4AQEA

Crystal structure of deafness associated mutant mouse cadherin-23 ec1- 2s70p and protocadherin-15 ec1-2 form i
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVPGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CADHERIN-23
publication title Structure of a Force-Conveying Cadherin Bond Essential for Inner-Ear Mechanotransduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aqeA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aqeA02
2OMWB 4APXB 3K6FA 4ZMPA 4AQ8C 4AXWB 2OMVB 1Q1PA 1L3WA 4ZMWA 4OY9A 1NCGA 4AQAB 2YQGA 3MVSA 5JYLA 2A4EA 3Q2LA 1SUHA 4APXA 4ZMLA 2YSTA 1EDHA 4ZMXA 2WD0A 2OMZB 4ZMZA 2EE0A 3LNGA 2QVIA 3Q2WA 4AQAA 2WHVA 4AQ8A 3LNFA 5CZRA 4NUMA 2OMUB 1ZXKA 3LNHA 3K5RA 4XXWC 3K6DA 3K5SA 2A4CA 1FF5A 1WYJA 3UBFA 1O6SB 4NUQA 4ZT1A 2WCPA 2WBXA 4QD2E 4AQEA 3UBGA 4AK1A 2OMYB 2QVFB 1NCIA 4ZMQA 2X2UA 4AQEB 1OP4A 5JYMA 4NUPA 4ZTEA 2OMXB 4XXWA 4ZMNA 3LNEA 4NQQA 5CO1A 3LNDA 3UBHA 4ZMVA 1NCJA 4ZI8A 3K6IA 1ZVNA 3LNIA 3FF8A 4ZMOA 3FF7A 3Q2NA 5KJ4A 1WUZA 4ZMTA 2O72A 2OMTB 1NCHA 3PPEA 3QRBA 4ZMYA 3Q2VA 4AXWA 5DZVA 2V37A
chains in the Genus database with same CATH superfamily
3C6LB 1EAQA 2OSXA 3DGGA 4PWEA 5DT1H 5J56B 1IZJA 2VLJD 4Y5YA 4HZAA 4AQZA 4PW4A 3H55A 1M3IA 5I1CH 2AJ3A 3NIGF 2GUOB 2DIAA 1S2EA 3ARGB 4Y2NA 4AYDC 4F7KA 2VR4A 3GMRA 3DYPA 2N1TE 4GIOA 1WBZA 2ZKXA 1QPPA 2ITCA 4I77H 4P46A 1UQSA 2OZ4L 4KRPC 4TQEL 5IROC 1A47A 4O02B 4GMSH 4LSRL 3BRGC 1IT9H 1U2HA 2H41A 4NQDD 5DHVH 4FJ6A 4P5RA 3HFMH 4FTVB 5I71B 5DJ0A 3DX6A 4HV8B 1ASOA 3I9IA 1KYDA 4LQFH 5IY5B 25C8H 3AS3A 5AZUA 3RGVC 5B1JA 4C56A 2WLJA 1U8CA 4NN5C 5DS2A 2IMMA 2H2SD 4BA0A 3CNKA 2R1XB 4BQ8A 4NKMB 4HDIA 5CP3H 3LQAH 2QVMA 3PAVA 2O5NA 2WQ8A 2XOTA 4NM8H 1F11A 3A6BL 4GQPH 4K8RD 1QHQA 4OZFA 2OYLA 4Q52A 2WCPA 1EMTH 2Y2WA 3D07A 4OZIB 2YMXH 2AEIT 4IBYA 1L7IH 1MWAA 3BZ4A 4AYSA 2Q7NA 3U4KA 3VXUA 2BOCB 8CGTA 3ZRCC 2V5TA 2ZAGA 2XN9A 3HG1E 1EHLH 4NGHH 4WO4B 3AU1A 1BREA 1BP3B 5H37A 1BLNA 3EFDH 5DI8A 5DMKA 9PCYA 2FX8H 1CD1B 4XPHL 2VGLM 5FO7A 4AKOA 2CCWA 3O6FB 1LWHA 1U8NB 4U0QB 2O93L 1X6LA 4GAJH 4EXPX 4M5YL 1ADQA 3L3DB 3VFVA 4OLWH 5DXWA 4LRIC 4DUVA 2W88A 4AOFA 2L04A 1FE8L 1E4XI 4KGJA 1IGCL 1EERB 1Z5YD 2P7TB 4P3CL 3WUWG 2A9DA 3CC1A 4PP2B 2C9RA 1DVQA 3FN9A 4TVPH 1NEZA 5I6XC 4G6KH 3HNVL 4UTBA 2DMCA 5IOPB 2VDRL 1T89A 2XJKA 4KFMA 1N10A 5I6OA 1ZVSA 1E4WH 2PXYB 2ERJC 2ZP8A 1NEUA 4IEFA 5EU5B 1AGCA 2EVFA 3J7HA 2QKIA 3HN5A 5DRNA 3CDGB 4F3FB 2X4TB 3HG4A 4ANUA 3GHBH 4NQXA 5FKAB 1WA0X 3W57A 3CLFL 5FCUL 3C60D 1EA9C 1W0VB 5EBMA 2NYYD 2ADFL 1DBKL 1T83A 4RMSA 4NCDA 4PRNA 5JHDA 3ZVVA 4PJEA 4FQLL 4ONFH 3L4ZA 1Z5HA 4NP4H 1UA6H 2D2OA 1L0YA 2R69H 4HEME 1P4BH 1RFDH 1ES0B 3LS5H 3BDBA 4XAKD 5HHOD 2J6EA 4EI6B 1OGPA 4ZUTB 4AJYV 3AACA 2VRAA 3WN5A 5HHNA 1E2ZA 3M86A 3ARBD 3Q6GL 2D3VA 4Z7WE 3DETD 3UBXG 1I9JL 2E8ZA 2FWLB 4PJ8B 3NZ8B 1OF0A 3OKYA 4D9LL 2YSTA 1YMME 4Z0BL 3L13A 1SLWA 2IBBA 2NZ9C 1IAIM 5AOIA 3RX8A 4R7NA 2UXTA 5HHME 2X0VA 4PB0L 4WLCA 1KFGA 4LQ1A 1P69B 2CA3A 2RFXA 5ALCH 3ZPDA 1KCLA 2VZTA 4HKJB 5GRJH 3UAJC 4E9TA 1BD2A 3N50A 2W0KA 1S8DB 2XLLA 2L7QA 5GRZA 5HI5C 1L9OA 4L3EB 5DEJA 5K9JH 2A5UA 1ZSDA 1W9XA 1E8XA 3U7WH 2ZX7A 1E28B 5FYKH 3MLYH 4L3CB 4F57L 1O7DE 3LZPA 3MLVL 1BG1A 3EH2A 4AT6A 3HB3C 2J1WA 4NQED 3WCYA 4LVHC 4BCYA 1DUZB 1K4DB 3JBG7 5JOFA 2WYIA 2DKSA 2FTAA 1AFVH 4HBCH 4KRMB 1TETH 1PD6A 2IDSA 2IF7A 4WI0B 1RU9H 4X99A 1U8IA 3G9AB 4U1MB 5FK9A 5TK2A 3S2CA 3GTNA 3TU6A 3VFGH 4PJXF 2OTPA 2QSQA 4YSOA 3IFNL 5IB5B 5I73B 1Q9WA 1W72H 2H26B 4BUGA 2VXSH 3P69A 3F5WB 1V10A 3MV11 4KOCA 2Y5TA 4JPVL 4XZUA 5B4MC 4GT7A 2XZQL 1WT5A 1DFBL 3C8KB 1KELH 2LTQB 1MJJB 5DSCA 4HUNB 4Y4FA 1A6VL 1BXUA 4Z9KB 4EE2A 4Q9QH 5BMFH 4JZOA 1KBGH 4U7SA 2VLRA 5G4OA 5JOPD 1UOKA 1D6EB 5C08D 4F37F 1AQDA 1V05A 1KTLB 3Q2NA 2EH7L 4QI3A 1OCWL 4X7CC 1RP9A 1NMCB 4W4OC 1TPXC 1G1CA 4AWJC 2BVPA 3BN9C 1B0GB 4JRYA 5J12C 3FJTA 1QYGH 2DDQL 3Q1SL 3TPUA 5ISZE 1E5YA 1R5WB 3V4LA 4MZ2A 3OXRB 1ZLVH 1HQ4A 1SBSH 1UM6H 1J9CT 3V5DB 3KZ8A 3EBGA 4PD4J 3P11H 4IGBD 2FBJL 1VFMA 2P8MB 4LP5A 1DUYB 3RWIB 1HHHA 3KXFD 4F5CE 5KSAD 2NRDA 1RZQA 1IEBA 4IMLB 2DQTL 4HFWA 4LCYA 4FXKA 1T5WA 4X4YB 1XSJA 4RMRA 3ARXA 4R9HA 4MQXC 4U0RC 3W9DB 2HVJA 4PJ9B 1A5FH 5J3HD 4R96B 5LCVA 3M1BA 1DQMH 2NPLX 2X4OB 3BHBA 4UBDC 5FM4A 2ZCKL 3OGOE 1S9YA 3NCYS 2F8XC 4N3TA 2Q0ZX 2FO4B 1PBYA 4GYBA 1ZEAL 3O0LA 2HUEA 2KLRA 2IAMB 3ASOB 1Q0EA 4P23D 2G5UA 1IAIH 5G5DA 5E6IB 3V6FB 1IEHA 1XVSA 1OALA 2J1XA 4MNQB 3MLTB 1KV7A 5CINH 5E9DA 1SOKA 1M53A 1KDIA 4JFPA 4KRNA 4L23A 4NSKB 1E27A 4YBLC 4OZIF 1MF2L 2EVIA 4NO2B 3DI2B 1MFDH 2VXTL 3GC3A 3K4AA 3KCPB 3RWDB 2W5PA 2R2HA 5BRQA 4BCZA 4H1LA 5FO8B 4ABWA 5HPMA 5E2VH 4ORGB 4XI5C 1A6ZA 1NKRA 4K07A 5GQBA 5HVFB 1HCVA 1HNFA 4AI7A 4FFWD 3LQAC 2JVUA 1N8ZB 3FUDA 2EVJA 4LAQL 3S36X 3WKML 1LEIB 1RZPA 5MEPA 9CGTA 1BECA 4X4MA 3T1WA 3FSVA 1QNZL 5MEOB 2ZAHA 4M3JA 1UYWL 3FUEA 3I02A 3MYJA 5KOVC 5C07A 5KYUA 2JCCB 4WWNA 3CH1B 3PQYD 2B1AL 2KH2B 2V4LA 1UFUA 3UJIH 1XFPA 1DLFH 4XP6L 5HGHB 2ETWA 5BV7L 3L3OA 3HBZA 1ZA6B 2F74A 4KXCA 4JFFB 4Q56A 4QRRE 4LO9A 1YUHB 2VB5A 3HPLB 4Y16A 4TSBH 2I69A 2Y07H 5DJ2A 4A7QA 3DPDA 5IIEA 1AXIB 1GY1A 5AOMA 1J11A 2X5PA 2ZCLL 2X0UA 1TU2A 3DX2A 3OTTA 1N64L 1E5AA 1XF1A 3PHOB 5CEXA 1JZ6A 1IBBA 5DHXB 2MJWA 2BOLA 2R0WL 4Q97A 4Z0XB 2A74A 3DDGA 2G9KA 2Z8RA 2IBZX 3F12B 2NY5H 3D85A 3SD5A 4X6EB 3QNXB 1NUNB 1Z9MA 4GBXB 1F13A 4AYFB 1REIA 5FWQA 3X1NA 1N26A 3EGXB 5TE4H 5CZVH 3AG2B 4UT6A 2WBJA 4GAYB 5F7WC 4ZD3L 3VTTA 2YA1A 3DSNA 4WTWA 2BOBA 2EIEA 1T20B 5EZOH 5J9PA 2X9ZA 4XOBA 1IGMH 1U6AH 1TVHB 3VB9A 3ARFD 1FYTA 1W0YT 4WI8A 4JDZA 5AOLA 2DJ4A 1Z9LA 5HGBA 1EDHA 3M45A 2RCSL 2FRGP 3P0VH 4RFOL 1AZVA 1DJGA 4OZHE 3UFIA 5GGVL 3AITA 4M8QB 4I5BB 3QIBA 4XR8C 1ACYH 2F8IA 4IRZL 3BP5B 3WEAA 1F97A 1TJHL 4A2DA 4A7TA 5C8JA 4Z7UE 4DK3A 3ZIYA 3TGXA 4HIQA 4G1EB 5BUAA 2IPKA 3ATFA 3O2DH 1IGTA 1BBDL 2VDKL 1CO1A 2ZXGA 2GTWA 2A6IB 3TZVB 1I53A 4JHWH 2BS9A 4JKKA 3UYOD 3NN8A 4UV7L 4YIQB 1KIUB 5HP5A 4GW5B 4Q58C 2WO3B 5DRZB 5CSBA 1P7KB 4M00A 3O4LA 4JFXB 3MRHA 1CGWA 4PRDA 2QSTA 4PRPE 3D69B 2Z9TA 1ZTMA 3HI5H 4X9FA 3IDYB 4GXVH 2AAVA 4K55A 1IM9A 4AYEC 4B95C 5CEYB 4MAZA 1P5VB 5IB4B 1ZMYA 1DANU 2MPVA 3DIVA 5C0AA 3FQRB 3PAUA 5DFTA 4MAYA 4ZTPH 4ZMVA 4HQQH 3BPOB 5IHZB 3QARA 2GAZB 2P8PB 4RZKA 3VA2C 2VNCA 4A6YB 3QHZH 4HWBL 1MQKL 3TN0A 1GA2A 5EN3A 3NPZB 3JTSB 2IWFA 5KJ4A 3I85A 4J3OC 1S7TA 4D9RD 3GSVA 4JMNA 5KVFL 3QNYB 4OCXH 4L8BB 1NCNA 3R1GL 3DX7B 3RL2B 3GI8L 4C57C 4OLZL 2WP3T 2OP4H 3LPGA 3OR6A 3ZHDA 3TEYA 1BWMA 3FFCA 2Z7YA 3RTLA 4ISVA 4MJIA 4IRSA 2AV1B 2IDQA 5EBWB 5I5JA 1T04B 2XV2A 3HNTH 1ORQB 2NOYA 5TQ0L 1GZHC 5IR1B 3VD9A 5KN5B 5I8CA 1DDTA 1P5UA 5DZ9A 3M17A 5DJZB 5TE7H 3WD5H 3QWNA 1MNNA 3HNSL 1YO4A 4XP5H 3MBXH 5JORA 2N7SA 3V6OE 3I6LE 1LK2B 1OGAA 1R5IA 2EO1A 1E5ZA 2NXYB 2UZXA 5K59F 4I0PB 2R39A 2Z3FA 15C8H 3VXSB 5L4JA 4PJHB 5G55A 3GS4A 1KCKA 1JK8A 3FCGA 4P57B 1FN4B 5F1IB 1WP6A 1QLEL 3H1ZA 2AFNA 1NCOA 4JCLA 3UZEC 3K81A 2CJSA 4NENB 4M7LL 2QLVB 3UCRA 5HDBF 2YD7A 2XT1B 1S7XB 4N8VA 4O4YL 3RWHA 2EXYD 4EZMA 4JGNA 2Y24A 1F3DJ 3CSPA 3LNGA 2YA2A 1NC2D 2E9BA 3Q2WA 4WQOA 3H9SD 5CN3A 5LGKA 3GMQA 3MRIB 3MNDA 5C9JB 2C8NA 1Y18A 4PFEA 1U9KA 4GKZA 4M8RA 2R0ZL 1VDGA 4LOUD 4JFED 2OZ4H 4TQEH 6FABL 5DWPA 4LSRH 1ETJA 4LCWA 2XQYA 5SV4A 3SBPA 4QR7A 2WAQA 1G7IA 1KG0A 5FO2A 4FLOA 4ANVA 1U95A 2YGNA 4WU7A 3S0PA 3UBGA 2N56A 3VM7A 1Q38A 1I8IA 4JAMB 7TAAA 2JCCF 4CC0A 3GMOB 1ZLWH 1KIPB 1XH2A 3KPQB 2Z31A 4PLOB 3V0VB 1ZT1A 2FR4A 4I2XE 2KERA 3QFJD 5DGQA 5FA3A 1VESA 4BE6A 5IBUG 4K8RH 5D5MF 3GSQA 2Z6FA 3A6BH 5J1AA 4PRAA 5ELIA 3FSOA 4XWGL 5JIHA 2BY1A 3OD3A 3TBYB 3EYFA 4DFIA 4DK5A 5A7BA 3NABL 4GRLC 1N0XL 2XY1A 2JTYA 3EJCA 4EQ2A 1CURA 3BUYB 4X9BA 1F4WL 3WTWA 1CBJA 1M7IA 3BH8A 5ACZB 4N8PA 3FTUA 1TJIL 2W9DL 2VZ1A 2YQBA 1P2CA 3KPRB 3SDCA 3DX9B 3P9MB 4JRLA 4XPHH 5CSZA 3HZVA 4ZMYA 4CVZB 1OO2A 4AE1A 4M5YH 5DD0L 3HBQA 1NLDH 4OV6F 4BZ1H 4OAWA 1FE8H 4NS0A 4AYGA 1EHKB 1IGCH 4P3CH 1BXVA 1PLGL 2WY3B 1KXQE 1FH5L 2NY5C 4JO5A 1ANUA 1YQVL 4YHNA 3GK8L 3N6YA 5EU4A 3HNVH 3IDIA 4PS8A 3WEMA 4F8NA 2VDRH 3HHMA 1CXHA 1OTUD 2ZE0A 2XYCA 5KUKA 1FVEA 3TT1L 3WN6A 4LSPL 1UOVA 5ERWB 4E2OA 1TZAA 3DGGB 3RU8L 3GNML 1PGRB 4OUUA 1SMAA 3FB6B 2W92A 2WXIA 4NRZB 3WE1A 3PWPE 5AB0A 4Y5YB 2ESVE 4TVPE 3P4NA 1SN2A 5DQJA 3TFBA 3Q9PA 4GKSA 3FU7A 3VI3A 3CLFH 5FW6A 5FCUH 4WUUA 4WEUD 5AW1B 4YFEA 2ADFH 3ASWA 3GMRB 3FCTA 4GG6E 2P5WA 1WBZB 2EADA 3UZVB 4EDXA 2WQXA 3ISWA 4FQLH 4GO9A 4MJ2A 2ITCB 3NJHA 1UQSB 2OL3A 2CHDA 3GXFA 4LVEA 4JPIB 2QMKA 3ZZQA 1B9KA 1KCUL 2AJSL 4MB1A 2AKRA 4QNPF 5CGYC 3Q6GH 5DJ0B 3DX6B 2Z7WA 4UYPA 4D9LH 1FNAA 1SYSA 2P52A 4HX1A 3SCMD 3F7PC 1T21B 4Z0BH 3BRDA 1E5BA 2UVFA 2AITA 1D5IL 4BSJA 4C56B 3DXAB 1U8CB 5IHHA 5D8JL 1T66C 1W16A 1DJHA 3I9GL 4PB0H 5DJCA 1HI6A 1NGXA 3GMLA 5F96L 3NJLA 4NFBA 4TUKL 4Z3TA 1J1PH 4N2MA 2DYPD 4QGTA 5HD8C 1F11B 1IARB 2ZZUT 1G7HA 3QPXL 4Z78B 4OZFB 3RY5A 1EVTC 5KSBA 3GSWA 3WS3A 3OAZH 3LKRA 4M7LT 1MWAB 1M7XA 1XAUA 1HWGB 1JZDC 2WK2A 3BZ4B 2YR3A 4GXUM 4MA7L 3VXUB 1YJDC 4KMQA 1NGYA 4PJIE 1PMYA 4F57H 5K9QI 3MLVH 2XN9B 1UM5L 1KZYA 2FWSA 3AU1B 4ZSOE 4CC4C 1BLNB 5T1JA 3MUZ1 4N2BA 5DI8B 5DMKB 3LXUX 5FO7B 3MXWL 4AVIA 4JR9L 1SJHB 1CT8A 4DKFL 3IFNH 3BQUC 5IM7A 3VFVB 3HE7B 2R2CA 1LYQA 4A2HA 2V2WA 1QBML 2KLTA 3MUHL 5IW6B 4MYWB 5LBSA 3WLWC 4AGOA 1Z9OA 4AE0A 4JPVH 2NY3C 2MPAL 1NEZB 3EJJX 4OM0L 2XZQH 4L0ZA 1DFBH 2QFRA 1K2DA 4KK5D 2VDQL 4UDTA 5EOTB 1R46A 1A6VH 1B4JL 4RGNC 3GF8A 4FERA 5DD1L 3ZOAA 1ZVSB 2DS4A 4UQEA 5I6PA 1MFMA 1S7VB 4LPXA 3QZLA 5AW2B 5C0JA 1AGCB 2D3NA 1AP2B 2QKIB 5DRNB 1KTRL 3MRNA 5IVOA 5CEZL 1D9KD 3HS0A 1EHNA 2AXWA 3SYAA 4NQXB 2EH7H 1OCWH 2WKLA 3I50L 3PG2A 5EBMB 2PPEA 3HMXL 4K7PL 5DLLA 1NOFA 2VW7A 2X9WA 5A6LA 2YQGA 4HIJB 4PRNB 3WGVB 2DDQH 3Q1SH 4PJEB 3HBGA 5CJOL 3N41F 1FFPA 3C5SA 5HHNB 4QKXB 4WW2C 1YPZA 3L3IA 1KB3A 2FBJH 4G8FA 4KXDA 4UDUA 2RR3A 3KLHD 5B39A 4A2GA 5CR1A 2OJZH 3KPSD 5E24E 2DQTH 4G42A 4R7NB 4ZFFA 5I18L 3KVPA 5D93B 3MJWA 4Z23A 3CQFA 2I60L 1I3VA 1UH3A 2CXGA 4MASA 3BX7C 3WS6C 3QDMD 1J10A 1X44A 2ZUWA 1EHAA 4L0PB 1BD2B 2Z7UA 4DOHB 3LN4B 2M26A 3PL6A 1NBZA 2ZCKH 4ZTOL 2H0JA 3ZQWA 2F9BT 1ZSDB 4M7ZC 4E9VA 3GI9L 4QD2E 1ZEAH 4M3KB 3BGMB 4AT6B 2V7NA 4QTHA 4RZCA 1KMGA 2P5PA 5M94B 5JO5A 5DUBA 5JOFB 1IGIL 2EP6A 1D5BA 2YPLD 2P42B 3MGOA 4MDRA 3MRCA 4M1DL 4NFDA 5FK9B 4UZGA 3QWQB 1MF2H 2YSSA 3UGUA 2IGTA 5JQ6L 2VXTH 2ZXAA 1Q9WB 1USQA 2F54D 2H2SC 4OF0A 4GQRA 4P2RA 1JPEA 3T65A 3CXHK 4QHNA 1FGVL 4D0DA 4XZUB 4K8RC 5G2NA 1A4BA 3C8HA 4LAQH 3NSYA 3WKMH 3M1OA 2FVNA 3L81A 3UL4A 2BCKB 3VYPA 5DSCB 4Y4FB 1WAPA 4NUJA 4JZOB 2ZICA 1QNZH 5BNXD 2BC4A 1IBFA 1UYWH 4U4IA 3SHSA 4JHZA 4WFED 4FA6A 2APSA 1VB9A 1EZSA 3FN0L 1AQDB 5DD5L 2B1AH 3VSQA 4XP6H 1R4XA 5MEQA 2AQSA 2EKJA 1HXKA 5BV7H 5EBGA 1IC0A 2BVPB 5I8KL 4JRYB 3UTTA 1LM8V 3DO7A 4XBPA 3TPUB 3IJ8A 4B96A 3R0MA 1HQ4B 1RH8A 2ZCLH 3GTTA 4H8HA 4UT9A 2BSCA 1N64H 2D7TL 1KIQB 3EH1A 1AZCA 1QEWA 1UXSB 2R0WH 3ZXAC 3FT9A 1UKSA 3SPIA 4WFHE 1HC1A 4YL9A 2G0LA 4MBRA 1HINL 3FSZA 1HHHB 3HHSB 2HUHA 5HSFA 1IEBB 1MCFA 4LCYB 4FXKB 1ILUA 1H3WM 1MIEL 1T5WB 5F7LB 4PJ5D 3VFOB 2ZQKA 1E3FA 2FL5A 1E4JA 12E8L 3C60C 2NYYC 1O7SA 3UBXB 4ZD3H 1F2XK 4Q8BA 4NZTL 3BHBB 2C9AA 1EFQA 2OI9B 1COBA 1S9YB 4ICWA 5C2BL 3OHXB 1UWEL 2GITA 3ARBC 4UM9D 3D4ZA 3DETC 2RCSH 2XZCL 2ZYSA 1RIHL 4BSVB 3FH7A 2XPYA 3QJTB 4RFOH 5E9DB 4LSQL 4DPBX 2FJHB 4JFPB 1FO0H 3MRRA 4XE5B 5GGVH 1WTGT 1E27B 3E2HB 4JRXD 2IO5A 4IRZH 2EDFA 3BMVA 4QOKA 3FTXA 1EJOL 2ZONA 3MCKA 3V5KB 1TJHH 5HPMB 4L9LA 4FYTA 3A4EA 3OQRA 4U1HA 3RRQA 2VXQA 2PTTA 4XO4A 4Z7NB 5DZLA 4BWUA 3QDJA 5L2JB 5DEGA 2VDKH 1BBDH 4X7TA 5AAMC 4PMEA 5MEPB 1EV2E 1ID2A 5HI3D 3ARTA 2I26N 3WU1A 4L4VD 2J4WL 3T2NL 3WNLA 4UV7H 3TTSA 3JTBA 5L2KE 4IKLA 5C07B 1I7TA 4WVRA 4TOYL 3RB7A 2EUWA 1QACA 2D4DA 1JD9A 3MBEA 3MOBL 4UQIM 1JTTA 4ZX6A 4J1UA 3NCXA 4P99A 3AS1A 5BJTA 4Y16B 1J0IA 3FB7A 5DJ2B 2OMWA 1R33A 5IIEB 1PZBA 1N8OE 2IH3A 2XQYK 1NPJA 1TU2B 2CUHA 5H2BA 3K2UL 3GUTA 4JFDD 5CEXB 4D3CL 1TLMA 4KWUA 3IN2A 1FIEA 4Z7QE 1QR1A 4HWBH 1MQKH 3D85B 1CDIA 3ZE0E 1MI5A 3QQDA 3T08A 2ADGA 5D7IA 1MFEL 4DSYA 5KVFH 5AZ2H 1Y07A 3R1GH 3GI8H 5D1ZD 4OLZH 1T6WA 3S48A 1KLFA 2YBGA 3DSNB 4KVPA 3GXTA 3MRBA 5TQ0H 5J9PB 3GEWB 1SXCA 4JFVA 3BPNC 4ANKA 3MACL 1FYTB 3HNSH 1PAZA 2ZYRA 3MV7A 4KDTA 3QAZC 4OCRH 2G2PA 5HGBB 5J5EA 4IGBC 4G9FA 3WHXA 4OGZA 4Y2DD 3EJZD 4MXVE 4AIZA 3KNBB 2O30A 3H3PL 3QIBB 1JPTH 1NEPA 1ML0A 1KDJA 4ZODA 2A4CA 1T1YB 1OW0A 1FYHB 1QLEH 5C8JB 5J3HC 4M7LH 4DUXA 4O4YH 3GD1C 1ROWA 4RSYA 2CDFA 3OM3B 2IPKB 4QXUL 4OFQA 4KBPA 2Y5EA 1IGTB 1BZ7A 4Q7DA 1OP5K 1MG2C 2Z65C 4A2LA 1TF4A 3GSXA 2IOOA 4G8GE 3ZTNL 3NN8B 4P23C 5TH2A 1AOZA 5CN2A 2BRRL 4N6RA 4A7UA 2R0ZH 2XIBA 5IJDC 4L1DA 4FQ2L 4JFOA 1ZGLP 1N6UA 4FQXA 4KKPA 3ZT6A 6FABH 2WGXA 1BWWA 4G6FB 4PRDB 3L5XL 3LNEA 5D4QA 3HS8A 3LRLA 3HAEH 4DP1X 3II3A 4MJHA 2FECI 4Y9FA 3QXUA 3VD7A 4P3DA 4LMQI 2ENSA 4FFWC 5C0AB 2DMBA 1ZIBA 5E4EC 5DK2A 5LDUA 4MAYB 4NIYE 3JV5A 1PVHA 2JCWA 3QDGA 3KJ4C 1I3RA 4FP8L 2JLLA 4KVCL 1AMXA 4P2QE 3BUTA 2NR6D 2EC8A 2CGZA 1FCGA 3IDNA 5E8PB 4NQDE 4KTEL 1V3MA 4TYUA 5L4MA 2RB8A 3TN0B 4F7PB 1YEWA 1BFVL 3IN0A 4N90E 4XWGH 1ED3B 3MRPA 1FLRL 1NPNA 2CNZA 5GS1A 3NABH 1BZEA 4BKTC 1N0XH 2BM3A 2QDVA 1L9QA 2BSSA 3LXCA 4MRBA 3A0OA 5EDXA 2ZF9A 5I1DA 4FNPA 5IW3A 3CZKA 3FFCB 5FYKU 3SE9L 4Z7OB 5BV7C 4IRSB 1F4WH 3SJVD 3DJSA 1KYFA 1NTDA 2X09A 4P5TD 1TJIH 2W9DH 5I8CB 4O51A 2AXJA 1P5UB 3M17B 2OJ1A 1OT2A 3HVNA 3DRQA 5CJ8A 3WUZA 4AQAB 2XIIA 3G7TA 3II2A 5JORB 4LSTL 2IFFL 3DMMB 1H15A 5DD0H 1L0QA 1OGAB 1PZ3A 1R5IB 4PGZA 1QSVA 3IJEA 4RGMC 4BFJA 2GI0A 1NJ9A 4PHXA 1PKOA 5T1MB 4H8WL 5BOJA 1PLGH 3BW9A 1FH5H 2ZOKB 1YQVH 2CALA 3GK8H 1CFBA 4AIEA 2EE0A 1FAKT 1ZT4B 1JK8B 3R7QA 1UWGL 3A24A 1NC4D 5AVXB 2FHCA 3NFSL 3TT1H 1Z9NA 4AITA 4LSPH 5E00A 1BZQK 4N8VB 3RWHB 3RU8H 3GNMH 5ES4B 3OJDB 4GSUA 3UEZA 3IGFA 1E42A 5FDYA 1X5KA 2CGRL 4KKRA 3TA3D 3ARFC 3GMQB 2D4FA 2ADJB 4XB7A 2HFGH 4XNYL 1OT4A 1Y18B 3L2MA 3PUUA 1AKJA 5L8LB 4DTGL 4G3YL 2DJMA 3T4YA 1AHWC 1A22B 4LEXL 3HG1A 4FXTA 3GXUB 1PQZA 2IPUK 3BH9A 2V3DA 4LCWB 3LIZA 4G5ZL 4Z7VB 4ZQKA 1KTJA 1OP3K 4OLXL 2MCAA 1G7IB 1OARL 1KG0B 1A3LL 1KCUH 2AJSH 2EDYA 2UXVA 4W6XB 2CRZA 4P9ML 5KZCD 2Y25A 4WU7B 1I8IB 3MJ9A 4RBPK 5F7NC 1I1AB 4ZS6D 4Y5VB 1G6RA 3VI4A 1D5IH 1WD9A 4DWHA 3QEGL 3BVDB 4TS6A 4N0YL 5D8JH 5IVXF 2Z31B 5TDOA 1J9QA 4EIBA 4TNFA 5F96H 4TUKH 3X3FL 2V5RA 2FX9L 3QZOA 5FA3B 2EDTA 3GSQB 5GGRA 4AEFA 5J1AB 3QPXH 1DVZA 4PRAB 5IB1A 3CMGA 4PMFA 3EYFB 3VH8G 1SXSA 5HGAB 2Q7AA 4MA7H 1PDKA 1GCYA 5DD6A 1ZKAA 1K8IA 3DTXB 4HC1A 5LVEA 1G94A 2D8KA 1M7IB 1UM5H 3BH8B 4XWOD 4JQIL 1T3FA 2BVYA 1XIWD 1SXZA 4ZOEA 4PH8A 1P2CB 2OA9A 4NT6A 5IK3A 5B3JF 4XP9L 5EG6C 4HEMA 1T03L 3MXWH 3HZVB 4JR9H 2G9HA 2Y7MA 1EH9A 3BXNA 3ROLA 1XCXA 2ED8A 4MB5A 3KG5A 1QBMH 4G80A 1AMYA 2VDMB 4JG1L 4HOZA 5C6PB 3KPNA 3T3PE 5HYJD 3EDEA 2MPAH 1YMMA 4YHNB 1NCCL 3N5AA 5EU4B 3GSOB 3IDIB 3B2MA 2VDQH 3BIBX 1B4JH 1CYXA 3CFBA 4MMYA 5DD1H 1FVEB 3MA9L 5DJ6A 5DVKA 1WCQA 4B5ZA 2CBOA 1C8QA 3WBDA 4L3FA 1GYUA 2WLYA 1WFIA 4OUUB 1LP9F 4AYID 5CEZH 1JNLL 4E5XG 3TS8A 3P4NB 3GBEA 4FL4B 4QHPA 4GKSB 3D18B 3VI3B 1NCBL 1TO5A 1R3KB 3I50H 3LCYA 3K0YA 4WUUB 3VQMA 3HMXH 4K7PH 4EN2A 3TO4C 5KBLA 2P5WB 3ECQA 3VG9B 4EDXB 4JFQA 1SOSA 3FBKA 4K5PA 3OKMA 4ZFOA 2OL3B 2ENPA 3HG2A 5C08E 3W9EA 2GEEA 1IC1A 5CJOH 1TQBB 4FC3E 3PNRB 4ZUWB 5JLZA 2AKRB 3RWJB 3GJEA 3IS1X 4RQQA 4RFEB 3HAEG 5KVDL 2HVKA 3LZRA 3VXNA 3GM8A 3GYRA 3N04A 4HX1B 5T3ZD 1NANH 4OCYL 2XG4B 3RAJL 2EXYC 5KAQG 2DJSA 4L1SA 3F7KA 2COQA 4GLRH 2OM5A 4OIFA 2HJFA 3CN2A 2YLHA 5I18H 3WL9A 2HPOA 2I60H 5DJCB 3US0A 1HI6B 3PFUA 2JKWA 3GMLB 1KB5A 3T0EE 5JW4N 2DKUA 2ZCZA 2R23A 1TG8A 3EYQD 4WK4B 3N85L 3VWKD 2WO2B 4W9ZA 1G7HB 1ZDSA 4JZNA 5KSBB 4LOUC 3GSWB 2WXJA 1N68A 4JREB 3WS3B 3LKRB 1AHMA 1GKOA 2MOGA 1EDYA 4ZTOH 1KCVL 1OZTG 2IV8A 3UBHA 4NM4L 3V6BR 3EOBA 3GI9H 3W0WD 2CLVA 4HCFA 2NYKA 2BP3A 2NW3A 3TVMA 2OPCA 4PJBE 2E7LC 1O0VA 4AY0A 4FD0A 3V6ZA 5C86A 2I7OA 1IGIH 1VAHA 5C09D 4CN4A 1EEUA 4GUOA 4XGZA 1TUPA 1MWOA 3DROA 5ISZA 2J2ZA 5E7FA 1CFTA 3IJ7A 4M1DH 1ICTA 1Q9LA 5JQ6H 1ZRUA 1CT8B 5GZND 1L6ZA 5IM7B 1UOLA 1MCSA 4GFTB 3GXNA 2V2WB 4Z7OF 2YAPA 5JHLA 3Q8BA 1VACA 3AQZA 3U9UB 5D1QD 1FGVH 4N87A 5D55A 1RKRA 4WWOA 1JV5A 4OF3A 2B39A 3INOA 4RMBA 4XC3L 4F5CA 3S36L 2E74C 2FEEL 4TVSa 2C9SA 4MQSB 4UDTB 1MLBA 1WTLA 2GCYA 1D5XA 3MBWA 5DR5L 5C0JB 1JK9A 1O6VA 1PPIA 4YUEL 3MRNB 4XCYB 4ZO7A 4NJAL 5E2TL 4RRPM 2AHIA 3FN0H 2IWEA 5DD5H 4YXHL 1BQLL 1K4CA 2AVFA 3QWRA 2BXZA 2BCMA 3NSCA 1KULA 5I8KH 3VMNA 4I9XA 4HU2A 4NCC1 4JO4H 1AR1B 4B9ZA 4Y19D 3BLBA 4KZEL 4QCIA 6TAAA 3MJGX 1FFPB 2WQUA 1YAZA 3C5SB 3KLLA 2BS71 4AGMA 2CR0A 2D7TH 4ODHL 1OTUC 4ETQB 4G8FB 3CVCA 2QZQA 1YEKL 1ZAGA 1BCIA 1BZOA 1HINH 4G70B 3RDTD 2OZNA 1H6TA 1XF4A 4ZFFB 4G42B 2F53E 1MIEH 1MKFA 4ZUVA 4EOWL 3X1EA 1JZHA 2GBAA 4Z7VF 4AGPA 5IROA 5EF3A 4J3WA 5I0XA 1FGNL 1M3JA 4ZNCD 2IANA 3LS4L 2ZUVA 1SXAA 3D7PA 5F93C 4ICXA 2K0RA 3ZE2E 3FU8A 4NZTH 1M1SA 1NBZB 5C2BH 3VXMD 1FWXA 1LEKA 5F7BA 2DOCA 4ZMQA 1UWEH 1FNHA 1J05A 4M9PA 1ESOA 4YHYC 2V7NB 2WSKA 4QTHB 3QUML 4R2GD 4B3EA 4NDMA 5DUBB 2XZCH 1MXDA 1E8ZA 1D5BB 3FULA 2XV3A 3LRMA 3SCMC 3TXAA 4QRRA 3MGOB 4LSQH 4APQD 3MRCB 2XBTA 5FUOL 5I82A 3KVDD 2YSSB 1ZVNA 4HW6A 1EJOH 5EU6E 4P2RB 2ZT9C 3IYLW 3WFZA 2HJKB 1UD4A 1DE4A 1ILSA 2XWTB 3SDAB 3T65B 4QHNB 4FGMA 2RD0A 4D0DB 1GH7A 3DUUA 2FYVA 4LLDA 4LVOB 3V9EA 4GY4A 1TYRA 4RA3A 3RUGE 2C3VA 2MOVA 1RHHA 5BZXA 3WGUB 4PCYA 1A3RL 4NUJB 5IQLA 3T2NH 1QBLL 2Q6WA 4MXWL 2BC4B 1Z66A 2FQGA 3IFPA 4MA3A 2E9IA 3MPCA 3U25A 3NACH 4DGIL 3OB8A 4LRIA 1E40A 2VSKB 1XMEB 4ABUA 4UYQA 4NKOA 5SX5K 2HKAA 3OZ9L 1OK8A 4GSQA 3MOBH 5MEQB 2ZKMX 3P3YA 2FO8A 4ZFGL 3UTTB 3DO7B 2DTML 4XBPB 2IEPA 3MGTA 4KX8A 2BSED 3EFOA 1Z2KA 1TVBA 2NCEA 5SWZE 5IT2L 3K2KA 4GRMA 4WKZA 3EF4A 3K2UH 4KK5C 4D3CH 1IEAA 5AW6B 1NWOA 4NO3B 3L95A 1RK1A 4I87A 1NAML 3B56A 3D3VD 3PGFL 2CDEA 1HCFX 2QBWA 3B7RL 4ZO8A 2C3WA 1D9KC 1MFEH 1Q9OA 1XR9A 1PCXA 4PGCA 3VXRD 2DQEL 2I85A 2D0HA 2FL5B 4IMKC 4R4BA 5D7EA 2WXGA 4C55A 5ACLA 4AEEA 1KJ2A 3BVWA 3EHBB 3NCFB 1ACZA 1A7QL 1WYJA 2CRIA 1J8HE 1F4HA 3MACH 2Q3AA 5I1GL 4ZT1A 4ZXBA 5BW7C 1CE1L 3LX9A 4LLQA 4BJLA 4CVXA 3LN5A 5LN4A 3F6IA 2V5MA 2XWBA 3LXAA 3TEZA 1I7ZB 1NCUA 1QSED 1UJTA 2FQEA 2HLEB 5CCGE 3KLHC 1MCEA 3IFLL 2CKBB 3SPVA 1PX3A 1F1AA 5DURD 4R97B 3A47A 3H3PH 3MCG1 3MRRB 3VD5A 5KSBF 4N0UE 1I8KA 3DHJA 3CVHL 1DEDA 4JGUA 3C2AL 4QOKB 3MCKB 3OKLA 3K74B 1SLUA 4L9LB 2W95A 5IMKA 2XG5A 3DYOA 4HZLA 4JGMA 4U1HB 3ZE1E 1IVLA 2PTTB 2L7UA 3GJFH 1EZLA 5EMYA 3X14A 1JCKA 3QDJB 5DEGB 3BPLB 4QXUH 1FSKB 4PREA 3TJPA 3KGSA 5GJTL 1OM9A 3FONB 3MRLB 4ZX3A 4XMTA 5FECA 1DQJA 1SMOA 2WXNA 4Q74A 5JHBA 3ZTNH 5F6IB 5K39A 5T1KA 2JKLA 1OB0A 1A7RL 4LVNC 2BRRH 4MDIA 4PV1C 2P3YA 1JUFB 3MUJA 3K0WA 4YHOL 2RAMA 1X5AA 1EIBA 3SYOA 3QCVL 3MBEB 4XNBA 5GRXG 4ELME 2ADYA 3L5XH 4J1UB 2XYBA 4NPJA 5DWUL 5IOKA 1BF8A 4TQPA 1YY8A 1B0RA 3V6OA 3H9SE 5BJTB 4LPVA 3OAYK 3SGJC 5FPIA 5IHUL 3FB7B 4YLBA 2OMWB 1Y6KR 5ETUA 1M1XA 4K9JA 4K5LA 2IH3B 2N3JA 4JG0L 5F9JA 3P2TA 2DEXX 5JIKA 3EW3B 4UZSA 5H2BB 4J2QA 2Z64C 4U1JA 3GUTB 4JFEE 4BHUA 3Q9QA 4FMKA 4AGNA 4N2DA 4FP8H 1QPXA 4KVCH 4N25A 4ESKA 3D8MA 3KBPA 4LLAA 1HHKA 5KSVA 2QGCA 1FBIL 3QHTC 4O58L 4FI6A 4W4OA 3RKDD 5IJVB 1BFVH 1MI5B 3QQDB 4NN7C 2ADGB 2MQ0A 5D7IB 1FLRH 2X0WA 1MHEB 2HRPL 5EEZA 3RWCA 2PYFA 4A1RA 3MV01 1KLFB 2FHBA 1HH9B 3SE9H 4WUKL 3IM1A 1EWHA 2VQ1A 3N1MC 3Q2CA 3MRBB 1FDLL 4Y4KD 1JMXA 3CSBA 3B9KD 1UATA 2L4OA 2ZWYA 5H35B 3KWTA 1O5PA 1QNIA 3MV7B 4LSTH 3RVXD 2IFFH 4AEIL 2LABA 1XR8A 2AK4D 3OKNA 4G9FB 1I9IL 3WHXB 1X5LA 3ECVA 5F7AA 3DPBA 4AIZB 1QUPA 2EUZA 3AVEA 2XV6B 3DARA 4H8WH 1T1WA 1ZWIB 2ZWSA 5FXCH 1I3GL 3L3JA 3PU7A 1UWGH 4BDVA 4HIHA 3M1CA 3NAAL 1WO2A 3NFSH 4HH9A 4XODA 5MENB 1KGJA 5DHVA 2CDFB 3M7FB 1YYCA 3KH3A 4AKQA 1BZ7B 1BMWA 2K6YA 3UYPB 3UMTA 4BK8A 1CMOA 3GSXB 3BE1L 3D06A 3FH5A 4FQJL 2XTJB 4RFNC 1ITCA 2G5BA 3JQOB 3BAIA 4KY1H 3FFOA 4PRHD 4XNYH 5TH2B 5CMAA 3UG5A 3ZT7A 4F7TB 4DTGH 1Z9SA 2HFEA 4G3YH 4Q2ZA 3IE9A 4M29A 1CDBA 4G43B 1A6AB 3TLRA 1IKOP 4JFOB 2UY7A 3QCTL 4FQXB 4WI5A 1BZ9A 2J1YA 2DQFA 4Y8AA 3MLPA 4PY8J 1E4HA 4G5ZH 1MPAL 3PAZA 1UB6A 4OLXH 5T3XE 1OARH 4LDOB 1A3LH 2ZOLA 4IKNA 3MI6A 4J4PA 3W3BA 4KXAA 1N67A 1KC5L 4P3DB 2QZ5A 1UZ6F 4P9MH 4PIRF 3F7YA 4G72B 3D51A 1H8OA 1ORSA 4Y1TA 5DK2B 4XXCC 1KXQA 5DJYB 5BPPA 3PAYA 3QEGH 3H2PA 4LEBA 4N0YH 2XRAL 3QDGB 1I3RB 1JE6A 5HI3C 3BUBA 4MGXA 5DU7A 4WEMB 5I1HL 3X3FH 4EVNA 3D1MC 1OCCB 2FX9H 4RRPG 1MFVA 4JLRA 2XI9A 4NWUH 4POUB 43C9A 4PS7A 3MRPB 2PUQT 2ZUYA 5GS1B 2H6PB 1A0QL 4B0MB 1F1DA 3ORJA 3PWPA 3PIQA 2W9LA 3L4XA 2ESVA 2BSSB 2YLKA 4D8PB 1MXGA 4GAGL 5I1DB 2D73A 1DP0A 5LAXA 5FGCE 4CMMB 4JQIH 5DHDA 4GG6A 5JXAL 1OQOA 4OM1L 3SQRA 1CLYL 3DRQB 3B2PA 4YSPA 4CBZA 1T03H 5CGMA 3S3BB 2VW6A 2EE2A 3HOGA 2KT6A 2K1MA 1H15B 3IJEB 2BIHA 1NJ9B 4J2XA 2F1BA 3FB5A 4JG1H 1DZBA 3BW9B 1B6UA 3L4UA 1NCCH 4KKLD 3RKPA 2H32B 2CJUL 4WTXA 2WWKO 5D1ZC 5C71A 4U3HA 3MA9H 5E00B 1Z0MA 4M6NL 2K9FB 2X6AA 4QPEA 1RY7B 3B2VL 3AROA 2Q20A 1L9MA 3N1GC 4QLRA 1RAMA 3GXIA 1S7QA 1JNLH 4AQEA 1UA7A 4U6HB 2DTSA 1NCBH 2R0KL 4URTB 2DQHL 3JZ7A 4O9HL 2WC7A 4OFVA 3TIDB 5IESL 1AKJB 1Y1DA 3FU5A 4PJIA 4Y2DC 4YBHA 1WWAX 3EJZC 3F84A 2Y5QA 3C6LD 3HG1B 3WO3B 1GGIL 4QF1A 4ZSOA 3HC0A 3APNA 1JCVA 2W9EL 3HFFA 3BH9B 3OB0H 4ZQKB 3FC8A 1KXVC 1M71A 1SBBA 1EAOA 3ARGD 3AG3B 1E2WA 5KVDH 4L4TB 3GZOA 1UUSA 4OCYH 3RAJH 1BYPA 5D6DC 1G6RB 3Q01A 3NZUA 4IU3A 3WO4B 2F08A 1RZKL 4LZKA 3QXWA 4O02L 3VW3L 3NIDE 5DS8A 5TDOB 2OYPA 1R6VA 3APDA 1I85C 3RVVD 4FTVD 5JA8B 3L4CA 2YAHA 4K3HA 3N85H 1KY6A 2PN5A 1WFOA 5GGRB 4YDJA 5I1KL 1W72A 3TV8A 5IB1B 1W15A 1EGJL 1FLTX 4LU5L 3L9YA 2FLRT 1RIVH 1T5XA 1HIMH 4CU6A 1KCVH 1S3KL 1PDKB 1ZLDA 5DD6B 4NM4H 4DPCX 4YDNA 4OUOA 1K8IB 2YXWA 1E5UI 1H8NA 3FPYA 3DJRA 3V0GA 4RH4A 1T3FB 3CFTA 1IC7L 3QDME 2VWEC 3VFSA 4NT6B 1ZANL 5FF6B 3DURA 2WYHA 5IK3B 5I6LA 5D7IF 2CJTA 1B90A 1QA9A 2VR8A 1ZS8A 2G9HB 4KJQD 4ZRGA 2CLZA 3T1FA 1I31A 3BXNB 1T2JA 3MVSA 3PGDA 3ROLB 2W8CA 1S9XA 2NR6C 2EDEA 4HEPG 4QRQA 4B53A 4G80B 2Y7OA 4ZPVA 4Z7WB 3CZJA 3KPNB 4H44C 4WO4D 4YHLL 1TKWA 2C4FU 3T0WA 1YMMB 4BUQA 4HCRA 2NNRA 4XC3H 3S36H 3V4PB 1BX2B 3NJKA 3O6FD 5HHMB 2AEPL 3CFBB 2UZPA 3NJMA 1BAWA 4MQ7B 4MMYB 5DJ6B 1JZIA 3GRWL 3NGBC 5JHAA 1T5KA 3SDXA 2F54E 3L5WA 4XPAL 2YAEA 3H42L 1S3RA 2PCXA 5DR5H 1MRDL 5JPNC 4P5TC 5GPRA 4YUEH 5MI0B 3PCYA 4NJAH 5E2TH 4KX9A 4YXHH 3V0HA 1BQLH 4DO4A 1C5CL 4PJCA 4QRTA 2KZKA 1A65A 3KM1A 4LKCA 1CF1A 3L08A 1ND0A 4L1BA 1A1MA 5IFHH 4YMPA 1HHJA 3KAAA 5B1BB 5IKCA 1OCZB 3RZCC 2PXYD 5C6WH 1ZK5A 4U2YA 1N3NA 1HSBA 1QZNA 4JFQB 2ZG1A 4H8WC 1KY7A 3FDWA 1ZHKB 2V9QA 2G3MA 1WWBX 3OKMB 4XPTL 3FQTA 4ZFOB 4KTGA 3UZEA 3V7AE 3W9EB 4KZEH 1QFHA 4EN3A 3QO0A 2R2BA 4WWID 4LSUL 2ZXCA 4W9CC 4ODHH 3V0EA 3RJQB 3GJEB 4RQQB 1FVCA 2FUQA 3VXNB 2GSIA 1OP4A 3CAFA 2XU9A 1AY1L 1YNLL 1F4XL 2FIKA 4Q6IC 3DO4A 4AQ1C 5D2NB 4U1GC 5FGSA 2XBDA 2O4EA 3CZEA 1GMEA 4GKNA 3V5HA 2HJFB 3TA3C 4JFTA 3WL9B 1LJMA 3Q05A 4EOWH 4YFDB 4LHQB 1KB5B 1J8RA 1I7UA 3LKNA 4PVLA 1FGNH 4OJFL 4TF4A 1QFWL 2R23B 1HL4A 3ZK0A 4PJ8D 1X5FA 3LS4H 4JZNB 2RGSA 3KPTA 4PV8A 4LMQE 4BEIA 1WWWX 2EDRA 4S0TD 4Z3GA 3UDWA 3BUQA 4W9FC 1WC7B 3EOBB 2EXTA 2CLVB 4Y8DC 5DO2D 4JFSA 5AWNH 1Z32X 3QUMH 1CDHA 3V6ZB 4FEIA 4UIKL 3X12A 1E2VA 3ALWA 3F6JA 1YY9D 4XGZB 1OLLA 3HRZA 3DROB 1BVKA 1PJ9A 2J2ZB 4ZS6C 5ISZB 1CFTB 4X9HA 5FUOH 1Q9LB 3IGAA 2LHAA 4L3ED 4WK0B 4FKEA 4XN4A 3WE6B 1UEMA 2OR7A 5D96C 3SO3B 5IQOA 5I2IB 1QFPA 1YECL 1DN2A 3ECBA 4OFKA 4G6ML 4I8DA 3D5OF 2A7BA 1VACB 2WANA 4F93B 3IGLA 2XVLA 4IOSD 5JMRA 1U93A 1Q94A 1JV5B 1QLRA 4R7LA 4WGKA 3VGHA 2EYRA 4L1HA 3JV6A 5DVLA 1A3RH 2O26U 5E8OA 2OULB 1HHGB 2GCYB 1A21A 2P1YA 1QBLH 3H3KA 3KLAB 4MXWH 4N9GA 4XPGL 3QYMA 1HZLA 2FX7L 3MBWB 1JK9B 1WLHA 3EJTA 4XWOC 1MCBA 5I23A 1XIWC 3C75A 2XACC 3RI5F 4DGIH 1DQLL 4KNSA 4L5FH 2DH2A 2A38A 1ZLUH 3OZ9H 1K4CB 1I4FA 5EUOF 3CVIL 2YD2A 2OLDA 5DJ8A 3ZTEA 4PSRA 1B6DA 4ZFGH 2BVQA 3RPIA 4LEEA 4L4VE 2DTMH 5LDSA 1UUNA 1VGKA 3HC4L 3IAGC 1S7SA 3JUZA 1H9DA 1X9LA 3QO1A 4EIUA 5IT2H 2G3ZA 2JB6A 4PJAF 4QCIB 3BKYL 4MKMA 4N1CA 2P26A 4RISL 1G1KA 4ILDA 1GSKA 5F3FA 3SBQA 1LO3L 1X9UA 2DWXA 4AEHL 1NAMH 2ZSWA 1AQKL 3PGFH 2DQIL 3H85A 1XF4B 1JXDA 2DRUA 3EXJA 2DQEH 4ZUVB 3FQ1A 1YEFL 1CFMA 4FLQA 4HP5A 3JVGA 2H6UA 2EVHA 2NY4D 2YZ8A 4LPUA 2ZF8A 1B3IA 3M46A 4G7YL 2ILLA 2QFPA 2WINA 2EAEA 5L2KA 1A7QH 3G04B 1G6VK 3ZR5A 2Y7SA 1LEKB 5I1GH 1CE1H 5C0CE 4DNLA 5E0QA 4QUOA 4NN5B 2EYSA 2R9HD 4NDMB 3OV6A 1RJLA 3OL2A 5GGSA 4QRRB 3IFLH 1X5MA 2VAJA 4CKVX 2J55A 3G08A 3SGDI 4K73A 3CVHH 5E5UB 3C2AH 3B3IA 1D2PA 3AB0B 3CSYA 4J6IA 1DE4B 2IAMD 5JQHC 4FRWA 5E6ID 1ETB1 2WZ5A 2RQEA 3EYQC 4OJYA 3VWKC 1HDMA 1HX0A 4BRVA 3DUUB 2P80A 4MNQD 4LLDB 3ZL4L 2WSDA 4JQXA 3U7YL 3QE5A 2YN3A 3QS2A 2C3VB 4CC4A 5BUPA 1KT2A 1RHHB 4K94L 5GJTH 2DWEA 1V3LA 2AXHA 4P4KA 3S5LA 4GRWE 4HALA 4JS7A 2YN5A 4N28A 5JZ7D 1BQHG 2NNXA 2MKWA 3S37X 1A7RH 3IFPB 4MA3B 3BQUA 4R5VA 5HHPA 4Z7WF 3L7EB 1GGCL 4CN1A 3L7FB 1JOIA 1N4XL 4YHOH 1XF5A 4NKOB 3HC2A 4KQ3L 3QCVH 1WPCA 3ULUE 5E9AA 2UUDK 2ARJQ 2ICCA 5GZNC 5DWUH 3VVVA 4OD3L 3QG7L 1A25A 1HWHB 3MGTB 1RPUA 3BLPX 5IHUH 5D1QC 5TF1L 2PO6A 3VGAB 1TVBB 1YYML 2ERJB 5KVGE 5CSGA 4JG0H 2FJGA 3AQXA 1OB1B 4OZHB 2IWGA 3KLKA 3FTVA 3VB8A 3P2DA 3KGUA 4DGWC 1OM3L 3KHQA 5HVHB 1IEAB 4N85A 2E56A 4FS0A 3L95B 4IHOA 1FFOA 4GOSA 1RK1B 2BWQA 5DJXA 1FBIH 4O58H 4JFFD 4A66A 4Z7UB 4I13B 1I82A 2CGYA 3ZJAA 1Q9OB 1RLWA 1XR9B 1J0HA 2VWEE 2B1OA 4PGCB 5TQ2L 4LARL 2HRPH 3X11A 4R4BB 4JG9A 3BAYA 2CUIA 4FCAA 5GGQL 3FO9A 4WUKH 1INDH 2W38A 2WBXA 3OXSA 1KJ2B 5I75B 3I2CL 1NM4A 3W11D 1JYNA 2QGEA 4WW2A 4E9RA 4MMXA 3P40A 3QQ9C 3FT3B 3T2LA 3MRMA 2UXGA 4GBXD 3A4DA 1KGIA 1I9EA 3LHPL 4JN1L 4P2OD 4R3SB 4ZXBB 1DVFA 2VLJA 4CVXB 2WO4A 1LD9A 2H3NB 3LN5B 4AEIH 5A1AA 4PRPB 2EIJB 3MDJA 3RIFF 2IBGA 1I9IH 5DC0A 3SPVB 3IDUA 3WS6A 1I8KB 1I3GH 4LPWA 4X9YA 3E3QE 3CHOA 3E6HA 2FT7A 4XN2A 4N0FB 5BRZE 2YZ1A 4DVRL 3NAAH 4OT1H 3MGAA 1ZIAA 4P2QA 2QHRL 5AFAA 5IMKB 2XG5B 4NQDA 1PFCA 2NDGA 1SYVB 3X14B 2XN0A 3BN3B 2Z0BA 4NLHA 5HYSA 2UY6A 1E30A 1SFHA 5CCHE 5FECB 4FQJH 3WIHA 3KPPA 4RLDA 1DQJB 2W0LA 1RSFA 3PJSB 3E80A 4IOFD 5T1KB 5I8EA 4R2GC 5HVGB 4LGSB 4KJPD 1AKPA 3OMZA 4FDWA 4MDIB 4N22A 1FNEA 1AD9A 3AREA 3DVFA 3QCTH 3QQNA 5HDWA 4APQC 4NKDA 1I8MA 5AWNL 1D7FA 3K6FA 5E6SB 4DQAA 4DZBA 3HIZA 1MPAH 1YEDA 3OAUL 3QG6A 3TZVD 3NBNA 1YY8B 1B0RB 4HXBL 1JZ2A 1BGXL 1KC5H 3VX1A 3POHA 3MUUA 4GUQA 5ETUB 4AMWA 4MD5B 5FB8A 1F3DH 5CBEA 1JPSL 4U1JB 5FFOA 4HGWA 1U3JA 3QULA 3GRBA 5CIPH 3U6XA 2HB0A 3DIFA 3T77A 4W6WB 2VLKE 3F7RA 5I1HH 1HHKB 2Y36L 5KSVB 4M7JL 5DYFA 1T0NB 1TPXB 2W60A 4BZ1A 1A0QH 1EZUA 3QUYA 3RWCB 2PYFB 4R0LC 2BIQA 2OR8A 4GAGH 4R6UA 1ZS2A 2WCSA 4MZRA 3T71A 2VQ1B 4YDLC 2A4ZA 2YHGA 2KYIA 3ULVE 4KI5C 2Q3XA 2XN2A 5JXAH 4RMVA 4P05A 4JFWA 3AG4B 3BZFB 4OM1H 1OOAA 3ARQA 4PJDF 3H2QA 4KQ0A 1XR8B 1QASA 3OKNB 3P77A 3DPBB 1ZGLA 4AK1A 4E41D 1EK3A 35C8L 4HIPA 2B4CL 4NOBA 3JWNE 3L3JB 5KAQF 1AG0A 4RESB 3I74A 2CJUH 1MUJA 4HIHB 3UC2A 3BSGA 1F8TL 1DVTA 1ULVA 4Z8FL 4HH9B 4KNTA 4HJ1A 3RX7A 4M6NH 2NXYD 1X5HA 2FE0A 4I2XB 3ARBA 5DHVB 3BAXA 3B2VH 4WK2B 4OVVA 4I0PD 3ZYIA 5F0MB 2G4GA 4IKJA 1NCJA 3VXSD 4Z6AT 2XA3A 2O61A 4GJTB 2G5BB 2R0KH 2DQHH 4K2UL 2L0DA 4JHBA 4O9HH 4YBLB 1JIBA 4I9WE 1M4KA 5CMAB 2HFEB 3SGEH 5IESH 5HDRA 4AYMC 4Q2ZB 3EH5B 1R34A 2X6CA 4UUJB 1MEXL 1OCRB 3UTQA 5JHDE 2MWCA 3CDYA 2UY7B 3O0RL 2DQFB 2Z91A 4X9IA 1SQ2N 1JTPA 2FDBP 2W9EH 3B1UA 3WTYA 5I30L 1GW6A 1OD9A 5IFJA 3VMPA 1TQTA 5AAMA 2CHXA 1X7QA 3F7YB 2ZXQA 1OPOA 4ODVL 1ORSB 2GBTA 1Y0LA 3L1EA 3C6EA 2VLMD 5I74B 1RZKH 4O02H 3VW3H 2DQGL 3NEOA 1AO7D 5LGHL 3NA9H 4F27A 1ACCA 4EVNB 2C3GA 3FCSA 3U0TA 1A2YA 4X6DF 2A4EA 1CXFA 1TJMA 43C9B 4B9JA 5I1KH 5T3ZE 1EGJH 4LU5H 3PWPB 5LGYA 3VFWA 5M95B 2ESVB 1S3KH 3BISA 4OZHF 4NHUA 2A73A 2ZJSL 1FVDA 3T0VA 1HE8A 1SVBA 4JL1A 3H8NA 5LAXB 5D7KD 5JXED 1BFOB 1S7RA 5ENWA 4HOXA 1ZJBA 3DJ9A 1P4IL 1RMFL 4PRBA 4TULL 4GG6B 1IC7H 2VXVL 4Z7UF 4XT1C 1ZANH 4NO0A 2EEDA 1H19A 1WAEA 4MMZA 1PD1A 5C08A 3IMSA 4LDCA 3V7MA 3W0WE 5J6HA 2ZTBA 3DHMA 4IK7A 3ZDXE 1MCPL 2JXMA 3FB5B 3ILDA 2ALWA 1CXIA 3NFPA 4K0OA 3RKDC 2DMHA 3IDGA 4GO6B 1MFBL 3EGDA 3AABA 4L8CA 2AJXL 2AEPH 3O2VL 1SGKA 4L8DA 3LKQA 4MLSA 4XX5A 1M2VB 3GRWH 5D6CA 5D70L 4XPAH 2OJEB 3H42H 4JW3A 2VLRE 2UWEE 4L8SC 2QR0B 4Y4KC 5F0JB 3LQZA 3K71B 3B9KC 3L1OL 1VZHA 4AQEB 1QQDA 4GQZA 1C5CH 2QTEA 1WGOA 4XP1L 3RVXC 4H8PA 4GT0A 4OU3A 5CU5A 1AZZC 4JDTL 4PJIB 4PJBA 5DTFA 4G5AA 5AOJA 5F7HA 2P46B 1UGNA 3FTZA 4QF1B 4TNGA 3FUIA 1TXKA 1CFNA 3HC0B 4IDJL 4XPTH 4ZSOB 2HPTA 1CTNA 1A1OA 3CN0A 1EVUA 3AZUA 2DB8A 3FF8A 1M71B 4LSUH 1CDUA 4PP1D 3EO0A 5KANG 1GR7A 3EJRA 3FTSA 1VKXA 4Y9CA 2H5UA 1AY1H 4OIBA 1YNLH 4HS6A 1F4XH 4P23A 4LCIL 2B9BA 3PPEA 3CH8A 2DQ6A 4RIRA 2A9AA 1JMZA 5FYLE 1TEFA 3L9RA 5DS8B 5E9NA 3RFZC 3B7YA 5AVZB 3N44B 4YSRA 1PZAA 4OJFH 5ADOL 1QFWH 2F7RA 5F88A 1D5ZA 5I9QB 4K71C 4YDJB 1GXEA 1W72B 3EOAB 5EC2A 5LB1A 2H4EA 3TEXA 1T5XB 4A7GA 2AQTA 2CBMA 3FAWA 4C56D 3DXAD 3S3CB 1LLAA 1UD3A 3G6JE 5F9WB 3SYPA 3N43B 1EZVY 3MSPA 2OMZA 4UIKH 1Q90A 3BT0A 2JIXA 2EE3A 4PWFA 1SUHA 2HTLD 3DURB 3QJUB 1MWAL 2WZ0A 2YUVA 1QA9B 1ZS8B 2CLZB 3UGEA 2F5AL 5C0FA 3PGDB 4DP7X 1SDYA 1YECH 3VXUD 4QRQB 2DYRB 5F1OB 4D8OA 4YS4A 4G6MH 4U1KB 4ZPVB 4WHDA 4AK2A 2XN9D 5I0DA 3VI4E 5K1NA 2HWZL 1TKWB 2JJWA 4FXGC 3FRUA 3ZDWA 4FXLA 4JBSA 3NVQA 3ZDZE 2F53A 5ITBH 1ADQL 3QEQB 3HE7D 3L5WB 4XPGH 4YGAB 2WUCL 4F58L 2FX7H 4NIKB 3NCCB 1DQLH 3NP4A 2F7OA 3B9VA 3CSFA 4QRTB 1U3YA 4WHYG 4HS3A 4B7LA 3CVIH 4LKCB 1NFAA 1ND0B 1A1MB 3GS7A 1YUKB 1HHJB 4BQ9A 4Z76A 5IKCB 4LASL 5C97A 2E3VA 5ABZA 8PAZA 1HSBB 4Z5RA 3HC4H 3LZNA 2EIZA 3FQTB 2YARA 4OQ1A 3AT0A 5JUEL 5IJCC 4KKLC 2DZEA 3ABMB 5JHMA 3BKYH 4EN3B 1J9TA 2R2BB 4L5FE 1IIIA 3KYMA 4RISH 5L4IA 2Q7YB 4D9QE 1LO3H 4GSDH 3TWYA 3ARFA 1FVCB 3RTQA 2WOBA 5IB3A 5EU6A 2GSIB 3IAQA 2FIKB 1AQKH 3MTRA 5AZEL 5CFAA 4X6FA 2X28A 3KCWA 4KI5E 3QP3A 2DQIH 1DSYA 4L4JA 1AHWA 5E95B 2J6EL 4DJMA 1U8OB 3G6AA 1HXMA 1ONQB 4PBDA 3RUGA 2MHAA 1YEFH 2FLBT 4XHQA 1I7UB 1FO0A 2B1HL 3LKNB 3QXAA 2IXQA 1TFPA 4IRZA 4F8PA 4N1EA 4G7YH 4XVOA 3BPCA 3UG3A 3C6LC 4PV8B 2ZYIA 3D0LA 5D71L 3GFUA 2CMRL 1JHLL 2VKXA 3ZKSD 3CDCA 3L5IA 3DVGB 3NK4A 3ARGC 3ES6A 3KWVA 3X12B 1J9SA 4EKXA 3VDBA 3CXFA 5GGTA 2EINB 1QUNA 2NSQA 3KS0J 1A6WL 2BVTA 1BD2D 3HRZB 3BEVA 1BVKB 1RP8A 2Y6TE 3C6SA 3LYRA 3IRPX 5HVWA 3IGAB 5SWZA 1RZKC 5KBNC 2OQJA 2VN6A 2GYSA 3ELAT 5EU3A 3SKUD 1RK0A 4HPYL 5FM8A 2G30A 3NH7H 2GK2A 2OCCB 3HR6A 3RIAK 3RVVC 5EDSA 3QA3A 5AW3B 2Y3AA 3VG0L 4GG6F 1U93B 1Q94B 4LHUA 1XGQA 3ZL4H 4YX2L 3U7YH 4ZMXA 2EYRB 2XN1A 3F65A 3JV6B 1R24A 4K94H 3Q8EA 2AEOA 5A3IC 5E8OB 1DCEA 5LO7A 4FJZA 4FG2A 4N9GB 4TLUA 3SE8L 1GGCH 2CIKA 1N4XH 1OHQA 3RHWK 4M5SA 2GPZA 4KQ3H 4ZDHB 1I4FB 4HWBA 5E23A 3D9AL 3L9BA 1J8HA 4KJQC 1AQMA 4TVUA 3O4LE 2EEXA 5DJ8B 4B9IA 1A6UL 3NIGE 2R4RL 4OD3H 4YXLL 2BVQB 3MV9E 3QG7H 4BM7A 4J8RA 3FUFA 3K91A 4KZ0A 3VFTA 4QRPD 1GYWA 2HT4D 4HJGA 4N1HB 5TF1H 4WO4C 4NUQA 1S7SB 1QWUA 1YYMH 3QO1B 3UTOA 1F6FB 4DEPC 1T2QL 3ZX1A 1IRAY 4N0UA 3FZUD 1OM3H 4Z3HA 5D4JA 3O6FC 2NSXA 2FH8A 2OMXA 1UCTA 1XSOA 4LCVA 4HMCA 1XZ0A 3MFGB 4PJIF 2ZSWB 2X53A 4M5ZL 5E94A 3TO4A 1V27A 2WP3O 4QAWA 2OK0L 2I32A 5TQ2H 3WFBH 4LARH 5LNGA 4XNUL 1DQDL 5TDNB 5IEKA 3LNDA 4E0RB 5GGQH 3REVA 1IIKA 3TBTA 1J48A 3WIFA 3AWGA 1F1GA 4DEWA 2H0PA 3I2CH 2PXYC 4MJIE 3NSDA 2V8LA 4ORZC 3RWGB 2WINB 2AERT 2W94A 1AR2A 5L2KB 5J13B 3APCA 1XXFC 4HULB 2APVA 4XXDA 5GRVK 3LHPH 2WLZA 4UQ2B 4YHZL 3VYNA 1ZHBB 4HT1H 2DQUL 4X0KB 4ELMA 3PDGA 2XWJB 3WV0A 3QIUD 3N44F 1CC3A 4HMDA 4OR1A 1RJLB 3H9SA 1JVLA 1UHVA 2PYEE 4QHKJ 1X9QA 3BCDA 3G08B 1SJXA 2GT9B 3B3IB 4JFHD 3CSYB 2CR3A 1HYRC 4JFEA 3FT2A 4DVRH 4MNGE 2QHRH 2AK4E 3N43F 4Z7QB 1ZVHA 3GSRB 4LPYA 3BFOA 4GPVA 4PJ8C 2LOEA 5EU7C 2WIMA 4PWJA 4TUOA 4UZUA 3NTCL 4E36A 5E9DD 3ZE0B 4AW7A 5I24A 3MLZL 4EUPG 5KW9L 1MSPA 1JS4A 3KWWB 1KT2B 1QR4A 2DWEB 3NZSA 3S5LB 2ZUQB 4P4KB 2VZ3A 2NYZA 5DO2C 1ZTXL 4GIPD 2EKSB 5HHPB 3BQUB 5HDQL 1TMCB 4NPYA 2A6JB 1YY9C 3NDYE 4BINA 2C1PA 3F2LA 1XF5B 5H4ZA 1DQTA 1IB5A 1CTOA 1R3IL 1X5GA 2E6PA 1NWPA 3CWGA 4LKXA 4QTIL 3OAUH 1SY6L 3Q44A 5DMGD 2F7IA 4PJ7E 5A2LH 3SKMA 2D2CC 4HXBH 2D3LA 4IS6A 3DC0A 1YLBB 1BGXH 1LE9B 3ZBMA 2Z8VC 5C07D 2YJLA 2PO6B 4QRUA 5DMJB 2FJGB 3NPSB 1BYOA 4YSSA 3V8OA 3W37A 1JPSH 3B2UD 1MCIA 2EDHA 1F6AA 4WW1A 4E9XA 3RNQA 2E6JA 2DIEA 2J56A 1FFOB 3O3DA 2Q2LA 2Y36H 5DJXB 5GS2D 3FHQA 2I9LA 4Y16D 3RVTC 3NCEB 4M7JH 1SEQL 2IOIA 3SN6N 5T1LA 4WJKB 2E27L 3EYOA 2L3BA 2NSMA 5GGSY 2UZIL 3X11B 1NDMB 1OPGL 5E6YA 4IBQA 1DJIA 4MJ5A 2VQ4A 2JNZA 4FFZL 3FO9B 4G8GB 4WV1A 2OXGA 3OXSB 3OF6A 4WW2B 1HEHC 2FEJA 4HK0B 1YEEL 4MMXB 3TH4T 4F9LA 1TQCB 3ZDYE 4G82A 4QYAA 1NCDL 3FCBA 4PWKA 3UCQA 1JV2A 1BIIA 5DVMA 1DVFB 1II4E 1LD9B 1PG7X 1OEZW 3JVFC 5GJSH 1NMCC 4MZ3A 3VFMA 4NNYA 3QQXA 5BXFB 4L1LA 2VITA 2TSBA 4EDWL 2X1QA 1AVAA 3FOLA 2BNUA 2F19L 35C8H 2B4CH 4J3XA 2FJFA 1BF2A 3E6HB 4WI3A 1FYTD 4PJ6A 1PYWA 1F8TH 1HT6A 4M7ZB 4P2QB 4Z8FH 3GZQA 1VSCA 3PWJA 2NY4C 5F7YC 4NQDB 4JY6A 1BW8A 1CZ8L 4C54A 5HYSB 2UY6B 3OJMB 5EO9B 4PJFF 3SCMA 1TTGA 3QIBD 5CUSL 4TNVK 5I66B 2D7NA 4PI2A 1MVUA 3VD4A 4YAQA 1IKFL 2F18A 2IOMA 2QQLL 4JE4B 2PW2B 1OGTA 4K2UH 5I8EB 3GT6A 4BUHA 2R9HC 3T04D 5I15L 1DLHA 2G3XA 2YK1L 4ZX5A 1CQYA 1FNEB 1MEXH 4F20A 1AD9B 2X44D 3AREB 2RA1A 3CFUA 3O0RH 4YFLI 4F2EA 3B37A 1I8MB 2EACA 3PJLA 5FGBC 3AM8A 4X6BB 5I5MA 4DZBB 1ZCRA 1NIBA 5GS0L 1YEDB 5GS0D 1GZPA 4JCMA 2IAMC 3OSKA 5E6IC 1LO5B 1DQKA 2RHEA 2X40A 4JN2A 4ODVH 4XE0A 4YK4C 5CBEB 2ICES 4OCNC 3N2JA 4HGWB 4RCAA 3QULB 2DQGH 4G6FD 4K94C 1RJZA 2LLLA 3CDFA 3DIFB 5LGHH 4BH7A 5KVEH 4UF7C 2Y1YA 2WBWB 5JZ7C 3P73A 2R83A 1NAKL 2ARJA 1OE3A 2W60B 2Q76A 5SWQA 1F56A 2K45A 4WHTB 3G3LA 3QUYB 5JW5A 4MAYD 2BY2A 2RACA 4BKLA 4DO6A 2ZJSH 3STZB 1FZKA 1QKZL 4XB8A 5F2FA 3CLWA 1P4IH 1RMFH 4TULH 3UAEA 2VXVH 3TN0D 1CLOL 4FCHA 3WNNA 2CRYA 4MCYB 4KKAD 2OMYB 4AGLA 1OQXA 1MVFA 4FG6D 3FFCD 5CJ5A 3P77B 2XWEA 1MCPH 4GAFB 4IRSD 2ZG3A 1ZGLB 1HYSD 2JE8A 3F85A 3IMVA 5HI4D 3HMXA 3QORA 4U31A 1JGEA 1MFBH 1BA9A 2ZKHL 4KFZC 1MUJB 2AJXH 4OZIE 5LBGA 3O2VH 5I16A 3DMMD 2P44B 5L7XL 3ZGIA 1DR9A 1NDGA 5FYJE 1OGAD 3F3HA 5D70H 1EQWA 3W11C 4GW4A 3ARBB 4N0RA 2WZAA 5F1SA 2PF6A 3TYGL 5J8OA 5ESQA 3CPLA 3L1OH 4PHZA 2E76C 4GBXC 3NJJA 2C9XA 4P2OC 2O61B 4XP1H 1NCHA 1RUKL 2ZOOA 1DQIA 4CA4A 5FDWA 1HAUA 3R8QA 1SJEA 4JDTH 5CCKL 5D7HA 2EDQA 2VZSA 5TGBA 4Z7QF 3UTQB 4KKQA 4GI6A 4Y88A 4IDJH 4CILA 3QDMA 4J8QA 4AX3A 2XIDA 4CSZA 1JVOA 4F7CA 4CKQA 4HJSA 1PF3A 5TTRA 5I0WA 2XWDA 5IBLD 3WNJA 1YPZE 4E9QA 2BW4A 3DTUB 4JPSA 1PY0A 1X7QB 3MA7A 1J86A 3KGTA 4YOKA 2ORBL 4P9HL 4ZS7L 4LCIH 1Y0LB 3T3PB 5BQ7B 4OQTL 3BJ91 3OKKA 3BLKA 1WBXA 3NSJA 5IHWA 3S3JA 3T0DA 4IOFC 4C8XA 4FJYA 4O2FA 2GEQA 5ADOH 3U0TB 2QGDA 4WNQA 2APBA 4HH8A 2VERN 4KJPC 4Y5XA 2F54A 3NJFA 1UXWA 3O3UN 4KHXL 4K5OA 4MXVF 5FUZH 1I1AD 3SGJA 1P6FA 3LVTA 3ZHKA 2LW3A 1F3JA 4TL4A 2Z35A 4NHUB 5C0BB 2VUYA 2ZOUA 4GG8A 3TZVC 2Z31D 3Q0HA 4PRID 1GYCA 1S7RB 5ENWB 3HPJB 5HJDA 1HOCA 3F64A 1MW1A 4PRBB 1KBBA 1U8JB 5A2CA 2KS0A 4OZFH 2E46A 3CZSA 1EFXB 4NO0B 5I0YA 2Z93A 2AS5M 3WTSA 1MWAH 1HXYB 2P8LA 1XF3A 1P4LA 1T1XA 1QD0A 4MMZB 5J6GA 1EHXA 3KJ6L 5C08B 3S8GB 2F5AH 1YN6A 3T5WA 4BFRA 5J6HB 1RPKA 5HJ3A 3TOPA 2Q2EB 4OF8A 4YVNA 4PR5A 2EC9U 2LAAA 3KH4A 3NFPB 2HWZH 4JO3L 4D7PA 3IDGB 3P1VA 3BI9X 3TNNA 3PP4L 3H6JA 2ITEA 3ILEA 3EGDB 3OPUA 3TCXA 2WXRA 3ZKND 3WELA 2O5XL 1ADQH 3NA4A 2I5YL 3LKQB 4L8DB 5B38G 3BPOC 2H3XC 5D6CB 1TTFA 3BUDA 2D9QB 4CVUA 2WUCH 4F58H 1OSZA 3V4VA 3T0EB 2VDML 4H13C 3DRTA 3LQZB 4NX0A 4B9FA 4C58B 4EI5A 1QQDB 1V54B 3LRSA 5AUMA 2VJ0A 1AI1H 3LJ3A 3V8CA 1NCWL 2XKSA 4LASH 4MWFA 4PJBB 5JDJA 5IF0A 5DTFB 2QPFA 2JMRA 3KWXA 4BFNA 5JUEH 2X4SA 3UROR 1SNRA 1A1OB 2OAAA 4UOJA 5E03A 2EDLA 3EO0B 2UXFA 4QY8A 4AC4A 3ATAA 4WGWB 4WUUD 1N5YL 4IK6A 1VKXB 2F5BL 2HFTA 2P5WD 4HS6B 3UTZA 2NXYC 4UTAA 4P23B 4UM9A 1WAAF 5AZEH 4ZG1A 5J11B 2OL3L 4I0PC 1WZMA 4RIRB 5F7KC 1NBYA 4CJ1A 2J6EH 1PLAA 2Y0SA 3L9RB 2EH8H 4LSDA 4B7IA 1PLCA 3FS9A 3QB7C 2B1HH 1XH3A 1A9EA 1CL7L 3PRZA 4JRXA 1D5ZB 5AB2A 1CGXA 1PKQE 2FNBA 2JJUA 3O3BA 3ZYOA 3D39E 3VCLA 1C16A 3SPHA 5D71H 3Q2LA 2CMRH 2NXZB 4TLKA 1JHLH 3E0GA 4CL7A 3SYQA 2ITDA 3ME0B 1SQMA 1ZPLA 4BWWA 2OMZB 3C5JB 3KJ4B 2JIXB 1XB3A 5EUKA 5JPMA 1WV7T 4GH7B 4CDHA 4L4VA 1A6WH 2P47B 2CM6A 3TURA 1ETA1 5I76B 2K6ZA 5FX3A 3VWJB 3LVEA 3NCMA 3QBTB 4YNYA 2VJ8A 5EOQL 2ODHA 3IVKA 1BEYL 5E08L 3AAZA 3B8YA 4HPYH 4JZJC 2HMID 2FEDD 1P9MA 2GIMA 1SLXA 2V8MA 3VG0H 5GXBB 1FF5A 5L0QC 2QADB 3FRUB 5EO1A 4YX2H 1SF3A 3WAKA 5K59E 3VUAA 1CG9A 2EEBA 3WY2A 5EIIG 2F53B 1SLVA 1UURA 1G4RA 3EJYD 1KJMA 1MW0A 4JQVA 4JL2A 4AW4A 5JXEC 2B16A 2WSPA 4JFDA 5LBSL 4ZZFA 5GRUL 4R4ND 3CC5B 3SE8H 1KXTA 2HG5A 2IGLA 3S37L 1YYLL 1F4YL 2VE6A 5HDBE 1GS8A 3ZE2B 5EN2A 1EZVX 3TEWA 4YN3A 3D9AH 3PV7A 1CK0L 3IMRA 4HS3B 4HCIA 2BMKB 4BA8A 1A6UH 4YXLH 5HYEA 1CS6A 1K3IA 2X87A 4Z5RB 5IV2B 1UACL 2EIZB 3VFUA 5AG9A 2J8OA 3PLYA 4BFKA 1BYNA 1T2QH 2ZPKL 1BMZA 5FUCC 1TQSA 3KYMB 4XOCA 4U7MA 1N59A 5IB3B 3ARFB 4XMZA 3RTQB 3QQ4A 5EU6B 1G7LB 3AUVA 3VFPA 1BAGA 3IJHA 3ENEA 4X6FB 4M5ZH 1AR1D 3VXQA 4Y2DA 3NMEA 4LB8A 5KG9A 1AHWB 2OK0H 1D2OA 3BSHA 3EZ8A 3GDCA 4QHLB 5I1EL 1WIUA 2HAZA 4XNUH 1HXMB 1DQDH 3QFDB 5TDPA 4J12A 3HG3A 5E8DL 3RUGB 4K5NA 5SWSD 1QRKA 1FO0B 2WJ5A 4J3VA 4XNMA 4CDGC 5GZOA 2IXQB 2NNAA 4U49A 2OR9L 4I3GA 5CWSA 5DZVA 3BPCB 1ZXQA 4U1SA 3P30H 3CHXA 3D0LB 1J5CA 2DKMA 5D5ME 3T3PF 4A55A 2I9TA 4Y5YC 1U2YA 4YHZH 4EZLA 5D6DA 3MUGA 5GHWL 2DQUH 4PP1C 1UA3A 5JIIA 3ES6B 1FCCA 1WS8A 2FGZA 2XA8L 3HHRB 4JFZL 1DBJL 1QUNB 1TQVA 1MFAL 1JHTA 1I85A 3BEVB 3C6SB 1GC1H 4OGYL 4OZFG 4KGLA 1Y1UA 5SWZB 1IFHL 2OQJB 3HR5B 3TBSA 4HJEA 5EU3B 2Y6SC 1RK0B 3RX5A 5HY9A 3QA3B 1N5AA 4Z7IA 2BW5A 5FM5O 5KYWA 3MJ8B 1D5RA 4IRJA 5GRWA 4H88L 1KPUB 1JF1A 3UJTL 1SOXA 4YE4L 4LHUB 4W9IC 1XGQB 1VEOA 3NTCH 5H37G 2V33A 3MLZH 5KW9H 1RL1A 4QKTA 1R24B 5L88L 5B1JC 3OAWA 4A7VA 3QPKA 4DUWA 3AUWB 4QMEA 3WJLA 4H2AA 3GSUA 1KOAA 2M1KA 4P2RD 4J5VA 1ZTXH 3BWUF 3GQFA 3SDAD 5HDQH 3T6QC 1TJGL 5E8EA 2CIKB 2NR6A 1IAII 2HTLC 1B3JA 1DSFL 2DI9A 4ODBD 3EO1A 5F7EL 3ZKMD 1R3IH 1J8HB 4QTIH 5EPMA 1C5BL 1SY6H 2EIBA 3BIKA 4LCCB 1FZOA 3MRFA 4I4WA 4TNVF 2LGNA 3E1F1 4K23L 1PEWA 3VFTB 5GGVY 3S35X 4TM9A 1E7VA 4YBQD 4EQ3A 1IBHA 3KLQA 4OTXL 4JM0A 2K9UA 5JPNA 2XWCA 4LL4A 4P5TA 4N0UB 1BQUA 3QJFA 1U8QB 1IGYA 3CBJB 1KXHA 2OMXB 3R4DA 3PUCA 2BNRE 1NKGA 4YPJA 3HE7C 5BRZA 5GS2H 1XZ0B 4HIXL 4PJBF 5D72L 3ZE1B 1SEQH 5E94B 2J20A 3K2IA 3TO4B 2E27H 3VDCA 2DL9A 3RZCA 1PZUB 4J39A 5K9OB 1QFUL 2UZIH 4KDVA 4UT9L 5IVZA 1OPGH 4GI9A 1FI8C 1O75A 5IEKB 4KO6A 2IH8A 3REVB 4FFZH 4FQCL 2WB1A 3WIFB 3WENA 2ZSVA 3JWOC 3OLEA 1UJ3A 2IADA 2Y1ZA 1YEEH 3KD4A 2EJ1A 4KQ4L 2AJZA 1V3JA 2QKIC 2CNYA 4HHWA 1D5MA 2WWMD 1NCDH 3SYCA 4Q6IA 4HUWA 4KJYA 1NMAL 4ELMB 5FYJU 4LAJH 2VC2B 2C9QA 3D30A 5B1KA 3H9SB 4BCXA 1T83C 3QJXA 5ESAA 4UB0L 3EHBD 5IZ7A 4KX7A 3MRDA 3ULAB 4HWUA 3P4MA 5KBMA 2YD5A 4A7GF 2G5RA 1L5GA 4G1MA 1LK3L 5AVRB 4JFEB 4OCWL 3FT2B 5BZZA 2WGNB 3BSZL 2N0KA 2VLKA 4MJ6B 2CKBL 1CZ8H 1URZA 2HYMA 3LEXB 4TUOB 4V1DD 4E41E 3CE1A 3QUXA 3VRLF 5CUSH 5BCAA 3HZKA 5D93C 1IKFH 2QQLH 5DS1A 2B2XL 1A3QA 2XFXA 1Z5LA 5DC9B 1D7CA 5I15H 2YK1H 4UIMA 4NPYB 3JV0A 2LE9A 2VXQL 3QXVA 4FNRA 4KK6D 4XCEA 5DZOA 3U0PA 3UX9B 3T2QA 2IV9A 2NZIA 4WJ5A 4S0HA 4LKXB 2N0MA 4EO5A 2Y9RT 1B4LA 1U91A 2OV0A 3P3TA 3TIEB 5GS0H 1UKQA 4F7MA 2R29A 2WQSA 3ESOA 2VRQA 3SKMB 4NAJA 4IS6B 3GM0A 4RAUA 4IM8A 1BXAA 4RSVA 3PDDA 4DP6X 1UD8A 3CFEB 3V0WL 3EF7A 5KVMC 1QOKA 3IDJA 1N7ML 5DUML 3R7RA 5CD5D 5J1TC 2X3CA 1X9RA 1XIWA 1PTZA 2YFNA 4JQIA 4WW1B 4YZWA 1S6NA 3MBED 3UZQA 2WKOF 1RUML 3RNQB 3WAJA 1MZYA 2ED9A 5AL8A 3C5ZA 1IBGL 4ZNEE 3QUGA 3B7TA 4KPHL 3OG4B 1NAKH 2I9LB 4PG2C 2YD4A 4JEGB 2XFGB 4PGDB 5T1LB 3EYOB 4AMKL 2HN7A 3FQWB 3W81A 3TJHD 1WT5C 2K3HA 5B3SB 3MX0A 4ZUUB 4MJ5B 2VLME 3O41B 4WV1B 1QSZA 2BFGA 3QH3A 2OXGB 3RBGA 4BFOA 1AO7E 1QKZH 4XH2A 5KVEE 2A3TA 1CVSC 2HT4C 5IW1B 3K6SA 4GAAA 1MI5D 1C8PA 1CLOH 1MIML 3AXIA 4KU1A 1XGZA 1BIIB 4I0CC 4KMLB 3RA7L 3VMOA 3FZUC 3LZOA 3RUGF 2VR9A 4NNYB 3L4WA 5BZDA 2VITB 4OV5A 1U8PA 5EOCJ 2X05A 4QWWD 3E6FA 1A8ZA 3P02A 2BNUB 4DP0X 2HX7A 3OX8A 1JP5A 2FJFB 3CU7A 2ZKHH 3TNMA 4WSJA 3K8KA 1PYWB 2GBVA 2PR4H 3IXAB 3MV7D 3MZTA 5IMLA 5CD3B 3MZGB 5L7XH 3ET9F 1R3HB 4G9FD 3PWJB 1HCZA 4BGLA 4JY6B 4DCQA 2WLLA 1LHZA 5FIEA 3TYGH 4OCSL 3UAAA 3CIQA 3SCMB 2WNXA 3IU4L 5I1LA 2VXUL 1NCGA 1SHMA 4J27A 1RUKH 2EABA 1NBVL 4H1LG 5CCKH 2J8UF 3QIUC 2XNAA 1DLHB 3CUPA 4ZOCA 2A9BA 3LRKA 5MEND 4DFHA 4FE9A 3N42B 1GC1C 1HESA 3RBSA 2OI9C 4EUPB 1KCSH 4LLWA 4M1GL 3HI6L 1VCBC 1GZPB 4W9EC 3OHXC 2KBGA 1CFQB 2XTJD 5GRYA 1KGCD 2VSMB 2IAAC 4XPBL 3W0WA 2XQBL 2DN7A 2VDPB 4X6CF 1MFNA 4JN2B 2NUPA 2EE9A 4P9HH 4ZS7H 5JIPA 4H25B 4RAVA 1UFGA 4OQTH 4FQXD 5C09A 4FNUA 3UO8B 3ZR6A 1RCYA 4XN5A 4WFGD 5LNDA 2LQRA 4L9DA 1W0WA 3BAWA 3P73B 1FFNA 5DZNA 3FT4B 1HN1A 2ARJB 4KKBD 3WY3A 5SWQB 2Q76B 3BZEA 2UWEA 3MOQA 4KHXH 3V55A 1MELA 1F42A 2CJ3A 1QLFA 4QHMA 1PU0A 1QAWA 1XCWA 2DI8A 2DLEA 2J73A 5JW5B 4BKLB 3O6LL 2QV4A 5DMGC 2FH6A 3N0AA 1FZKB 1NA8A