BH9A 4JDZB 3NCEB 3B7UX 3EJYC 1KYAA 2ERJB 3SO3B 4GI8A 5KVGL 2XV2A 2BVPA 3BWUC 1ZE3H 3VXMA 1VFBB 2F53D 3U6XS 2YN3A 2VQ1A 4DAGH 1WTLA 2HRLA 1HHKA 1XIWD 1OSZA 4K7PX 2WXPA 3WCYA 1CO1A 15C8H 5DJAB 3QDGE 4GSUA 1UENA 4K3DL 4WV1C 3KW7A 4N5EC 2Z92B 1MWAA 3KJ6L 5I6NA 3UYPA 1BQLL 3O81A 2CLZA 3ZTJG 4XBMA 1UFUA 4FE9A 3M6DA 5CZKA 4JZJA 2ZX9A 3C6LC 4N6RA 1TFPA 2WXKA 3LKNA 2P8PA 1XDTT 4HJSA 4NN6C 4F8TA 1CLZH 3BVDB 4UZGA 4X9HA 3RWDB 1HT6A 2V9RA 1I1CA 2VLLA 3U30C 4FA6A 3P4NA 1AIFB 4OLVH 5F72S 1YVLA 3AT9A 2DMBA 4CA4A 8PAZA 4EDXA 5ANMA 2X9YA 4G9DA 4AZ8B 4PVNA 3BWZA 3S7GA 3RY6A 2YSSA 2VJXA 5JW5A 1RZKC 4YNYB 3K0YA 1FAIL 1HNFA 2X28A 4TNVF 2GPZA 3P0VH 2W65A 3U36A 3UAAA 5E9DB 1KN4L 1U30A 2GCYA 4OB5L 3PGFH 3N43F 1F3JA 3HG2A 1QSEB 2H2PD 1KNOB 1S2EA 3ARUA 5EU6A 3V4LA 1ZHNB 4ETYA 1ORSB 1G9NH 3QORB 4AENA 1RJLB 1RIVH 2J1XA 4RGNC 3KYMA 3EJCA 2W95A 3S5ZA 4LPCA 4Z1PA 4ZTOL 3NRQA 4GLRI 3AS0A 3W5MA 4EAEA 3E6HB 4Q6IA 5D7LD 4B7IA 2PR9A 5HDRA 4EOWL 1DVFA 4MD5B 2PPEA 1FFRA 1TEFA 2IG2H 1S7QB 4UAHA 5IWLC 2IFFL 2WLLB 1DJZA 1JWMB 3ARGA 2RQEA 3GBML 3DX7A 4TVUA 2QV2A 3T9WA 4M7ZB 1MEXL 3BN9C 5D8JH 4D0BB 3S88H 2I5YH 3VH8G 3GSQA 4FQHA 4TULH 3D2UA 3GLAA 2TAAA 3ZMEA 1O7VA 3A4AA 4IRZA 3GJFH 4MGXA 4Z7QE 2ZTBA 3HR5B 4A04A 1IKFL 1B0GA 3H0TB 3WKMH 1GYUA 3MYJA 4JN1H 4ZMLA 4UDUA 4Y7MA 3S96B 1G6RB 1VPOL 2HX8A 2OSLB 4TVPH 1HZKA 4NNXB 2XQYG 3GMNA 3TYGH 1YMMB 1NAMB 1JGEA 3AAZA 4F7EB 1XD0A 4QXUL 5TE4H 1FVCA 3IDMA 1AXSA 3T2QA 4TSCH 4GRWH 4EZLA 4MB3A 2G2RA 2B59A 3QRLA 4O2CB 3TT1L 1LO2L 5B21A 43C9A 1JGUL 4NJAH 2VMDA 3E8UH 4ZX5A 5B38B 4PW9A 1RJCA 1AS6A 2R1YB 2CGRL 2NUPA 4M8RA 4PJXE 3ROOA 1VACB 3U0TB 4HK3J 2GTZB 1QRNE 5EC2A 4I3SH 1QQDA 2AJVH 2DWDB 1D9KD 2PW1A 3NJFA 4X6DE 2EE0A 3OSKA 2WCPA 2P80A 3GHPA 4UUJB 4ZJ9A 3WY4A 4DGVH 8FABB 3DRTA 5AUMA 2Q7NA 1SVCP 4KDTC 3IDIA 3CFJA 3EBHA 1MUJB 3HE7C 4WV1B 3UBXG 2HN7B 1BVNP 4N22A 4DGIH 3KR3L 1B2WL 3GI8H 1HCYA 2J2ZA 2VL4A 5J4MA 2C3WA 1NLBL 3C6LB 3DBXB 3WE6B 4Z7UB 1SOXA 4LOFA 2ZWKA 4HUNB 4NN6B 4C56A 4J8RB 1KCWA 4W93A 3OHXB 3FCSB 2PXYD 5I15H 1IFGA 1LNUA 4XR8C 3TO4A 3ZE2B 5C3IA 4ORGB 1MDTA 5IM7A 1PKQA 3ZKQD 3WHE1 4DZBB 5AVUB 3DNKA 1ADQL 4I4WA 3RIFK 1LGVA 3T04D 4UILH 3U0WH 3UPRB 1TU2A 1J5CA 3H4FA 4R7NB 4P23C 4OIIL 4NO5B 2YLHA 1T5XA 4JDEA 4OFVA 1TO5A 3CHPA 3KNBA 4HOZA 4W68A 4KKLD 4OLXH 4X4MA 3WUWG 2F74A 1MOEA 3D08A 4AV4A 2LT9A 3H9HB 2BVOB 2XVBA 4J2XA 4QHNA 1IFRA 1DANU 2CPCA 3SQOL 1ID5I 3L6FA 3O4LA 3L3IB 1ANUA 3H7BA 1N64L 2FECL 3KCWA 1ZLSH 4Y5YB 5CBAB 3LS5L 5ITFB 1UD2A 3VX1A 1JPGB 1MLBB 5KSAC 1JNJA 5EIIA 4TQIA 1GMEA 2CR3A 3KYOB 2CNZA 5F0LB 4HGWA 4RGNB 4X80L 3ZE1B 5KYWB 2AERT 3QDGA 1HOEA 3L13A 4TLKA 12E8L 5DD0L 4WW2B 3LH2L 1BOGA 5G4NA 5L4MA 4LKXB 3IFNL 1YNKL 3FUJA 3HVNA 1I82A 4BFBD 3HTLX 4HLEA 3S8FB 1P4UA 4AM0Q 4UDTB 2YHGA 2BNQD 4XXCA 1H15B 5EEWA 1CDHA 5CU5A 4PLNC 5BO0D 1F3RB 2RCSL 3PP3K 4W9HC 3L1FA 1W15A 2NLJA 3QIWC 2YJQA 5AB1A 2I60L 1PG7L 5LCVL 2V7HA 1YRKA 1NCOA 4HT1L 4Y5VA 2VDNB 1R0AL 3BESR 4JJ5B 3ALPA 4MD0A 4XMPH 4YPGA 4UOW1 5BZWB 35C8L 2B3IA 1TYJA 3B7YA 1QLRB 1LQSR 3D85B 4QRBA 4HA1A 1ICTA 3VWKD 4IGBD 3EOBB 4MD4A 5JLZA 5GRVK 3RJQB 3SBWC 4WWNA 4FNLH 4PCTA 4NO0D 4R3SB 4WSJA 1S9WB 4N3TA 3WMSA 1HE7A 1A02N 4MX7B 3V4UH 3VX0A 4B6ZA 3CFTA 5CMAB 4YSSA 1NICA 2MKWA 2Z7WA 4HFWA 5CCHE 4B9GA 4LL4A 5CIPH 1WIOA 5TK4A 3EYFA 2AXWA 5GRYA 1GGCL 5A6IA 2CO7B 3FXIC 2D7OA 3NIGF 4IBLT 2CR6A 2WK2A 3CZKA 2NYYD 3UPCA 4G80A 3QUYB 3QYCA 3Q2LA 5T1KA 5TK2A 2IQ9H 3EJUA 4MVBC 5LGJA 3TA4D 1YY9C 1XF1A 3EHBD 5EZIH 3R7QA 1DEEA 3FTGB 1MRCL 3WSQH 3ROLB 4X83A 3NYKA 1JFHA 4NO2A 3IF1B 1TNMA 1MPAH 3WNJA 4KJYA 4QRSB 3U6XA 4BA0A 4Z3JA 2DQEH 4XPTH 1BEXA 4PRPD 2X4UA 2DIEA 4M8QA 3O9WA 4D3CH 4DWHA 5DMIL 1JVOA 5TE7L 3E6FA 3HAEG 4PD4J 5DS8A 3NZHH 4JVPA 2RGSA 3X11B 3SIKA 3ULUF 4FYQA 2P46B 2JKTM 3FUHA 4H13C 3T0EC 3CN4A 5CEXA 1DQMH 1F6FB 4O4YL 2E6JA 4AMKH 1KEGH 2QSVA 4WFHD 3LKSA 2AQ1A 5LN4A 1MJ7L 1N19A 4I1NB 4PHZA 5H35A 1KELH 1IAIM 3PWJB 4BKSC 4KU1A 2R2HB 1U8QA 4M5SA 1FVEB 1V05A 3TLRA 4X6FA 2ZKWA 4OF6A 3CZSA 3FONA 4P23B 5D7SH 2N0KA 1W2KT 3UAEA 2DYPA 4YO0B 2E7LC 2SODB 1W0WA 4K3EH 2P5EE 3VXSE 3U6RB 1GVIA 6PCYA 1Z3GL 3U2IA 3KDPB 2Z9TA 3B2VL 2DEYX 5EC1A 1CF1A 1AD0B 1KCVH 5LG1A 3HC3L 1JFQH 3F7VA 3FUNA 4Z76B 4H8VA 1WA2X 5KSAB 3QDMD 2EDXA 3RDTA 4L4TD 1ZWIB 5E94A 3EGSB 5HYJB 5A3IC 2A4CA 3TEXA 1A7RH 1R3IL 4LLMA 5TGBB 1AZVA 4I9WD 4KZCA 4NT6B 3LH8A 3OLDA 1Q0XL 5EFIB 4OI8A 1MCLA 1HL5A 3P73B 1KGCD 5DQJA 1JZHA 3QPXL 3BD4A 2RH0A 3T6WA 1B3IA 3EOYG 1U8HA 4PRHD 1WJ3A 4YHIB 1HS6A 2Y6TE 5ILTH 2HFEB 1USZA 3I84A 2NNAB 3QIWB 3N1GC 4CDHA 1FN4A 3O6FC 1FZKB 3FTSA 4PW4A 1YMHB 3RNQB 1SOKA 1JOIA 4NQCA 5EUOE 3EFDL 1TSHA 1XSOA 2XN9D 4U1MB 1XF4A 3SDCD 4PD4K 2H2SC 5F89B 1T80A 3RY4A 2WVVA 2J21A 2B16A 4UBDD 3RTQA 5GGRA 5B39G 5J56B 7PCYA 3PNRB 5C07A 3RURA 5C6WH 2OYLA 3CVBA 1QPKA 4ZI8A 5TFSL 1EXGA 3BXNA 4FXKB 3MXVL 1I3UA 4MNGB 5BS0D 32C2B 5FUOL 2GC4C 4S1DD 1WGVA 2BO0A 2N1TE 1R5VA 3PYCA 1CK0H 1JWSB 2VXUL 3T09A 5LNGA 2E56A 3FT4B 2ARJB 3DYOA 3C5XA 2AABL 4S1RL 4F37K 1KENL 1VPOH 2M8XA 4JPWL 4UIMA 1I3GH 1JZ2A 3I9AA 3OF6D 5HVGB 3DMMC 2X5PA 1G4MA 1KJ2B 2FX7L 2ZOOA 2PETA 5B1JC 1NC4B 4NENB 2O6CA 3QDJA 4IBQA 4NPYB 5J13C 1AHKA 1M71A 2FHFA 1K3ZA 4MSWA 2XN2A 3OZ9H 1FSKB 2X6VA 1TYEB 2FUTA 1EHXA 2BS9A 5KW9L 1SHWA 1L6PA 4LHUG 1KIUB 3TT1H 1BJMA 1JGUH 5JIMA 4F8LA 1CLYH 2HH0L 3A3YB 4N90D 5BMFH 5L4JA 4OD3L 3DETC 3QEHA 4AE0A 3CGTA 5DMGD 2HVJA 2ICEC 4LVNC 2HLEB 4X99A 5AAWA 1ACZA 4F2ME 4EN3C 5DURD 3CDGA 2CUHA 2R2EA 5EOTA 2DWEA 2HJLA 3IDNA 4JL2A 1CD8A 3WIFB 4APQB 4RISH 5D1XD 4WCYL 2DTMH 3QJUB 4M61B 1BZ7B 1DVTA 4DW2H 1UYWH 3T0EB 5DZVA 1KIRB 3HNSL 1DQJB 1TMCB 4HOXA 1FF5A 1PYWB 1U8MB 1JPEA 4L1TA 3IMTA 4Q9RH 1XQ4A 1PLAA 3RB5A 1F4AA 2BNRE 3NBNA 2QSCH 2LABA 1JXFA 1KG0B 5MEND 3I3EA 5F9WC 2GIYA 5E8PA 4KKAC 4W9JC 1QSVA 4BHUA 1C5DB 2XWDA 1THCA 4Y2DB 3TBYA 3UGXA 3B43A 3IWVA 4GAGH 3T6ZA 4BYHA 3LRSA 3V6OA 1GPOH 2C8NA 2ZKHH 3SB3A 1AGBB 1ONQA 2IANE 3WGUB 1ADQH 1AR1C 4M56A 4BZ1A 4PVLA 3NJGA 4OCMC 5G5DA 4PJ5A 5DI8B 3VQ2C 5EWIH 2FEEI 5DJ0A 4ENED 3U0PA 4CVZB 1G1OA 5JHLA 1CGSH 2BINA 4ZS6D 4DKEL 1E6JH 2QVFB 5FA3A 1VSCA 1NMBL 2BP8A 3MR9A 4JQIL 1ZSDA 5TQ2L 2O5ZL 1M7IB 3HNTH 2P3YA 4PP2A 4HKZB 2K3TA 3BT2H 3MI6A 1JZ8A 3ARDA 3V0WH 3KPRB 4Y4HA 4XBPB 4YDVB 3S3CB 2ADFL 3RE0A 2BS71 4G8GB 4R0LA 2X12A 5D1ZC 3LEYL 4OJDH 1ET5A 2YXWA 1J8RA 4MJIE 3S37X 1F18A 2EVIA 3GXIA 4PRBB 3QEQD 2PP8A 5EOCL 2I07B 3MLZL 3ME0A 4AQEA 5GZNA 1JL8A 4IKJA 3V0GA 3LKRB 5AZ2L 3B9KA 4WU7A 4ZO6A 3QYNA 3QNYA 4B5EA 4HJTA 2AGJL 2VDMB 2BWQA 4HEPG 3OQ3B 4U1NB 3V0VA 5DRNA 3VXSA 5FKAA 1FGNL 2I60H 1PG7H 3IDYC 3QQDA 4F7MB 2FJFB 4IRSC 1UCBL 1JUFB 5LBVA 3VACA 3WXWL 5AB9A 5GGSA 1XZWA 1ZS8A 4HV8A 2Z31B 3NZ8A 4IQHA 3ELAT 2NY6D 4UWQB 4PJ8C 3WS6C 1JGDB 1J1XH 3SOTA 1BQHB 4J3OF 1WV7T 1ZLUK 4JFOA 3Q3GA 1PY9A 2C9VA 3HI6L 1UM5H 2B0SH 3DMMB 3CZEA 4P9HH 3ML9A 2I26N 5A2AA 3I6LE 2C7UA 1J9TA 2FD6H 4ISVA 4NRXB 3Q2WA 5E6ID 3VI3E 3PS6A 1RQ5A 1CTOA 2RR3A 1CBVH 4JFYB 5J13B 4DHLA 3UTPE 2XRAL 3EG9B 5FW6A 4CADB 4YVUA 1ZDSA 2GSMB 4OCWH 1TITA 2DZEA 2FLBT 3NFSH 3W0WA 4H8UA 3EH3B 5I18L 5IV2A 1UQSB 5FKPB 1BIIB 2J4WH 4NZ8A 1CE6A 4KVNL 4PJFB 5A43C 5BQ7A 2F61A 4ALAC 1MF2H 2V37A 3HHSB 3C5JA 3IJYB 4R4ND 5C70A 5B38G 4LVNB 2IGFL 4JGMA 3VI4E 4LT7A 3CNKA 4H1LH 1VERA 4KZEL 5BZDB 3O6MH 4FFTA 2O1AA 5ESQA 1FFOB 1CURA 3SOBH 4GEIA 4XHJD 3EIFA 2W60A 5DU7A 5E1AB 1MCOL 3L1GA 2J88L 3L5XL 5CKGA 3U1PA 4R97C 5D7KD 4RAHA 3CH1B 1HK6A 5D7IA 5DEFA 3BPNC 5L2KA 1QFWM 2IAMC 3QULA 4X4XA 2WYHA 5F9WB 4PCSA 3H6JA 4TVPD 1OARH 5I9QC 3VH8A 2QADD 2AK1H 3KL0A 5INCB 2XWBA 4MJ6A 1MCHA 3FK3A 4TF4A 1LWJA 1AR1B 3O6LL 1CD1A 4JAMA 3TA3B 2BY1A 2VN5A 2BX5A 2UWEA 4W9ZA 4XC3H 3DHUA 1JDDA 2GI7A 3GIZL 1NCIA 2BFVL 3OKYA 3GTNA 3TOPA 1WCBA 4NNPL 1Q0EA 2XQYA 5L2JB 3V55A 3DVNB 5CZXD 4WFEE 4JR9L 3AWEA 4O5LL 1ZCRA 5C3TA 3D51A 4YHYB 1WTGT 2B4CH 4AIXA 1F86A 3HZKB 2Q86B 3JTTA 2VZTA 2EZ0C 2FGWL 3L2MA 5IEKB 4EVNA 4XP6H 1YEGL 4AIOA 5KBNC 1Z9SA 2QKSA 3TWYA 5DLLA 1SY6A 2Y7LA 4M6AA 4A7VA 2G60L 3RWCA 2HFGH 2MQ0A 5BZXA 2WXOA 5KVFL 1D5ZA 1NGXA 1EAOA 4WDIB 4OJFH 1OL0A 1ETB1 4RVBA 5DMYA 1VFAB 1T0MA 1NBZA 2AJYL 3IRPX 3LQZB 5F1OB 4JANA 1MZZA 3AXLB 3QIBA 3BVXA 1I1YA 1CLOL 3JWDC 4WF7A 4B9FA 1CCZA 4HF5L 2FWUA 4LOVA 2UZIL 3G6JE 2VM3A 1JMXA 3Q6FB 3MRPA 4F5CE 1DLFH 3BSHA 5EUOF 1XF3B 4G6KL 3UBXA 1A9BB 2BSRA 4RA0C 1QI4A 1XAUA 2LTQC 4FTDA 3QO1A 4HMDA 2ENQA 4IRSB 2CKNA 3FBQA 4D9RD 3BGMB 3ZZSA 2NNRA 3OQRA 3V4PB 5C7ZA 5CSGA 4ZFFB 4E42B 1KB5L 2W59A 1FC1A 4W9FC 2X38A 1KC5L 4NQCE 5FO7B 4PJ8B 4FLRA 4JO3L 3CFMA 4UT6A 4QXVA 5CU9A 4ZFOB 4DN3H 5ISZB 1CPUA 3CDYA 5DJ2B 2OR8A 2R0KH 4P99A 4PCYA 4PG9B 4Y1AA 5D7IF 5JW4R 3C5SA 2D03L 2JKRM 1M6OB 4ODSH 1FV1A 4I0PC 1DBBH 1GGIL 1R9FA 1UH4A 2FX8H 4HSQA 4Q6KA 5CGBA 4HCRA 3SKNA 1L9QA 4A7QA 1M7DB 1I7TB 3GXNA 4WVRA 3QQ4B 2KQMA 3QW9A 4GQQA 7FABH 1UXWA 3Q48A 2W9EH 5HVFB 4YX2H 3S37L 3EADA 1RFDL 3VXUE 2FX7H 2UWEF 5CEYB 5I1EL 2ZCHL 2X1XR 1TYRA 4HH8A 4ZMPA 4F2EA 5ABDE 1YPZA 1XB3A 6FABL 2WCSA 2YPLE 4HKBA 2FL5B 3PJSA 4IDJL 3RZCD 4ZXBC 5AAMA 7TAAA 1S78C 2V5YA 4XVTL 5IHZB 3AM8A 3UG3A 1A14H 1IV8A 2HKHL 5D7JB 4F1ZA 1OTUD 1AKJD 2D3JA 4R90L 5IOPB 2R69A 1HNYA 2DKUA 3B2DC 3BH8A 1RK1B 3DSFL 3NSFA 4P4KA 2Q7YB 3UH8A 5JPMC 1P4LB 5LHDA 5ICYA 4X9YA 3BKMH 3V4VB 5AVZB 4AE1A 3OTTA 2IAMB 4ENZA 2D31B 5ENWA 4B41A 1ZJBA 4M6NL 1MFUA 2O5NA 1I1RA 3MLVL 4NBXB 4NAQA 3MRGA 4O02H 4Z78B 4Y19B 1IAKB 2PYFA 3JYCA 3UERA 3OR7B 2Y7QB 4OQTL 1MRFL 1WRFA 5F96H 1ZLVH 3OKKB 3CMOH 3IJ7A 4P9ML 4PJCB 3QUKA 3VD7A 3WFEH 4GUPA 3CSPA 1BF2A 2WCGA 5DMJB 3DJ9A 3MACL 4D0CA 1R1CA 2MNJB 3GMMB 4ODXB 2HTLC 4K3HA 1TZGL 2FB4L 1GYVA 3T4AA 5ADPH 3NABH 4JDTL 4U1GC 2BERA 3TIDA 5TF1L 3RHWF 4NO3A 3ZDXE 1QA9B 3MNZB 3PPEA 1ADWA 4CNIB 1Q9KA 1WEJH 5EORL 1ZT4B 5DRXB 4UOQA 3MREA 1CGYA 4QLRA 2BJML 3BP6A 2IOIA 2R9HC 3ARED 4MLIA 1QZ1A 3V0EA 4MJ5A 4NFCA 5E6RB 4K5PA 2VH5L 3EF4A 4AL8L 2B9AA 5GGVL 4PTTB 2Y6SD 5I17A 2EDNA 2HZHA 3TPUB 1AD9A 3RWJB 2E46A 1KLUA 2NX5A 3O3DB 1NMAL 1HEZA 3DJSA 3MA9L 4MCZB 4FYSA 3WLBA 1OB1B 1ZT7B 1DP0A 1HH6A 4OAWA 1MHEB 1RU9L 3L4WA 3GSUA 1U3HA 1YPZF 1A7PL 3FFOA 2ARWA 4U6YA 2LTQB 4XMKL 3S5LB 2DI9A 3HAEA 2DLHA 3LB6D 3CSYA 4K94H 5IQ7L 2ZNWA 3L9EA 2Y1VA 4NQUA 1EO8H 2VC2B 2MSPA 4PRNA 3SYOA 1RH8A 4L4VE 3STZA 1DQLH 1NEPA 5CJQH 4X8CA 4LLQA 3CBRA 3WJJC 4C57C 2VLKD 1OGTB 5JR1L 1B4RA 2PO6C 1IM9A 5BRZD 4QHKI 4NM4H 4I1PA 4XNYL 1UCBH 2AK4E 3I9PA 2FEEL 3LRKA 4FQQA 3T08A 3ZL4L 2DQFA 3P11L 2GEQA 2G4GA 3EO9H 4KO5A 4MXQC 2IBZY 1JPSL 3UTQB 1FG2A 2YOAA 1TTRA 3TH4T 1IEBB 4MS8D 4QJ5B 2WUCL 5JNYA 2XU9A 2ZKMX 4BCXA 3KPLB 4EBQL 3QXVA 4NQDA 4W9DC 3B3BA 1MCPH 4RRPM 4ZUUB 2OMZB 2VITA 3MCLH 4AMWA 4CU6A 1TQBB 4MNHB 3QUMB 5KANG 4AJ0A 5J3HD 5CZVH 1B3JA 2NSXA 2J5LC 1HZHL 4APXB 3ECWA 3I6KA 1XIWC 3RU8H 4GAFB 3G6DH 4ZXBB 5FLUA 3MCYA 3B6SA 3V52L 4M5YH 1A6VL 2NUTA 4KOBA 1EFXA 2GK2A 4H0IA 5JUEL 2VMCA 3LPGA 5FGSA 3HCVA 4H26B 4HYTB 5EH1A 2VZVA 3QARA 1A7BA 4EZMA 5FW8A 1MW3A 1Q94B 3K2KA 2ZYSA 3BWAA 5DK2B 5CFAA 3EXJA 1GSKA 3NOIA 3POCA 3TCLA 3FT3B 1KV7A 3CWGA 4NS0A 4FKEA 2X1WL 4DO6A 5FM5O 2ZUSA 3Q6GL 1PBYA 2JV6A 3K6SA 3Q05A 1DN0A 4F58L 5JIHA 2YQ3A 3OLGA 1VZHA 4JFXA 5T5FL 4L5FH 5I1GL 1QTPA 2VDLH 5HHXL 1H5BA 5DJDA 1FORL 2MTAA 2YUXA 3L2NA 4ATTA 1N5YL 2R7EA 2X05A 3VXOA 4WFFD 2H6OA 1YN6B 1N4XL 5DFTA 4CSTA 4M4RA 1H0DB 4ZX6A 5JHDB 3EJZD 4U1GB 3VRLE 5CJBA 5DQ9B 4WQOA 1XD1A 2FZ3B 4HXBH 4MNQB 1WFJA 3L3JB 4QRPE 1EWHA 1NUNB 3L45A 3HG1E 4BZ2L 4JFPA 1A6ZB 3NCMA 5C09D 3VD9A 5C0DB 5DSCA 1KJMB 5IW6A 3ESVF 1PLCA 3LQAC 3FOLB 1OPOA 2NSMA 1HESA 2XXFA 2VN4A 1S5HB 3OAWA 4PRDA 4UTAA 4HD9A 2R2CA 2D3VA 4G8FA 3BUBA 1JNNL 1BZ9B 4GBXA 4UT9H 2FJUB 4BQCA 1SJHB 4I1RA 4LHUA 1JXDA 2O6EA 2I9TA 5TDNA 3DX0A 3L3OB 4P8QA 5GISH 1HN1A 2YPVH 3QJHB 2QVTA 3G5VA 2ZOKA 1D2OA 3NN8A 2XNAA 4P46A 3UCQA 1A9VA 4YSDA 2OMXB 4R83A 3WFZA 4JDZA 3IMBA 4JN2B 4GOSA 1H8LA 4ZODA 3SGEH 2ZCLH 4P2QB 4ZUWB 3HS9A 2DMCA 5I1KH 1A22B 2V2TB 4OM0L 3QR2A 3UAJA 1AZUA 1VFBA 4K0OA 4NHUA 4TNEA 2HVKB 1YEJH 2F1EA 1WAEA 4RMVA 3VCLB 4PP1D 4Z8FL 1S3RA 1BZDA 4ELKA 5DJAA 2WLZA 2HJKB 3DI2B 4HWEH 5JA9A 2FNWA 3UTTD 3VDBA 2MPAH 1CXHA 3ARBB 4WZ9A 4QEGA 2PO6B 2Z92A 1HILB 5C0AB 1UWFA 4ZOCA 4QAMB 2ATKB 3T8XB 3MBEB 3ZY7A 3GS7A 1GAFL 2A3TA 3KYNB 4E41B 3DROB 2WXGA 3RWDA 3OSVA 1ZT1B 5L7XH 4WTZG 4KV5E 1YJDC 1V54B 2VLJD 2VDPL 1JK9B 4FULA 1P5UB 4B9KC 5CD3A 1AIFA 3IB4A 4P5MB 3N50A 4MMYB 1BQHG 1Q8MA 4F57L 3GBLA 4NXSA 4P2CG 4AZ8A 5A40E 2GQHA 2A9NL 2EDOA 4PJDB 2YD7A 3WOVA 5GHWL 5D9SB 4YNYA 2F53B 4QR7A 2MNWA 2CDGB 2J5LB 4UU9B 4ORZC 1FNLA 1HDMB 3OKOB 4IKNA 3T2OA 1XIWB 4BXVA 4N26A 4Y4FC 2JKWA 5B7MA 5E9DA 5BV7H 3L4CA 4XNZC 2WHVA 5KBPA 1W8EA 2KS0A 1VEPA 3LS4H 3WE1A 1QSEA 2VMEA 1U21A 1G7HB 1WIPA 2ZCHH 4LU5H 2J6WA 5HDQH 4X4YB 5CEZL 1ZHNA 3N41F 2YEVB 5F71A 1H3WM 1ORSA 4L4VA 1QD0A 5DK3A 5IB3B 1ODAA 2UX7A 3C08H 3QORA 1RJLA 1P7QD 4N8UA 5IW1B 3ZO9A 4A6YB 3KWXA 3BFOA 5JW3L 4ZFQA 1TVDA 3E6HA 3AGVA 3FFDB 4OF3A 3UO1L 4AC2A 4A7TA 4MD5A 3Q8AA 4DGUA 1FPTL 4HEPA 1S7QA 1GYWA 5EEZA 3MO1B 4A68A 2WLLA 4LPTA 5KSUB 1V10A 3P3SA 1MIEH 1EHNA 5HHOE 1NCCH 1QBLH 4N8CH 3DUSB 5C0FB 3MOBH 4P06A 3EUUA 1T04B 1RLBA 4D0BA 4KUCD 3UO8B 5KBKA 1DR9A 5IJCC 5I76B 1Z9LA 5FYLE 3IJSB 5A6MA 4KTDL 4MAYD 3TESA 4BH7B 4P9MH 3HR5A 3UMNA 3W57A 2O5XL 3ZR6A 4YSAA 2KKQA 1PZ5A 3H0TA 4MCNA 4EE2A 4XCCH 1X9RA 3O41B 5GRJH 2O6PA 4UMSA 3RKDC 4X7SL 1G6RA 3SE9H 4F2FA 3GDBA 2OSLA 1UZ6F 2GJPA 2YAHA 4R8WH 5D7LB 1Y6KR 1OSPH 2ZXDA 4JFFE 3HBZA 3MV01 4NNXA 1YMMA 2ENPA 3KPMA 1KN2H 1NAMA 1KZQA 2FQEA 4GQPH 2VDRH 4F7EA 1MW2A 1QZNA 4XMLH 2YK1L 3MV9D 2BJMH 4YGAB 4FNPA 5GJSH 1T4KB 4O2CA 1VF5C 3WFCH 5GJTL 3JWNC 5C9JB 4AL8H 2WGXA 5B38A 2R1YA 1SUJA 3MJ7B 3B1TA