4AQYL

Structure of ribosome-apramycin complexes
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aqyL00
1IBKL 3HOYG 3OTOQ 2WAQE 4A3LH 1XTDA 5C3EH 3RZDH 2Y0SE 4L5QA 2B63G 4LFCL 1VQOA 2NVYH 3UDXA 1WFQA 3F8TA 3S2HH 4PZ7A 4DR4Q 2UXDL 3K7UC 3GTKH 2UU9L 4QY7A 1C0AA 3F2BA 1PH6A 3VDYA 4POFA 1HNZQ 4DR1L 1MIUA 1GVPA 2ATWA 1Q1BA 3CCJA 2JA8G 1KRSA 2VUMG 3PUWA 4A3IG 3J80i 1N36Q 2ZJRA 1N33Q 5JJIA 4DUZL 4X64L 2JJQA 4EQ5A 4LFAQ 1BBUA 1VQBA 5C0XG 2YTYA 3A5UA 3T1HL 5FJ8H 1PH8A 2JA5H 4LF7L 1AE2A 1HNWL 2OTJA 1I5FA 2JQOA 4B3SL 4DR6L 2XTIA 4OWXB 3U58A 1VQEA 3FKIH 4POGA 1OXVA 2AWOA 2WB1G 1VCIA 3HOXH 2E2HH 1XNQL 2BH2A 1D7QA 1CSQA 1K8GA 3I55A 1YBYA 4HJ9A 2R92G 4LW1A 4JI6L 1TWGH 3GDEA 3U4ZA 2JA6H 4A3GH 2D0PA 4A3BG 2VW9A 1KC8C 1VQ8A 4A3JH 3J81i 2OQKA 5IWAQ 3NBHB 3T1YQ 1EQRA 4QQBX 3H0GH 2CWAA 4APVA 3RNUA 3HOVG 2JEBI 3OW2A 2R7DA 2FXQA 3EBEA 1B8AA 2Q2IA 3KDFA 4KI0A 1YHQA 1QZGA 1GKHA 5C4XH 5C44H 1Y1VG 3PF4A 1QVFA 2JA7G 1DGSA 4J15A 5JEAG 1IBML 2R6GA 4C3IH 4DV7Q 4LF6Q 3CC4A 4JBKA 2AWNA 4L5TA 2UUBL 4BY7H 1LM0A 4A3KG 2E8GA 1B7YB 4QL5A 4JBWA 3RR5A 4DR2Q 2ZJPA 4DV0Q 3AQQA 1X56A 3F2CA 2EXDA 2UXBL 4DV5L 3UDGA 3E0EA 5ELOA 3F2DA 2UUCQ 4C3HH 2B63H 1QUQA 4X65L 2MO1A 4OO1G 4RMFA 2WFWA 2PQAA 4OWWB 4DR7L 1UE1A 2WB1E 3FP9A 3CMEA 1VQMA 2IX1A 4Y52H 2YU9H 4A3LG 5C3EG 4YWKA 5M5XH 2E2JH 2R7ZH 1IXRA 4JBJA 2VS1A 1EIFA 2A19A 4PG3A 2JA9A 1PH1A 1YHBA 1X65A 5GROA 1K0RA 1YHAA 1SLJA 2V1CC 1EIYB 2ES2A 1JT8A 3GTPH 5JJLA 3HKSA 3H3VH 3S16H 4P73A 1BVSA 4YCUA 1K3RA 2HHHQ 3J80c 1NE3A 1OTCA 3K80C 4A3DH 4DNIA 1X3GA 3ER0A 4GS3A 5LMUQ 2GVBA 5AJ3Q 1BBWA 5DLQE 4YWMA 1XMQQ 1Q8KA 5IYCH 4A3FH 3W1BA 2N3SA 5M3MH 4DPGA 1YIJA 3PUZA 3CMAA 3TREA 3I56A 5K36G 2JA5G 4UP9A 5FJ8G 2BA0A 5C4JH 2DGYA 4IO9A 3RN2A 2UUAQ 3I4NH 4A3BH 1IZ6A 1FVIA 1G51A 1N34L 1Z9FA 3PSIA 2ALYB 4R1JA 1UE7A 4A76A 3FKIG 2F3IA 3RLOA 2LXJA 3HOXG 1PHJA 1VQNA 3LGJA 4HIDA 3J81c 4JV5Q 2PI2E 3EIVA 3HOZH 3K7AH 4KHZA 1FJGQ 2JA6G 4A3GG 5GAEC 3S15H 4JI5Q 2K4KA 4KHPL 4A3JG 5ELNA 3ICEA 4PZ6A 3M4OH 1JJGA 3H0GG 1E3PA 4LFBQ 1Q1EA 5GAHC 4JI0L 1VQLA 1S3OA 4LFCQ 2PNHA 3NENA 2RHSB 1H95A 4JI8Q 3PO3G 2UXDQ 3TQYA 4O2DA 1TWAH 5C4XG 1TWHH 5C44G 2VQEL 4YWLA 2ASBA 2AMCB 3FHWA 4A3CH 4YY3L 1D8LA 5LMNL 3PUVA 4DR1Q 2K5NA 2JK8A 1WI5A 4NPSA 1CKNA 4R4IA 3SGIA 5GAGC 4AYBE 1SROA 4BY7G 4R4OA 4OX9Q 1TWCH 4DUYL 2ZM6L 2I5MX 1NMGA 4A3MH 4DV4L 2KHIA 3I7FA 3M4QA 3MXNB 4GLVB 4LWCA 4X64Q 4GNXB 4HIOA 1Z47A 1Q12A 1CUKA 2N49A 3T1HQ 3PO2H 4HIMA 1HNWQ 1SR3A 1VS0A 1WOCA 1M90C 4LF7Q 3RZOH 2CWPA 2VQFL 2C35B 2E5LQ 3HOUH 1LUZA 1HZ9A 2KCTA 1MKHA 3M3YH 4IJHA 1TWFH 3J7A5 4ME3A 3F1ZA 4OONA 5EAYA 1KHIA 4DV6L 2KCMA 3U50C 1SFOH 2IHEA 4JI6Q 3DM3A 2R7ZG 4LF4Q 4XTCS 1HZCA 1EFWA 1QVCA 4JI7Q 3M85A 4LF5Q 4MTNA 5J3BA 4IOCA 3MEFA 1RL2A 2IT1A 1I6HH 4LF8L 3OYYA 2LSSA 3AYHB 3CF5A 2K14A 4YCWA 3CCVA 1ASYA 4A3DG 4P72A 1CKNB 4TQUS 4GKKL 1IBMQ 4B3TQ 3S2DH 3AEVA 1PH9A 2K5VA 1JJCB 2VL6A 5IYCG 4A3FG 1VQ6A 2IY5B 3RLFA 2N78A 5M3MG 5BR8L 1KIXA 1JJ2A 4X62L 1J5EQ 1XPRA 3JAMi 3I4NG 4DR5Q 3E9IA 4IPCA 1U0LA 4B3RQ 5IYDH 2UXBQ 4DV5Q 1X6OA 5FLXc 2GVAA 1HZBA 2PMZE 4DK6C 1VQAA 1YVCA 2MNAA 4LNQA 4BXXH 4X65Q 1HZAA 4YHHQ 4O0AA 3PO3H 1VQJA 1FGUA 1P16A 2HIXA 3WWVA 3G4SA 3HOZG 4DR7Q 1CSPA 3D0FA 4JI1L 2HIVA 2I5HA 2UXCQ 1V9PA 3GTMH 1YJWA 2PI2A 4HJ7A 1XMOQ 3TS2A 4GOPA 4MNOA 1NJIC 5HGQA 1PYBA 2CKZB 1PH5A 1YNXA 3GTLH 3G48A 3S17H 2NN6G 1P8LA 1HH2P 2HQLA 4GOPC 4LF9L 4A3CG 3U4VA 1KL9A 3PGZA 3CCLA 3GD7A 2CQOA 1Q82C 1N36L 3UDFA 4IFDG 1NY4A 4QIWE 1SE8A 1YITA 3CQZH 4NXNL 1VQPA 1GD7A 1WJJA 1EQQA 1I94L 3K8AA 4A3MG 1VQDA 1KRTA 1YI2A 3G6EA 1JMCA 5IP9H 4LUVA 3PO2G 1EYGA 2K52A 1NBWA 1N32L 1MJEA 4WJ4A 1N34Q 3HOUG 5C0XI 4MZ9A 3CCUA 1JE5A 2CCZA 4P75A 3GTJH 4B3MQ 1XNRL 1K83H 1CKOA 3T1YL 2D62A 3A5ZB 5IE8A 4AYBG 3CCSA 4ALPA 4DAMA 4JYAL 4KLKA 2Z6KA 1BKBA 4P71A 4GOPB 4AQYL 4NXMQ 5E7NA 3HOWH 4WJ3M 4DV3L 1L1OA 4JI0Q 1VQFA 2ZJQA 1RIPA 2K50A 2Z6KC 4QJFA 4GNXA 4JI2L 2VQEQ 1AE3A 1L1OC 2VY3A 4YY3Q 2JEAI 3JC66 1PA6A 4X66L 1LTLA 1NMFA 3JAMc 4GNXC 4GN3B 3STBD 1EWIA 4DUYQ 1S72A 3GTOH 4A93H 2UUCL 3L0OA 2YTVA 3EN2A 3M9BA 5C0XJ 4DV2L 4P74A 3S1RH 1K8AC 1IBKQ 1LYLA 1X55A 4UY8C 2B3GA 5IYDG 3CD6A 5JJKA 4UP7A 3KLWA 3PIPA 4DR3L 1T9HA 4BXXG 3ULJA 5GQOA 1X3FA 1L0WA 2VQFQ 4DV1L 1E1OA 1EUJA 1X54A 3IRBA 4JCVE 4BBRH 4DKAC 1KD1C 2KHJA 3Q8DA 5FLMH 2VNUD 3HKZG 1KQSA 2UU9Q 3PCOB 3S1QH 2A1AA 4C2MH 4GN5A 1E1TA 2QA4A 4GKJL 4DV6Q 5HY6A 4JG2A 1XPUA 3CAMA 4K0KL 2LXKA 3PIOA 1L1OB 1VQ5A 1W3SA 2EIFA 4DUZQ 1C7YA 2Q2UA 3STBC 2KBNA 5LMUL 4JI4L 4JI3L 5AJ3L 4LF8Q 1O7IA 4FDBA 2IHFA 1Y1WH 1OXTA 5JEAJ 4GN4B 1GO3E 3CCMA 2K5HA 2I0QA 3I4OA 4B3SQ 1HNXL 1WCMH 4DR6Q 5H1SE 5IYBH 2K75A 1XNQQ 1A8VA 4HJ5A 3H15A 1OXUA 2ZTEA 5BR8Q 4X62Q 1PH7A 5IP9G 1GM5A 5IY0A 3KJPA 2OWOA 4JV5L 3K81C 5M3FH 3RN5A 1N9WA 1UEBA 1V1QA 4XIGS 4AIMA 1Y14B 1R9TH 2ZTCA 4IOAA 2NVXH 4JI5L 1PVOA 1AH9A 2MFIA 3L7ZC 1K73C 3GO5A 1L2FA 2JE6I 2N8NA 1M1KC 1IBLL 4L5RC 2NVQH 3S14H 1IL2A 3HKZE 4LFBL 3I2ZA 1TXYA 4AH6A 5IT9c 2F4VL 1B70B 3HFZB 4JI1Q 4JI8L 1VQGA 1PH2A 2Z0SA 3HOWG 1NTGA 3BZCA 5GADC 2UUBQ 1U5KA 3A0JA 3K0XA 1HR0L 1HNZL 3TEHB 2IX0A 1E7ZA 1HJPA 4NB3A 4BA1I 4OX9L 1E22A 4LF9Q 2B29A 2OCEA 4TVAB 1W2BA 1PFSA 3KF8B 4IJLA 2MQHA 4A4IA 4HJ8A 4PZ8A 2HT1A 3OTOL 2ZTDA 1X9NA 3TS0A 4NXNQ 3S24A 2OQ0A 1I50H 4A93G 1I94Q 1PH3A 1VQ9A 4UP8A 2NZOA 4RG1A 4H02A 2E5LL 4DR4L 3ULLA 2GN5A 1G291 3NEMA 3CP0A 2QGQA 3DLLA 1N32Q 2I5LX 5IP7H 3CXCA 2XGTA 4A3EH 2ID0A 1SRUA 1Q46A 3KYHC 4BBRG 4LF4L 2CFMA 3AFPA 5FLMG 3KFUA 1KXLA 3NELA 1XPOA 1X3EA 4A75A 4JI7L 4LF5L 1UWVA 4Y7NH 1XNRQ 1N33L 4PMWA 4LFAL 2L15A 1A0IA 1C9OA 3A74A 4IPHA 4IPDA 1UE5A 2RF4A 3W5OA 4AQYQ 4JYAQ 4JOIA 2E2IH 3G71A 4DV3Q 4HIKA 1Q7YC 1SN8A 3ZJYC 4B3TL 2QEXA 3PF5A 1Y1WG 4JC0A 3L2PA 3H3VI 4JI2Q 2MO0A 4JOIC 3KJOA 2R93H 4LUOA 1YJNA 1J5EL 4C3JH 1VQCA 2Q2TA 3I4MH 2KENA 1WCMG 5IYBG 4BY1G 4OWTB 4X66Q 4DR5L 3GTQH 3HOYH 1VQHA 3UE1A 4B3RL 5IWAL 4DK3C 2WP8J 4UPAA 3J7ZC 4BBSG 4BA2I 4KHPQ 2RHQB 4YHHL 2Q2HA 4DV2Q 1IYJB 2BH8A 3CCRA 5M3FG 1YZ6A 1MJCA 3KOJA 1QVGA 2D0OA 2NZHA 3BJUA 2AKWB 3M4PA 2BA1A 4IPGA 4DR3Q 1JB7A 3S1NH 1VQIA 3ERSX 4DV7L 2UXCL 1E24A 1G6PA 4LF6L 3RLNA 4DV1Q 1XMOL 1K9MC 1J6QA 1FL0A 2JA8H 2VUMH 4GLAC 1Q81C 3KF6A 4A3IH 4L5SA 1OXSC 1WYDA 2RCNA 4R4QA 2VZAA 5LMNQ 2R7FA 4LUZA 5LMNW 4DR2L 1QZHA 1ASZA 4GKJQ 4OXPA 3KDFB 3CCEA 4DV0L 4EX5A 3B6YA 1SMXA 4K0KQ 2EQSA 1A63A 2ZM6Q 4QGUA 3CW2C 4GLXA 1N8RC 1A62A 4DV4Q 1KAWA 4JI4Q 4JI3Q 1EOVA 1VQ4A 3CPFA 3GTGH 1CKMA 1PYSB 2NN6I 1XJVA 3CCQA 2R92H 2WAQG 3D31A 2AHOB 3BZKA 4DAYB 1HNXQ 2Y0SG 4IFDI 1Q86C 1V43A 3UDIA 4YCVA 3W1GA 4OO1I 1I3QH 2NVTH 2DUDA 1QUQB 4HJAA 2YYZA 2F52A 1VQKA 2A8VA 3PV0A 2PQAB 1PH4A 3HOVH 2YTXA 4B3ML 2HHHL 4X6AH 5M5YH 5IP7G 3J81j 4A3EG 1Y1VH 3AFQA 1OXXK 3E9HA 3PUYA 2JA7H 3BU2A 4NXML 4R4CA 3KF6B 5M5WH 1XMQL 1IBLQ 3CPWA 3CC2A 4A3KH 4GKKQ 2F4VQ 3ULPA 1YJ9A 1VQ7A 4JBMA 3UE0A 3CC7A 2UUAL 1YEZA 3M7NA 4BY1H 3TRZA 4BBSH 1HR0W 1HR0Q 3S1MH 3PUXA 2H5XA 1PV4A 4R4TA 1UE6A 4IFDJ 2R93G 2OTLA 1S40A 3I4MG 1FJGL 2YV5A
chains in the Genus database with same CATH superfamily
3HOYG 4Y7NB 2WAQE 1EQTA 4A3LH 2Y0SE 2RSNA 1EY8A 3UDXA 1WFQA 2UXDL 2HCIA 2UU9L 1C0AA 4I7AA 1SYDA 1PH6A 4DR1L 5FLXL 3NBIA 3OPOA 3CCJA 3I4MB 2VUMG 3PUWA 3I70A 3I91A 2JYOA 1B3AA 4DUZL 1K83B 1ZYRD 4N9PA 3HP3A 4LFAQ 3DMUA 5C0XG 1HPCA 5FO8B 2PW5A 1STGA 1JORA 1KNAA 4OWXB 4POGA 2E2HH 1XNQL 1VCIA 1JQYD 4FYDA 1CSQA 1K8GA 4HJ9A 2EJFC 2JA8B 4JI6L 1TWGH 3GDEA 2JA6H 1EQVA 3NQTA 2NTTA 3UI2A 3NPPA 1CZGA 3NK9A 4KTAA 1WTOA 4ZYSA 3RNUA 3GV3A 2JEBI 3EBEA 2FXQA 4KI0A 4KD3A 1GKHA 2WB1B 1RDPD 4C3IH 1JWMD 3EROA 2V4DA 1CI3M 2AWNA 4Q5VA 1GHJA 3K0YA 2UUBL 4J1MA 1WTVA 1SEBD 4JBWA 2NVTB 1LV9A 3AQQA 1X56A 4I65A 5A35A 2UXBL 3UDGA 5ELOA 2UUCQ 5M5YB 2MO1A 4OO1G 2H1EA 2WFWA 2PQAA 4XQQA 3FP9A 3PIP3 4Y52H 2YU9H 5C3EG 1E2WA 1S5DD 2R7ZH 1I4QA 1PH1A 4CKBA 1B4OA 1K0RA 2V1CC 1XXGA 1LTRD 3T53B 1EIYB 1SE3A 4JK1C 2XWJB 3HKSA 4MN3A 1IW7D 5EJWA 2BCOA 2JP1A 4OIJA 1Y8PB 1YNJD 2MJ8A 5M3FB 3ER0A 5LMUQ 5J39A 2GVBA 5AJ3Q 3VYRA 1BBWA 1XMQQ 2NVQB 3LWEA 2N88A 1YIJA 5K36G 5G3LD 5FJ8G 2UUAQ 1XWEA 2BA0A 3I4NH 4JPBW 1FVIA 1UE7A 3FKIG 2LXJA 2L5TA 3LGJA 3EIVA 4IUTA 4PZ6A 5I9PA 5CBAE 5TSSA 1E3PA 1S5FD 1Q8IA 4JI8Q 1XX8A 2FMCA 2UXDQ 2NB0A 4XQJA 4ZKBB 5C4XG 5C44G 2VQEL 2ASBA 4A3CH 3HOXB 3OWEB 3PUVA 4DR1Q 1H9KA 4R4IA 1SROA 1QJOA 1FNWA 1M8AA 4R4OA 4DUYL 2H4OA 4QF4A 4HCEA 4A3JB 4DV4L 2ZXOA 1WD0A 5IGBA 5EPKA 4X3KA 1KDBA 1SR3A 1WOCA 4KN4C 4C3HG 1HTPA 5CV9A 2CWPA 2KCTA 2EYPA 1J9OA 3M3YH 4KJOA 4FF4A 3SVMA 4BS9A 5EAYA 1KHIA 3U50C 4DNTB 4JI6Q 4C3JB 1HA6A 4MTNA 2IT1A 4LF8L 1CKNB 4TQUS 4F8MA 3C1EA 1EL0A 2EOTA 3RMHA 2K5VA 5M5XB 2X6GA 3MXGA 1OO9B 1BCPB 1VMPA 2UXBQ 2PYKA 1HZBA 2PMZE 4DK6C 2MNAA 4LNQA 1SYCA 1I4HA 4A3DB 4BWGB 1ONLA 1FGUA 1CSPA 1SNDA 4JI1L 2HIVA 5KRUA 3NQIA 1SE4A 2UXCQ 1YJWA 5M3MB 1XMOQ 4MNOA 1T5EA 4R8NA 3IAYA 3G48A 2RSOA 1P8LA 2HQLA 2K28A 1PTOD 3U4VA 3NTHA 4L6TB 1MBYA 2FHTA 1GD7A 1R4QB 4A3MG 3NE5B 1JMCA 3P20A 3PO2G 3N52A 1I6VC 3KLSA 4N8FA 2Q8TA 4KJNA 3NSWA 2SDFA 3CCUA 4IUUA 4P75A 2A6HC 3L3OC 4PMCA 3GTJH 4B3MQ 4QMGA 1XNRL 3A5ZB 1ENCA 5IE8A 3CCSA 3PQIA 4JYAL 4GOPB 4P71A 4NXMQ 1SYBA 3BVMA 5C3EB 1DCZA 4UHVA 3MXNA 1JC7A 3RZOB 4GNXA 4FVMA 2VQEQ 1AE3A 3R3OA 4DAVA 5FO7B 4X66L 1A2UA 5K5PA 3R2TA 2QILA 4DUYQ 4AYBB 1Q3LA 2KQ3A 1S72A 3GTOH 4A93H 4S3SA 3M9BA 3S1RH 1IBKQ 3CD6A 5JJKA 4UP7A 4MIUA 3M7GA 5GQOA 2CH4A 1E1OA 1X54A 4DV1L 4BBRH 4DKAC 5FLMH 3S2DB 3VYUA 2A1AA 3FKIB 4C2MH 3CKIB 2B2WA 4TKOB 4RH6A 4JG2A 1XPUA 3PIOA 1L1OB 1ZEQX 1H9RA 2ICEC 3OOCA 1Y8OB 3Q0AA 4RKBA 3W2DA 4JI3L 4LF8Q 1O7IA 3L9AX 1OXTA 3QG1A 4GN4B 3H6MA 1H9JA 2I0QA 1KTKA 2K5HA 3HKZB 4B3SQ 1HNXL 4DR6Q 5H1SE 1RKNA 5IYBH 3OHXC 3H3VC 1A8VA 4HJ5A 2KHSA 2L9HA 4TSSA 1GM5A 3KJPA 2OWOA 3K81C 1V1QA 2RDGA 4IOAA 1Y14B 1A3VA 2ENBA 4JI5L 1AH9A 3GO5A 2JE6I 1EZ8A 4C3HB 3S14H 1IYUA 3I2ZA 4JI1Q 1D1IA 3MFGA 1J8IA 3A0JA 2IX0A 1HJPA 4O42A 3GTPB 3WOFA 1HTLD 1W2BA 4PZ8A 1HQMC 3OTOL 5KYLA 4RGNA 3TS0A 4TRDA 5DAUA 2PZTA 4K5XA 1UAPA 3FDTA 3HOWB 4H02A 3MAQA 3OMCA 1ICFB 2GN5A 2QGQA 1NNXA 5BN3A 1KLGD 1EY6A 5C4JB 3CXCA 3KYHC 3NELA 4JI7L 1XNRQ 1CZWA 1UWVA 2E75C 2NTSA 1N33L 3SK5A 4RKLA 1BBXC 1EWHA 5IGCA 2L15A 1C9OA 4JYAQ 3W5OA 4CJ2C 3G71A 2F0JA 4V0BA 2D9UA 2EY5A 2PQEA 5CGKA 1YJNA 1VQCA 4OIKA 1FNUA 2K1BA 4X66Q 4DR5L 3GTQH 4DAYA 4B3RL 5IWAL 2WP8J 2PNRC 1AZQA 3DWAA 3CCRA 2NZHA 3BJUA 4IALA 2BA1A 3S1NH 1VQIA 4FNFA 4K5WA 2R3ZA 1UEAB 4DV1Q 3BDOA 1LT4D 1CHQD 1J6QA 1K9MC 1FL0A 4A3IH 1GUNA 1WYDA 4L5SA 5LMNQ 4X3UA 5LMNW 1E0BA 4QB4A 2KCCA 4WFN3 1TU2B 4EX5A 2ZT9C 1QNUA 3IFTA 1A63A 4QGUA 1SMYC 4F88A 4GLXA 4R8IA 2QF7A 4RHRA 4JI3Q 1VQ4A 1DJRD 2NVXB 5BN4A 3CPFA 4HSVA 3X3MA 3VR4A 2NN6I 1HNXQ 3LX0A 3W1GA 1A6XA 4OO1I 1GUSA 2F52A 2PQAB 3HOVH 2HHHL 3J81j 3SE0A 2CW0C 1H9MA 1U4PA 2DNEA 5M5WH 3CPWA 3J7AV 5DM63 1I50B 2Y0SB 3NUCA 1VQ7A 3CC7A 1UUPA 1TQOA 4BY1H 3G6JB 3EJIA 1NUCA 4BBSH 2L55A 3S1MH 2H5XA 1L0XB 4R4TA 1UE6A 1PV4A 4IFDJ 1EEFD 3I4MG 3S17B 3OTOQ 2F0KA 1MHWC 4CJ1B 4L5QA 4RWSC 2EYOA 3NBHA 1VQOA 2NVYH 2B2VC 1EY7A 1KAAA 2A74C 3GQBA 3GTKH 4HR7B 3F2BA 4HCSA 2ATWA 2JA8G 1N36Q 1N33Q 4X64L 1F9RA 2FINB 1VQBA 3A5UA 3T1HL 2YTYA 5E4WC 3HEJA 1PH8A 2JA5H 4LF7L 1I5FA 2F0UA 3EQLC 2JQOA 1EEID 2WB1G 2BH2A 3I55A 1YBYA 5C4HA 4LW1A 3ND9A 3U4ZA 4A3GH 1BO0A 3A54A 2NBFA 1VQ8A 3J81i 5IWAQ 2DJGC 2KVMA 2K32A 3T1YQ 3WDNA 3H0GH 2EY2A 1HUNA 1QZGA 1YHQA 2BOSA 3D4RA 3PF4A 3GTGB 2JA7G 4J15A 5JEAG 3R8BA 1T5XD 4LAAA 3CC4A 2R92B 4L5TA 4BY7H 1GUOA 1TT2A 1EY0A 1LM0A 4A3KG 4QL5A 3S1QB 1I3QB 2ZJPA 1B9NA 2IW3A 1SXTA 1B53A 1MGSA 2KA7A 4DGZA 3E0EA 1QWYA 2B63H 2G9HD 4X65L 4RMFA 1S5ED 1Y1VB 4ABNA 4DR7L 1UE1A 1GXDC 2F0GA 3CMEA 2IX1A 1U4MA 2PZUA 3FPPA 2VS1A 1EIFA 2A19A 4ZRZA 1X65A 1YHAA 4HAEA 3H3VH 2O5IC 1QG7A 4P73A 4YCUA 5JPMC 2IPKD 2LS01 2HHHQ 5FO9B 3PIO3 2OF1A 2J4XA 4DNIA 1JOQA 1R4PB 2BDOA 5C3WA 5IYCH 4A3FH 1QNKA 5KNCA 3I56A 1NSNS 4UP9A 3J80E 2EJMA 2DGYA 3I73A 4IO9A 3RN2A 4A3BH 4CKEA 3SHLA 2F3IA 3RLOA 2K04A 3HOXG 1D6EC 3HS0C 1PHJA 2D2CC 4HIDA 3J81c 4JV5Q 1ZXTA 3HOZH 3K7AH 4KHZA 4KHPL 3S15H 5A2QL 2MGSA 1EY5A 4A3JG 1SE2A 5KNBA 3ICEA 1YNJC 3M4OH 1JJGA 2CHBD 4LFBQ 1Q1EA 1NR2A 2RHSB 3TQYA 4O2DA 1SNPA 1TWAH 1TWHH 3R93A 1CQFA 1GUGA 2A68D 1EFID 1D8LA 1U9RA 2K5NA 2JK8A 1BDOA 1WI5A 1HNZQ 4IFDH 2ZXPA 2I07B 3C2PA 1IHZA 4OX9Q 2JA6B 1EWCA 5IGGA 2I5MX 3GP7A 3A8JE 2KHIA 3MXNB 4LWCA 4X64Q 3VR5A 4GNXB 1PRTB 2AQ3B 5CYUA 2CVRA 3QWNA 2N49A 3T1HQ 4LF7Q 1VS0A 5EKLA 2C35B 3HOUH 5LL6X 1HZ9A 3I8ZA 5CV5A 2B8GA 2AUJD 1TWFH 4IJHA 4C3IB 3J7A5 3F1ZA 2O5JC 1K0SA 4OONA 2L12A 4DV6L 4KN7C 1LT6D 1SFOH 3DM3A 1SYFA 4LF4Q 2BDNA 4O1NA 4LF5Q 1F2MA 2PW7A 3KLSX 4IOCA 1RL2A 3MTSA 2B2TC 2PMZB 2LSSA 3AYHB 4YCWA 1ASYA 4A3DG 4GKKL 4B3TQ 3AEVA 2EYMA 4IUNA 2YU9B 2IY5B 1DOLA 1KNEA 2N78A 5M3MG 5KGUA 3RD4A 1WTXA 1RTNA 2AUKA 3JAMi 1EIHA 4IPCA 5IYDH 3FEWX 5M9OA 2EZVA 1YVCA 2E76C 4X65Q 2NWGA 4YHHQ 4KK7A 3TN2A 4DR7Q 3G4SA 3WWVA 5LL6S 2JXMB 2XIWA 5DNFA 4FF1A 2F0QA 3GTMH 5CV6A 1SNMA 2IWHA 3A8KE 3I4NB 1QILA 1H9SA 3SR1A 2O4XA 3GTLH 2KEDA 3D4WA 2NN6G 3QOJA 4GOPC 2CQOA 5LHY1 1PDQA 4QIWE 4NDXA 3I3CA 2EYLA 1YITA 3OW7A 4ZAIA 3CQZH 1KLUD 2JA7B 2O2LD 4NW2A 3MEHA 5IP9H 4DNRB 4A3KB 1EYGA 1B3QA 1O78A 3E3XA 2CCZA 2X6LA 4IURA 3DHQA 2K5DA 4K2KA 1K83H 2D62A 4AYBG 4ALPA 1PTOC 4MHEA 2SOBA 5E7NA 4EQOA 3RZDB 1VQFA 2Z6KC 4OEMB 1L1OC 2VY3A 2X69A 2XWBB 1Y8NB 3JAMc 3STBD 1HA5A 3V96A 1EWIA 3L0OA 1HFGA 3EN2A 5C0XJ 4DV2L 3KLRA 1BCPD 3HG9A 4BXXG 3NWSA 1TIID 3ULJA 4ZKCB 1IKMA 3Q24A 3J81E 2K5QA 4CDCC 4LK1C 3HKZG 1KQSA 2UU9Q 1E1TA 4GKJL 4DV6Q 5D65A 4I7ZC 2OT2A 3CAMA 2LXKA 3CRLC 1XTCD 4XYQA 2EIFA 3HRZC 4DUZQ 2Q2UA 2F0LA 2KBNA 2MHVA 1Y1WH 5ELBA 1GO3E 3DUZA 5G3LF 3MC0B 1WCMH 3ONAB 4RHSA 1XNQQ 2F0NA 4UAIA 2EY6A 5HURA 1DYQA 3CRKC 2F3WA 5M3FH 4EQNA 3RN5A 1N9WA 1Q90A 2L11A 5E4XA 3D4DA 1I4RA 2MFIA 3L7ZC 3T56B 1V1PA 2LY7A 1WD1A 2NVQH 1ILQA 1IL2A 5J22A 1S4ZA 4AH6A 1B70B 1D2BA 1VQGA 2Z0SA 3HOWG 4CGYB 2G5DA 2UUBQ 3TEHB 2A6EC 1E7ZA 2F0HA 1E22A 2EYJA 2OCEA 3BVGA 2DN8A 4TVAB 2F0MA 3D6CA 5EBCA 5IT9E 1EOTA 2LFNA 2MQHA 3GTJB 1LT3D 2DNCA 3S24A 4DK0A 1HUMA 2FMMA 4UP8A 3MA2B 2Q8IB 2RBMA 2E5LL 1G291 4K5VA 3DLLA 3QR8A 3BZDB 1DOKA 3NXWA 4FXGC 4OHJA 4R9WA 5IIFA 5IP7H 1IKLA 5E3FA 4A3EH 2ID0A 1SRUA 1CTMA 4ZUIA 3OMGA 1DONA 2CFMA 2EVBA 3FRPB 3KFUA 1KXLA 5ELCA 4A75A 1A3UA 3RUZA 1PFMA 3GTOB 1BF4A 3NTKA 4IPHA 4IPDA 3S1RB 1UE5A 2E2IH 4HIKA 3ZJYC 3C46A 2QEXA 3L2PA 4RA8A 5KEEA 3KJOA 2MO0A 4JOIC 4K6LA 2VB2X 3KK7A 4LUOA 4BBRB 4C3JH 1J5EL 2KENA 4C2MB 4BY1G 3HOYH 4DK3C 3J7ZC 4BBSG 1TWCB 3TZDA 4DV2Q 2Q2HA 4XT3B 5EBDA 1YZ6A 2Z6BA 1JB7A 1G8ZD 3ERSX 5T1GA 4LF6L 2VUMH 4GLAC 3KF6A 1LTGD 1OXSC 3MFYA 1TS2A 1ASZA 2R7FA 4GKJQ 2DY7A 4DR2L 4OXPA 1PTOF 4XDXA 5C0XH 4DV4Q 1AP0A 3EFXD 1KAWA 2GA4B 1I6HB 3BG3A 3KBGA 1ML0D 3JAME 3CCQA 2WAQG 3S14B 1DXMA 1D5XC 2Y0SG 1MSGA 1V43A 5D3IB 4YCVA 2DUDA 4HJAA 1VQKA 2A8VA 3PV0A 1Z6HA 4KKSA 3T13A 2YTXA 4EQPA 4Z9CB 4IUQA 3AFQA 4PV1C 3PUYA 5ELEA 4L8JA 4R4CA 1YNND 3CC2A 1JICA 4F87A 3ULPA 5EGTA 1JWUD 2A6ED 2QKIC 4PMBA 3TRZA 1JOKA 3OWFA 2IL8A 4M1UB 4DA2A 2XVSA 3VR2A 1GJXA 4KY6A 3D8GA 4CHTB 4J6HA 2R93G 5ISRA 1FJGL 4XQNA 1O7ZA 1D5MC 2B2VA 1WTWA 1XTDA 5C3EH 1PYWD 2B63G 4LFCL 3AMUA 3S2HH 4HN7A 3K7UC 3V2TA 5CR3A 5FK9C 3VDYA 2B2YC 4N9TA 1GVPA 3CU7A 1FNVA 2K05A 3T51B 3J80i 3GTQB 2E74C 2JJQA 4OGQC 1TR5A 3DXJC 4K8JA 3TBIB 1AW7A 5FJ8H 5K36H 1AE2A 1PTOH 2OTJA 4RAUC 5C5MA 2XTIA 2Z9HA 2AQ2B 4IQZA 1VQEA 4M8AA 3U58A 4YIJA 3FKIH 2IX3A 3S1NB 1OXVA 2AWOA 4J8QA 3NHHA 2WINB 1WTPA 2R92G 3U9SA 2K7VA 2WIIB 4ZCKA 4B08A 1LO5D 1MI2A 1PMRA 2D0PA 3BYTB 4A3IB 1C8CA 2M9VA 2VW9A 4A3BG 2OQKA 3I90A 2CWAA 4APVA 1O7LA 4HSPA 2PO4A 1ZKOA 5C4XH 5C44H 1Y1VG 1QVFA 1CT1D 1IBML 2R6GA 4HMIA 4IUPA 4LF6Q 1NCVA 1DM0B 2N55A 2E8GA 1B7YB 4NKLA 3RR5A 4DR2Q 1CA5A 4WRDA 3ZYYX 5EPJA 3F2CA 2FJ2A 3HOVB 4C3HH 1QUQA 1EIGA 3TZUA 4OWWB 4KV6A 3OIQA 4UDUC 4RGTA 3A7LA 1KABA 4DAPA 4A3LG 2XNAC 4YWKA 2E2JH 4JBJA 4PG3A 1YHBA 1V8QA 4BY1B 2ES2A 1JCKB 3GTPH 3S16H 3MHBA 4BBSB 1BVSA 1G2TA 1TKWB 1K3RA 2KECA 3GV6A 3J80c 1NE3A 3K80C 2A69D 4GS3A 3TMEA 3HGBA 5DLQE 4YWMA 1Q8KA 1H9SB 3W1BA 4DPGA 4OL7A 1SAPA 4G57A 5C5LA 4ULLA 1G2SA 2NVYB 5C4JH 1G51A 1Z9FA 3K5MA 4R1JA 2ALYB 3Q23A 3GTKB 1GUWA 4G7ZC 1PRTC 3K5LA 1B44D 3TP5A 1FJGQ 2JA6G 4JI5Q 1JE4A 1F2LA 5KYIA 2HDMA 2WAQB 1EY4A 5GAHC 1H95A 1S3OA 4LFCQ 3NENA 2JA5B 3T16A 4YWLA 2AMCB 4YY3L 4C3IG 4FO2A 1PA6A 4NPSA 5GAGC 3SGIA 1CKNA 4AYBE 3HZXA 2L4NA 4A3GB 4RCOA 2ZM6L 1NMGA 4K6DA 4A3MH 3DEOA 4HIOA 1ESRA 3H0GB 1BR9A 1Z47A 3PO2H 1M90C 1LTSD 2VQFL 1STHA 2K5WA 1K8MA 3MZ5A 3OIPA 2R93B 2R7ZG 4FP5D 2A68C 2B2TA 4XTCS 1EFWA 4JI7Q 5J3BA 3MEFA 2G9DA 4CKCA 2B63B 3OYYA 1XYIA 4H44C 2F0FA 3CCVA 4P72A 1IBMQ 3E6ZX 3LWUA 2VL6A 1PH9A 1KIXA 2NYZD 2EY1A 4WJWA 1XPRA 3I4NG 4DR5Q 4B3RQ 1B2TA 1VQAA 4ZQ3A 3ERQA 3PO3H 1P16A 1VDZA 2HIXA 4DF7A 5EQ0A 3URYA 2B39A 3D0FA 2F0WA 2I5HA 2F3VA 2OEOA 1X3QA 1SYGA 2BE5C 5FLXE 4HJ7A 4F7XA 4GOPA 1NJIC 4A3BB 5HGQA 5JVG3 2SNSA 1PYBA 2CKZB 1PH5A 1B1ZA 1GHKA 1V1PB 3S17H 1Y69U 2HD3A 1PZID 4A3CG 2EPBA 3PGZA 3GD7A 3CHBD 1A3TA 3AB9A 3UDFA 1NY4A 4NXNL 1VQPA 3HOZB 3K7AB 3S15B 1FR3A 1KRTA 1LABA 1YI2A 3M4OB 2PCFB 3G6EA 2DJFC 1PRTD 1MJEA 3F2UA 4WJ4A 1STBA 4MZ9A 1JE5A 1B50A 1CKOA 2MP1A 3BYYB 1TY2A 4DAMA 1BQQT 4KLKA 2Z6KA 2F0DA 1B9MA 4AQYL 4WJ3M 3TP8A 4DV3L 1L1OA 3KUPA 3K6OA 3SDZA 2K50A 3VR6A 2XRQD 4QJFA 3HOUB 1V1OA 4YY3Q 2NUCA 1IYVA 1AZPA 3IKJA 4GN3B 1SFOB 3QB3A 5KIXA 1F9SA 2UUCL 4JW0A 4P74A 1S5BD 1LYLA 3BS1A 3KLWA 4DR3L 5AFWA 1BXTA 1X3FA 2VQFQ 1EUJA 1JOOA 2Z4IA 1KD1C 5HGTA 3BDCA 3FVQA 3PCOB 3S1QH 2E2HB 1E2VA 3ITPA 5HY6A 2DY8A 1SNCA 1TWGB 3AU7A 1GUTA 3MXUA 1VQ5A 1W3SA 1I4GA 1STAA 3STBC 2FFKB 5LMUL 2ZXRA 5AJ3L 5JEAJ 2XRSD 4KY5A 4H13C 1ESFA 3H94A 1BCPC 2K75A 4CDFC 3H15A 1HHVA 1PH7A 2LKVA 5IY0A 3NP8A 1WTHA 1R9TH 2E2DC 1UEBA 4XIGS 4XYOA 4AIMA 2QCPX 2HCCA 4L63B 1PVOA 3K58A 1L2FA 3DEPA 3Q6SA 2N8NA 1IBLL 4L5RC 3CQZB 2BE5D 3SEBA 1TXYA 5IT9c 4JI8L 4LJZC 4ZK9B 1NTGA 2QW7A 2R7ZB 1HR0L 5CORA 4NB3A 2SEBD 1A15A 4BA1I 2PPBC 3A55A 2CQAA 1PFSA 4IJLA 4HJ8A 4A4IA 4B9WA 1SJHD 3QOLA 4NXNQ 1F9PA 4PQXA 2OQ0A 3TDQA 5I2XA 4A93G 1PZKD 1PH3A 1VQ9A 2B2UC 2EE1A 4RG1A 4DR4L 2F0OA 2KJXA 4G4KA 1JB3A 1HQRD 3NWTA 4BBRG 1Q46A 5FLMG 1TS4A 1WTRA 1SYEA 1XPOA 1LTBD 1X3EA 5CV4A 1MSHA 4Y7NH 3MWYW 4PNYA 3C3LA 1X3PA 1K8OA 3IL8A 2ICIA 4MTKA 1A0IA 1NR4A 3A74A 2RF4A 4ODGA 4AQYQ 1ILPA 4JOIA 4DV3Q 3K57A 2WACA 2HUGA 1Q7YC 1JR0D 4ME5A 3H3VI 4JC0A 5ELDA 3I4MH 3J80L 5IYBG 2HQEA 4OWTB 2EXZA 3UE1A 3QIAA 3E5SA 4BA2I 4KHPQ 1IYJB 1MJCA 3M4PA 4DR3Q 4IPGA 2RDHA 1Y1WB 4DV7L 2UXCL 1S5CD 1XMOL 2JA8H 1FYCA 2R61A 1WCMB 1WVLA 5C3XA 3M3YB 3D6WA 2VZAA 4R4QA 1G6ZA 4U68A 3CCEA 4DV0L 1SMXA 1LACA 1N8RC 1A62A 4CDEC 2JSOA 1EOVA 5I2YA 1CKMA 5EKKA 3P1HA 1XJVA 1X32A 1SBBB 4DAYB 4IFDI 3V05A 1Q86C 3UDIA 2MUYA 2F4IA 3VYTA 2NVTH 1QUQB 1PH4A 4B3ML 1WTQA 4EVOA 5M5YH 3E0JA 3E9HA 2JA7H 5JEAH 1RD9D 4KMUC 4HEDA 1IBLQ 4NXML 1ET9A 1HFNA 2KEEA 3KF8A 4A3KH 4GKKQ 3H91A 4JBMA 4QUFA 3SXHA 1YEZA 3M7NA 4DN4M 1HR0W 1HR0Q 4H7BA 2RQXA 3PUXA 4DXGA 4A3EB 2OTLA 4RCNA 2YV5A 1L0YB 1IBKL 1CHPD 3RZDH 1BCPF 5JOBA 4ZUJA 5I4DA 4JVZA 1LT5D 2B2YA 3F8TA 2E2IB 4PZ7A 1YNNC 4DR4Q 5NUCA 1SJED 4QY7A 1K28A 4POFA 1MIUA 1Q1BA 1KRSA 4A3IG 3HOYB 2ZJRA 3SK8A 4CDDC 2XN9C 5JJIA 3A56A 4EQ5A 3D3RA 1PFBA 1BBUA 1HNWL 1C48A 4B3SL 4DR6L 1QCBD 3HOXH 1D7QA 1AEXA 2VUMB 3TP7A 1STEA 2KCNA 2WKCA 5T1IA 1KC8C 3VR3A 4HMJA 4A3JH 1TVXA 3NBHB 4QQBX 1EQRA 3SK6A 3HOVG 1F9QA 4A93B 3OW2A 2R7DA 1B8AA 2Q2IA 3KDFA 1C4QA 1DGSA 4DV7Q 2OXPA 1ENAA 4JBKA 1EYAA 1HCZA 4KHVA 2C9OA 4DV0Q 2TSSA 3X3NA 2EXDA 4B9XA 4DV5L 2RA4A 3KBXA 3F2DA 3EVQA 2B8FA 2WB1E 4G7OC 1LTID 2K6AA 2F0TA 1VQMA 5M5XH 1IXRA 5I6WA 2KUMA 2JA9A 1EY9A 5GROA 5JJZA 3J81L 1SLJA 1JT8A 5JJLA 4CBVA 2IJ0A 1I4PA 1OTCA 4A3DH 4CJ0B 1X3GA 1BUVT 1SNOA 4IZ8A 2EJGC 5KNDA 2N3SA 5M3MH 2F0SA 3PUZA 3CMAA 1RF2D 3MVVA 3TREA 1JWSD 2JA5G 3FMCA 2RKSA 5CBEE 3S2HB 1IZ6A 1N34L 3P75A 3PSIA 2XSCA 4A76A 2WV6D 1VQNA 5BN5A 5E1FA 2PI2E 5I6YA 1LTAD 1TS5A 4A3GG 5GAEC 2K4KA 2VB3X 2F1MA 4Q0FA 5ELNA 4X3SA 3H0GG 2A69C 4JI0L 1VQLA 2PNHA 1PTOB 4FF3A 5D14A 3PO3G 2K03A 1F77A 2NN6H 3C1FA 3I72A 1EYCA 4C1NI 3FHWA 3U9OA 5LMNL 2JN4A 4BY7G 4OO1H 1TWCH 3I7FA 3M4QA 5IODA 4GLVB 5IT9L 1Q12A 1CUKA 2RDFA 5EKIA 4HIMA 3VA7A 1HNWQ 2AQ1B 2F0EA 3RZOH 1RJTA 5C4XB 1D5ZC 2Q8RE 5C44B 1LUZA 2E5LQ 1IL8A 1MKHA 4ME3A 1KDAA 5IGEA 1EYDA 4K14A 2KCMA 4KKTA 5DM73 2IHEA 4U673 2QDBA 3T4AC 1HZCA 1QVCA 1UNSA 1SNQA 3M85A 1I6HH 2WKDA 1M4VA 5CV7A 1GOZA 3CF5A 2K14A 2C5CA 1FGBD 3FPUB 3PMFA 3QJYA 3S2DH 2PZWA 1VQ6A 1JJCB 4OELB 5IYCG 4A3FG 2E2JB 3RLFA 1JJ2A 5BR8L 1AFPA 4X62L 1J5EQ 1CFMA 5L37A 3E9IA 1RODA 1U0LA 5IOCA 3S16B 4KD4A 1FD7D 1X6OA 2GVAA 5FLXc 4DV5Q 2F03A 2L1BA 4BXXH 1HZAA 4O0AA 3W3AA 3K59A 1VQJA 5C4ZA 3HOZG 4FXKC 2HDLA 3VA5A 1V9PA 5IGDA 2P5ZX 2PI2A 3TS2A 2A6HD 1YNXA 1HH2P 4LF9L 1VMCA 1KL9A 3CCLA 1Q82C 1N36L 1DOMA 4IFDG 4DXFA 1CQVA 1SE8A 2TMPA 3N6RA 2EYHA 1WJJA 2F0IA 1EQQA 1I94L 3K8AA 4GZYC 1VQDA 4P2CB 5M5WB 3WOEA 1F2YA 4LUVA 3JAML 2K52A 1NBWA 1NAPA 1N32L 1N34Q 1D1KA 1U4LA 3HOUG 5C0XI 2J0TD 4NP5A 3S1MB 4ZLTF 3T1YL 2KOLA 5JPNC 2MPMA 4A3MB 1BKBA 1W6KA 3HOWH 3EA6A 4JI0Q 1LTTD 3PO2B 2ZJQA 1RIPA 4V190 4XXEA 4JI2L 4C1NK 4FF2A 2JEAI 3JC66 1LTLA 1NMFA 4GNXC 5FOBB 1W6JA 2YTVA 2CH4W 3TP6A 4UY8C 1A2TA 1K8AC 1X55A 2B3GA 5IYDG 3DM1A 2SNMA 3PIPA 3M4YA 1SSOA 1T9HA 4EGVA 1L0WA 3IRBA 4H0LC 4JCVE 1STYA 2KHJA 3Q8DA 4G7HC 2NZ1D 2VNUD 4GN5A 2QA4A 4DK1A 3A8IE 3J7AF 1U4RA 4K0KL 2Z8LA 3DWPA 1EU3A 1K3BC 2B2WC 2EDGA 4C56C 1C7YA 1CK1A 1Z7TA 4JI4L 4FDBA 5IGFA 2IHFA 4E6IA 2RVLA 3K5NA 3PO3B 1ENFA 3CCMA 3I4OA 3BVZA 1OXUA 3J7YW 1EZ6A 2ZTEA 5BR8Q 4X62Q 4BY7B 1F2ZA 5IP9G 4FXDA 3R2IA 2A5HA 2K33A 2M00A 4JV5L 5CMDA 4N8X1 5A2QE 2L0CA 2QEJC 2ZTCA 2NVXH 1CA6A 1SDFA 1K73C 4K8IA 1M1KC 1E2ZA 4LFBL 1ICWA 3HKZE 2Z1CA 2F4VL 5JVH3 1STNA 3HFZB 1PH2A 1RTOA 4ILWA 1RCVD 1HRJA 5CC4A 2QDLA 1CM9A 3BZCA 5GADC 1U5KA 1II3A 3K0XA 1HNZL 3OSOA 3LNNA 1BNZA 2LMCB 4NMZA 4OX9L 4LF9Q 2B29A 3KF8B 5D3DA 2B2UA 4RGOS 1BOSA 2HT1A 2ZTDA 1X9NA 2K01A 4QIWB 1I50H 1RHPA 2Z4HA 1I94Q 4RFBA 4KY7A 3SK4A 2NZOA 3ULLA 3NEMA 4A3FB 3CP0A 3H09A 1TY0A 3K5OA 1ET6A 1N32Q 4KKUA 2I5LX 1PFNA 2XGTA 1PZJD 4WORA 4LF4L 3AFPA 5C6AA 1DD2A 4LF5L 4PMWA 3ND8A 4LFAL 2M2LA 1TS3A 4DU9A 3MXPA 5DEHA 1HXYD 1ZYRC 4IN3A 2D5DA 4IUVA 5I9OA 4B3TL 1QB5D 1SN8A 3DWQA 1LLRD 3PF5A 1Y1WG 3O13A 4JI2Q 3Q22A 2EYFA 2R93H 2F0VA 1TWAB 2Q2TA 1TWHB 1WCMG 1SMYD 4HTHA 2J7ZA 1VQHA 1QE6A 4UPAA 2RCFA 2RHQB 4YHHL 2BH8A 1QVGA 5M3FG 4RGMA 3KOJA 2D0OA 5JAVA 2AKWB 4XT1B 1E24A 2I46A 1G6PA 3RLNA 4QUCA 1Q81C 1O7YA 2RCNA 1TWFB 2VXWA 1QZHA 2F0PA 4LUZA 2CW0D 3KDFB 1KDCA 5ELFA 3B6YA 4K0KQ 2EQSA 1O80A 3VYSA 2ZM6Q 4DFAA 3CW2C 1R9TB 4LMQD 5J1ZA 4JI4Q 4K2LA 3GTGH 1QOHA 1PYSB 3NTIA 2R92H 3D31A 2AHOB 3BZKA 3IFDA 1EU4A 5F2DA 1PRTF 5COYA 5FKAC 1I3QH 4X3TA 1PLFA 2YYZA 3QO2A 1VF5C 4X6AH 1G91A 5IP7G 5CV8A 3S9WA 1IW7C 4A3EG 1Y1VH 1OXXK 3BU2A 4QCLA 3KF6B 1XMQL 2A73B 1AN8A 4ID6A 2F4VQ 3BDLA 1YJ9A 1VF7A 3UE0A 2UUAL 3G7LA 3GTMB 1I4XA 1DZ1A 5EPLA 1PXUA 3I4LA 3P7JA 1MD2D 3GTLB 4C3JG 1S40A 3TSSA 3A7AB
chains in the Genus database with same CATH topology
1IBKL 3HOYG 3OTOQ 2WAQE 4A3LH 1XTDA 5C3EH 3RZDH 2Y0SE 4L5QA 2B63G 4LFCL 1VQOA 2NVYH 3UDXA 1WFQA 3F8TA 3S2HH 4PZ7A 4DR4Q 2UXDL 3K7UC 3GTKH 2UU9L 4QY7A 1C0AA 3F2BA 1PH6A 3VDYA 4POFA 1HNZQ 4DR1L 1MIUA 1GVPA 2ATWA 1Q1BA 3CCJA 2JA8G 1KRSA 2VUMG 3PUWA 4A3IG 3J80i 1N36Q 2ZJRA 1N33Q 5JJIA 4DUZL 4X64L 2JJQA 4EQ5A 4LFAQ 1BBUA 1VQBA 5C0XG 2YTYA 3A5UA 3T1HL 5FJ8H 1PH8A 2JA5H 4LF7L 1AE2A 1HNWL 2OTJA 1I5FA 2JQOA 4B3SL 4DR6L 2XTIA 4OWXB 3U58A 1VQEA 3FKIH 4POGA 1OXVA 2AWOA 2WB1G 1VCIA 3HOXH 2E2HH 1XNQL 2BH2A 1D7QA 1CSQA 1K8GA 3I55A 1YBYA 4HJ9A 2R92G 4LW1A 4JI6L 1TWGH 3GDEA 3U4ZA 2JA6H 4A3GH 2D0PA 4A3BG 2VW9A 1KC8C 1VQ8A 4A3JH 3J81i 2OQKA 5IWAQ 3NBHB 3T1YQ 1EQRA 4QQBX 3H0GH 2CWAA 4APVA 3RNUA 3HOVG 2JEBI 3OW2A 2R7DA 2FXQA 3EBEA 1B8AA 2Q2IA 3KDFA 4KI0A 1YHQA 1QZGA 1GKHA 5C4XH 5C44H 1Y1VG 3PF4A 1QVFA 2JA7G 1DGSA 4J15A 5JEAG 1IBML 2R6GA 4C3IH 4DV7Q 4LF6Q 3CC4A 4JBKA 2AWNA 4L5TA 2UUBL 4BY7H 1LM0A 4A3KG 2E8GA 1B7YB 4QL5A 4JBWA 3RR5A 4DR2Q 2ZJPA 4DV0Q 3AQQA 1X56A 3F2CA 2EXDA 2UXBL 4DV5L 3UDGA 3E0EA 5ELOA 3F2DA 2UUCQ 4C3HH 2B63H 1QUQA 4X65L 2MO1A 4OO1G 4RMFA 2WFWA 2PQAA 4OWWB 4DR7L 1UE1A 2WB1E 3FP9A 3CMEA 1VQMA 2IX1A 4Y52H 2YU9H 4A3LG 5C3EG 4YWKA 5M5XH 2E2JH 2R7ZH 1IXRA 4JBJA 2VS1A 1EIFA 2A19A 4PG3A 2JA9A 1PH1A 1YHBA 1X65A 5GROA 1K0RA 1YHAA 1SLJA 2V1CC 1EIYB 2ES2A 1JT8A 3GTPH 5JJLA 3HKSA 3H3VH 3S16H 4P73A 1BVSA 4YCUA 1K3RA 2HHHQ 3J80c 1NE3A 1OTCA 3K80C 4A3DH 4DNIA 1X3GA 3ER0A 4GS3A 5LMUQ 2GVBA 5AJ3Q 1BBWA 5DLQE 4YWMA 1XMQQ 1Q8KA 5IYCH 4A3FH 3W1BA 2N3SA 5M3MH 4DPGA 1YIJA 3PUZA 3CMAA 3TREA 3I56A 5K36G 2JA5G 4UP9A 5FJ8G 2BA0A 5C4JH 2DGYA 4IO9A 3RN2A 2UUAQ 3I4NH 4A3BH 1IZ6A 1FVIA 1G51A 1N34L 1Z9FA 3PSIA 2ALYB 4R1JA 1UE7A 4A76A 3FKIG 2F3IA 3RLOA 2LXJA 3HOXG 1PHJA 1VQNA 3LGJA 4HIDA 3J81c 4JV5Q 2PI2E 3EIVA 3HOZH 3K7AH 4KHZA 1FJGQ 2JA6G 4A3GG 5GAEC 3S15H 4JI5Q 2K4KA 4KHPL 4A3JG 5ELNA 3ICEA 4PZ6A 3M4OH 1JJGA 3H0GG 1E3PA 4LFBQ 1Q1EA 5GAHC 4JI0L 1VQLA 1S3OA 4LFCQ 2PNHA 3NENA 2RHSB 1H95A 4JI8Q 3PO3G 2UXDQ 3TQYA 4O2DA 1TWAH 5C4XG 1TWHH 5C44G 2VQEL 4YWLA 2ASBA 2AMCB 3FHWA 4A3CH 4YY3L 1D8LA 5LMNL 3PUVA 4DR1Q 2K5NA 2JK8A 1WI5A 4NPSA 1CKNA 4R4IA 3SGIA 5GAGC 4AYBE 1SROA 4BY7G 4R4OA 4OX9Q 1TWCH 4DUYL 2ZM6L 2I5MX 1NMGA 4A3MH 4DV4L 2KHIA 3I7FA 3M4QA 3MXNB 4GLVB 4LWCA 4X64Q 4GNXB 4HIOA 1Z47A 1Q12A 1CUKA 2N49A 3T1HQ 3PO2H 4HIMA 1HNWQ 1SR3A 1VS0A 1WOCA 1M90C 4LF7Q 3RZOH 2CWPA 2VQFL 2C35B 2E5LQ 3HOUH 1LUZA 1HZ9A 2KCTA 1MKHA 3M3YH 4IJHA 1TWFH 3J7A5 4ME3A 3F1ZA 4OONA 5EAYA 1KHIA 4DV6L 2KCMA 3U50C 1SFOH 2IHEA 4JI6Q 3DM3A 2R7ZG 4LF4Q 4XTCS 1HZCA 1EFWA 1QVCA 4JI7Q 3M85A 4LF5Q 4MTNA 5J3BA 4IOCA 3MEFA 1RL2A 2IT1A 1I6HH 4LF8L 3OYYA 2LSSA 3AYHB 3CF5A 2K14A 4YCWA 3CCVA 1ASYA 4A3DG 4P72A 1CKNB 4TQUS 4GKKL 1IBMQ 4B3TQ 3S2DH 3AEVA 1PH9A 2K5VA 1JJCB 2VL6A 5IYCG 4A3FG 1VQ6A 2IY5B 3RLFA 2N78A 5M3MG 5BR8L 1KIXA 1JJ2A 4X62L 1J5EQ 1XPRA 3JAMi 3I4NG 4DR5Q 3E9IA 4IPCA 1U0LA 4B3RQ 5IYDH 2UXBQ 4DV5Q 1X6OA 5FLXc 2GVAA 1HZBA 2PMZE 4DK6C 1VQAA 1YVCA 2MNAA 4LNQA 4BXXH 4X65Q 1HZAA 4YHHQ 4O0AA 3PO3H 1VQJA 1FGUA 1P16A 2HIXA 3WWVA 3G4SA 3HOZG 4DR7Q 1CSPA 3D0FA 4JI1L 2HIVA 2I5HA 2UXCQ 1V9PA 3GTMH 1YJWA 2PI2A 4HJ7A 1XMOQ 3TS2A 4GOPA 4MNOA 1NJIC 5HGQA 1PYBA 2CKZB 1PH5A 1YNXA 3GTLH 3G48A 3S17H 2NN6G 1P8LA 1HH2P 2HQLA 4GOPC 4LF9L 4A3CG 3U4VA 1KL9A 3PGZA 3CCLA 3GD7A 2CQOA 1Q82C 1N36L 3UDFA 4IFDG 1NY4A 4QIWE 1SE8A 1YITA 3CQZH 4NXNL 1VQPA 1GD7A 1WJJA 1EQQA 1I94L 3K8AA 4A3MG 1VQDA 1KRTA 1YI2A 3G6EA 1JMCA 5IP9H 4LUVA 3PO2G 1EYGA 2K52A 1NBWA 1N32L 1MJEA 4WJ4A 1N34Q 3HOUG 5C0XI 4MZ9A 3CCUA 1JE5A 2CCZA 4P75A 3GTJH 4B3MQ 1XNRL 1K83H 1CKOA 3T1YL 2D62A 3A5ZB 5IE8A 4AYBG 3CCSA 4ALPA 4DAMA 4JYAL 4KLKA 2Z6KA 1BKBA 4P71A 4GOPB 4AQYL 4NXMQ 5E7NA 3HOWH 4WJ3M 4DV3L 1L1OA 4JI0Q 1VQFA 2ZJQA 1RIPA 2K50A 2Z6KC 4QJFA 4GNXA 4JI2L 2VQEQ 1AE3A 1L1OC 2VY3A 4YY3Q 2JEAI 3JC66 1PA6A 4X66L 1LTLA 1NMFA 3JAMc 4GNXC 4GN3B 3STBD 1EWIA 4DUYQ 1S72A 3GTOH 4A93H 2UUCL 3L0OA 2YTVA 3EN2A 3M9BA 5C0XJ 4DV2L 4P74A 3S1RH 1K8AC 1IBKQ 1LYLA 1X55A 4UY8C 2B3GA 5IYDG 3CD6A 5JJKA 4UP7A 3KLWA 3PIPA 4DR3L 1T9HA 4BXXG 3ULJA 5GQOA 1X3FA 1L0WA 2VQFQ 4DV1L 1E1OA 1EUJA 1X54A 3IRBA 4JCVE 4BBRH 4DKAC 1KD1C 2KHJA 3Q8DA 5FLMH 2VNUD 3HKZG 1KQSA 2UU9Q 3PCOB 3S1QH 2A1AA 4C2MH 4GN5A 1E1TA 2QA4A 4GKJL 4DV6Q 5HY6A 4JG2A 1XPUA 3CAMA 4K0KL 2LXKA 3PIOA 1L1OB 1VQ5A 1W3SA 2EIFA 4DUZQ 1C7YA 2Q2UA 3STBC 2KBNA 5LMUL 4JI4L 4JI3L 5AJ3L 4LF8Q 1O7IA 4FDBA 2IHFA 1Y1WH 1OXTA 5JEAJ 4GN4B 1GO3E 3CCMA 2K5HA 2I0QA 3I4OA 4B3SQ 1HNXL 1WCMH 4DR6Q 5H1SE 5IYBH 2K75A 1XNQQ 1A8VA 4HJ5A 3H15A 1OXUA 2ZTEA 5BR8Q 4X62Q 1PH7A 5IP9G 1GM5A 5IY0A 3KJPA 2OWOA 4JV5L 3K81C 5M3FH 3RN5A 1N9WA 1UEBA 1V1QA 4XIGS 4AIMA 1Y14B 1R9TH 2ZTCA 4IOAA 2NVXH 4JI5L 1PVOA 1AH9A 2MFIA 3L7ZC 1K73C 3GO5A 1L2FA 2JE6I 2N8NA 1M1KC 1IBLL 4L5RC 2NVQH 3S14H 1IL2A 3HKZE 4LFBL 3I2ZA 1TXYA 4AH6A 5IT9c 2F4VL 1B70B 3HFZB 4JI1Q 4JI8L 1VQGA 1PH2A 2Z0SA 3HOWG 1NTGA 3BZCA 5GADC 2UUBQ 1U5KA 3A0JA 3K0XA 1HR0L 1HNZL 3TEHB 2IX0A 1E7ZA 1HJPA 4NB3A 4BA1I 4OX9L 1E22A 4LF9Q 2B29A 2OCEA 4TVAB 1W2BA 1PFSA 3KF8B 4IJLA 2MQHA 4A4IA 4HJ8A 4PZ8A 2HT1A 3OTOL 2ZTDA 1X9NA 3TS0A 4NXNQ 3S24A 2OQ0A 1I50H 4A93G 1I94Q 1PH3A 1VQ9A 4UP8A 2NZOA 4RG1A 4H02A 2E5LL 4DR4L 3ULLA 2GN5A 1G291 3NEMA 3CP0A 2QGQA 3DLLA 1N32Q 2I5LX 5IP7H 3CXCA 2XGTA 4A3EH 2ID0A 1SRUA 1Q46A 3KYHC 4BBRG 4LF4L 2CFMA 3AFPA 5FLMG 3KFUA 1KXLA 3NELA 1XPOA 1X3EA 4A75A 4JI7L 4LF5L 1UWVA 4Y7NH 1XNRQ 1N33L 4PMWA 4LFAL 2L15A 1A0IA 1C9OA 3A74A 4IPHA 4IPDA 1UE5A 2RF4A 3W5OA 4AQYQ 4JYAQ 4JOIA 2E2IH 3G71A 4DV3Q 4HIKA 1Q7YC 1SN8A 3ZJYC 4B3TL 2QEXA 3PF5A 1Y1WG 4JC0A 3L2PA 3H3VI 4JI2Q 2MO0A 4JOIC 3KJOA 2R93H 4LUOA 1YJNA 1J5EL 4C3JH 1VQCA 2Q2TA 3I4MH 2KENA 1WCMG 5IYBG 4BY1G 4OWTB 4X66Q 4DR5L 3GTQH 3HOYH 1VQHA 3UE1A 4B3RL 5IWAL 4DK3C 2WP8J 4UPAA 3J7ZC 4BBSG 4BA2I 4KHPQ 2RHQB 4YHHL 2Q2HA 4DV2Q 1IYJB 2BH8A 3CCRA 5M3FG 1YZ6A 1MJCA 3KOJA 1QVGA 2D0OA 2NZHA 3BJUA 2AKWB 3M4PA 2BA1A 4IPGA 4DR3Q 1JB7A 3S1NH 1VQIA 3ERSX 4DV7L 2UXCL 1E24A 1G6PA 4LF6L 3RLNA 4DV1Q 1XMOL 1K9MC 1J6QA 1FL0A 2JA8H 2VUMH 4GLAC 1Q81C 3KF6A 4A3IH 4L5SA 1OXSC 1WYDA 2RCNA 4R4QA 2VZAA 5LMNQ 2R7FA 4LUZA 5LMNW 4DR2L 1QZHA 1ASZA 4GKJQ 4OXPA 3KDFB 3CCEA 4DV0L 4EX5A 3B6YA 1SMXA 4K0KQ 2EQSA 1A63A 2ZM6Q 4QGUA 3CW2C 4GLXA 1N8RC 1A62A 4DV4Q 1KAWA 4JI4Q 4JI3Q 1EOVA 1VQ4A 3CPFA 3GTGH 1CKMA 1PYSB 2NN6I 1XJVA 3CCQA 2R92H 2WAQG 3D31A 2AHOB 3BZKA 4DAYB 1HNXQ 2Y0SG 4IFDI 1Q86C 1V43A 3UDIA 4YCVA 3W1GA 4OO1I 1I3QH 2NVTH 2DUDA 1QUQB 4HJAA 2YYZA 2F52A 1VQKA 2A8VA 3PV0A 2PQAB 1PH4A 3HOVH 2YTXA 4B3ML 2HHHL 4X6AH 5M5YH 5IP7G 3J81j 4A3EG 1Y1VH 3AFQA 1OXXK 3E9HA 3PUYA 2JA7H 3BU2A 4NXML 4R4CA 3KF6B 5M5WH 1XMQL 1IBLQ 3CPWA 3CC2A 4A3KH 4GKKQ 2F4VQ 3ULPA 1YJ9A 1VQ7A 4JBMA 3UE0A 3CC7A 2UUAL 1YEZA 3M7NA 4BY1H 3TRZA 4BBSH 1HR0W 1HR0Q 3S1MH 3PUXA 2H5XA 1PV4A 4R4TA 1UE6A 4IFDJ 2R93G 2OTLA 1S40A 3I4MG 1FJGL 2YV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK L;  3HOY G;  3OTO Q;  2WAQ E;  4A3L H;  1XTD A;  5C3E H;  3RZD H;  2Y0S E;  4L5Q A;  2B63 G;  4LFC L;  1VQO A;  2NVY H;  3UDX A;  1WFQ A;  3F8T A;  3S2H H;  4PZ7 A;  4DR4 Q;  2UXD L;  3K7U C;  3GTK H;  2UU9 L;  4QY7 A;  1C0A A;  3F2B A;  1PH6 A;  3VDY A;  4POF A;  1HNZ Q;  4DR1 L;  1MIU A;  1GVP A;  2ATW A;  1Q1B A;  3CCJ A;  2JA8 G;  1KRS A;  2VUM G;  3PUW A;  4A3I G;  3J80 i;  1N36 Q;  2ZJR A;  1N33 Q;  5JJI A;  4DUZ L;  4X64 L;  2JJQ A;  4EQ5 A;  4LFA Q;  1BBU A;  1VQB A;  5C0X G;  2YTY A;  3A5U A;  3T1H L;  5FJ8 H;  1PH8 A;  2JA5 H;  4LF7 L;  1AE2 A;  1HNW L;  2OTJ A;  1I5F A;  2JQO A;  4B3S L;  4DR6 L;  2XTI A;  4OWX B;  3U58 A;  1VQE A;  3FKI H;  4POG A;  1OXV A;  2AWO A;  2WB1 G;  1VCI A;  3HOX H;  2E2H H;  1XNQ L;  2BH2 A;  1D7Q A;  1CSQ A;  1K8G A;  3I55 A;  1YBY A;  4HJ9 A;  2R92 G;  4LW1 A;  4JI6 L;  1TWG H;  3GDE A;  3U4Z A;  2JA6 H;  4A3G H;  2D0P A;  4A3B G;  2VW9 A;  1KC8 C;  1VQ8 A;  4A3J H;  3J81 i;  2OQK A;  5IWA Q;  3NBH B;  3T1Y Q;  1EQR A;  4QQB X;  3H0G H;  2CWA A;  4APV A;  3RNU A;  3HOV G;  2JEB I;  3OW2 A;  2R7D A;  2FXQ A;  3EBE A;  1B8A A;  2Q2I A;  3KDF A;  4KI0 A;  1YHQ A;  1QZG A;  1GKH A;  5C4X H;  5C44 H;  1Y1V G;  3PF4 A;  1QVF A;  2JA7 G;  1DGS A;  4J15 A;  5JEA G;  1IBM L;  2R6G A;  4C3I H;  4DV7 Q;  4LF6 Q;  3CC4 A;  4JBK A;  2AWN A;  4L5T A;  2UUB L;  4BY7 H;  1LM0 A;  4A3K G;  2E8G A;  1B7Y B;  4QL5 A;  4JBW A;  3RR5 A;  4DR2 Q;  2ZJP A;  4DV0 Q;  3AQQ A;  1X56 A;  3F2C A;  2EXD A;  2UXB L;  4DV5 L;  3UDG A;  3E0E A;  5ELO A;  3F2D A;  2UUC Q;  4C3H H;  2B63 H;  1QUQ A;  4X65 L;  2MO1 A;  4OO1 G;  4RMF A;  2WFW A;  2PQA A;  4OWW B;  4DR7 L;  1UE1 A;  2WB1 E;  3FP9 A;  3CME A;  1VQM A;  2IX1 A;  4Y52 H;  2YU9 H;  4A3L G;  5C3E G;  4YWK A;  5M5X H;  2E2J H;  2R7Z H;  1IXR A;  4JBJ A;  2VS1 A;  1EIF A;  2A19 A;  4PG3 A;  2JA9 A;  1PH1 A;  1YHB A;  1X65 A;  5GRO A;  1K0R A;  1YHA A;  1SLJ A;  2V1C C;  1EIY B;  2ES2 A;  1JT8 A;  3GTP H;  5JJL A;  3HKS A;  3H3V H;  3S16 H;  4P73 A;  1BVS A;  4YCU A;  1K3R A;  2HHH Q;  3J80 c;  1NE3 A;  1OTC A;  3K80 C;  4A3D H;  4DNI A;  1X3G A;  3ER0 A;  4GS3 A;  5LMU Q;  2GVB A;  5AJ3 Q;  1BBW A;  5DLQ E;  4YWM A;  1XMQ Q;  1Q8K A;  5IYC H;  4A3F H;  3W1B A;  2N3S A;  5M3M H;  4DPG A;  1YIJ A;  3PUZ A;  3CMA A;  3TRE A;  3I56 A;  5K36 G;  2JA5 G;  4UP9 A;  5FJ8 G;  2BA0 A;  5C4J H;  2DGY A;  4IO9 A;  3RN2 A;  2UUA Q;  3I4N H;  4A3B H;  1IZ6 A;  1FVI A;  1G51 A;  1N34 L;  1Z9F A;  3PSI A;  2ALY B;  4R1J A;  1UE7 A;  4A76 A;  3FKI G;  2F3I A;  3RLO A;  2LXJ A;  3HOX G;  1PHJ A;  1VQN A;  3LGJ A;  4HID A;  3J81 c;  4JV5 Q;  2PI2 E;  3EIV A;  3HOZ H;  3K7A H;  4KHZ A;  1FJG Q;  2JA6 G;  4A3G G;  5GAE C;  3S15 H;  4JI5 Q;  2K4K A;  4KHP L;  4A3J G;  5ELN A;  3ICE A;  4PZ6 A;  3M4O H;  1JJG A;  3H0G G;  1E3P A;  4LFB Q;  1Q1E A;  5GAH C;  4JI0 L;  1VQL A;  1S3O A;  4LFC Q;  2PNH A;  3NEN A;  2RHS B;  1H95 A;  4JI8 Q;  3PO3 G;  2UXD Q;  3TQY A;  4O2D A;  1TWA H;  5C4X G;  1TWH H;  5C44 G;  2VQE L;  4YWL A;  2ASB A;  2AMC B;  3FHW A;  4A3C H;  4YY3 L;  1D8L A;  5LMN L;  3PUV A;  4DR1 Q;  2K5N A;  2JK8 A;  1WI5 A;  4NPS A;  1CKN A;  4R4I A;  3SGI A;  5GAG C;  4AYB E;  1SRO A;  4BY7 G;  4R4O A;  4OX9 Q;  1TWC H;  4DUY L;  2ZM6 L;  2I5M X;  1NMG A;  4A3M H;  4DV4 L;  2KHI A;  3I7F A;  3M4Q A;  3MXN B;  4GLV B;  4LWC A;  4X64 Q;  4GNX B;  4HIO A;  1Z47 A;  1Q12 A;  1CUK A;  2N49 A;  3T1H Q;  3PO2 H;  4HIM A;  1HNW Q;  1SR3 A;  1VS0 A;  1WOC A;  1M90 C;  4LF7 Q;  3RZO H;  2CWP A;  2VQF L;  2C35 B;  2E5L Q;  3HOU H;  1LUZ A;  1HZ9 A;  2KCT A;  1MKH A;  3M3Y H;  4IJH A;  1TWF H;  3J7A 5;  4ME3 A;  3F1Z A;  4OON A;  5EAY A;  1KHI A;  4DV6 L;  2KCM A;  3U50 C;  1SFO H;  2IHE A;  4JI6 Q;  3DM3 A;  2R7Z G;  4LF4 Q;  4XTC S;  1HZC A;  1EFW A;  1QVC A;  4JI7 Q;  3M85 A;  4LF5 Q;  4MTN A;  5J3B A;  4IOC A;  3MEF A;  1RL2 A;  2IT1 A;  1I6H H;  4LF8 L;  3OYY A;  2LSS A;  3AYH B;  3CF5 A;  2K14 A;  4YCW A;  3CCV A;  1ASY A;  4A3D G;  4P72 A;  1CKN B;  4TQU S;  4GKK L;  1IBM Q;  4B3T Q;  3S2D H;  3AEV A;  1PH9 A;  2K5V A;  1JJC B;  2VL6 A;  5IYC G;  4A3F G;  1VQ6 A;  2IY5 B;  3RLF A;  2N78 A;  5M3M G;  5BR8 L;  1KIX A;  1JJ2 A;  4X62 L;  1J5E Q;  1XPR A;  3JAM i;  3I4N G;  4DR5 Q;  3E9I A;  4IPC A;  1U0L A;  4B3R Q;  5IYD H;  2UXB Q;  4DV5 Q;  1X6O A;  5FLX c;  2GVA A;  1HZB A;  2PMZ E;  4DK6 C;  1VQA A;  1YVC A;  2MNA A;  4LNQ A;  4BXX H;  4X65 Q;  1HZA A;  4YHH Q;  4O0A A;  3PO3 H;  1VQJ A;  1FGU A;  1P16 A;  2HIX A;  3WWV A;  3G4S A;  3HOZ G;  4DR7 Q;  1CSP A;  3D0F A;  4JI1 L;  2HIV A;  2I5H A;  2UXC Q;  1V9P A;  3GTM H;  1YJW A;  2PI2 A;  4HJ7 A;  1XMO Q;  3TS2 A;  4GOP A;  4MNO A;  1NJI C;  5HGQ A;  1PYB A;  2CKZ B;  1PH5 A;  1YNX A;  3GTL H;  3G48 A;  3S17 H;  2NN6 G;  1P8L A;  1HH2 P;  2HQL A;  4GOP C;  4LF9 L;  4A3C G;  3U4V A;  1KL9 A;  3PGZ A;  3CCL A;  3GD7 A;  2CQO A;  1Q82 C;  1N36 L;  3UDF A;  4IFD G;  1NY4 A;  4QIW E;  1SE8 A;  1YIT A;  3CQZ H;  4NXN L;  1VQP A;  1GD7 A;  1WJJ A;  1EQQ A;  1I94 L;  3K8A A;  4A3M G;  1VQD A;  1KRT A;  1YI2 A;  3G6E A;  1JMC A;  5IP9 H;  4LUV A;  3PO2 G;  1EYG A;  2K52 A;  1NBW A;  1N32 L;  1MJE A;  4WJ4 A;  1N34 Q;  3HOU G;  5C0X I;  4MZ9 A;  3CCU A;  1JE5 A;  2CCZ A;  4P75 A;  3GTJ H;  4B3M Q;  1XNR L;  1K83 H;  1CKO A;  3T1Y L;  2D62 A;  3A5Z B;  5IE8 A;  4AYB G;  3CCS A;  4ALP A;  4DAM A;  4JYA L;  4KLK A;  2Z6K A;  1BKB A;  4P71 A;  4GOP B;  4AQY L;  4NXM Q;  5E7N A;  3HOW H;  4WJ3 M;  4DV3 L;  1L1O A;  4JI0 Q;  1VQF A;  2ZJQ A;  1RIP A;  2K50 A;  2Z6K C;  4QJF A;  4GNX A;  4JI2 L;  2VQE Q;  1AE3 A;  1L1O C;  2VY3 A;  4YY3 Q;  2JEA I;  3JC6 6;  1PA6 A;  4X66 L;  1LTL A;  1NMF A;  3JAM c;  4GNX C;  4GN3 B;  3STB D;  1EWI A;  4DUY Q;  1S72 A;  3GTO H;  4A93 H;  2UUC L;  3L0O A;  2YTV A;  3EN2 A;  3M9B A;  5C0X J;  4DV2 L;  4P74 A;  3S1R H;  1K8A C;  1IBK Q;  1LYL A;  1X55 A;  4UY8 C;  2B3G A;  5IYD G;  3CD6 A;  5JJK A;  4UP7 A;  3KLW A;  3PIP A;  4DR3 L;  1T9H A;  4BXX G;  3ULJ A;  5GQO A;  1X3F A;  1L0W A;  2VQF Q;  4DV1 L;  1E1O A;  1EUJ A;  1X54 A;  3IRB A;  4JCV E;  4BBR H;  4DKA C;  1KD1 C;  2KHJ A;  3Q8D A;  5FLM H;  2VNU D;  3HKZ G;  1KQS A;  2UU9 Q;  3PCO B;  3S1Q H;  2A1A A;  4C2M H;  4GN5 A;  1E1T A;  2QA4 A;  4GKJ L;  4DV6 Q;  5HY6 A;  4JG2 A;  1XPU A;  3CAM A;  4K0K L;  2LXK A;  3PIO A;  1L1O B;  1VQ5 A;  1W3S A;  2EIF A;  4DUZ Q;  1C7Y A;  2Q2U A;  3STB C;  2KBN A;  5LMU L;  4JI4 L;  4JI3 L;  5AJ3 L;  4LF8 Q;  1O7I A;  4FDB A;  2IHF A;  1Y1W H;  1OXT A;  5JEA J;  4GN4 B;  1GO3 E;  3CCM A;  2K5H A;  2I0Q A;  3I4O A;  4B3S Q;  1HNX L;  1WCM H;  4DR6 Q;  5H1S E;  5IYB H;  2K75 A;  1XNQ Q;  1A8V A;  4HJ5 A;  3H15 A;  1OXU A;  2ZTE A;  5BR8 Q;  4X62 Q;  1PH7 A;  5IP9 G;  1GM5 A;  5IY0 A;  3KJP A;  2OWO A;  4JV5 L;  3K81 C;  5M3F H;  3RN5 A;  1N9W A;  1UEB A;  1V1Q A;  4XIG S;  4AIM A;  1Y14 B;  1R9T H;  2ZTC A;  4IOA A;  2NVX H;  4JI5 L;  1PVO A;  1AH9 A;  2MFI A;  3L7Z C;  1K73 C;  3GO5 A;  1L2F A;  2JE6 I;  2N8N A;  1M1K C;  1IBL L;  4L5R C;  2NVQ H;  3S14 H;  1IL2 A;  3HKZ E;  4LFB L;  3I2Z A;  1TXY A;  4AH6 A;  5IT9 c;  2F4V L;  1B70 B;  3HFZ B;  4JI1 Q;  4JI8 L;  1VQG A;  1PH2 A;  2Z0S A;  3HOW G;  1NTG A;  3BZC A;  5GAD C;  2UUB Q;  1U5K A;  3A0J A;  3K0X A;  1HR0 L;  1HNZ L;  3TEH B;  2IX0 A;  1E7Z A;  1HJP A;  4NB3 A;  4BA1 I;  4OX9 L;  1E22 A;  4LF9 Q;  2B29 A;  2OCE A;  4TVA B;  1W2B A;  1PFS A;  3KF8 B;  4IJL A;  2MQH A;  4A4I A;  4HJ8 A;  4PZ8 A;  2HT1 A;  3OTO L;  2ZTD A;  1X9N A;  3TS0 A;  4NXN Q;  3S24 A;  2OQ0 A;  1I50 H;  4A93 G;  1I94 Q;  1PH3 A;  1VQ9 A;  4UP8 A;  2NZO A;  4RG1 A;  4H02 A;  2E5L L;  4DR4 L;  3ULL A;  2GN5 A;  1G29 1;  3NEM A;  3CP0 A;  2QGQ A;  3DLL A;  1N32 Q;  2I5L X;  5IP7 H;  3CXC A;  2XGT A;  4A3E H;  2ID0 A;  1SRU A;  1Q46 A;  3KYH C;  4BBR G;  4LF4 L;  2CFM A;  3AFP A;  5FLM G;  3KFU A;  1KXL A;  3NEL A;  1XPO A;  1X3E A;  4A75 A;  4JI7 L;  4LF5 L;  1UWV A;  4Y7N H;  1XNR Q;  1N33 L;  4PMW A;  4LFA L;  2L15 A;  1A0I A;  1C9O A;  3A74 A;  4IPH A;  4IPD A;  1UE5 A;  2RF4 A;  3W5O A;  4AQY Q;  4JYA Q;  4JOI A;  2E2I H;  3G71 A;  4DV3 Q;  4HIK A;  1Q7Y C;  1SN8 A;  3ZJY C;  4B3T L;  2QEX A;  3PF5 A;  1Y1W G;  4JC0 A;  3L2P A;  3H3V I;  4JI2 Q;  2MO0 A;  4JOI C;  3KJO A;  2R93 H;  4LUO A;  1YJN A;  1J5E L;  4C3J H;  1VQC A;  2Q2T A;  3I4M H;  2KEN A;  1WCM G;  5IYB G;  4BY1 G;  4OWT B;  4X66 Q;  4DR5 L;  3GTQ H;  3HOY H;  1VQH A;  3UE1 A;  4B3R L;  5IWA L;  4DK3 C;  2WP8 J;  4UPA A;  3J7Z C;  4BBS G;  4BA2 I;  4KHP Q;  2RHQ B;  4YHH L;  2Q2H A;  4DV2 Q;  1IYJ B;  2BH8 A;  3CCR A;  5M3F G;  1YZ6 A;  1MJC A;  3KOJ A;  1QVG A;  2D0O A;  2NZH A;  3BJU A;  2AKW B;  3M4P A;  2BA1 A;  4IPG A;  4DR3 Q;  1JB7 A;  3S1N H;  1VQI A;  3ERS X;  4DV7 L;  2UXC L;  1E24 A;  1G6P A;  4LF6 L;  3RLN A;  4DV1 Q;  1XMO L;  1K9M C;  1J6Q A;  1FL0 A;  2JA8 H;  2VUM H;  4GLA C;  1Q81 C;  3KF6 A;  4A3I H;  4L5S A;  1OXS C;  1WYD A;  2RCN A;  4R4Q A;  2VZA A;  5LMN Q;  2R7F A;  4LUZ A;  5LMN W;  4DR2 L;  1QZH A;  1ASZ A;  4GKJ Q;  4OXP A;  3KDF B;  3CCE A;  4DV0 L;  4EX5 A;  3B6Y A;  1SMX A;  4K0K Q;  2EQS A;  1A63 A;  2ZM6 Q;  4QGU A;  3CW2 C;  4GLX A;  1N8R C;  1A62 A;  4DV4 Q;  1KAW A;  4JI4 Q;  4JI3 Q;  1EOV A;  1VQ4 A;  3CPF A;  3GTG H;  1CKM A;  1PYS B;  2NN6 I;  1XJV A;  3CCQ A;  2R92 H;  2WAQ G;  3D31 A;  2AHO B;  3BZK A;  4DAY B;  1HNX Q;  2Y0S G;  4IFD I;  1Q86 C;  1V43 A;  3UDI A;  4YCV A;  3W1G A;  4OO1 I;  1I3Q H;  2NVT H;  2DUD A;  1QUQ B;  4HJA A;  2YYZ A;  2F52 A;  1VQK A;  2A8V A;  3PV0 A;  2PQA B;  1PH4 A;  3HOV H;  2YTX A;  4B3M L;  2HHH L;  4X6A H;  5M5Y H;  5IP7 G;  3J81 j;  4A3E G;  1Y1V H;  3AFQ A;  1OXX K;  3E9H A;  3PUY A;  2JA7 H;  3BU2 A;  4NXM L;  4R4C A;  3KF6 B;  5M5W H;  1XMQ L;  1IBL Q;  3CPW A;  3CC2 A;  4A3K H;  4GKK Q;  2F4V Q;  3ULP A;  1YJ9 A;  1VQ7 A;  4JBM A;  3UE0 A;  3CC7 A;  2UUA L;  1YEZ A;  3M7N A;  4BY1 H;  3TRZ A;  4BBS H;  1HR0 W;  1HR0 Q;  3S1M H;  3PUX A;  2H5X A;  1PV4 A;  4R4T A;  1UE6 A;  4IFD J;  2R93 G;  2OTL A;  1S40 A;  3I4M G;  1FJG L;  2YV5 A; 
#chains in the Genus database with same CATH topology
 3HOY G;  4Y7N B;  2WAQ E;  1EQT A;  4A3L H;  2Y0S E;  2RSN A;  1EY8 A;  3UDX A;  1WFQ A;  2UXD L;  2HCI A;  2UU9 L;  1C0A A;  4I7A A;  1SYD A;  1PH6 A;  4DR1 L;  5FLX L;  3NBI A;  3OPO A;  3CCJ A;  3I4M B;  2VUM G;  3PUW A;  3I70 A;  3I91 A;  2JYO A;  1B3A A;  4DUZ L;  1K83 B;  1ZYR D;  4N9P A;  3HP3 A;  4LFA Q;  3DMU A;  5C0X G;  1HPC A;  5FO8 B;  2PW5 A;  1STG A;  1JOR A;  1KNA A;  4OWX B;  4POG A;  2E2H H;  1XNQ L;  1VCI A;  1JQY D;  4FYD A;  1CSQ A;  1K8G A;  4HJ9 A;  2EJF C;  2JA8 B;  4JI6 L;  1TWG H;  3GDE A;  2JA6 H;  1EQV A;  3NQT A;  2NTT A;  3UI2 A;  3NPP A;  1CZG A;  3NK9 A;  4KTA A;  1WTO A;  4ZYS A;  3RNU A;  3GV3 A;  2JEB I;  3EBE A;  2FXQ A;  4KI0 A;  4KD3 A;  1GKH A;  2WB1 B;  1RDP D;  4C3I H;  1JWM D;  3ERO A;  2V4D A;  1CI3 M;  2AWN A;  4Q5V A;  1GHJ A;  3K0Y A;  2UUB L;  4J1M A;  1WTV A;  1SEB D;  4JBW A;  2NVT B;  1LV9 A;  3AQQ A;  1X56 A;  4I65 A;  5A35 A;  2UXB L;  3UDG A;  5ELO A;  2UUC Q;  5M5Y B;  2MO1 A;  4OO1 G;  2H1E A;  2WFW A;  2PQA A;  4XQQ A;  3FP9 A;  3PIP 3;  4Y52 H;  2YU9 H;  5C3E G;  1E2W A;  1S5D D;  2R7Z H;  1I4Q A;  1PH1 A;  4CKB A;  1B4O A;  1K0R A;  2V1C C;  1XXG A;  1LTR D;  3T53 B;  1EIY B;  1SE3 A;  4JK1 C;  2XWJ B;  3HKS A;  4MN3 A;  1IW7 D;  5EJW A;  2BCO A;  2JP1 A;  4OIJ A;  1Y8P B;  1YNJ D;  2MJ8 A;  5M3F B;  3ER0 A;  5LMU Q;  5J39 A;  2GVB A;  5AJ3 Q;  3VYR A;  1BBW A;  1XMQ Q;  2NVQ B;  3LWE A;  2N88 A;  1YIJ A;  5K36 G;  5G3L D;  5FJ8 G;  2UUA Q;  1XWE A;  2BA0 A;  3I4N H;  4JPB W;  1FVI A;  1UE7 A;  3FKI G;  2LXJ A;  2L5T A;  3LGJ A;  3EIV A;  4IUT A;  4PZ6 A;  5I9P A;  5CBA E;  5TSS A;  1E3P A;  1S5F D;  1Q8I A;  4JI8 Q;  1XX8 A;  2FMC A;  2UXD Q;  2NB0 A;  4XQJ A;  4ZKB B;  5C4X G;  5C44 G;  2VQE L;  2ASB A;  4A3C H;  3HOX B;  3OWE B;  3PUV A;  4DR1 Q;  1H9K A;  4R4I A;  1SRO A;  1QJO A;  1FNW A;  1M8A A;  4R4O A;  4DUY L;  2H4O A;  4QF4 A;  4HCE A;  4A3J B;  4DV4 L;  2ZXO A;  1WD0 A;  5IGB A;  5EPK A;  4X3K A;  1KDB A;  1SR3 A;  1WOC A;  4KN4 C;  4C3H G;  1HTP A;  5CV9 A;  2CWP A;  2KCT A;  2EYP A;  1J9O A;  3M3Y H;  4KJO A;  4FF4 A;  3SVM A;  4BS9 A;  5EAY A;  1KHI A;  3U50 C;  4DNT B;  4JI6 Q;  4C3J B;  1HA6 A;  4MTN A;  2IT1 A;  4LF8 L;  1CKN B;  4TQU S;  4F8M A;  3C1E A;  1EL0 A;  2EOT A;  3RMH A;  2K5V A;  5M5X B;  2X6G A;  3MXG A;  1OO9 B;  1BCP B;  1VMP A;  2UXB Q;  2PYK A;  1HZB A;  2PMZ E;  4DK6 C;  2MNA A;  4LNQ A;  1SYC A;  1I4H A;  4A3D B;  4BWG B;  1ONL A;  1FGU A;  1CSP A;  1SND A;  4JI1 L;  2HIV A;  5KRU A;  3NQI A;  1SE4 A;  2UXC Q;  1YJW A;  5M3M B;  1XMO Q;  4MNO A;  1T5E A;  4R8N A;  3IAY A;  3G48 A;  2RSO A;  1P8L A;  2HQL A;  2K28 A;  1PTO D;  3U4V A;  3NTH A;  4L6T B;  1MBY A;  2FHT A;  1GD7 A;  1R4Q B;  4A3M G;  3NE5 B;  1JMC A;  3P20 A;  3PO2 G;  3N52 A;  1I6V C;  3KLS A;  4N8F A;  2Q8T A;  4KJN A;  3NSW A;  2SDF A;  3CCU A;  4IUU A;  4P75 A;  2A6H C;  3L3O C;  4PMC A;  3GTJ H;  4B3M Q;  4QMG A;  1XNR L;  3A5Z B;  1ENC A;  5IE8 A;  3CCS A;  3PQI A;  4JYA L;  4GOP B;  4P71 A;  4NXM Q;  1SYB A;  3BVM A;  5C3E B;  1DCZ A;  4UHV A;  3MXN A;  1JC7 A;  3RZO B;  4GNX A;  4FVM A;  2VQE Q;  1AE3 A;  3R3O A;  4DAV A;  5FO7 B;  4X66 L;  1A2U A;  5K5P A;  3R2T A;  2QIL A;  4DUY Q;  4AYB B;  1Q3L A;  2KQ3 A;  1S72 A;  3GTO H;  4A93 H;  4S3S A;  3M9B A;  3S1R H;  1IBK Q;  3CD6 A;  5JJK A;  4UP7 A;  4MIU A;  3M7G A;  5GQO A;  2CH4 A;  1E1O A;  1X54 A;  4DV1 L;  4BBR H;  4DKA C;  5FLM H;  3S2D B;  3VYU A;  2A1A A;  3FKI B;  4C2M H;  3CKI B;  2B2W A;  4TKO B;  4RH6 A;  4JG2 A;  1XPU A;  3PIO A;  1L1O B;  1ZEQ X;  1H9R A;  2ICE C;  3OOC A;  1Y8O B;  3Q0A A;  4RKB A;  3W2D A;  4JI3 L;  4LF8 Q;  1O7I A;  3L9A X;  1OXT A;  3QG1 A;  4GN4 B;  3H6M A;  1H9J A;  2I0Q A;  1KTK A;  2K5H A;  3HKZ B;  4B3S Q;  1HNX L;  4DR6 Q;  5H1S E;  1RKN A;  5IYB H;  3OHX C;  3H3V C;  1A8V A;  4HJ5 A;  2KHS A;  2L9H A;  4TSS A;  1GM5 A;  3KJP A;  2OWO A;  3K81 C;  1V1Q A;  2RDG A;  4IOA A;  1Y14 B;  1A3V A;  2ENB A;  4JI5 L;  1AH9 A;  3GO5 A;  2JE6 I;  1EZ8 A;  4C3H B;  3S14 H;  1IYU A;  3I2Z A;  4JI1 Q;  1D1I A;  3MFG A;  1J8I A;  3A0J A;  2IX0 A;  1HJP A;  4O42 A;  3GTP B;  3WOF A;  1HTL D;  1W2B A;  4PZ8 A;  1HQM C;  3OTO L;  5KYL A;  4RGN A;  3TS0 A;  4TRD A;  5DAU A;  2PZT A;  4K5X A;  1UAP A;  3FDT A;  3HOW B;  4H02 A;  3MAQ A;  3OMC A;  1ICF B;  2GN5 A;  2QGQ A;  1NNX A;  5BN3 A;  1KLG D;  1EY6 A;  5C4J B;  3CXC A;  3KYH C;  3NEL A;  4JI7 L;  1XNR Q;  1CZW A;  1UWV A;  2E75 C;  2NTS A;  1N33 L;  3SK5 A;  4RKL A;  1BBX C;  1EWH A;  5IGC A;  2L15 A;  1C9O A;  4JYA Q;  3W5O A;  4CJ2 C;  3G71 A;  2F0J A;  4V0B A;  2D9U A;  2EY5 A;  2PQE A;  5CGK A;  1YJN A;  1VQC A;  4OIK A;  1FNU A;  2K1B A;  4X66 Q;  4DR5 L;  3GTQ H;  4DAY A;  4B3R L;  5IWA L;  2WP8 J;  2PNR C;  1AZQ A;  3DWA A;  3CCR A;  2NZH A;  3BJU A;  4IAL A;  2BA1 A;  3S1N H;  1VQI A;  4FNF A;  4K5W A;  2R3Z A;  1UEA B;  4DV1 Q;  3BDO A;  1LT4 D;  1CHQ D;  1J6Q A;  1K9M C;  1FL0 A;  4A3I H;  1GUN A;  1WYD A;  4L5S A;  5LMN Q;  4X3U A;  5LMN W;  1E0B A;  4QB4 A;  2KCC A;  4WFN 3;  1TU2 B;  4EX5 A;  2ZT9 C;  1QNU A;  3IFT A;  1A63 A;  4QGU A;  1SMY C;  4F88 A;  4GLX A;  4R8I A;  2QF7 A;  4RHR A;  4JI3 Q;  1VQ4 A;  1DJR D;  2NVX B;  5BN4 A;  3CPF A;  4HSV A;  3X3M A;  3VR4 A;  2NN6 I;  1HNX Q;  3LX0 A;  3W1G A;  1A6X A;  4OO1 I;  1GUS A;  2F52 A;  2PQA B;  3HOV H;  2HHH L;  3J81 j;  3SE0 A;  2CW0 C;  1H9M A;  1U4P A;  2DNE A;  5M5W H;  3CPW A;  3J7A V;  5DM6 3;  1I50 B;  2Y0S B;  3NUC A;  1VQ7 A;  3CC7 A;  1UUP A;  1TQO A;  4BY1 H;  3G6J B;  3EJI A;  1NUC A;  4BBS H;  2L55 A;  3S1M H;  2H5X A;  1L0X B;  4R4T A;  1UE6 A;  1PV4 A;  4IFD J;  1EEF D;  3I4M G;  3S17 B;  3OTO Q;  2F0K A;  1MHW C;  4CJ1 B;  4L5Q A;  4RWS C;  2EYO A;  3NBH A;  1VQO A;  2NVY H;  2B2V C;  1EY7 A;  1KAA A;  2A74 C;  3GQB A;  3GTK H;  4HR7 B;  3F2B A;  4HCS A;  2ATW A;  2JA8 G;  1N36 Q;  1N33 Q;  4X64 L;  1F9R A;  2FIN B;  1VQB A;  3A5U A;  3T1H L;  2YTY A;  5E4W C;  3HEJ A;  1PH8 A;  2JA5 H;  4LF7 L;  1I5F A;  2F0U A;  3EQL C;  2JQO A;  1EEI D;  2WB1 G;  2BH2 A;  3I55 A;  1YBY A;  5C4H A;  4LW1 A;  3ND9 A;  3U4Z A;  4A3G H;  1BO0 A;  3A54 A;  2NBF A;  1VQ8 A;  3J81 i;  5IWA Q;  2DJG C;  2KVM A;  2K32 A;  3T1Y Q;  3WDN A;  3H0G H;  2EY2 A;  1HUN A;  1QZG A;  1YHQ A;  2BOS A;  3D4R A;  3PF4 A;  3GTG B;  2JA7 G;  4J15 A;  5JEA G;  3R8B A;  1T5X D;  4LAA A;  3CC4 A;  2R92 B;  4L5T A;  4BY7 H;  1GUO A;  1TT2 A;  1EY0 A;  1LM0 A;  4A3K G;  4QL5 A;  3S1Q B;  1I3Q B;  2ZJP A;  1B9N A;  2IW3 A;  1SXT A;  1B53 A;  1MGS A;  2KA7 A;  4DGZ A;  3E0E A;  1QWY A;  2B63 H;  2G9H D;  4X65 L;  4RMF A;  1S5E D;  1Y1V B;  4ABN A;  4DR7 L;  1UE1 A;  1GXD C;  2F0G A;  3CME A;  2IX1 A;  1U4M A;  2PZU A;  3FPP A;  2VS1 A;  1EIF A;  2A19 A;  4ZRZ A;  1X65 A;  1YHA A;  4HAE A;  3H3V H;  2O5I C;  1QG7 A;  4P73 A;  4YCU A;  5JPM C;  2IPK D;  2LS0 1;  2HHH Q;  5FO9 B;  3PIO 3;  2OF1 A;  2J4X A;  4DNI A;  1JOQ A;  1R4P B;  2BDO A;  5C3W A;  5IYC H;  4A3F H;  1QNK A;  5KNC A;  3I56 A;  1NSN S;  4UP9 A;  3J80 E;  2EJM A;  2DGY A;  3I73 A;  4IO9 A;  3RN2 A;  4A3B H;  4CKE A;  3SHL A;  2F3I A;  3RLO A;  2K04 A;  3HOX G;  1D6E C;  3HS0 C;  1PHJ A;  2D2C C;  4HID A;  3J81 c;  4JV5 Q;  1ZXT A;  3HOZ H;  3K7A H;  4KHZ A;  4KHP L;  3S15 H;  5A2Q L;  2MGS A;  1EY5 A;  4A3J G;  1SE2 A;  5KNB A;  3ICE A;  1YNJ C;  3M4O H;  1JJG A;  2CHB D;  4LFB Q;  1Q1E A;  1NR2 A;  2RHS B;  3TQY A;  4O2D A;  1SNP A;  1TWA H;  1TWH H;  3R93 A;  1CQF A;  1GUG A;  2A68 D;  1EFI D;  1D8L A;  1U9R A;  2K5N A;  2JK8 A;  1BDO A;  1WI5 A;  1HNZ Q;  4IFD H;  2ZXP A;  2I07 B;  3C2P A;  1IHZ A;  4OX9 Q;  2JA6 B;  1EWC A;  5IGG A;  2I5M X;  3GP7 A;  3A8J E;  2KHI A;  3MXN B;  4LWC A;  4X64 Q;  3VR5 A;  4GNX B;  1PRT B;  2AQ3 B;  5CYU A;  2CVR A;  3QWN A;  2N49 A;  3T1H Q;  4LF7 Q;  1VS0 A;  5EKL A;  2C35 B;  3HOU H;  5LL6 X;  1HZ9 A;  3I8Z A;  5CV5 A;  2B8G A;  2AUJ D;  1TWF H;  4IJH A;  4C3I B;  3J7A 5;  3F1Z A;  2O5J C;  1K0S A;  4OON A;  2L12 A;  4DV6 L;  4KN7 C;  1LT6 D;  1SFO H;  3DM3 A;  1SYF A;  4LF4 Q;  2BDN A;  4O1N A;  4LF5 Q;  1F2M A;  2PW7 A;  3KLS X;  4IOC A;  1RL2 A;  3MTS A;  2B2T C;  2PMZ B;  2LSS A;  3AYH B;  4YCW A;  1ASY A;  4A3D G;  4GKK L;  4B3T Q;  3AEV A;  2EYM A;  4IUN A;  2YU9 B;  2IY5 B;  1DOL A;  1KNE A;  2N78 A;  5M3M G;  5KGU A;  3RD4 A;  1WTX A;  1RTN A;  2AUK A;  3JAM i;  1EIH A;  4IPC A;  5IYD H;  3FEW X;  5M9O A;  2EZV A;  1YVC A;  2E76 C;  4X65 Q;  2NWG A;  4YHH Q;  4KK7 A;  3TN2 A;  4DR7 Q;  3G4S A;  3WWV A;  5LL6 S;  2JXM B;  2XIW A;  5DNF A;  4FF1 A;  2F0Q A;  3GTM H;  5CV6 A;  1SNM A;  2IWH A;  3A8K E;  3I4N B;  1QIL A;  1H9S A;  3SR1 A;  2O4X A;  3GTL H;  2KED A;  3D4W A;  2NN6 G;  3QOJ A;  4GOP C;  2CQO A;  5LHY 1;  1PDQ A;  4QIW E;  4NDX A;  3I3C A;  2EYL A;  1YIT A;  3OW7 A;  4ZAI A;  3CQZ H;  1KLU D;  2JA7 B;  2O2L D;  4NW2 A;  3MEH A;  5IP9 H;  4DNR B;  4A3K B;  1EYG A;  1B3Q A;  1O78 A;  3E3X A;  2CCZ A;  2X6L A;  4IUR A;  3DHQ A;  2K5D A;  4K2K A;  1K83 H;  2D62 A;  4AYB G;  4ALP A;  1PTO C;  4MHE A;  2SOB A;  5E7N A;  4EQO A;  3RZD B;  1VQF A;  2Z6K C;  4OEM B;  1L1O C;  2VY3 A;  2X69 A;  2XWB B;  1Y8N B;  3JAM c;  3STB D;  1HA5 A;  3V96 A;  1EWI A;  3L0O A;  1HFG A;  3EN2 A;  5C0X J;  4DV2 L;  3KLR A;  1BCP D;  3HG9 A;  4BXX G;  3NWS A;  1TII D;  3ULJ A;  4ZKC B;  1IKM A;  3Q24 A;  3J81 E;  2K5Q A;  4CDC C;  4LK1 C;  3HKZ G;  1KQS A;  2UU9 Q;  1E1T A;  4GKJ L;  4DV6 Q;  5D65 A;  4I7Z C;  2OT2 A;  3CAM A;  2LXK A;  3CRL C;  1XTC D;  4XYQ A;  2EIF A;  3HRZ C;  4DUZ Q;  2Q2U A;  2F0L A;  2KBN A;  2MHV A;  1Y1W H;  5ELB A;  1GO3 E;  3DUZ A;  5G3L F;  3MC0 B;  1WCM H;  3ONA B;  4RHS A;  1XNQ Q;  2F0N A;  4UAI A;  2EY6 A;  5HUR A;  1DYQ A;  3CRK C;  2F3W A;  5M3F H;  4EQN A;  3RN5 A;  1N9W A;  1Q90 A;  2L11 A;  5E4X A;  3D4D A;  1I4R A;  2MFI A;  3L7Z C;  3T56 B;  1V1P A;  2LY7 A;  1WD1 A;  2NVQ H;  1ILQ A;  1IL2 A;  5J22 A;  1S4Z A;  4AH6 A;  1B70 B;  1D2B A;  1VQG A;  2Z0S A;  3HOW G;  4CGY B;  2G5D A;  2UUB Q;  3TEH B;  2A6E C;  1E7Z A;  2F0H A;  1E22 A;  2EYJ A;  2OCE A;  3BVG A;  2DN8 A;  4TVA B;  2F0M A;  3D6C A;  5EBC A;  5IT9 E;  1EOT A;  2LFN A;  2MQH A;  3GTJ B;  1LT3 D;  2DNC A;  3S24 A;  4DK0 A;  1HUM A;  2FMM A;  4UP8 A;  3MA2 B;  2Q8I B;  2RBM A;  2E5L L;  1G29 1;  4K5V A;  3DLL A;  3QR8 A;  3BZD B;  1DOK A;  3NXW A;  4FXG C;  4OHJ A;  4R9W A;  5IIF A;  5IP7 H;  1IKL A;  5E3F A;  4A3E H;  2ID0 A;  1SRU A;  1CTM A;  4ZUI A;  3OMG A;  1DON A;  2CFM A;  2EVB A;  3FRP B;  3KFU A;  1KXL A;  5ELC A;  4A75 A;  1A3U A;  3RUZ A;  1PFM A;  3GTO B;  1BF4 A;  3NTK A;  4IPH A;  4IPD A;  3S1R B;  1UE5 A;  2E2I H;  4HIK A;  3ZJY C;  3C46 A;  2QEX A;  3L2P A;  4RA8 A;  5KEE A;  3KJO A;  2MO0 A;  4JOI C;  4K6L A;  2VB2 X;  3KK7 A;  4LUO A;  4BBR B;  4C3J H;  1J5E L;  2KEN A;  4C2M B;  4BY1 G;  3HOY H;  4DK3 C;  3J7Z C;  4BBS G;  1TWC B;  3TZD A;  4DV2 Q;  2Q2H A;  4XT3 B;  5EBD A;  1YZ6 A;  2Z6B A;  1JB7 A;  1G8Z D;  3ERS X;  5T1G A;  4LF6 L;  2VUM H;  4GLA C;  3KF6 A;  1LTG D;  1OXS C;  3MFY A;  1TS2 A;  1ASZ A;  2R7F A;  4GKJ Q;  2DY7 A;  4DR2 L;  4OXP A;  1PTO F;  4XDX A;  5C0X H;  4DV4 Q;  1AP0 A;  3EFX D;  1KAW A;  2GA4 B;  1I6H B;  3BG3 A;  3KBG A;  1ML0 D;  3JAM E;  3CCQ A;  2WAQ G;  3S14 B;  1DXM A;  1D5X C;  2Y0S G;  1MSG A;  1V43 A;  5D3I B;  4YCV A;  2DUD A;  4HJA A;  1VQK A;  2A8V A;  3PV0 A;  1Z6H A;  4KKS A;  3T13 A;  2YTX A;  4EQP A;  4Z9C B;  4IUQ A;  3AFQ A;  4PV1 C;  3PUY A;  5ELE A;  4L8J A;  4R4C A;  1YNN D;  3CC2 A;  1JIC A;  4F87 A;  3ULP A;  5EGT A;  1JWU D;  2A6E D;  2QKI C;  4PMB A;  3TRZ A;  1JOK A;  3OWF A;  2IL8 A;  4M1U B;  4DA2 A;  2XVS A;  3VR2 A;  1GJX A;  4KY6 A;  3D8G A;  4CHT B;  4J6H A;  2R93 G;  5ISR A;  1FJG L;  4XQN A;  1O7Z A;  1D5M C;  2B2V A;  1WTW A;  1XTD A;  5C3E H;  1PYW D;  2B63 G;  4LFC L;  3AMU A;  3S2H H;  4HN7 A;  3K7U C;  3V2T A;  5CR3 A;  5FK9 C;  3VDY A;  2B2Y C;  4N9T A;  1GVP A;  3CU7 A;  1FNV A;  2K05 A;  3T51 B;  3J80 i;  3GTQ B;  2E74 C;  2JJQ A;  4OGQ C;  1TR5 A;  3DXJ C;  4K8J A;  3TBI B;  1AW7 A;  5FJ8 H;  5K36 H;  1AE2 A;  1PTO H;  2OTJ A;  4RAU C;  5C5M A;  2XTI A;  2Z9H A;  2AQ2 B;  4IQZ A;  1VQE A;  4M8A A;  3U58 A;  4YIJ A;  3FKI H;  2IX3 A;  3S1N B;  1OXV A;  2AWO A;  4J8Q A;  3NHH A;  2WIN B;  1WTP A;  2R92 G;  3U9S A;  2K7V A;  2WII B;  4ZCK A;  4B08 A;  1LO5 D;  1MI2 A;  1PMR A;  2D0P A;  3BYT B;  4A3I B;  1C8C A;  2M9V A;  2VW9 A;  4A3B G;  2OQK A;  3I90 A;  2CWA A;  4APV A;  1O7L A;  4HSP A;  2PO4 A;  1ZKO A;  5C4X H;  5C44 H;  1Y1V G;  1QVF A;  1CT1 D;  1IBM L;  2R6G A;  4HMI A;  4IUP A;  4LF6 Q;  1NCV A;  1DM0 B;  2N55 A;  2E8G A;  1B7Y B;  4NKL A;  3RR5 A;  4DR2 Q;  1CA5 A;  4WRD A;  3ZYY X;  5EPJ A;  3F2C A;  2FJ2 A;  3HOV B;  4C3H H;  1QUQ A;  1EIG A;  3TZU A;  4OWW B;  4KV6 A;  3OIQ A;  4UDU C;  4RGT A;  3A7L A;  1KAB A;  4DAP A;  4A3L G;  2XNA C;  4YWK A;  2E2J H;  4JBJ A;  4PG3 A;  1YHB A;  1V8Q A;  4BY1 B;  2ES2 A;  1JCK B;  3GTP H;  3S16 H;  3MHB A;  4BBS B;  1BVS A;  1G2T A;  1TKW B;  1K3R A;  2KEC A;  3GV6 A;  3J80 c;  1NE3 A;  3K80 C;  2A69 D;  4GS3 A;  3TME A;  3HGB A;  5DLQ E;  4YWM A;  1Q8K A;  1H9S B;  3W1B A;  4DPG A;  4OL7 A;  1SAP A;  4G57 A;  5C5L A;  4ULL A;  1G2S A;  2NVY B;  5C4J H;  1G51 A;  1Z9F A;  3K5M A;  4R1J A;  2ALY B;  3Q23 A;  3GTK B;  1GUW A;  4G7Z C;  1PRT C;  3K5L A;  1B44 D;  3TP5 A;  1FJG Q;  2JA6 G;  4JI5 Q;  1JE4 A;  1F2L A;  5KYI A;  2HDM A;  2WAQ B;  1EY4 A;  5GAH C;  1H95 A;  1S3O A;  4LFC Q;  3NEN A;  2JA5 B;  3T16 A;  4YWL A;  2AMC B;  4YY3 L;  4C3I G;  4FO2 A;  1PA6 A;  4NPS A;  5GAG C;  3SGI A;  1CKN A;  4AYB E;  3HZX A;  2L4N A;  4A3G B;  4RCO A;  2ZM6 L;  1NMG A;  4K6D A;  4A3M H;  3DEO A;  4HIO A;  1ESR A;  3H0G B;  1BR9 A;  1Z47 A;  3PO2 H;  1M90 C;  1LTS D;  2VQF L;  1STH A;  2K5W A;  1K8M A;  3MZ5 A;  3OIP A;  2R93 B;  2R7Z G;  4FP5 D;  2A68 C;  2B2T A;  4XTC S;  1EFW A;  4JI7 Q;  5J3B A;  3MEF A;  2G9D A;  4CKC A;  2B63 B;  3OYY A;  1XYI A;  4H44 C;  2F0F A;  3CCV A;  4P72 A;  1IBM Q;  3E6Z X;  3LWU A;  2VL6 A;  1PH9 A;  1KIX A;  2NYZ D;  2EY1 A;  4WJW A;  1XPR A;  3I4N G;  4DR5 Q;  4B3R Q;  1B2T A;  1VQA A;  4ZQ3 A;  3ERQ A;  3PO3 H;  1P16 A;  1VDZ A;  2HIX A;  4DF7 A;  5EQ0 A;  3URY A;  2B39 A;  3D0F A;  2F0W A;  2I5H A;  2F3V A;  2OEO A;  1X3Q A;  1SYG A;  2BE5 C;  5FLX E;  4HJ7 A;  4F7X A;  4GOP A;  1NJI C;  4A3B B;  5HGQ A;  5JVG 3;  2SNS A;  1PYB A;  2CKZ B;  1PH5 A;  1B1Z A;  1GHK A;  1V1P B;  3S17 H;  1Y69 U;  2HD3 A;  1PZI D;  4A3C G;  2EPB A;  3PGZ A;  3GD7 A;  3CHB D;  1A3T A;  3AB9 A;  3UDF A;  1NY4 A;  4NXN L;  1VQP A;  3HOZ B;  3K7A B;  3S15 B;  1FR3 A;  1KRT A;  1LAB A;  1YI2 A;  3M4O B;  2PCF B;  3G6E A;  2DJF C;  1PRT D;  1MJE A;  3F2U A;  4WJ4 A;  1STB A;  4MZ9 A;  1JE5 A;  1B50 A;  1CKO A;  2MP1 A;  3BYY B;  1TY2 A;  4DAM A;  1BQQ T;  4KLK A;  2Z6K A;  2F0D A;  1B9M A;  4AQY L;  4WJ3 M;  3TP8 A;  4DV3 L;  1L1O A;  3KUP A;  3K6O A;  3SDZ A;  2K50 A;  3VR6 A;  2XRQ D;  4QJF A;  3HOU B;  1V1O A;  4YY3 Q;  2NUC A;  1IYV A;  1AZP A;  3IKJ A;  4GN3 B;  1SFO B;  3QB3 A;  5KIX A;  1F9S A;  2UUC L;  4JW0 A;  4P74 A;  1S5B D;  1LYL A;  3BS1 A;  3KLW A;  4DR3 L;  5AFW A;  1BXT A;  1X3F A;  2VQF Q;  1EUJ A;  1JOO A;  2Z4I A;  1KD1 C;  5HGT A;  3BDC A;  3FVQ A;  3PCO B;  3S1Q H;  2E2H B;  1E2V A;  3ITP A;  5HY6 A;  2DY8 A;  1SNC A;  1TWG B;  3AU7 A;  1GUT A;  3MXU A;  1VQ5 A;  1W3S A;  1I4G A;  1STA A;  3STB C;  2FFK B;  5LMU L;  2ZXR A;  5AJ3 L;  5JEA J;  2XRS D;  4KY5 A;  4H13 C;  1ESF A;  3H94 A;  1BCP C;  2K75 A;  4CDF C;  3H15 A;  1HHV A;  1PH7 A;  2LKV A;  5IY0 A;  3NP8 A;  1WTH A;  1R9T H;  2E2D C;  1UEB A;  4XIG S;  4XYO A;  4AIM A;  2QCP X;  2HCC A;  4L63 B;  1PVO A;  3K58 A;  1L2F A;  3DEP A;  3Q6S A;  2N8N A;  1IBL L;  4L5R C;  3CQZ B;  2BE5 D;  3SEB A;  1TXY A;  5IT9 c;  4JI8 L;  4LJZ C;  4ZK9 B;  1NTG A;  2QW7 A;  2R7Z B;  1HR0 L;  5COR A;  4NB3 A;  2SEB D;  1A15 A;  4BA1 I;  2PPB C;  3A55 A;  2CQA A;  1PFS A;  4IJL A;  4HJ8 A;  4A4I A;  4B9W A;  1SJH D;  3QOL A;  4NXN Q;  1F9P A;  4PQX A;  2OQ0 A;  3TDQ A;  5I2X A;  4A93 G;  1PZK D;  1PH3 A;  1VQ9 A;  2B2U C;  2EE1 A;  4RG1 A;  4DR4 L;  2F0O A;  2KJX A;  4G4K A;  1JB3 A;  1HQR D;  3NWT A;  4BBR G;  1Q46 A;  5FLM G;  1TS4 A;  1WTR A;  1SYE A;  1XPO A;  1LTB D;  1X3E A;  5CV4 A;  1MSH A;  4Y7N H;  3MWY W;  4PNY A;  3C3L A;  1X3P A;  1K8O A;  3IL8 A;  2ICI A;  4MTK A;  1A0I A;  1NR4 A;  3A74 A;  2RF4 A;  4ODG A;  4AQY Q;  1ILP A;  4JOI A;  4DV3 Q;  3K57 A;  2WAC A;  2HUG A;  1Q7Y C;  1JR0 D;  4ME5 A;  3H3V I;  4JC0 A;  5ELD A;  3I4M H;  3J80 L;  5IYB G;  2HQE A;  4OWT B;  2EXZ A;  3UE1 A;  3QIA A;  3E5S A;  4BA2 I;  4KHP Q;  1IYJ B;  1MJC A;  3M4P A;  4DR3 Q;  4IPG A;  2RDH A;  1Y1W B;  4DV7 L;  2UXC L;  1S5C D;  1XMO L;  2JA8 H;  1FYC A;  2R61 A;  1WCM B;  1WVL A;  5C3X A;  3M3Y B;  3D6W A;  2VZA A;  4R4Q A;  1G6Z A;  4U68 A;  3CCE A;  4DV0 L;  1SMX A;  1LAC A;  1N8R C;  1A62 A;  4CDE C;  2JSO A;  1EOV A;  5I2Y A;  1CKM A;  5EKK A;  3P1H A;  1XJV A;  1X32 A;  1SBB B;  4DAY B;  4IFD I;  3V05 A;  1Q86 C;  3UDI A;  2MUY A;  2F4I A;  3VYT A;  2NVT H;  1QUQ B;  1PH4 A;  4B3M L;  1WTQ A;  4EVO A;  5M5Y H;  3E0J A;  3E9H A;  2JA7 H;  5JEA H;  1RD9 D;  4KMU C;  4HED A;  1IBL Q;  4NXM L;  1ET9 A;  1HFN A;  2KEE A;  3KF8 A;  4A3K H;  4GKK Q;  3H91 A;  4JBM A;  4QUF A;  3SXH A;  1YEZ A;  3M7N A;  4DN4 M;  1HR0 W;  1HR0 Q;  4H7B A;  2RQX A;  3PUX A;  4DXG A;  4A3E B;  2OTL A;  4RCN A;  2YV5 A;  1L0Y B;  1IBK L;  1CHP D;  3RZD H;  1BCP F;  5JOB A;  4ZUJ A;  5I4D A;  4JVZ A;  1LT5 D;  2B2Y A;  3F8T A;  2E2I B;  4PZ7 A;  1YNN C;  4DR4 Q;  5NUC A;  1SJE D;  4QY7 A;  1K28 A;  4POF A;  1MIU A;  1Q1B A;  1KRS A;  4A3I G;  3HOY B;  2ZJR A;  3SK8 A;  4CDD C;  2XN9 C;  5JJI A;  3A56 A;  4EQ5 A;  3D3R A;  1PFB A;  1BBU A;  1HNW L;  1C48 A;  4B3S L;  4DR6 L;  1QCB D;  3HOX H;  1D7Q A;  1AEX A;  2VUM B;  3TP7 A;  1STE A;  2KCN A;  2WKC A;  5T1I A;  1KC8 C;  3VR3 A;  4HMJ A;  4A3J H;  1TVX A;  3NBH B;  4QQB X;  1EQR A;  3SK6 A;  3HOV G;  1F9Q A;  4A93 B;  3OW2 A;  2R7D A;  1B8A A;  2Q2I A;  3KDF A;  1C4Q A;  1DGS A;  4DV7 Q;  2OXP A;  1ENA A;  4JBK A;  1EYA A;  1HCZ A;  4KHV A;  2C9O A;  4DV0 Q;  2TSS A;  3X3N A;  2EXD A;  4B9X A;  4DV5 L;  2RA4 A;  3KBX A;  3F2D A;  3EVQ A;  2B8F A;  2WB1 E;  4G7O C;  1LTI D;  2K6A A;  2F0T A;  1VQM A;  5M5X H;  1IXR A;  5I6W A;  2KUM A;  2JA9 A;  1EY9 A;  5GRO A;  5JJZ A;  3J81 L;  1SLJ A;  1JT8 A;  5JJL A;  4CBV A;  2IJ0 A;  1I4P A;  1OTC A;  4A3D H;  4CJ0 B;  1X3G A;  1BUV T;  1SNO A;  4IZ8 A;  2EJG C;  5KND A;  2N3S A;  5M3M H;  2F0S A;  3PUZ A;  3CMA A;  1RF2 D;  3MVV A;  3TRE A;  1JWS D;  2JA5 G;  3FMC A;  2RKS A;  5CBE E;  3S2H B;  1IZ6 A;  1N34 L;  3P75 A;  3PSI A;  2XSC A;  4A76 A;  2WV6 D;  1VQN A;  5BN5 A;  5E1F A;  2PI2 E;  5I6Y A;  1LTA D;  1TS5 A;  4A3G G;  5GAE C;  2K4K A;  2VB3 X;  2F1M A;  4Q0F A;  5ELN A;  4X3S A;  3H0G G;  2A69 C;  4JI0 L;  1VQL A;  2PNH A;  1PTO B;  4FF3 A;  5D14 A;  3PO3 G;  2K03 A;  1F77 A;  2NN6 H;  3C1F A;  3I72 A;  1EYC A;  4C1N I;  3FHW A;  3U9O A;  5LMN L;  2JN4 A;  4BY7 G;  4OO1 H;  1TWC H;  3I7F A;  3M4Q A;  5IOD A;  4GLV B;  5IT9 L;  1Q12 A;  1CUK A;  2RDF A;  5EKI A;  4HIM A;  3VA7 A;  1HNW Q;  2AQ1 B;  2F0E A;  3RZO H;  1RJT A;  5C4X B;  1D5Z C;  2Q8R E;  5C44 B;  1LUZ A;  2E5L Q;  1IL8 A;  1MKH A;  4ME3 A;  1KDA A;  5IGE A;  1EYD A;  4K14 A;  2KCM A;  4KKT A;  5DM7 3;  2IHE A;  4U67 3;  2QDB A;  3T4A C;  1HZC A;  1QVC A;  1UNS A;  1SNQ A;  3M85 A;  1I6H H;  2WKD A;  1M4V A;  5CV7 A;  1GOZ A;  3CF5 A;  2K14 A;  2C5C A;  1FGB D;  3FPU B;  3PMF A;  3QJY A;  3S2D H;  2PZW A;  1VQ6 A;  1JJC B;  4OEL B;  5IYC G;  4A3F G;  2E2J B;  3RLF A;  1JJ2 A;  5BR8 L;  1AFP A;  4X62 L;  1J5E Q;  1CFM A;  5L37 A;  3E9I A;  1ROD A;  1U0L A;  5IOC A;  3S16 B;  4KD4 A;  1FD7 D;  1X6O A;  2GVA A;  5FLX c;  4DV5 Q;  2F03 A;  2L1B A;  4BXX H;  1HZA A;  4O0A A;  3W3A A;  3K59 A;  1VQJ A;  5C4Z A;  3HOZ G;  4FXK C;  2HDL A;  3VA5 A;  1V9P A;  5IGD A;  2P5Z X;  2PI2 A;  3TS2 A;  2A6H D;  1YNX A;  1HH2 P;  4LF9 L;  1VMC A;  1KL9 A;  3CCL A;  1Q82 C;  1N36 L;  1DOM A;  4IFD G;  4DXF A;  1CQV A;  1SE8 A;  2TMP A;  3N6R A;  2EYH A;  1WJJ A;  2F0I A;  1EQQ A;  1I94 L;  3K8A A;  4GZY C;  1VQD A;  4P2C B;  5M5W B;  3WOE A;  1F2Y A;  4LUV A;  3JAM L;  2K52 A;  1NBW A;  1NAP A;  1N32 L;  1N34 Q;  1D1K A;  1U4L A;  3HOU G;  5C0X I;  2J0T D;  4NP5 A;  3S1M B;  4ZLT F;  3T1Y L;  2KOL A;  5JPN C;  2MPM A;  4A3M B;  1BKB A;  1W6K A;  3HOW H;  3EA6 A;  4JI0 Q;  1LTT D;  3PO2 B;  2ZJQ A;  1RIP A;  4V19 0;  4XXE A;  4JI2 L;  4C1N K;  4FF2 A;  2JEA I;  3JC6 6;  1LTL A;  1NMF A;  4GNX C;  5FOB B;  1W6J A;  2YTV A;  2CH4 W;  3TP6 A;  4UY8 C;  1A2T A;  1K8A C;  1X55 A;  2B3G A;  5IYD G;  3DM1 A;  2SNM A;  3PIP A;  3M4Y A;  1SSO A;  1T9H A;  4EGV A;  1L0W A;  3IRB A;  4H0L C;  4JCV E;  1STY A;  2KHJ A;  3Q8D A;  4G7H C;  2NZ1 D;  2VNU D;  4GN5 A;  2QA4 A;  4DK1 A;  3A8I E;  3J7A F;  1U4R A;  4K0K L;  2Z8L A;  3DWP A;  1EU3 A;  1K3B C;  2B2W C;  2EDG A;  4C56 C;  1C7Y A;  1CK1 A;  1Z7T A;  4JI4 L;  4FDB A;  5IGF A;  2IHF A;  4E6I A;  2RVL A;  3K5N A;  3PO3 B;  1ENF A;  3CCM A;  3I4O A;  3BVZ A;  1OXU A;  3J7Y W;  1EZ6 A;  2ZTE A;  5BR8 Q;  4X62 Q;  4BY7 B;  1F2Z A;  5IP9 G;  4FXD A;  3R2I A;  2A5H A;  2K33 A;  2M00 A;  4JV5 L;  5CMD A;  4N8X 1;  5A2Q E;  2L0C A;  2QEJ C;  2ZTC A;  2NVX H;  1CA6 A;  1SDF A;  1K73 C;  4K8I A;  1M1K C;  1E2Z A;  4LFB L;  1ICW A;  3HKZ E;  2Z1C A;  2F4V L;  5JVH 3;  1STN A;  3HFZ B;  1PH2 A;  1RTO A;  4ILW A;  1RCV D;  1HRJ A;  5CC4 A;  2QDL A;  1CM9 A;  3BZC A;  5GAD C;  1U5K A;  1II3 A;  3K0X A;  1HNZ L;  3OSO A;  3LNN A;  1BNZ A;  2LMC B;  4NMZ A;  4OX9 L;  4LF9 Q;  2B29 A;  3KF8 B;  5D3D A;  2B2U A;  4RGO S;  1BOS A;  2HT1 A;  2ZTD A;  1X9N A;  2K01 A;  4QIW B;  1I50 H;  1RHP A;  2Z4H A;  1I94 Q;  4RFB A;  4KY7 A;  3SK4 A;  2NZO A;  3ULL A;  3NEM A;  4A3F B;  3CP0 A;  3H09 A;  1TY0 A;  3K5O A;  1ET6 A;  1N32 Q;  4KKU A;  2I5L X;  1PFN A;  2XGT A;  1PZJ D;  4WOR A;  4LF4 L;  3AFP A;  5C6A A;  1DD2 A;  4LF5 L;  4PMW A;  3ND8 A;  4LFA L;  2M2L A;  1TS3 A;  4DU9 A;  3MXP A;  5DEH A;  1HXY D;  1ZYR C;  4IN3 A;  2D5D A;  4IUV A;  5I9O A;  4B3T L;  1QB5 D;  1SN8 A;  3DWQ A;  1LLR D;  3PF5 A;  1Y1W G;  3O13 A;  4JI2 Q;  3Q22 A;  2EYF A;  2R93 H;  2F0V A;  1TWA B;  2Q2T A;  1TWH B;  1WCM G;  1SMY D;  4HTH A;  2J7Z A;  1VQH A;  1QE6 A;  4UPA A;  2RCF A;  2RHQ B;  4YHH L;  2BH8 A;  1QVG A;  5M3F G;  4RGM A;  3KOJ A;  2D0O A;  5JAV A;  2AKW B;  4XT1 B;  1E24 A;  2I46 A;  1G6P A;  3RLN A;  4QUC A;  1Q81 C;  1O7Y A;  2RCN A;  1TWF B;  2VXW A;  1QZH A;  2F0P A;  4LUZ A;  2CW0 D;  3KDF B;  1KDC A;  5ELF A;  3B6Y A;  4K0K Q;  2EQS A;  1O80 A;  3VYS A;  2ZM6 Q;  4DFA A;  3CW2 C;  1R9T B;  4LMQ D;  5J1Z A;  4JI4 Q;  4K2L A;  3GTG H;  1QOH A;  1PYS B;  3NTI A;  2R92 H;  3D31 A;  2AHO B;  3BZK A;  3IFD A;  1EU4 A;  5F2D A;  1PRT F;  5COY A;  5FKA C;  1I3Q H;  4X3T A;  1PLF A;  2YYZ A;  3QO2 A;  1VF5 C;  4X6A H;  1G91 A;  5IP7 G;  5CV8 A;  3S9W A;  1IW7 C;  4A3E G;  1Y1V H;  1OXX K;  3BU2 A;  4QCL A;  3KF6 B;  1XMQ L;  2A73 B;  1AN8 A;  4ID6 A;  2F4V Q;  3BDL A;  1YJ9 A;  1VF7 A;  3UE0 A;  2UUA L;  3G7L A;  3GTM B;  1I4X A;  1DZ1 A;  5EPL A;  1PXU A;  3I4L A;  3P7J A;  1MD2 D;  3GTL B;  4C3J G;  1S40 A;  3TSS A;  3A7A B; 
#chains in the Genus database with same CATH homology
 1IBK L;  3HOY G;  3OTO Q;  2WAQ E;  4A3L H;  1XTD A;  5C3E H;  3RZD H;  2Y0S E;  4L5Q A;  2B63 G;  4LFC L;  1VQO A;  2NVY H;  3UDX A;  1WFQ A;  3F8T A;  3S2H H;  4PZ7 A;  4DR4 Q;  2UXD L;  3K7U C;  3GTK H;  2UU9 L;  4QY7 A;  1C0A A;  3F2B A;  1PH6 A;  3VDY A;  4POF A;  1HNZ Q;  4DR1 L;  1MIU A;  1GVP A;  2ATW A;  1Q1B A;  3CCJ A;  2JA8 G;  1KRS A;  2VUM G;  3PUW A;  4A3I G;  3J80 i;  1N36 Q;  2ZJR A;  1N33 Q;  5JJI A;  4DUZ L;  4X64 L;  2JJQ A;  4EQ5 A;  4LFA Q;  1BBU A;  1VQB A;  5C0X G;  2YTY A;  3A5U A;  3T1H L;  5FJ8 H;  1PH8 A;  2JA5 H;  4LF7 L;  1AE2 A;  1HNW L;  2OTJ A;  1I5F A;  2JQO A;  4B3S L;  4DR6 L;  2XTI A;  4OWX B;  3U58 A;  1VQE A;  3FKI H;  4POG A;  1OXV A;  2AWO A;  2WB1 G;  1VCI A;  3HOX H;  2E2H H;  1XNQ L;  2BH2 A;  1D7Q A;  1CSQ A;  1K8G A;  3I55 A;  1YBY A;  4HJ9 A;  2R92 G;  4LW1 A;  4JI6 L;  1TWG H;  3GDE A;  3U4Z A;  2JA6 H;  4A3G H;  2D0P A;  4A3B G;  2VW9 A;  1KC8 C;  1VQ8 A;  4A3J H;  3J81 i;  2OQK A;  5IWA Q;  3NBH B;  3T1Y Q;  1EQR A;  4QQB X;  3H0G H;  2CWA A;  4APV A;  3RNU A;  3HOV G;  2JEB I;  3OW2 A;  2R7D A;  2FXQ A;  3EBE A;  1B8A A;  2Q2I A;  3KDF A;  4KI0 A;  1YHQ A;  1QZG A;  1GKH A;  5C4X H;  5C44 H;  1Y1V G;  3PF4 A;  1QVF A;  2JA7 G;  1DGS A;  4J15 A;  5JEA G;  1IBM L;  2R6G A;  4C3I H;  4DV7 Q;  4LF6 Q;  3CC4 A;  4JBK A;  2AWN A;  4L5T A;  2UUB L;  4BY7 H;  1LM0 A;  4A3K G;  2E8G A;  1B7Y B;  4QL5 A;  4JBW A;  3RR5 A;  4DR2 Q;  2ZJP A;  4DV0 Q;  3AQQ A;  1X56 A;  3F2C A;  2EXD A;  2UXB L;  4DV5 L;  3UDG A;  3E0E A;  5ELO A;  3F2D A;  2UUC Q;  4C3H H;  2B63 H;  1QUQ A;  4X65 L;  2MO1 A;  4OO1 G;  4RMF A;  2WFW A;  2PQA A;  4OWW B;  4DR7 L;  1UE1 A;  2WB1 E;  3FP9 A;  3CME A;  1VQM A;  2IX1 A;  4Y52 H;  2YU9 H;  4A3L G;  5C3E G;  4YWK A;  5M5X H;  2E2J H;  2R7Z H;  1IXR A;  4JBJ A;  2VS1 A;  1EIF A;  2A19 A;  4PG3 A;  2JA9 A;  1PH1 A;  1YHB A;  1X65 A;  5GRO A;  1K0R A;  1YHA A;  1SLJ A;  2V1C C;  1EIY B;  2ES2 A;  1JT8 A;  3GTP H;  5JJL A;  3HKS A;  3H3V H;  3S16 H;  4P73 A;  1BVS A;  4YCU A;  1K3R A;  2HHH Q;  3J80 c;  1NE3 A;  1OTC A;  3K80 C;  4A3D H;  4DNI A;  1X3G A;  3ER0 A;  4GS3 A;  5LMU Q;  2GVB A;  5AJ3 Q;  1BBW A;  5DLQ E;  4YWM A;  1XMQ Q;  1Q8K A;  5IYC H;  4A3F H;  3W1B A;  2N3S A;  5M3M H;  4DPG A;  1YIJ A;  3PUZ A;  3CMA A;  3TRE A;  3I56 A;  5K36 G;  2JA5 G;  4UP9 A;  5FJ8 G;  2BA0 A;  5C4J H;  2DGY A;  4IO9 A;  3RN2 A;  2UUA Q;  3I4N H;  4A3B H;  1IZ6 A;  1FVI A;  1G51 A;  1N34 L;  1Z9F A;  3PSI A;  2ALY B;  4R1J A;  1UE7 A;  4A76 A;  3FKI G;  2F3I A;  3RLO A;  2LXJ A;  3HOX G;  1PHJ A;  1VQN A;  3LGJ A;  4HID A;  3J81 c;  4JV5 Q;  2PI2 E;  3EIV A;  3HOZ H;  3K7A H;  4KHZ A;  1FJG Q;  2JA6 G;  4A3G G;  5GAE C;  3S15 H;  4JI5 Q;  2K4K A;  4KHP L;  4A3J G;  5ELN A;  3ICE A;  4PZ6 A;  3M4O H;  1JJG A;  3H0G G;  1E3P A;  4LFB Q;  1Q1E A;  5GAH C;  4JI0 L;  1VQL A;  1S3O A;  4LFC Q;  2PNH A;  3NEN A;  2RHS B;  1H95 A;  4JI8 Q;  3PO3 G;  2UXD Q;  3TQY A;  4O2D A;  1TWA H;  5C4X G;  1TWH H;  5C44 G;  2VQE L;  4YWL A;  2ASB A;  2AMC B;  3FHW A;  4A3C H;  4YY3 L;  1D8L A;  5LMN L;  3PUV A;  4DR1 Q;  2K5N A;  2JK8 A;  1WI5 A;  4NPS A;  1CKN A;  4R4I A;  3SGI A;  5GAG C;  4AYB E;  1SRO A;  4BY7 G;  4R4O A;  4OX9 Q;  1TWC H;  4DUY L;  2ZM6 L;  2I5M X;  1NMG A;  4A3M H;  4DV4 L;  2KHI A;  3I7F A;  3M4Q A;  3MXN B;  4GLV B;  4LWC A;  4X64 Q;  4GNX B;  4HIO A;  1Z47 A;  1Q12 A;  1CUK A;  2N49 A;  3T1H Q;  3PO2 H;  4HIM A;  1HNW Q;  1SR3 A;  1VS0 A;  1WOC A;  1M90 C;  4LF7 Q;  3RZO H;  2CWP A;  2VQF L;  2C35 B;  2E5L Q;  3HOU H;  1LUZ A;  1HZ9 A;  2KCT A;  1MKH A;  3M3Y H;  4IJH A;  1TWF H;  3J7A 5;  4ME3 A;  3F1Z A;  4OON A;  5EAY A;  1KHI A;  4DV6 L;  2KCM A;  3U50 C;  1SFO H;  2IHE A;  4JI6 Q;  3DM3 A;  2R7Z G;  4LF4 Q;  4XTC S;  1HZC A;  1EFW A;  1QVC A;  4JI7 Q;  3M85 A;  4LF5 Q;  4MTN A;  5J3B A;  4IOC A;  3MEF A;  1RL2 A;  2IT1 A;  1I6H H;  4LF8 L;  3OYY A;  2LSS A;  3AYH B;  3CF5 A;  2K14 A;  4YCW A;  3CCV A;  1ASY A;  4A3D G;  4P72 A;  1CKN B;  4TQU S;  4GKK L;  1IBM Q;  4B3T Q;  3S2D H;  3AEV A;  1PH9 A;  2K5V A;  1JJC B;  2VL6 A;  5IYC G;  4A3F G;  1VQ6 A;  2IY5 B;  3RLF A;  2N78 A;  5M3M G;  5BR8 L;  1KIX A;  1JJ2 A;  4X62 L;  1J5E Q;  1XPR A;  3JAM i;  3I4N G;  4DR5 Q;  3E9I A;  4IPC A;  1U0L A;  4B3R Q;  5IYD H;  2UXB Q;  4DV5 Q;  1X6O A;  5FLX c;  2GVA A;  1HZB A;  2PMZ E;  4DK6 C;  1VQA A;  1YVC A;  2MNA A;  4LNQ A;  4BXX H;  4X65 Q;  1HZA A;  4YHH Q;  4O0A A;  3PO3 H;  1VQJ A;  1FGU A;  1P16 A;  2HIX A;  3WWV A;  3G4S A;  3HOZ G;  4DR7 Q;  1CSP A;  3D0F A;  4JI1 L;  2HIV A;  2I5H A;  2UXC Q;  1V9P A;  3GTM H;  1YJW A;  2PI2 A;  4HJ7 A;  1XMO Q;  3TS2 A;  4GOP A;  4MNO A;  1NJI C;  5HGQ A;  1PYB A;  2CKZ B;  1PH5 A;  1YNX A;  3GTL H;  3G48 A;  3S17 H;  2NN6 G;  1P8L A;  1HH2 P;  2HQL A;  4GOP C;  4LF9 L;  4A3C G;  3U4V A;  1KL9 A;  3PGZ A;  3CCL A;  3GD7 A;  2CQO A;  1Q82 C;  1N36 L;  3UDF A;  4IFD G;  1NY4 A;  4QIW E;  1SE8 A;  1YIT A;  3CQZ H;  4NXN L;  1VQP A;  1GD7 A;  1WJJ A;  1EQQ A;  1I94 L;  3K8A A;  4A3M G;  1VQD A;  1KRT A;  1YI2 A;  3G6E A;  1JMC A;  5IP9 H;  4LUV A;  3PO2 G;  1EYG A;  2K52 A;  1NBW A;  1N32 L;  1MJE A;  4WJ4 A;  1N34 Q;  3HOU G;  5C0X I;  4MZ9 A;  3CCU A;  1JE5 A;  2CCZ A;  4P75 A;  3GTJ H;  4B3M Q;  1XNR L;  1K83 H;  1CKO A;  3T1Y L;  2D62 A;  3A5Z B;  5IE8 A;  4AYB G;  3CCS A;  4ALP A;  4DAM A;  4JYA L;  4KLK A;  2Z6K A;  1BKB A;  4P71 A;  4GOP B;  4AQY L;  4NXM Q;  5E7N A;  3HOW H;  4WJ3 M;  4DV3 L;  1L1O A;  4JI0 Q;  1VQF A;  2ZJQ A;  1RIP A;  2K50 A;  2Z6K C;  4QJF A;  4GNX A;  4JI2 L;  2VQE Q;  1AE3 A;  1L1O C;  2VY3 A;  4YY3 Q;  2JEA I;  3JC6 6;  1PA6 A;  4X66 L;  1LTL A;  1NMF A;  3JAM c;  4GNX C;  4GN3 B;  3STB D;  1EWI A;  4DUY Q;  1S72 A;  3GTO H;  4A93 H;  2UUC L;  3L0O A;  2YTV A;  3EN2 A;  3M9B A;  5C0X J;  4DV2 L;  4P74 A;  3S1R H;  1K8A C;  1IBK Q;  1LYL A;  1X55 A;  4UY8 C;  2B3G A;  5IYD G;  3CD6 A;  5JJK A;  4UP7 A;  3KLW A;  3PIP A;  4DR3 L;  1T9H A;  4BXX G;  3ULJ A;  5GQO A;  1X3F A;  1L0W A;  2VQF Q;  4DV1 L;  1E1O A;  1EUJ A;  1X54 A;  3IRB A;  4JCV E;  4BBR H;  4DKA C;  1KD1 C;  2KHJ A;  3Q8D A;  5FLM H;  2VNU D;  3HKZ G;  1KQS A;  2UU9 Q;  3PCO B;  3S1Q H;  2A1A A;  4C2M H;  4GN5 A;  1E1T A;  2QA4 A;  4GKJ L;  4DV6 Q;  5HY6 A;  4JG2 A;  1XPU A;  3CAM A;  4K0K L;  2LXK A;  3PIO A;  1L1O B;  1VQ5 A;  1W3S A;  2EIF A;  4DUZ Q;  1C7Y A;  2Q2U A;  3STB C;  2KBN A;  5LMU L;  4JI4 L;  4JI3 L;  5AJ3 L;  4LF8 Q;  1O7I A;  4FDB A;  2IHF A;  1Y1W H;  1OXT A;  5JEA J;  4GN4 B;  1GO3 E;  3CCM A;  2K5H A;  2I0Q A;  3I4O A;  4B3S Q;  1HNX L;  1WCM H;  4DR6 Q;  5H1S E;  5IYB H;  2K75 A;  1XNQ Q;  1A8V A;  4HJ5 A;  3H15 A;  1OXU A;  2ZTE A;  5BR8 Q;  4X62 Q;  1PH7 A;  5IP9 G;  1GM5 A;  5IY0 A;  3KJP A;  2OWO A;  4JV5 L;  3K81 C;  5M3F H;  3RN5 A;  1N9W A;  1UEB A;  1V1Q A;  4XIG S;  4AIM A;  1Y14 B;  1R9T H;  2ZTC A;  4IOA A;  2NVX H;  4JI5 L;  1PVO A;  1AH9 A;  2MFI A;  3L7Z C;  1K73 C;  3GO5 A;  1L2F A;  2JE6 I;  2N8N A;  1M1K C;  1IBL L;  4L5R C;  2NVQ H;  3S14 H;  1IL2 A;  3HKZ E;  4LFB L;  3I2Z A;  1TXY A;  4AH6 A;  5IT9 c;  2F4V L;  1B70 B;  3HFZ B;  4JI1 Q;  4JI8 L;  1VQG A;  1PH2 A;  2Z0S A;  3HOW G;  1NTG A;  3BZC A;  5GAD C;  2UUB Q;  1U5K A;  3A0J A;  3K0X A;  1HR0 L;  1HNZ L;  3TEH B;  2IX0 A;  1E7Z A;  1HJP A;  4NB3 A;  4BA1 I;  4OX9 L;  1E22 A;  4LF9 Q;  2B29 A;  2OCE A;  4TVA B;  1W2B A;  1PFS A;  3KF8 B;  4IJL A;  2MQH A;  4A4I A;  4HJ8 A;  4PZ8 A;  2HT1 A;  3OTO L;  2ZTD A;  1X9N A;  3TS0 A;  4NXN Q;  3S24 A;  2OQ0 A;  1I50 H;  4A93 G;  1I94 Q;  1PH3 A;  1VQ9 A;  4UP8 A;  2NZO A;  4RG1 A;  4H02 A;  2E5L L;  4DR4 L;  3ULL A;  2GN5 A;  1G29 1;  3NEM A;  3CP0 A;  2QGQ A;  3DLL A;  1N32 Q;  2I5L X;  5IP7 H;  3CXC A;  2XGT A;  4A3E H;  2ID0 A;  1SRU A;  1Q46 A;  3KYH C;  4BBR G;  4LF4 L;  2CFM A;  3AFP A;  5FLM G;  3KFU A;  1KXL A;  3NEL A;  1XPO A;  1X3E A;  4A75 A;  4JI7 L;  4LF5 L;  1UWV A;  4Y7N H;  1XNR Q;  1N33 L;  4PMW A;  4LFA L;  2L15 A;  1A0I A;  1C9O A;  3A74 A;  4IPH A;  4IPD A;  1UE5 A;  2RF4 A;  3W5O A;  4AQY Q;  4JYA Q;  4JOI A;  2E2I H;  3G71 A;  4DV3 Q;  4HIK A;  1Q7Y C;  1SN8 A;  3ZJY C;  4B3T L;  2QEX A;  3PF5 A;  1Y1W G;  4JC0 A;  3L2P A;  3H3V I;  4JI2 Q;  2MO0 A;  4JOI C;  3KJO A;  2R93 H;  4LUO A;  1YJN A;  1J5E L;  4C3J H;  1VQC A;  2Q2T A;  3I4M H;  2KEN A;  1WCM G;  5IYB G;  4BY1 G;  4OWT B;  4X66 Q;  4DR5 L;  3GTQ H;  3HOY H;  1VQH A;  3UE1 A;  4B3R L;  5IWA L;  4DK3 C;  2WP8 J;  4UPA A;  3J7Z C;  4BBS G;  4BA2 I;  4KHP Q;  2RHQ B;  4YHH L;  2Q2H A;  4DV2 Q;  1IYJ B;  2BH8 A;  3CCR A;  5M3F G;  1YZ6 A;  1MJC A;  3KOJ A;  1QVG A;  2D0O A;  2NZH A;  3BJU A;  2AKW B;  3M4P A;  2BA1 A;  4IPG A;  4DR3 Q;  1JB7 A;  3S1N H;  1VQI A;  3ERS X;  4DV7 L;  2UXC L;  1E24 A;  1G6P A;  4LF6 L;  3RLN A;  4DV1 Q;  1XMO L;  1K9M C;  1J6Q A;  1FL0 A;  2JA8 H;  2VUM H;  4GLA C;  1Q81 C;  3KF6 A;  4A3I H;  4L5S A;  1OXS C;  1WYD A;  2RCN A;  4R4Q A;  2VZA A;  5LMN Q;  2R7F A;  4LUZ A;  5LMN W;  4DR2 L;  1QZH A;  1ASZ A;  4GKJ Q;  4OXP A;  3KDF B;  3CCE A;  4DV0 L;  4EX5 A;  3B6Y A;  1SMX A;  4K0K Q;  2EQS A;  1A63 A;  2ZM6 Q;  4QGU A;  3CW2 C;  4GLX A;  1N8R C;  1A62 A;  4DV4 Q;  1KAW A;  4JI4 Q;  4JI3 Q;  1EOV A;  1VQ4 A;  3CPF A;  3GTG H;  1CKM A;  1PYS B;  2NN6 I;  1XJV A;  3CCQ A;  2R92 H;  2WAQ G;  3D31 A;  2AHO B;  3BZK A;  4DAY B;  1HNX Q;  2Y0S G;  4IFD I;  1Q86 C;  1V43 A;  3UDI A;  4YCV A;  3W1G A;  4OO1 I;  1I3Q H;  2NVT H;  2DUD A;  1QUQ B;  4HJA A;  2YYZ A;  2F52 A;  1VQK A;  2A8V A;  3PV0 A;  2PQA B;  1PH4 A;  3HOV H;  2YTX A;  4B3M L;  2HHH L;  4X6A H;  5M5Y H;  5IP7 G;  3J81 j;  4A3E G;  1Y1V H;  3AFQ A;  1OXX K;  3E9H A;  3PUY A;  2JA7 H;  3BU2 A;  4NXM L;  4R4C A;  3KF6 B;  5M5W H;  1XMQ L;  1IBL Q;  3CPW A;  3CC2 A;  4A3K H;  4GKK Q;  2F4V Q;  3ULP A;  1YJ9 A;  1VQ7 A;  4JBM A;  3UE0 A;  3CC7 A;  2UUA L;  1YEZ A;  3M7N A;  4BY1 H;  3TRZ A;  4BBS H;  1HR0 W;  1HR0 Q;  3S1M H;  3PUX A;  2H5X A;  1PV4 A;  4R4T A;  1UE6 A;  4IFD J;  2R93 G;  2OTL A;  1S40 A;  3I4M G;  1FJG L;  2YV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...