4AQYL

Structure of ribosome-apramycin complexes
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aqyL00
2K5NA 1EIYB 3PCOB 2QGQA 1E1OA 5IP9G 5GAEC 1Z9FA 4AQYL 4BY1H 2OQ0A 4IFDG 4X66L 2JA9A 1L1OA 4Y7NH 4JI2L 2NN6G 3G71A 4BXXG 1EFWA 1LTLA 1JJCB 2BH8A 4DV7L 1WCMH 2LXKA 4A3JH 4PZ6A 4K0KL 1GVPA 4DR2Q 2XGTA 2BH2A 4DUZL 1UWVA 1QZHA 4X6AH 1HNWL 4R4CA 1E1TA 3M3YH 1Y1VG 3CCEA 4B3RL 2KBNA 4JOIA 1KHIA 3T1YL 4L5QA 2RF4A 3L0OA 2A1AA 4AYBG 3KJOA 3GTPH 3J80i 1HZCA 2NVXH 3PO2G 3GTJH 2JA5G 2B63G 4B3SL 1X9NA 3U50C 1FVIA 5IYDH 2VUMG 1Q82C 3S24A 4DNIA 4DPGA 4JI0L 2ALYB 1M90C 3TS2A 3ER0A 3STBC 4JYAL 3PO3H 5JJIA 4QY7A 3KYHC 1EOVA 4TQUS 1L1OB 1BBWA 4MNOA 1K8AC 2YU9H 4JI7L 4C3HH 3J7A5 5GQOA 1SN8A 3AEVA 4A4IA 3GO5A 3NBHB 2ASBA 4NB3A 1VQ6A 3UDIA 1PH1A 1NY4A 2YTVA 2R6GA 3CP0A 1HNXL 1YI2A 3KF6A 1K73C 3HKSA 3CCSA 1DGSA 1VQJA 1TWGH 1EQRA 3NELA 3CCJA 4KLKA 4A3MG 3CC4A 4HIDA 3KFUA 1IBLL 1Q1EA 3FKIH 2FXQA 4LFCQ 4DUYQ 1QZGA 1VQBA 2N49A 4AH6A 1Q86C 1AE2A 3JC66 3M9BA 4DUZQ 4A3BG 2PMZE 2AKWB 2IY5B 3EBEA 2VQEL 1JB7A 5JJLA 3K80C 4JG2A 5AJ3L 4DV7Q 1YIJA 2R92G 2JA6H 1OXTA 4YY3L 5IWAQ 2PQAB 3PV0A 4HJ8A 4YCWA 3J80c 4X64Q 1OXVA 1J6QA 1HNZL 4YWKA 1ASZA 3K8AA 5C3EH 4B3ML 4A3GG 3G48A 1VQ5A 4A3FH 4DV2Q 4B3SQ 4DV6Q 1I6HH 1I5FA 1V43A 3I55A 1L2FA 5GROA 1N33L 4FDBA 4UPAA 3HOXH 1XMQL 2K52A 5IYBG 4BY7H 4P72A 1PH7A 3S14H 2UUAL 2F3IA 1HR0W 1IXRA 4B3TQ 3UE1A 1PYSB 3UDXA 2ZM6Q 1K3RA 2WAQE 3HOVG 4LF8L 4LW1A 2JA8H 1WYDA 4OWWB 3OYYA 5M5YH 1VQAA 3IRBA 3CAMA 1PH3A 2Z6KC 3TREA 4GNXC 1CKNB 1EIFA 2DUDA 2K4KA 5FJ8H 4APVA 3PF5A 4UP9A 2F52A 4UP8A 4XTCS 3NENA 1J5EL 1C7YA 1XPUA 1KQSA 1MKHA 1C0AA 5FLMH 4IOAA 1YITA 4KHPQ 1Y1WG 4OONA 4A3KG 2GVAA 1JE5A 3HOZH 2ZTDA 4UP7A 1EUJA 4JI8Q 4H02A 3M85A 2ES2A 1XNQQ 4QQBX 3PUZA 2GN5A 4YCVA 2Q2UA 4LF8Q 2ZM6L 1YEZA 4DK3C 3T1HL 3RZOH 3JAMc 1KAWA 1P16A 2VS1A 4C3JH 3KF8B 1HZAA 1I50H 1HNZQ 2AMCB 3MXNB 1CKOA 3Q8DA 4HJ9A 3VDYA 5BR8Q 1VQOA 1XMOL 2K14A 2UUCQ 4JI4L 3OW2A 4A3EG 1EYGA 4P75A 4ME3A 5C4XG 2OTJA 3H15A 4A3JG 1TXYA 4A3DG 4A3EH 4JI7Q 4LUVA 2N3SA 1X65A 1K9MC 3KF6B 4BY1G 3FP9A 5LMUL 2V1CC 1KD1C 1YNXA 2EIFA 1X54A 1YHBA 5IP9H 5IP7G 4DV3L 1VQNA 2JA8G 2ZJPA 3G4SA 1YJ9A 1B70B 1VQEA 4NXML 2JK8A 4GKKL 1GKHA 2HIVA 2VW9A 2CCZA 4BBRH 2JEBI 1E22A 5C4JH 1G51A 1SMXA 4LF4Q 1X3EA 3F1ZA 3PIOA 1Y1WH 4R1JA 4A3DH 1YHAA 2R7FA 1WFQA 5C4XH 3HOZG 5HY6A 3U4ZA 1JT8A 1KL9A 3PSIA 5M5XH 4P73A 4JI3L 1WJJA 2VQEQ 2E8GA 3CCQA 4C2MH 4LF4L 3BJUA 1VQLA 1R9TH 3GTKH 3J81j 2UUBQ 4A3BH 1O7IA 1V9PA 4EX5A 1KC8C 1OTCA 1JMCA 1WOCA 1N34Q 2OWOA 3PIPA 3TQYA 5GAHC 4GN3B 1TWCH 1B8AA 1VQDA 3FKIG 4MTNA 1MJEA 3CPFA 1PH8A 2WB1G 1IBKL 4J15A 4DV5Q 4A3MH 2OTLA 4LF9Q 1FJGL 3EN2A 1HNXQ 4AYBE 1Y14B 3GTQH 2HQLA 4DR6Q 1Q46A 4PZ8A 4OWTB 4DR4Q 2AWNA 4X65Q 5C0XG 2A8VA 3T1YQ 2R7ZH 1YBYA 4A3GH 1SFOH 1IZ6A 5C44H 1P8LA 1UE7A 4OO1I 1TWFH 2MO1A 3K0XA 5ELNA 4LNQA 2K5HA 3TS0A 4JBWA 2CWPA 4PZ7A 4QJFA 3RLNA 3SGIA 4JI1L 4GOPB 4GNXB 1RL2A 2K50A 3BU2A 2KENA 2IX0A 3U58A 2I5LX 5IYCH 3CCRA 3I4NH 3PUYA 2F4VL 3PGZA 2OCEA 1W2BA 3H0GG 5ELOA 3S1QH 2H5XA 2L15A 4GN4B 1PH2A 4AQYQ 4OWXB 2WAQG 5IYBH 4JBKA 4GOPA 1VQHA 3LGJA 4HIMA 4DR7Q 1OXXK 3ULJA 4QGUA 2K5VA 3GTOH 3GTLH 2UXDL 3M7NA 4IPGA 3A0JA 4DK6C 4X62Q 1X6OA 4A75A 3T1HQ 2ZJRA 1CSPA 3H0GH 4BA2I 2IHEA 3JAMi 3U4VA 5IYCG 4DV0L 1HR0L 4LF6L 4K0KQ 1Y1VH 3ERSX 2IT1A 3M4QA 4DR3L 4YWMA 2F4VQ 1IBML 3HOWH 3K7UC 4PMWA 4IOCA 2RHQB 3CCLA 4LF7L 1BBUA 5BR8L 1PYBA 2VQFQ 2HHHL 4TVAB 2R92H 3ULPA 1YJNA 1A0IA 1X3FA 3AYHB 3PUXA 3S16H 4IFDI 3KJPA 3DM3A 3PO3G 1UE6A 4LF5Q 1K83H 3HOUG 2UXDQ 2DGYA 3G6EA 3CCUA 4DV0Q 1HR0Q 4L5RC 1G291 2NVTH 1N9WA 3GDEA 5M3FH 2CKZB 3F2BA 2ID0A 2D0PA 1V1QA 4GS3A 4HJ5A 2JA5H 2GVBA 4DAYB 1VQIA 3PO2H 1IBKQ 4UY8C 4P71A 5IP7H 4R4TA 1GM5A 4B3MQ 2YYZA 1S40A 1VQKA 2CWAA 1XNRL 1G6PA 2AHOB 1VS0A 3CW2C 1S3OA 2YV5A 4A3KH 4A93H 1A63A 4DAMA 1E24A 4JI6Q 2MNAA 5JEAJ 1VQFA 4GLXA 1BKBA 4QIWE 4JI5L 4GLAC 2QEXA 2OQKA 4RG1A 2IX1A 3ZJYC 1VQGA 2PI2A 1UE5A 2K75A 1Z47A 4DUYL 1N8RC 3CD6A 2VUMH 1EQQA 1SLJA 4BBRG 1IBLQ 4LF9L 2WP8J 4P74A 1LM0A 2VL6A 1Q7YC 3CF5A 1N34L 4BY7G 2E5LQ 3RN2A 1VCIA 2NVYH 2IHFA 1PA6A 4GKKQ 1AE3A 3HOUH 3S1MH 1TWAH 2QA4A 2Q2IA 2KHIA 3RN5A 3A5ZB 4X64L 4DR5Q 2PNHA 1QVFA 4AIMA 3H3VH 2PQAA 4JV5Q 5IWAL 4R4QA 1LUZA 1WCMG 4A3CH 2CQOA 5FJ8G 1EWIA 3F2DA 1KRTA 3S17H 1E7ZA 1JJGA 3KDFA 4LFAL 1LYLA 2Z6KA 5GAGC 3OTOQ 1QUQB 1NMFA 5C0XI 1Q1BA 5EAYA 4DKAC 4LFBL 3A74A 2RHSB 5JEAG 2E2HH 1HJPA 3F8TA 4KHZA 4L5TA 1PH9A 1UEBA 2N8NA 3AFQA 1IL2A 2EXDA 4HJ7A 2ZTCA 2UUBL 1VQ9A 1NJIC 4NXNQ 2JA7G 4A3FG 2UXCQ 1CUKA 1K8GA 1L0WA 1X3GA 4IPHA 4DV3Q 2NVQH 2UXBL 1VQCA 2R93G 2NZOA 3PUVA 5LMUQ 1CSQA 1PH5A 4JI6L 3E9IA 4OXPA 2ATWA 5H1SE 5GADC 2JA6G 1JJ2A 3PUWA 3S1NH 1X56A 2NZHA 4JI0Q 4LF7Q 4YHHL 1IYJB 3EIVA 3I2ZA 5E7NA 2R93H 3HOVH 3TRZA 3H3VI 4R4OA 4DV2L 2E5LL 2JE6I 3AFPA 2XTIA 4XIGS 3UDGA 4YWLA 4JBJA 1QUQA 1HNWQ 3HOYH 1KIXA 3HOXG 1CKNA 1I3QH 2B63H 2Y0SE 4PG3A 4HJAA 1I94L 4LF5L 1Q8KA 1NMGA 1SR3A 3BZKA 3KDFB 3AQQA 3HFZB 4OX9Q 4A3CG 4B3RQ 4A76A 1N36L 1VQMA 3UDFA 3BZCA 2Q2TA 2WB1E 5C3EG 4LUOA 4JI5Q 3HKZE 4YHHQ 4DR3Q 1J5EQ 4WJ3M 2HT1A 5FLXc 1N36Q 1KRSA 4GKJQ 3CC2A 4YY3Q 1H95A 2KHJA 4OX9L 1QVGA 4IPCA 1I94Q 4KI0A 4LF6Q 1SROA 1U0LA 3NEMA 2LSSA 2YTYA 5LMNW 4JBMA 2A19A 2UXCL 4DR6L 4WJ4A 2LXJA 4NXNL 3A5UA 3S15H 2D62A 4LUZA 3W1BA 3J7ZC 3ULLA 1T9HA 1A62A 1NBWA 3I56A 1M1KC 2D0OA 3CMEA 3CMAA 1N33Q 1VQPA 1HH2P 3RLOA 4DV6L 1QVCA 1BVSA 4JI1Q 1C9OA 5M5WH 3L2PA 4JI4Q 5HGQA 2I0QA 4BXXH 4NPSA 3KLWA 1K0RA 2WFWA 2VZAA 4DV4L 4BBSH 1WI5A 3F2CA 1GO3E 3W1GA 5LMNQ 4LWCA 1PV4A 1PHJA 3B6YA 1D8LA 1HZ9A 2Q2HA 4X62L 5AJ3Q 4O0AA 4DV5L 1FJGQ 1KXLA 5IYDG 4EQ5A 2VNUD 4X65L 2MFIA 4DR4L 3FHWA 3I4MH 1VQ8A 3I4MG 2UU9Q 4OO1G 3CCMA 1UE1A 3D0FA 4LFAQ 4IFDJ 4YCUA 1N32Q 1FL0A 1Q12A 2NN6I 1XPRA 2BA1A 3J81c 2HIXA 5FLMG 5C0XJ 1VQ4A 1PH4A 4JI3Q 4L5SA 4JOIC 3J81i 3GTGH 1CKMA 4JCVE 3K81C 2I5HA 2E2JH 4DR5L 4DR2L 2UXBQ 1SRUA 2KCMA 1VQ7A 1MJCA 3ICEA 1HZBA 3HOWG 3DLLA 5M3MG 2I5MX 3HKZG 4JV5L 2PI2E 4MZ9A 3RLFA 3TEHB 1SE8A 2EQSA 2UUCL 2BA0A 3I7FA 1PVOA 1XNRQ 1GD7A 4A3LH 1N32L 1FGUA 3W5OA 3GD7A 1S72A 3OTOL 4LFBQ 5J3BA 1X55A 2CFMA 4JC0A 4A3LG 1RIPA 1NTGA 4A3IG 4NXMQ 3CC7A 2KCTA 3WWVA 2C35B 2N78A 3CCVA 4DV4Q 5IY0A 1U5KA 1PH6A 4QL5A 3MEFA 1Q81C 3I4NG 1AH9A 5M3MH 1E3PA 1OXUA 5LMNL 5IT9c 1L1OC 4IPDA 4GKJL 2B3GA 4O2DA 4JI2Q 4X66Q 4JYAQ 3E9HA 1ASYA 3RNUA 3S2HH 2MO0A 3K7AH 1TWHH 5C44G 3KOJA 3S1RH 5DLQE 1OXSC 1XMOQ 2R7ZG 1YZ6A 2Y0SG 4C3IH 3PF4A 1MIUA 4DR1Q 2UU9L 3CQZH 1XPOA 4IJHA 3L7ZC 2E2IH 2RCNA 3HOYG 4BA1I 1W3SA 1YJWA 2VY3A 2JEAI 4DR7L 1D7QA 1PFSA 4KHPL 4DV1Q 3UE0A 5JJKA 4DR1L 4JI8L 1XNQL 4HIOA 3M4PA 2AWOA 2VQFL 4ALPA 2HHHQ 1B7YB 3STBD 1XJVA 4BBSG 2B29A 4IJLA 4GOPC 4POGA 3M4OH 3RR5A 2JJQA 4GLVB 4RMFA 2ZTEA 3CPWA 3RZDH 4Y52H 3I4OA 1IBMQ 4A93G 4POFA 1XTDA 2JQOA 3CXCA 1NE3A 4HIKA 4GN5A 4A3IH 4B3TL 3GTMH 1A8VA 5K36G 2MQHA 2JA7H 3E0EA 4R4IA 4DV1L 4GNXA 1YHQA 3S2DH 2ZJQA 2R7DA 2Z0SA 5IE8A 3D31A 4LFCL 2YTXA 4IO9A 2UUAQ 5M3FG 1YVCA 1XMQQ
chains in the Genus database with same CATH superfamily
4KJOA 1Z9FA 2A5HA 4CGYB 4X66L 1L1OA 4K5WA 4Y7NH 3G71A 4BXXG 2RSOA 5EQ0A 1AEXA 1UWVA 1PTOH 4HAEA 4MIUA 1HNWL 4B3RL 2KBNA 2L4NA 1JR0D 4JOIA 2A1AA 1ONLA 2B2WA 5KGUA 1LO5D 4B08A 1TS5A 4X3SA 3S24A 2BDOA 4DA2A 5J1ZA 3U9OA 2ALYB 3ER0A 2J0TD 4TQUS 1L1OB 2OXPA 4MNOA 3Q23A 5GQOA 2EYPA 4HTHA 3GO5A 3NBHB 2LFNA 3VYSA 4KKTA 2X69A 1ILPA 3D4WA 1YI2A 3HKSA 1DGSA 1VQJA 1O7ZA 2K1BA 3NELA 1SNCA 2K7VA 1Q1EA 1HFGA 1RODA 2R92B 3NSWA 5BN4A 3GQBA 4DV7Q 2A69C 2JA6H 2QILA 5LL6S 1M8AA 3PV0A 3SVMA 4YCWA 1Y69U 1OXVA 1HNZL 5ELDA 4QIWB 4YWKA 4A3GG 3G48A 4JVZA 2B2YA 4A3FH 4B3SQ 4OGQC 4DV6Q 1I6HH 1I5FA 2QDLA 1L2FA 2NBFA 1XMQL 4P72A 4HSVA 2P5ZX 3UE1A 3SDZA 2ZM6Q 2WAQE 3N52A 3HOVG 5C6AA 3GTMB 3K57A 3OYYA 3IRBA 3TREA 4GNXC 1R4QB 4KD4A 2K4KA 5FJ8H 4UP9A 3KBGA 3L9AX 2F52A 5DM73 1MKHA 4PMBA 3EROA 1Y1WG 3MEHA 1JE4A 2ZTDA 4JI8Q 4G4KA 3M85A 4NDXA 3OIPA 1A15A 1WCMB 1WD1A 1YEZA 5DM63 4RHSA 3FPPA 2K32A 1I50H 3VDYA 3TZDA 3Q8DA 2EY1A 1XMOL 3GTJB 1ICFB 1JWSD 1EU3A 3IFTA 1STAA 3CKIB 4JI7Q 4C3JB 5M5WB 4BY1G 3FP9A 2V1CC 3MZ5A 1VQNA 4KK7A 1YJ9A 3UI2A 4NXML 2JK8A 4GKKL 1H9SA 2F0PA 1E22A 4C2MB 1EYCA 5ELFA 4KV6A 2O5IC 4F7XA 1YHAA 2QKIC 3QOJA 5D3DA 3HOZG 3U9SA 3PQIA 4OIKA 1CA6A 1G91A 3CCQA 4WJWA 3GTQB 1E2ZA 2FMMA 5FO7B 2UUBQ 1CFMA 1V9PA 1N34Q 3TQYA 4GN3B 1RJTA 1PTOB 2ZT9C 3FKIG 2XNAC 1MJEA 3CPFA 3TP8A 1PH8A 1FJGL 4J15A 4A3MH 2OTLA 3J80E 3J7AV 4DR6Q 4PZ8A 3OWFA 4OWTB 4DR4Q 1STBA 2AWNA 5JVG3 2JP1A 4A3GH 1IZ6A 1UE7A 5JVH3 2K5HA 4QJFA 4PZ7A 4H0LC 3RLNA 3SGIA 2F4IA 1RL2A 4GNXB 2EE1A 2IX0A 1EZ6A 2PO4A 2I5LX 5IYCH 3I4NH 2CH4A 5C0XH 4N8FA 2F4VL 5ELOA 3NXWA 2L15A 4AQYQ 4Q0FA 1SYBA 2WAQG 5IYBH 1LTAD 5T1GA 3QJYA 1OXXK 1CK1A 1BCPC 4IPGA 4X62Q 2NUCA 5I6WA 4A75A 3T1HQ 3S1NB 1CSPA 5FK9C 2IHEA 3S9WA 1F9QA 2B2WC 4DR3L 2NVTB 4PMWA 2Q8TA 2HHHL 5CORA 4A3CG 3HZXA 1PTOC 2RBMA 2Q8IB 5IGFA 3PO2B 1CZWA 2B2UA 3SE0A 1GHKA 3G6EA 3CCUA 2PW5A 2Z1CA 4DF7A 1JOOA 3R3OA 2CKZB 2KVMA 2ID0A 2D0PA 1II3A 1A3TA 5C3WA 1GM5A 2YYZA 4RAUC 5IGEA 4RKLA 1XNRL 1VS0A 4ME5A 1PLFA 2YV5A 1AZPA 4DAMA 1E24A 2EYMA 1VQFA 4JI5L 3R2IA 4GLAC 3S15B 3MXPA 1KLGD 3ZJYC 1O7YA 1VQGA 2K75A 1JB3A 1N8RC 3CD6A 1CQVA 1IBLQ 4LF9L 5IGCA 1LM0A 2VL6A 2KEDA 3V96A 4ULLA 2ENBA 3FVQA 1JORA 1LTGD 4AIMA 3H3VH 4FF4A 4A3CH 1WCMG 2L9HA 4DAPA 4MN3A 5ELBA 1I4QA 3F2DA 2F0GA 5J22A 1E7ZA 4PMCA 1XXGA 1L0XB 3PIP3 5CR3A 3OTOQ 4DKAC 3A74A 1UNSA 4V190 3I3CA 4H44C 1Z7TA 2N8NA 2EXDA 4HJ7A 3BYTB 5F2DA 4A3FG 1CUKA 5TSSA 4IPHA 4DV3Q 2R93G 3NTKA 5LMUQ 1CSQA 1PH5A 1VMPA 2ATWA 4DFAA 4DAVA 1CQFA 3I2ZA 5E7NA 3A7AB 3T53B 2E5LL 2JE6I 4LJZC 3L3OC 5M5YB 1CKNA 3QR8A 2Y0SE 1I94L 2NTTA 4B3RQ 4IUNA 4OX9Q 1TS3A 1BCPD 3Q0AA 1VQMA 2M00A 3UDFA 3A8KE 1GUWA 5C3EG 1WTQA 1JC7A 2VB3X 4G57A 1MSGA 1J5EQ 4WJ3M 1S4ZA 5FLXc 2EY6A 1PRTC 4XQJA 1H9SB 4OX9L 2EYOA 1I94Q 3BDOA 1SROA 1U4LA 3RD4A 4ZUIA 3K0YA 1CTMA 2D62A 2TSSA 3W1BA 2KEEA 1N33Q 4RHRA 2VUMB 3VYUA 2C5CA 4IQZA 1QG7A 4NPSA 4PV1C 1FNVA 1GO3E 3W1GA 4FVMA 2Z6BA 4XYQA 4EQ5A 2VNUD 4X65L 4R8NA 3FHWA 3I4MH 2UU9Q 4IUQA 1PRTB 1UE1A 2F0KA 1WTOA 4F87A 3S17B 2KJXA 2EYFA 4RH6A 4ZKBB 1N32Q 1Q12A 1NUCA 2JSOA 1PH4A 2HIXA 4L5SA 4PQXA 2A68C 1HUNA 2I5HA 4EQNA 2E2JH 4DR2L 1U4PA 3BYYB 1MJCA 4JV5L 2PI2E 2UUCL 1XNRQ 3FDTA 1N32L 3W5OA 3OTOL 4JC0A 1LACA 1Q3LA 1STNA 2E2DC 2C35B 4DV4Q 1Q81C 1AH9A 3DUZA 1E3PA 1GJXA 1HTPA 1L1OC 2CVRA 4GKJL 1CA5A 4O2DA 4JI2Q 3GV6A 1FNUA 3RNUA 3BVGA 4DN4M 2MO0A 1NCVA 3K7AH 1TWHH 2ZXPA 1FR3A 3KOJA 1I4HA 3V05A 5CGKA 2F0NA 3T51B 4Q5VA 3PF4A 3CQZH 2RCNA 3HOYG 2OT2A 1HA6A 5KYLA 2LMCB 1D7QA 4R8IA 1PFSA 5JJKA 4DR1L 4RGOS 5LL6X 2HHHQ 1S5DD 1ZXTA 3OOCA 5I4DA 4GOPC 3R8BA 3RR5A 4X3TA 1SE3A 4GLVB 2G5DA 3CPWA 4Y52H 1IBMQ 4B9XA 3CXCA 4BBRB 1EY9A 3GTMH 2A69D 4NP5A 2MQHA 1W6JA 3E0EA 4BY1B 4DV1L 1YHQA 2ZJQA 2R7DA 3NUCA 1YNNC 1AZQA 5KEEA 1B1ZA 2QGQA 1E1OA 2K6AA 2K05A 2EJMA 2KA7A 5GAEC 1HQMC 1I3QB 2B63B 4BY1H 2JA5B 3WDNA 1EFWA 2BH8A 4PZ6A 5KNBA 1GVPA 4HSPA 5E4WC 1R4PB 1QZHA 4X6AH 1PTOD 3A56A 3CCEA 1FYCA 2HCIA 5KNDA 4AYBG 2NVXH 3GTJH 4K8IA 2EY2A 3Q6SA 1X9NA 5IYDH 1LLRD 4UAIA 1Q82C 2VB2X 4K8JA 4DPGA 1Y8OB 3I73A 3TS2A 3PO3H 3SHLA 1EOVA 4DAYA 1BBWA 4R9WA 3OMCA 1K8AC 2BE5D 5IGDA 4JI7L 1SN8A 3AEVA 2F0DA 3DWPA 1VMCA 4NB3A 3UDIA 1PMRA 1VQ6A 2YTVA 3CP0A 4I7AA 1BO0A 1TWGH 1EQRA 3CCJA 2MUYA 4QCLA 2FXQA 1SNQA 2N49A 1Q86C 3JC66 2NB0A 4A3BG 2IY5B 2E2HB 2AKWB 1HXYD 3OSOA 3KBXA 2GA4B 2R92G 1OXTA 2PQAB 1STGA 4HJ8A 5I6YA 3J80c 3TBIB 3WOFA 1B53A 1J6QA 1W6KA 2XN9C 1ASZA 3K8AA 3ONAB 5C3EH 4B3ML 2JA6B 1V43A 3I55A 1K8OA 1SFOB 3E3XA 1B50A 3NPPA 1PH7A 1HR0W 4K2LA 1PYSB 2RSNA 3SXHA 1K3RA 1G8ZD 1EEID 4LF8L 2JA8H 2RDGA 1WYDA 4OWWB 4PNYA 3CAMA 1EIFA 1FNWA 2DY8A 1XPUA 3EQLC 3GTOB 1KQSA 2K5WA 2JYOA 4OONA 4A3KG 1BR9A 2K28A 1XNQQ 4LF8Q 1B2TA 4OELB 3T1HL 5E1FA 3T13A 2NYZD 4KN4C 3JAMc 1KAWA 1QJOA 5CV6A 3IFDA 3M4YA 4C3JH 3KF8B 1HZAA 1SE2A 3MFYA 2M2LA 1HNZQ 3I90A 1CKOA 3T56B 1TY0A 3MXGA 5BR8Q 4HJ9A 2UUCQ 1S5FD 4KY5A 1LT4D 2SDFA 1K28A 4A3EG 1EYGA 3FRPB 4RCNA 4FF3A 2L12A 1B9NA 4A3JG 2F03A 1GHJA 1TXYA 5CBEE 1DOMA 1X65A 1K9MC 1BQQT 3KF6B 3NP8A 2EIFA 1X54A 1YHBA 5IP9H 5IP7G 1EWCA 1B70B 3LWUA 1VQEA 1B3QA 3DEOA 5CMDA 3C2PA 2JEBI 1RTNA 1SMXA 1F9RA 2Z4IA 3F1ZA 3PIOA 1CHQD 1CI3M 4R1JA 4FYDA 2R7FA 1WFQA 5C4XH 1JT8A 1KL9A 4P73A 1V1OA 1WJJA 5G3LF 1JICA 2E8GA 5C4JB 4C2MH 4LF4L 3I8ZA 3GTKH 3J81j 4K5XA 1K8MA 3R2TA 4CDFC 3PIPA 3KUPA 5GAHC 1HPCA 3SK6A 1VQDA 3MVVA 1IBKL 2WB1G 2L11A 4L6TB 1I4RA 5C3EB 2LS01 4AYBE 2HQLA 1Q46A 4C3IG 5C0XG 1YBYA 1Q8IA 4BWGB 3BVZA 2DNEA 3DHQA 4LNQA 4OO1I 4JI4Q 1JOKA 2CWPA 3D3RA 4KMUC 2K50A 2KENA 5KNCA 1EIHA 3SEBA 3OMGA 2PNRC 4QUCA 3MHBA 2EZVA 4OWXB 1A2TA 3FPUB 3LGJA 4DR7Q 3MXUA 1BDOA 3ULJA 4FO2A 3A0JA 1UUPA 4XT1B 4LAAA 1ENCA 4KY7A 2ZJRA 1HFNA 1CZGA 3ERSX 3I70A 4LK1C 3M4QA 4YWMA 1IBML 3MAQA 3CCLA 2RHQB 1PYBA 3HOZH 4TVAB 3ULPA 4CDCC 3AYHB 1KDBA 3KJPA 3I4MB 4DU9A 3BDCA 1UE6A 1K83H 4TSSA 3HOUG 1F77A 2DGYA 4DV0Q 1HR0Q 4L5RC 1G291 1N9WA 3GDEA 2F0TA 4HJ5A 2JA5H 4DAYB 2EJFC 2EPBA 4P71A 3A54A 5ISRA 2CWAA 1LT3D 2MGSA 2AHOB 1RD9D 4A3KH 1S3OA 3F2UA 4BY7B 1IL8A 1DONA 5JEAJ 1TS4A 4GLXA 1C8CA 1B44D 1E2VA 1SEBD 3GP7A 3R93A 4ILWA 2A74C 4RG1A 2HCCA 2PI2A 4DUYL 1PFMA 2VUMH 2F0HA 1SLJA 1DJRD 3LWEA 5ELCA 1DOKA 3MA2B 1Q7YC 3URYA 3PMFA 3AU7A 3RN2A 1VCIA 3GTKB 2NVYH 2FMCA 3D6WA 4C3HB 1GUSA 4XQNA 5FLXL 5DAUA 1QVFA 2PQAA 4JV5Q 5IWAL 1LUZA 5C4HA 5FJ8G 2N88A 5JOBA 3H6MA 1NR4A 2F0UA 1BF4A 1KRTA 3PO3B 1IHZA 2ZXOA 4LFAL 1XWEA 1LYLA 5GAGC 5BN5A 4LFBL 4IUUA 5C3XA 2E2HH 4WFN3 1WTXA 1PH9A 2R61A 2E2JB 1LTRD 2CW0D 1EY4A 2UXCQ 3ERQA 2B2YC 3TZUA 1ML0D 1TT2A 2NVQH 2HDLA 1E2WA 4A3IB 2K04A 5GADC 2JA6G 3A7LA 4MHEA 1JJ2A 5CC4A 3RMHA 2F0LA 5IT9L 1TVXA 3HOVH 2DJFC 3TRZA 1PYWD 4DV2L 3UDGA 4YWLA 4JBJA 1QUQA 1IYUA 5M3MB 1G6ZA 1SMYC 1SXTA 4HJAA 4A3BB 1Q8KA 1SR3A 3AQQA 2AQ3B 2I07B 2Q2TA 1TWCB 3GV3A 4ABNA 2RKSA 2QCPX 4CJ0B 4C3HG 4YHHQ 1ESRA 4DR3Q 3MC0B 4HCSA 4FP5D 1BCPB 1N36Q 4IUVA 4YY3Q 1H95A 3K5MA 2RDHA 1LT5D 4KI0A 2YTYA 5LMNW 4JBMA 2A19A 3QIAA 4DR6L 2O5JC 3A5UA 3S15H 5FOBB 1IYVA 1NBWA 1QVCA 1C9OA 3L2PA 1VF5C 2F0JA 1SYCA 1BUVT 1ZYRD 2WKCA 4AYBB 4BXXH 3OHXC 3DWQA 4CJ2C 3J81E 1RTOA 1QCBD 2F0OA 1PV4A 3IAYA 1D8LA 2Q2HA 5AJ3Q 1EWHA 2ICIA 1FJGQ 1KXLA 5IYDG 3N6RA 3W2DA 3I4MG 5IOCA 5E3FA 1RKNA 4TRDA 2NWGA 1RCVD 3NQTA 1QNKA 1XPRA 1VQ4A 5C0XJ 5M3FB 4JOIC 4FXDA 2N55A 1QWYA 2NVXB 3DEPA 2F0IA 2UXBQ 2B2TA 1VQ7A 3ICEA 2XRSD 3DLLA 5D65A 2I5MX 4RGMA 4MZ9A 2BE5C 1SNDA 2EQSA 2BA0A 5M5XB 3KLSA 1GD7A 4A3LH 3GD7A 1S72A 2RQXA 5J3BA 1X55A 2CFMA 2YU9B 1DM0B 1RIPA 2WV6D 1NTGA 5AFWA 4DK1A 1V1PA 3WWVA 1S5ED 1IW7C 1WTHA 3CCVA 2F0WA 1GXDC 5LMNL 5IT9c 4IPDA 2DY7A 4JYAQ 1RHPA 4KKUA 2K01A 5C44G 5IODA 5DLQE 1YZ6A 1MIUA 4X3KA 4P2CB 5CV9A 5C5MA 3OIQA 2EDGA 5JAVA 4IJHA 1XPOA 3DM1A 1W3SA 1KNEA 4RGTA 2D5DA 2JEAI 5FKAC 1EQVA 1DYQA 1YNND 4RA8A 3P7JA 5FLXE 3QB3A 3S16B 1XNQL 1G2TA 2F0VA 2VQFL 4ALPA 1XJVA 5A2QL 1TKWB 4POGA 3J81L 1BNZA 5JPMC 2ZTEA 3I4OA 4POFA 2BOSA 3HOWB 1NE3A 4GN5A 4ID6A 4GNXA 5CV4A 2XVSA 2Z0SA 3A55A 3E5SA 4A3DB 2YTXA 4DV2Q 3I91A 1LABA 4AQYL 2K03A 2B8FA 2OQ0A 4JI2L 3M7GA 1GUTA 1JJCB 4DV7L 4K0KL 2XGTA 1E1TA 3M3YH 3ND8A 1PFNA 5EKLA 2HUGA 1KDAA 4L5QA 2RF4A 3L0OA 1SYGA 4CKBA 3GTPH 3J80i 1DXMA 3PO2G 1A6XA 1WTVA 3P20A 2VUMG 1HTLD 3BVMA 4DNIA 5ELEA 4JI0L 1M90C 1X32A 3STBC 4JYAL 5JJIA 3KYHC 2YU9H 3J7A5 1MI2A 1TWAB 1SSOA 2AUJD 2WAQB 1NY4A 4JW0A 1HNXL 2MHVA 2B2UC 3H0GB 2NTSA 1EY5A 4KY6A 5M9OA 3CCSA 4KLKA 4A3MG 3CC4A 2FINB 2M9VA 4HIDA 3FKIH 2KCNA 4DUYQ 1I4XA 4FF2A 3HGBA 2K5QA 1AE2A 2SNSA 3M9BA 2PMZE 1JB7A 2VQEL 4QB4A 4JG2A 5AJ3L 4RCOA 1YIJA 4YY3L 5EJWA 4X64Q 4EVOA 4F8MA 2NVQB 3K5OA 1IKMA 2B2VA 1ET9A 1SMYD 2BCOA 3KF8A 4HCEA 4FDBA 4UPAA 3HOXH 5JEAH 5IYBG 3I72A 2F0EA 1PZJD 3S14H 2F3IA 2H1EA 1IXRA 1AP0A 1QILA 2WIIB 2Z6KC 3J7AF 1CKNB 4N9TA 2A6EC 1LTSD 3C1EA 4APVA 5HGTA 3PF5A 1GUOA 5BN3A 4XTCS 1C7YA 2CW0C 3NENA 1A3VA 2PQEA 3LNNA 5FLMH 2WACA 2GVAA 4C56C 4XDXA 1EUJA 2ES2A 4FNFA 4H02A 4QQBX 4MTKA 1Y1VB 4YCVA 5G3LD 2ZM6L 4IALA 4DK3C 2B2TC 2HD3A 4OEMB 1KNAA 3H94A 3BG3A 3NTIA 3VR2A 4JI4L 3Q22A 1EOTA 3OW2A 3QO2A 3ITPA 4ME3A 3NBHA 2F0MA 5C4XG 5DNFA 2NN6H 3QWNA 1KD1C 2JA8G 3G4SA 1Y1WB 4IUTA 1GKHA 1TQOA 2HIVA 2PCFB 3JAML 4BBRH 1SYEA 5C4JH 4DGZA 4LF4Q 4ZAIA 2FJ2A 2KUMA 2NZ1D 3D6CA 3DXJC 3U4ZA 5M5XH 4HEDA 4JI3L 1EFID 3OPOA 4XXEA 1NSNS 5FO9B 4A3BH 5J39A 2Y0SB 1OTCA 2LY7A 4A3GB 1F2MA 1TWCH 1STHA 3CHBD 1T5EA 1KAAA 4LF9Q 4DV5Q 3ZYYX 4RWSC 4X65Q 2A8VA 2R7ZH 4CKCA 4V0BA 1P8LA 3HOXB 2MO1A 5ELNA 1HNWQ 4JBWA 4QF4A 4JI1L 2E74C 3EA6A 3NTHA 3LX0A 4RFBA 3CCRA 4JPBW 2HQEA 3H0GG 1PH2A 3K59A 1CM9A 4GOPA 1VQHA 5CV7A 1Q90A 4QGUA 1D5ZC 3M7NA 2JN4A 2L0CA 4DK6C 1X6OA 2TMPA 4DV0L 3JAMi 5IYCG 1HR0L 3KK7A 2IT1A 3NWTA 1EL0A 3HOWH 4IOCA 5EKKA 4LF7L 2R92H 1YJNA 3X3MA 3SR1A 3PUXA 3S16H 3S2DB 3PO3G 4CJ1B 3MFGA 3A8JE 2NVTH 1VQIA 3PO2H 1IBKQ 1K3BC 4UY8C 4B3MQ 2QW7A 3SK4A 1EIGA 3CW2C 2F3VA 1A63A 1NNXA 4JI6Q 4L8JA 5EBDA 1QNUA 3T16A 1BKBA 4QMGA 2JA8B 2QEXA 4WRDA 2IX1A 4DXFA 3P1HA 1L0YB 5C4XB 1MGSA 2QDBA 2WP8J 2DNCA 3CF5A 1N34L 4BY7G 2E5LQ 2C9OA 1WD0A 1BOSA 2IHFA 5I9PA 1PA6A 1AE3A 2IWHA 2Q2IA 3RN5A 4X64L 4DR5Q 4U673 4G7HC 2F1MA 1M4VA 3HOUB 1PRTD 2ICEC 1A3UA 2J7ZA 4K14A 4KTAA 2Z9HA 3S1MB 2I46A 5HURA 3S17H 2DN8A 3KDFA 2Z6KA 1AFPA 5DEHA 1NMFA 5C0XI 5EAYA 2HDMA 1IKLA 1HJPA 2WINB 4KHZA 4L5TA 1UEBA 3AFQA 1AN8A 2EVBA 4NXNQ 1VQ9A 2SEBD 1K8GA 4RKBA 4DNTB 2R93B 3PUVA 2IJ0A 2X6GA 2CQAA 4HN7A 4IUPA 4A3FB 3E9IA 2L5TA 4K5VA 1WTPA 2NZHA 4JI0Q 1H9MA 4OL7A 3H3VI 4R4OA 1JOQA 5EBCA 4XIGS 3AFPA 1WTRA 3HOYH 1V8QA 1RF2D 4H13C 4PG3A 3C3LA 4LF5L 1NMGA 3BZKA 2RDFA 1QE6A 3BZCA 2WB1E 1F9SA 5COYA 4JI5Q 4O1NA 3HKZE 1S5CD 1PDQA 1KABA 2R3ZA 1WVLA 1ENAA 2E76C 1KRSA 4J8QA 3NQIA 4K6DA 4IPCA 1U0LA 2LSSA 1EYAA 4NXNL 4DXGA 1GOZA 4LUZA 5EPJA 3ULLA 1T9HA 3I56A 3CMEA 3CMAA 4WORA 1VQPA 1HH2P 3RLOA 1BBXC 5EPKA 1BVSA 5M5WH 2D2CC 5HGQA 2I0QA 4ZQ3A 2EOTA 2WFWA 4DV4L 2VXWA 4B9WA 3IKJA 3F2CA 4LWCA 3B6YA 2XRQD 1HZ9A 3KLRA 4X62L 2PPBC 1JWUD 3TP5A 2F0QA 2AQ1B 2MFIA 4A3EB 4DR4L 1VQ8A 4OO1G 4IFDJ 4YCUA 5K36H 2L55A 3DWAA 1EY8A 5FLMG 3J81c 3H3VC 1HHVA 1EY6A 3J81i 2CH4W 1CKMA 1DD2A 5D3IB 1JWMD 1NR2A 4DR5L 1HZBA 4N8X1 3HOWG 5M3MG 3HKZG 5KYIA 4C1NI 3TEHB 4X3UA 3X3NA 3OW7A 3I7FA 4F88A 1PXUA 1PVOA 1O78A 1TU2B 1FGUA 3IL8A 4BS9A 4CBVA 2QF7A 3FEWX 4RGNA 4A3IG 4NXMQ 4ODGA 2PZWA 1TWHB 1UAPA 1BCPF 2N78A 1PH6A 2PMZB 4JK1C 5M3MH 3E0JA 3JAME 1SNPA 4X66Q 2G9HD 3S2HH 3FKIB 2Q8RE 5C44B 3J80L 3RZOB 1O7LA 2R7ZG 1XMOQ 3C1FA 2A6ED 2Y0SG 2AQ2B 4C3IH 1EYDA 1PTOF 2H4OA 4DR1Q 1EU4A 1J8IA 2E2IH 4OO1H 2EYLA 1Y8PB 3H91A 2IX3A 3M4OB 4KHPL 1EY7A 4LMQD 4DV1Q 3HOZB 1EZ8A 3UE0A 3RZDB 4JI8L 3M4PA 1VF7A 2AUKA 2O4XA 1LV9A 1SDFA 4BBSG 2B29A 2PZTA 5EKIA 1J9OA 4IZ8A 3D4RA 4RMFA 1MD2D 3RZDH 1XTDA 2JQOA 4B3TL 5CV5A 1X3PA 5K36G 5IGBA 1SYFA 5IE8A 4LFCL 2K5DA 4IO9A 5M3FG 1YVCA 1XMQQ 2K5NA 1EIYB 2A6HC 1EY0A 4TKOB 4UHVA 3PCOB 4CDEC 5IP9G 3VR6A 3VYRA 4IFDG 4QUFA 2JA9A 3K58A 2NN6G 1LTLA 4A3JH 1WCMH 2LXKA 5I9OA 1E0BA 4DR2Q 2BH2A 1FD7D 1DCZA 4DUZL 1SNMA 4R4CA 1U4MA 1Y1VG 3RUZA 3T1YL 1KHIA 1I4PA 3KJOA 1HZCA 4I65A 1D6EC 2JA5G 1SJED 2B63G 4B3SL 3U50C 1FVIA 1HUMA 3O13A 1Z6HA 4J6HA 2BDNA 3EFXD 2SOBA 3NK9A 1NAPA 4QY7A 5LHY1 2X6LA 4C3HH 4NW2A 4A4IA 3AB9A 2ASBA 4IURA 1PH1A 1T5XD 2ZXRA 3GTLB 2R6GA 5A35A 1ICWA 2EJGC 3KF6A 1K73C 2PZUA 2XIWA 3HG9A 5D14A 1STEA 4OHJA 4K2KA 1XX8A 3KFUA 1IBLL 3K7AB 4LFCQ 1G2SA 1QZGA 1VQBA 4AH6A 2FFKB 4I7ZC 4DUZQ 3Q24A 3EBEA 5JJLA 5KIXA 2JXMB 3K80C 2Z4HA 5IIFA 5L37A 5IWAQ 1MHWC 2OEOA 4CDDC 4ZK9B 4A3MB 1YNJC 4KD3A 4L63B 1VQ5A 1ZKOA 4KJNA 1LTTD 2XSCA 4XQQA 3VYTA 1PRTF 4FXGC 5GROA 1N33L 2MP1A 1HA5A 4BY7H 1DZ1A 2K52A 5CYUA 2UUAL 4B3TQ 3UDXA 4LW1A 2QEJC 2JA7B 3HEJA 5FO8B 5M5YH 1VQAA 1PH3A 5JPNC 1D1KA 2KOLA 2DUDA 2B39A 3SK5A 4HMJA 4UP8A 4M1UB 1J5EL 1H9KA 5I2XA 1C0AA 4IOAA 1YITA 4KHPQ 4YIJA 1RDPD 3HKZB 1D2BA 4ZYSA 1JE5A 2OF1A 4UP7A 3PUZA 2GN5A 1CT1D 2Q2UA 1XTCD 1IW7D 3RZOH 3M3YB 4HMIA 3VA7A 1P16A 2VS1A 1KDCA 3GTPB 4XYOA 2AMCB 3MXNB 2E2IB 1VQOA 2K14A 4G7ZC 4P75A 2L1BA 2OTJA 3H15A 4A3DG 2F0SA 4U68A 4A3EH 4LUVA 2N3SA 4FF1A 5LMUL 1YNXA 4DV3L 1EEFD 3MWYW 2ZJPA 4A3KB 5I2YA 4A93B 4EGVA 2VW9A 2CCZA 1F2LA 1G51A 1HCZA 5IGGA 1MSHA 1X3EA 1Y1WH 4A3DH 1LT6D 3PIO3 5HY6A 2IL8A 3PSIA 1QOHA 2VQEQ 4NKLA 3BJUA 1VQLA 1R9TH 2RA4A 3NE5B 2V4DA 3AMUA 1O7IA 1HQRD 4EX5A 1KC8C 2OWOA 1JMCA 1WOCA 1D5MC 1B8AA 4DK0A 4MTNA 3D4DA 1F2YA 3GTQH 3EN2A 1HNXQ 3K5NA 1Y14B 4N9PA 1A2UA 3I4NB 1TY2A 1JCKB 3T1YQ 3S2HB 2A68D 1LTID 1SFOH 5C44H 3E6ZX 1TWFH 3K0XA 3CU7A 3TS0A 1MBYA 4GOPB 3BU2A 3U58A 1OO9B 3EVQA 1PZKD 1V1PB 4FXKC 3PUYA 3VR3A 3PGZA 2OCEA 1W2BA 1HRJA 3DMUA 3NWSA 3S1QH 2H5XA 4GN4B 3NHHA 4JBKA 4HIMA 3GTLH 5E4XA 2K5VA 3GTOH 2UXDL 2IW3A 3VR4A 1GUGA 3H0GH 4BA2I 2EY5A 1DOLA 3U4VA 4LF6L 4K0KQ 1SJHD 1K83B 1Y1VH 2WB1B 4CKEA 4GZYC 2F4VQ 3K7UC 1BBUA 5BR8L 2VQFQ 3G6JB 4IFDI 4EQPA 1A0IA 1X3FA 1U9RA 3DM3A 2B8GA 3TP6A 4IFDH 4ZRZA 1Y8NB 4LF5Q 2UXDQ 2LKVA 5M3FH 3F2BA 4GS3A 1V1QA 1WTWA 2GVBA 3BZDB 4ZLTF 3TDQA 5IP7H 2FHTA 4R4TA 1C48A 1S40A 2MPMA 1VQKA 1G6PA 4A93H 1JQYD 4XT3B 2MNAA 1B4OA 3C46A 4QIWE 2RCFA 5NUCA 3A8IE 3J7YW 2OQKA 2A73B 1UE5A 1Z47A 4A3JB 1EQQA 4BBRG 5IT9E 1ENFA 4P74A 5EPLA 1R9TB 4GKKQ 3MTSA 3HOUH 2CHBD 4BBSB 3BS1A 3ND9A 1TWAH 5EGTA 1CHPD 3S1MH 2QA4A 1SNOA 2KHIA 3A5ZB 2PNHA 1B3AA 1C4QA 4R4QA 5C5LA 2CQOA 4DNRB 2NVYB 1EWIA 4ZKCB 1XYIA 1JJGA 1H9JA 1QUQB 1Q1BA 4CHTB 1PZID 2RHSB 3VR5A 5JEAG 3F8TA 2XWJB 2KCCA 4ZUJA 3K5LA 3G7LA 1IL2A 2UUBL 2ZTCA 2JA7G 1NJIC 4KKSA 3S1QB 2PW7A 2DJGC 1X3GA 1L0WA 5A2QE 2KECA 2UXBL 1VQCA 2NZOA 2Z8LA 1EQTA 3SK8A 3VA5A 4JI6L 4OXPA 5H1SE 1I6HB 3V2TA 3PUWA 3S1NH 3T4AC 1X56A 2KHSA 4LF7Q 2XWBB 1IYJB 3EIVA 4YHHL 3QG1A 2KQ3A 2R93H 4NMZA 3HRZC 2J4XA 2XTIA 1SE4A 1X3QA 3MXNA 1KIXA 3HOXG 1I3QH 2B63H 3KDFB 3HFZB 4E6IA 4A76A 1N36L 4LUOA 2F0FA 2O2LD 3CQZB 1PFBA 2HT1A 1D5XC 4GKJQ 3CC2A 2KHJA 1QVGA 1ZYRC 4LF6Q 1SAPA 5KRUA 1SYDA 3NEMA 4IN3A 4M8AA 2UXCL 4Z9CB 5JJZA 2LXJA 4WJ4A 2IPKD 2SNMA 2EXZA 3K6OA 3KLSX 3J7ZC 1A62A 1M1KC 2D0OA 2K33A 4DV6L 1ZEQX 4JI1Q 1STYA 3OWEB 1ESFA 3KLWA 1K0RA 2G9DA 1GUNA 2VZAA 1YNJD 1I50B 1WI5A 4BBSH 1SBBB 1PHJA 5LMNQ 4J1MA 4C3JG 3W3AA 2B2VC 4O0AA 4DV5L 1TS2A 3BDLA 5C4ZA 1TIID 1I6VC 4Y7NB 3CCMA 3D0FA 1I4GA 4LFAQ 1FL0A 2NN6I 2D9UA 3H09A 1K0SA 2BA1A 4JI3Q 1B9MA 3TP7A 1KLUD 3GTGH 4JCVE 3K81C 1QB5D 1SRUA 2KCMA 3CRLC 2EYJA 1H9RA 3I4LA 3RLFA 3S14B 1SE8A 2MJ8A 3GTGB 1VDZA 1O80A 4ZCKA 4LFBQ 3HS0C 4A3LG 4H7BA 3NBIA 3HOVB 3CC7A 4EQOA 2KCTA 1AW7A 5IY0A 1U5KA 3S1RB 4QL5A 2RVLA 3MEFA 3I4NG 3HOYB 4C3IB 1OXUA 2F3WA 3CRKC 2B3GA 1TWGB 3TSSA 3E9HA 1BXTA 1F9PA 1ASYA 5CBAE 2R7ZB 4S3SA 2E75C 3D8GA 3TN2A 3S1RH 1OXSC 1TWFB 4C1NK 1ET6A 2UU9L 3L7ZC 1KTKA 4BA1I 4OIJA 5T1IA 2A6HD 5K5PA 1YJWA 2VY3A 2WKDA 4DR7L 5CV8A 1D1IA 1F2ZA 4UDUC 4KHVA 4KN7C 1LTBD 4HIOA 3WOEA 1FGBD 2AWOA 1B7YB 3EJIA 3STBD 4IJLA 3QOLA 2EYHA 3HP3A 3TMEA 3M4OH 3P75A 2JJQA 1TR5A 4A93G 4HR7B 1UEAB 4HIKA 4A3IH 4O42A 1A8VA 1S5BD 2JA7H 4G7OC 1U4RA 4R4IA 4K6LA 3S2DH 1ILQA 3D31A 2UUAQ 2PYKA 3FMCA
chains in the Genus database with same CATH topology
2K5NA 1EIYB 3PCOB 2QGQA 1E1OA 5IP9G 5GAEC 1Z9FA 4AQYL 4BY1H 2OQ0A 4IFDG 4X66L 2JA9A 1L1OA 4Y7NH 4JI2L 2NN6G 3G71A 4BXXG 1EFWA 1LTLA 1JJCB 2BH8A 4DV7L 1WCMH 2LXKA 4A3JH 4PZ6A 4K0KL 1GVPA 4DR2Q 2XGTA 2BH2A 4DUZL 1UWVA 1QZHA 4X6AH 1HNWL 4R4CA 1E1TA 3M3YH 1Y1VG 3CCEA 4B3RL 2KBNA 4JOIA 1KHIA 3T1YL 4L5QA 2RF4A 3L0OA 2A1AA 4AYBG 3KJOA 3GTPH 3J80i 1HZCA 2NVXH 3PO2G 3GTJH 2JA5G 2B63G 4B3SL 1X9NA 3U50C 1FVIA 5IYDH 2VUMG 1Q82C 3S24A 4DNIA 4DPGA 4JI0L 2ALYB 1M90C 3TS2A 3ER0A 3STBC 4JYAL 3PO3H 5JJIA 4QY7A 3KYHC 1EOVA 4TQUS 1L1OB 1BBWA 4MNOA 1K8AC 2YU9H 4JI7L 4C3HH 3J7A5 5GQOA 1SN8A 3AEVA 4A4IA 3GO5A 3NBHB 2ASBA 4NB3A 1VQ6A 3UDIA 1PH1A 1NY4A 2YTVA 2R6GA 3CP0A 1HNXL 1YI2A 3KF6A 1K73C 3HKSA 3CCSA 1DGSA 1VQJA 1TWGH 1EQRA 3NELA 3CCJA 4KLKA 4A3MG 3CC4A 4HIDA 3KFUA 1IBLL 1Q1EA 3FKIH 2FXQA 4LFCQ 4DUYQ 1QZGA 1VQBA 2N49A 4AH6A 1Q86C 1AE2A 3JC66 3M9BA 4DUZQ 4A3BG 2PMZE 2AKWB 2IY5B 3EBEA 2VQEL 1JB7A 5JJLA 3K80C 4JG2A 5AJ3L 4DV7Q 1YIJA 2R92G 2JA6H 1OXTA 4YY3L 5IWAQ 2PQAB 3PV0A 4HJ8A 4YCWA 3J80c 4X64Q 1OXVA 1J6QA 1HNZL 4YWKA 1ASZA 3K8AA 5C3EH 4B3ML 4A3GG 3G48A 1VQ5A 4A3FH 4DV2Q 4B3SQ 4DV6Q 1I6HH 1I5FA 1V43A 3I55A 1L2FA 5GROA 1N33L 4FDBA 4UPAA 3HOXH 1XMQL 2K52A 5IYBG 4BY7H 4P72A 1PH7A 3S14H 2UUAL 2F3IA 1HR0W 1IXRA 4B3TQ 3UE1A 1PYSB 3UDXA 2ZM6Q 1K3RA 2WAQE 3HOVG 4LF8L 4LW1A 2JA8H 1WYDA 4OWWB 3OYYA 5M5YH 1VQAA 3IRBA 3CAMA 1PH3A 2Z6KC 3TREA 4GNXC 1CKNB 1EIFA 2DUDA 2K4KA 5FJ8H 4APVA 3PF5A 4UP9A 2F52A 4UP8A 4XTCS 3NENA 1J5EL 1C7YA 1XPUA 1KQSA 1MKHA 1C0AA 5FLMH 4IOAA 1YITA 4KHPQ 1Y1WG 4OONA 4A3KG 2GVAA 1JE5A 3HOZH 2ZTDA 4UP7A 1EUJA 4JI8Q 4H02A 3M85A 2ES2A 1XNQQ 4QQBX 3PUZA 2GN5A 4YCVA 2Q2UA 4LF8Q 2ZM6L 1YEZA 4DK3C 3T1HL 3RZOH 3JAMc 1KAWA 1P16A 2VS1A 4C3JH 3KF8B 1HZAA 1I50H 1HNZQ 2AMCB 3MXNB 1CKOA 3Q8DA 4HJ9A 3VDYA 5BR8Q 1VQOA 1XMOL 2K14A 2UUCQ 4JI4L 3OW2A 4A3EG 1EYGA 4P75A 4ME3A 5C4XG 2OTJA 3H15A 4A3JG 1TXYA 4A3DG 4A3EH 4JI7Q 4LUVA 2N3SA 1X65A 1K9MC 3KF6B 4BY1G 3FP9A 5LMUL 2V1CC 1KD1C 1YNXA 2EIFA 1X54A 1YHBA 5IP9H 5IP7G 4DV3L 1VQNA 2JA8G 2ZJPA 3G4SA 1YJ9A 1B70B 1VQEA 4NXML 2JK8A 4GKKL 1GKHA 2HIVA 2VW9A 2CCZA 4BBRH 2JEBI 1E22A 5C4JH 1G51A 1SMXA 4LF4Q 1X3EA 3F1ZA 3PIOA 1Y1WH 4R1JA 4A3DH 1YHAA 2R7FA 1WFQA 5C4XH 3HOZG 5HY6A 3U4ZA 1JT8A 1KL9A 3PSIA 5M5XH 4P73A 4JI3L 1WJJA 2VQEQ 2E8GA 3CCQA 4C2MH 4LF4L 3BJUA 1VQLA 1R9TH 3GTKH 3J81j 2UUBQ 4A3BH 1O7IA 1V9PA 4EX5A 1KC8C 1OTCA 1JMCA 1WOCA 1N34Q 2OWOA 3PIPA 3TQYA 5GAHC 4GN3B 1TWCH 1B8AA 1VQDA 3FKIG 4MTNA 1MJEA 3CPFA 1PH8A 2WB1G 1IBKL 4J15A 4DV5Q 4A3MH 2OTLA 4LF9Q 1FJGL 3EN2A 1HNXQ 4AYBE 1Y14B 3GTQH 2HQLA 4DR6Q 1Q46A 4PZ8A 4OWTB 4DR4Q 2AWNA 4X65Q 5C0XG 2A8VA 3T1YQ 2R7ZH 1YBYA 4A3GH 1SFOH 1IZ6A 5C44H 1P8LA 1UE7A 4OO1I 1TWFH 2MO1A 3K0XA 5ELNA 4LNQA 2K5HA 3TS0A 4JBWA 2CWPA 4PZ7A 4QJFA 3RLNA 3SGIA 4JI1L 4GOPB 4GNXB 1RL2A 2K50A 3BU2A 2KENA 2IX0A 3U58A 2I5LX 5IYCH 3CCRA 3I4NH 3PUYA 2F4VL 3PGZA 2OCEA 1W2BA 3H0GG 5ELOA 3S1QH 2H5XA 2L15A 4GN4B 1PH2A 4AQYQ 4OWXB 2WAQG 5IYBH 4JBKA 4GOPA 1VQHA 3LGJA 4HIMA 4DR7Q 1OXXK 3ULJA 4QGUA 2K5VA 3GTOH 3GTLH 2UXDL 3M7NA 4IPGA 3A0JA 4DK6C 4X62Q 1X6OA 4A75A 3T1HQ 2ZJRA 1CSPA 3H0GH 4BA2I 2IHEA 3JAMi 3U4VA 5IYCG 4DV0L 1HR0L 4LF6L 4K0KQ 1Y1VH 3ERSX 2IT1A 3M4QA 4DR3L 4YWMA 2F4VQ 1IBML 3HOWH 3K7UC 4PMWA 4IOCA 2RHQB 3CCLA 4LF7L 1BBUA 5BR8L 1PYBA 2VQFQ 2HHHL 4TVAB 2R92H 3ULPA 1YJNA 1A0IA 1X3FA 3AYHB 3PUXA 3S16H 4IFDI 3KJPA 3DM3A 3PO3G 1UE6A 4LF5Q 1K83H 3HOUG 2UXDQ 2DGYA 3G6EA 3CCUA 4DV0Q 1HR0Q 4L5RC 1G291 2NVTH 1N9WA 3GDEA 5M3FH 2CKZB 3F2BA 2ID0A 2D0PA 1V1QA 4GS3A 4HJ5A 2JA5H 2GVBA 4DAYB 1VQIA 3PO2H 1IBKQ 4UY8C 4P71A 5IP7H 4R4TA 1GM5A 4B3MQ 2YYZA 1S40A 1VQKA 2CWAA 1XNRL 1G6PA 2AHOB 1VS0A 3CW2C 1S3OA 2YV5A 4A3KH 4A93H 1A63A 4DAMA 1E24A 4JI6Q 2MNAA 5JEAJ 1VQFA 4GLXA 1BKBA 4QIWE 4JI5L 4GLAC 2QEXA 2OQKA 4RG1A 2IX1A 3ZJYC 1VQGA 2PI2A 1UE5A 2K75A 1Z47A 4DUYL 1N8RC 3CD6A 2VUMH 1EQQA 1SLJA 4BBRG 1IBLQ 4LF9L 2WP8J 4P74A 1LM0A 2VL6A 1Q7YC 3CF5A 1N34L 4BY7G 2E5LQ 3RN2A 1VCIA 2NVYH 2IHFA 1PA6A 4GKKQ 1AE3A 3HOUH 3S1MH 1TWAH 2QA4A 2Q2IA 2KHIA 3RN5A 3A5ZB 4X64L 4DR5Q 2PNHA 1QVFA 4AIMA 3H3VH 2PQAA 4JV5Q 5IWAL 4R4QA 1LUZA 1WCMG 4A3CH 2CQOA 5FJ8G 1EWIA 3F2DA 1KRTA 3S17H 1E7ZA 1JJGA 3KDFA 4LFAL 1LYLA 2Z6KA 5GAGC 3OTOQ 1QUQB 1NMFA 5C0XI 1Q1BA 5EAYA 4DKAC 4LFBL 3A74A 2RHSB 5JEAG 2E2HH 1HJPA 3F8TA 4KHZA 4L5TA 1PH9A 1UEBA 2N8NA 3AFQA 1IL2A 2EXDA 4HJ7A 2ZTCA 2UUBL 1VQ9A 1NJIC 4NXNQ 2JA7G 4A3FG 2UXCQ 1CUKA 1K8GA 1L0WA 1X3GA 4IPHA 4DV3Q 2NVQH 2UXBL 1VQCA 2R93G 2NZOA 3PUVA 5LMUQ 1CSQA 1PH5A 4JI6L 3E9IA 4OXPA 2ATWA 5H1SE 5GADC 2JA6G 1JJ2A 3PUWA 3S1NH 1X56A 2NZHA 4JI0Q 4LF7Q 4YHHL 1IYJB 3EIVA 3I2ZA 5E7NA 2R93H 3HOVH 3TRZA 3H3VI 4R4OA 4DV2L 2E5LL 2JE6I 3AFPA 2XTIA 4XIGS 3UDGA 4YWLA 4JBJA 1QUQA 1HNWQ 3HOYH 1KIXA 3HOXG 1CKNA 1I3QH 2B63H 2Y0SE 4PG3A 4HJAA 1I94L 4LF5L 1Q8KA 1NMGA 1SR3A 3BZKA 3KDFB 3AQQA 3HFZB 4OX9Q 4A3CG 4B3RQ 4A76A 1N36L 1VQMA 3UDFA 3BZCA 2Q2TA 2WB1E 5C3EG 4LUOA 4JI5Q 3HKZE 4YHHQ 4DR3Q 1J5EQ 4WJ3M 2HT1A 5FLXc 1N36Q 1KRSA 4GKJQ 3CC2A 4YY3Q 1H95A 2KHJA 4OX9L 1QVGA 4IPCA 1I94Q 4KI0A 4LF6Q 1SROA 1U0LA 3NEMA 2LSSA 2YTYA 5LMNW 4JBMA 2A19A 2UXCL 4DR6L 4WJ4A 2LXJA 4NXNL 3A5UA 3S15H 2D62A 4LUZA 3W1BA 3J7ZC 3ULLA 1T9HA 1A62A 1NBWA 3I56A 1M1KC 2D0OA 3CMEA 3CMAA 1N33Q 1VQPA 1HH2P 3RLOA 4DV6L 1QVCA 1BVSA 4JI1Q 1C9OA 5M5WH 3L2PA 4JI4Q 5HGQA 2I0QA 4BXXH 4NPSA 3KLWA 1K0RA 2WFWA 2VZAA 4DV4L 4BBSH 1WI5A 3F2CA 1GO3E 3W1GA 5LMNQ 4LWCA 1PV4A 1PHJA 3B6YA 1D8LA 1HZ9A 2Q2HA 4X62L 5AJ3Q 4O0AA 4DV5L 1FJGQ 1KXLA 5IYDG 4EQ5A 2VNUD 4X65L 2MFIA 4DR4L 3FHWA 3I4MH 1VQ8A 3I4MG 2UU9Q 4OO1G 3CCMA 1UE1A 3D0FA 4LFAQ 4IFDJ 4YCUA 1N32Q 1FL0A 1Q12A 2NN6I 1XPRA 2BA1A 3J81c 2HIXA 5FLMG 5C0XJ 1VQ4A 1PH4A 4JI3Q 4L5SA 4JOIC 3J81i 3GTGH 1CKMA 4JCVE 3K81C 2I5HA 2E2JH 4DR5L 4DR2L 2UXBQ 1SRUA 2KCMA 1VQ7A 1MJCA 3ICEA 1HZBA 3HOWG 3DLLA 5M3MG 2I5MX 3HKZG 4JV5L 2PI2E 4MZ9A 3RLFA 3TEHB 1SE8A 2EQSA 2UUCL 2BA0A 3I7FA 1PVOA 1XNRQ 1GD7A 4A3LH 1N32L 1FGUA 3W5OA 3GD7A 1S72A 3OTOL 4LFBQ 5J3BA 1X55A 2CFMA 4JC0A 4A3LG 1RIPA 1NTGA 4A3IG 4NXMQ 3CC7A 2KCTA 3WWVA 2C35B 2N78A 3CCVA 4DV4Q 5IY0A 1U5KA 1PH6A 4QL5A 3MEFA 1Q81C 3I4NG 1AH9A 5M3MH 1E3PA 1OXUA 5LMNL 5IT9c 1L1OC 4IPDA 4GKJL 2B3GA 4O2DA 4JI2Q 4X66Q 4JYAQ 3E9HA 1ASYA 3RNUA 3S2HH 2MO0A 3K7AH 1TWHH 5C44G 3KOJA 3S1RH 5DLQE 1OXSC 1XMOQ 2R7ZG 1YZ6A 2Y0SG 4C3IH 3PF4A 1MIUA 4DR1Q 2UU9L 3CQZH 1XPOA 4IJHA 3L7ZC 2E2IH 2RCNA 3HOYG 4BA1I 1W3SA 1YJWA 2VY3A 2JEAI 4DR7L 1D7QA 1PFSA 4KHPL 4DV1Q 3UE0A 5JJKA 4DR1L 4JI8L 1XNQL 4HIOA 3M4PA 2AWOA 2VQFL 4ALPA 2HHHQ 1B7YB 3STBD 1XJVA 4BBSG 2B29A 4IJLA 4GOPC 4POGA 3M4OH 3RR5A 2JJQA 4GLVB 4RMFA 2ZTEA 3CPWA 3RZDH 4Y52H 3I4OA 1IBMQ 4A93G 4POFA 1XTDA 2JQOA 3CXCA 1NE3A 4HIKA 4GN5A 4A3IH 4B3TL 3GTMH 1A8VA 5K36G 2MQHA 2JA7H 3E0EA 4R4IA 4DV1L 4GNXA 1YHQA 3S2DH 2ZJQA 2R7DA 2Z0SA 5IE8A 3D31A 4LFCL 2YTXA 4IO9A 2UUAQ 5M3FG 1YVCA 1XMQQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5N A;  1EIY B;  3PCO B;  2QGQ A;  1E1O A;  5IP9 G;  5GAE C;  1Z9F A;  4AQY L;  4BY1 H;  2OQ0 A;  4IFD G;  4X66 L;  2JA9 A;  1L1O A;  4Y7N H;  4JI2 L;  2NN6 G;  3G71 A;  4BXX G;  1EFW A;  1LTL A;  1JJC B;  2BH8 A;  4DV7 L;  1WCM H;  2LXK A;  4A3J H;  4PZ6 A;  4K0K L;  1GVP A;  4DR2 Q;  2XGT A;  2BH2 A;  4DUZ L;  1UWV A;  1QZH A;  4X6A H;  1HNW L;  4R4C A;  1E1T A;  3M3Y H;  1Y1V G;  3CCE A;  4B3R L;  2KBN A;  4JOI A;  1KHI A;  3T1Y L;  4L5Q A;  2RF4 A;  3L0O A;  2A1A A;  4AYB G;  3KJO A;  3GTP H;  3J80 i;  1HZC A;  2NVX H;  3PO2 G;  3GTJ H;  2JA5 G;  2B63 G;  4B3S L;  1X9N A;  3U50 C;  1FVI A;  5IYD H;  2VUM G;  1Q82 C;  3S24 A;  4DNI A;  4DPG A;  4JI0 L;  2ALY B;  1M90 C;  3TS2 A;  3ER0 A;  3STB C;  4JYA L;  3PO3 H;  5JJI A;  4QY7 A;  3KYH C;  1EOV A;  4TQU S;  1L1O B;  1BBW A;  4MNO A;  1K8A C;  2YU9 H;  4JI7 L;  4C3H H;  3J7A 5;  5GQO A;  1SN8 A;  3AEV A;  4A4I A;  3GO5 A;  3NBH B;  2ASB A;  4NB3 A;  1VQ6 A;  3UDI A;  1PH1 A;  1NY4 A;  2YTV A;  2R6G A;  3CP0 A;  1HNX L;  1YI2 A;  3KF6 A;  1K73 C;  3HKS A;  3CCS A;  1DGS A;  1VQJ A;  1TWG H;  1EQR A;  3NEL A;  3CCJ A;  4KLK A;  4A3M G;  3CC4 A;  4HID A;  3KFU A;  1IBL L;  1Q1E A;  3FKI H;  2FXQ A;  4LFC Q;  4DUY Q;  1QZG A;  1VQB A;  2N49 A;  4AH6 A;  1Q86 C;  1AE2 A;  3JC6 6;  3M9B A;  4DUZ Q;  4A3B G;  2PMZ E;  2AKW B;  2IY5 B;  3EBE A;  2VQE L;  1JB7 A;  5JJL A;  3K80 C;  4JG2 A;  5AJ3 L;  4DV7 Q;  1YIJ A;  2R92 G;  2JA6 H;  1OXT A;  4YY3 L;  5IWA Q;  2PQA B;  3PV0 A;  4HJ8 A;  4YCW A;  3J80 c;  4X64 Q;  1OXV A;  1J6Q A;  1HNZ L;  4YWK A;  1ASZ A;  3K8A A;  5C3E H;  4B3M L;  4A3G G;  3G48 A;  1VQ5 A;  4A3F H;  4DV2 Q;  4B3S Q;  4DV6 Q;  1I6H H;  1I5F A;  1V43 A;  3I55 A;  1L2F A;  5GRO A;  1N33 L;  4FDB A;  4UPA A;  3HOX H;  1XMQ L;  2K52 A;  5IYB G;  4BY7 H;  4P72 A;  1PH7 A;  3S14 H;  2UUA L;  2F3I A;  1HR0 W;  1IXR A;  4B3T Q;  3UE1 A;  1PYS B;  3UDX A;  2ZM6 Q;  1K3R A;  2WAQ E;  3HOV G;  4LF8 L;  4LW1 A;  2JA8 H;  1WYD A;  4OWW B;  3OYY A;  5M5Y H;  1VQA A;  3IRB A;  3CAM A;  1PH3 A;  2Z6K C;  3TRE A;  4GNX C;  1CKN B;  1EIF A;  2DUD A;  2K4K A;  5FJ8 H;  4APV A;  3PF5 A;  4UP9 A;  2F52 A;  4UP8 A;  4XTC S;  3NEN A;  1J5E L;  1C7Y A;  1XPU A;  1KQS A;  1MKH A;  1C0A A;  5FLM H;  4IOA A;  1YIT A;  4KHP Q;  1Y1W G;  4OON A;  4A3K G;  2GVA A;  1JE5 A;  3HOZ H;  2ZTD A;  4UP7 A;  1EUJ A;  4JI8 Q;  4H02 A;  3M85 A;  2ES2 A;  1XNQ Q;  4QQB X;  3PUZ A;  2GN5 A;  4YCV A;  2Q2U A;  4LF8 Q;  2ZM6 L;  1YEZ A;  4DK3 C;  3T1H L;  3RZO H;  3JAM c;  1KAW A;  1P16 A;  2VS1 A;  4C3J H;  3KF8 B;  1HZA A;  1I50 H;  1HNZ Q;  2AMC B;  3MXN B;  1CKO A;  3Q8D A;  4HJ9 A;  3VDY A;  5BR8 Q;  1VQO A;  1XMO L;  2K14 A;  2UUC Q;  4JI4 L;  3OW2 A;  4A3E G;  1EYG A;  4P75 A;  4ME3 A;  5C4X G;  2OTJ A;  3H15 A;  4A3J G;  1TXY A;  4A3D G;  4A3E H;  4JI7 Q;  4LUV A;  2N3S A;  1X65 A;  1K9M C;  3KF6 B;  4BY1 G;  3FP9 A;  5LMU L;  2V1C C;  1KD1 C;  1YNX A;  2EIF A;  1X54 A;  1YHB A;  5IP9 H;  5IP7 G;  4DV3 L;  1VQN A;  2JA8 G;  2ZJP A;  3G4S A;  1YJ9 A;  1B70 B;  1VQE A;  4NXM L;  2JK8 A;  4GKK L;  1GKH A;  2HIV A;  2VW9 A;  2CCZ A;  4BBR H;  2JEB I;  1E22 A;  5C4J H;  1G51 A;  1SMX A;  4LF4 Q;  1X3E A;  3F1Z A;  3PIO A;  1Y1W H;  4R1J A;  4A3D H;  1YHA A;  2R7F A;  1WFQ A;  5C4X H;  3HOZ G;  5HY6 A;  3U4Z A;  1JT8 A;  1KL9 A;  3PSI A;  5M5X H;  4P73 A;  4JI3 L;  1WJJ A;  2VQE Q;  2E8G A;  3CCQ A;  4C2M H;  4LF4 L;  3BJU A;  1VQL A;  1R9T H;  3GTK H;  3J81 j;  2UUB Q;  4A3B H;  1O7I A;  1V9P A;  4EX5 A;  1KC8 C;  1OTC A;  1JMC A;  1WOC A;  1N34 Q;  2OWO A;  3PIP A;  3TQY A;  5GAH C;  4GN3 B;  1TWC H;  1B8A A;  1VQD A;  3FKI G;  4MTN A;  1MJE A;  3CPF A;  1PH8 A;  2WB1 G;  1IBK L;  4J15 A;  4DV5 Q;  4A3M H;  2OTL A;  4LF9 Q;  1FJG L;  3EN2 A;  1HNX Q;  4AYB E;  1Y14 B;  3GTQ H;  2HQL A;  4DR6 Q;  1Q46 A;  4PZ8 A;  4OWT B;  4DR4 Q;  2AWN A;  4X65 Q;  5C0X G;  2A8V A;  3T1Y Q;  2R7Z H;  1YBY A;  4A3G H;  1SFO H;  1IZ6 A;  5C44 H;  1P8L A;  1UE7 A;  4OO1 I;  1TWF H;  2MO1 A;  3K0X A;  5ELN A;  4LNQ A;  2K5H A;  3TS0 A;  4JBW A;  2CWP A;  4PZ7 A;  4QJF A;  3RLN A;  3SGI A;  4JI1 L;  4GOP B;  4GNX B;  1RL2 A;  2K50 A;  3BU2 A;  2KEN A;  2IX0 A;  3U58 A;  2I5L X;  5IYC H;  3CCR A;  3I4N H;  3PUY A;  2F4V L;  3PGZ A;  2OCE A;  1W2B A;  3H0G G;  5ELO A;  3S1Q H;  2H5X A;  2L15 A;  4GN4 B;  1PH2 A;  4AQY Q;  4OWX B;  2WAQ G;  5IYB H;  4JBK A;  4GOP A;  1VQH A;  3LGJ A;  4HIM A;  4DR7 Q;  1OXX K;  3ULJ A;  4QGU A;  2K5V A;  3GTO H;  3GTL H;  2UXD L;  3M7N A;  4IPG A;  3A0J A;  4DK6 C;  4X62 Q;  1X6O A;  4A75 A;  3T1H Q;  2ZJR A;  1CSP A;  3H0G H;  4BA2 I;  2IHE A;  3JAM i;  3U4V A;  5IYC G;  4DV0 L;  1HR0 L;  4LF6 L;  4K0K Q;  1Y1V H;  3ERS X;  2IT1 A;  3M4Q A;  4DR3 L;  4YWM A;  2F4V Q;  1IBM L;  3HOW H;  3K7U C;  4PMW A;  4IOC A;  2RHQ B;  3CCL A;  4LF7 L;  1BBU A;  5BR8 L;  1PYB A;  2VQF Q;  2HHH L;  4TVA B;  2R92 H;  3ULP A;  1YJN A;  1A0I A;  1X3F A;  3AYH B;  3PUX A;  3S16 H;  4IFD I;  3KJP A;  3DM3 A;  3PO3 G;  1UE6 A;  4LF5 Q;  1K83 H;  3HOU G;  2UXD Q;  2DGY A;  3G6E A;  3CCU A;  4DV0 Q;  1HR0 Q;  4L5R C;  1G29 1;  2NVT H;  1N9W A;  3GDE A;  5M3F H;  2CKZ B;  3F2B A;  2ID0 A;  2D0P A;  1V1Q A;  4GS3 A;  4HJ5 A;  2JA5 H;  2GVB A;  4DAY B;  1VQI A;  3PO2 H;  1IBK Q;  4UY8 C;  4P71 A;  5IP7 H;  4R4T A;  1GM5 A;  4B3M Q;  2YYZ A;  1S40 A;  1VQK A;  2CWA A;  1XNR L;  1G6P A;  2AHO B;  1VS0 A;  3CW2 C;  1S3O A;  2YV5 A;  4A3K H;  4A93 H;  1A63 A;  4DAM A;  1E24 A;  4JI6 Q;  2MNA A;  5JEA J;  1VQF A;  4GLX A;  1BKB A;  4QIW E;  4JI5 L;  4GLA C;  2QEX A;  2OQK A;  4RG1 A;  2IX1 A;  3ZJY C;  1VQG A;  2PI2 A;  1UE5 A;  2K75 A;  1Z47 A;  4DUY L;  1N8R C;  3CD6 A;  2VUM H;  1EQQ A;  1SLJ A;  4BBR G;  1IBL Q;  4LF9 L;  2WP8 J;  4P74 A;  1LM0 A;  2VL6 A;  1Q7Y C;  3CF5 A;  1N34 L;  4BY7 G;  2E5L Q;  3RN2 A;  1VCI A;  2NVY H;  2IHF A;  1PA6 A;  4GKK Q;  1AE3 A;  3HOU H;  3S1M H;  1TWA H;  2QA4 A;  2Q2I A;  2KHI A;  3RN5 A;  3A5Z B;  4X64 L;  4DR5 Q;  2PNH A;  1QVF A;  4AIM A;  3H3V H;  2PQA A;  4JV5 Q;  5IWA L;  4R4Q A;  1LUZ A;  1WCM G;  4A3C H;  2CQO A;  5FJ8 G;  1EWI A;  3F2D A;  1KRT A;  3S17 H;  1E7Z A;  1JJG A;  3KDF A;  4LFA L;  1LYL A;  2Z6K A;  5GAG C;  3OTO Q;  1QUQ B;  1NMF A;  5C0X I;  1Q1B A;  5EAY A;  4DKA C;  4LFB L;  3A74 A;  2RHS B;  5JEA G;  2E2H H;  1HJP A;  3F8T A;  4KHZ A;  4L5T A;  1PH9 A;  1UEB A;  2N8N A;  3AFQ A;  1IL2 A;  2EXD A;  4HJ7 A;  2ZTC A;  2UUB L;  1VQ9 A;  1NJI C;  4NXN Q;  2JA7 G;  4A3F G;  2UXC Q;  1CUK A;  1K8G A;  1L0W A;  1X3G A;  4IPH A;  4DV3 Q;  2NVQ H;  2UXB L;  1VQC A;  2R93 G;  2NZO A;  3PUV A;  5LMU Q;  1CSQ A;  1PH5 A;  4JI6 L;  3E9I A;  4OXP A;  2ATW A;  5H1S E;  5GAD C;  2JA6 G;  1JJ2 A;  3PUW A;  3S1N H;  1X56 A;  2NZH A;  4JI0 Q;  4LF7 Q;  4YHH L;  1IYJ B;  3EIV A;  3I2Z A;  5E7N A;  2R93 H;  3HOV H;  3TRZ A;  3H3V I;  4R4O A;  4DV2 L;  2E5L L;  2JE6 I;  3AFP A;  2XTI A;  4XIG S;  3UDG A;  4YWL A;  4JBJ A;  1QUQ A;  1HNW Q;  3HOY H;  1KIX A;  3HOX G;  1CKN A;  1I3Q H;  2B63 H;  2Y0S E;  4PG3 A;  4HJA A;  1I94 L;  4LF5 L;  1Q8K A;  1NMG A;  1SR3 A;  3BZK A;  3KDF B;  3AQQ A;  3HFZ B;  4OX9 Q;  4A3C G;  4B3R Q;  4A76 A;  1N36 L;  1VQM A;  3UDF A;  3BZC A;  2Q2T A;  2WB1 E;  5C3E G;  4LUO A;  4JI5 Q;  3HKZ E;  4YHH Q;  4DR3 Q;  1J5E Q;  4WJ3 M;  2HT1 A;  5FLX c;  1N36 Q;  1KRS A;  4GKJ Q;  3CC2 A;  4YY3 Q;  1H95 A;  2KHJ A;  4OX9 L;  1QVG A;  4IPC A;  1I94 Q;  4KI0 A;  4LF6 Q;  1SRO A;  1U0L A;  3NEM A;  2LSS A;  2YTY A;  5LMN W;  4JBM A;  2A19 A;  2UXC L;  4DR6 L;  4WJ4 A;  2LXJ A;  4NXN L;  3A5U A;  3S15 H;  2D62 A;  4LUZ A;  3W1B A;  3J7Z C;  3ULL A;  1T9H A;  1A62 A;  1NBW A;  3I56 A;  1M1K C;  2D0O A;  3CME A;  3CMA A;  1N33 Q;  1VQP A;  1HH2 P;  3RLO A;  4DV6 L;  1QVC A;  1BVS A;  4JI1 Q;  1C9O A;  5M5W H;  3L2P A;  4JI4 Q;  5HGQ A;  2I0Q A;  4BXX H;  4NPS A;  3KLW A;  1K0R A;  2WFW A;  2VZA A;  4DV4 L;  4BBS H;  1WI5 A;  3F2C A;  1GO3 E;  3W1G A;  5LMN Q;  4LWC A;  1PV4 A;  1PHJ A;  3B6Y A;  1D8L A;  1HZ9 A;  2Q2H A;  4X62 L;  5AJ3 Q;  4O0A A;  4DV5 L;  1FJG Q;  1KXL A;  5IYD G;  4EQ5 A;  2VNU D;  4X65 L;  2MFI A;  4DR4 L;  3FHW A;  3I4M H;  1VQ8 A;  3I4M G;  2UU9 Q;  4OO1 G;  3CCM A;  1UE1 A;  3D0F A;  4LFA Q;  4IFD J;  4YCU A;  1N32 Q;  1FL0 A;  1Q12 A;  2NN6 I;  1XPR A;  2BA1 A;  3J81 c;  2HIX A;  5FLM G;  5C0X J;  1VQ4 A;  1PH4 A;  4JI3 Q;  4L5S A;  4JOI C;  3J81 i;  3GTG H;  1CKM A;  4JCV E;  3K81 C;  2I5H A;  2E2J H;  4DR5 L;  4DR2 L;  2UXB Q;  1SRU A;  2KCM A;  1VQ7 A;  1MJC A;  3ICE A;  1HZB A;  3HOW G;  3DLL A;  5M3M G;  2I5M X;  3HKZ G;  4JV5 L;  2PI2 E;  4MZ9 A;  3RLF A;  3TEH B;  1SE8 A;  2EQS A;  2UUC L;  2BA0 A;  3I7F A;  1PVO A;  1XNR Q;  1GD7 A;  4A3L H;  1N32 L;  1FGU A;  3W5O A;  3GD7 A;  1S72 A;  3OTO L;  4LFB Q;  5J3B A;  1X55 A;  2CFM A;  4JC0 A;  4A3L G;  1RIP A;  1NTG A;  4A3I G;  4NXM Q;  3CC7 A;  2KCT A;  3WWV A;  2C35 B;  2N78 A;  3CCV A;  4DV4 Q;  5IY0 A;  1U5K A;  1PH6 A;  4QL5 A;  3MEF A;  1Q81 C;  3I4N G;  1AH9 A;  5M3M H;  1E3P A;  1OXU A;  5LMN L;  5IT9 c;  1L1O C;  4IPD A;  4GKJ L;  2B3G A;  4O2D A;  4JI2 Q;  4X66 Q;  4JYA Q;  3E9H A;  1ASY A;  3RNU A;  3S2H H;  2MO0 A;  3K7A H;  1TWH H;  5C44 G;  3KOJ A;  3S1R H;  5DLQ E;  1OXS C;  1XMO Q;  2R7Z G;  1YZ6 A;  2Y0S G;  4C3I H;  3PF4 A;  1MIU A;  4DR1 Q;  2UU9 L;  3CQZ H;  1XPO A;  4IJH A;  3L7Z C;  2E2I H;  2RCN A;  3HOY G;  4BA1 I;  1W3S A;  1YJW A;  2VY3 A;  2JEA I;  4DR7 L;  1D7Q A;  1PFS A;  4KHP L;  4DV1 Q;  3UE0 A;  5JJK A;  4DR1 L;  4JI8 L;  1XNQ L;  4HIO A;  3M4P A;  2AWO A;  2VQF L;  4ALP A;  2HHH Q;  1B7Y B;  3STB D;  1XJV A;  4BBS G;  2B29 A;  4IJL A;  4GOP C;  4POG A;  3M4O H;  3RR5 A;  2JJQ A;  4GLV B;  4RMF A;  2ZTE A;  3CPW A;  3RZD H;  4Y52 H;  3I4O A;  1IBM Q;  4A93 G;  4POF A;  1XTD A;  2JQO A;  3CXC A;  1NE3 A;  4HIK A;  4GN5 A;  4A3I H;  4B3T L;  3GTM H;  1A8V A;  5K36 G;  2MQH A;  2JA7 H;  3E0E A;  4R4I A;  4DV1 L;  4GNX A;  1YHQ A;  3S2D H;  2ZJQ A;  2R7D A;  2Z0S A;  5IE8 A;  3D31 A;  4LFC L;  2YTX A;  4IO9 A;  2UUA Q;  5M3F G;  1YVC A;  1XMQ Q; 
#chains in the Genus database with same CATH topology
 4KJO A;  1Z9F A;  2A5H A;  4CGY B;  4X66 L;  1L1O A;  4K5W A;  4Y7N H;  3G71 A;  4BXX G;  2RSO A;  5EQ0 A;  1AEX A;  1UWV A;  1PTO H;  4HAE A;  4MIU A;  1HNW L;  4B3R L;  2KBN A;  2L4N A;  1JR0 D;  4JOI A;  2A1A A;  1ONL A;  2B2W A;  5KGU A;  1LO5 D;  4B08 A;  1TS5 A;  4X3S A;  3S24 A;  2BDO A;  4DA2 A;  5J1Z A;  3U9O A;  2ALY B;  3ER0 A;  2J0T D;  4TQU S;  1L1O B;  2OXP A;  4MNO A;  3Q23 A;  5GQO A;  2EYP A;  4HTH A;  3GO5 A;  3NBH B;  2LFN A;  3VYS A;  4KKT A;  2X69 A;  1ILP A;  3D4W A;  1YI2 A;  3HKS A;  1DGS A;  1VQJ A;  1O7Z A;  2K1B A;  3NEL A;  1SNC A;  2K7V A;  1Q1E A;  1HFG A;  1ROD A;  2R92 B;  3NSW A;  5BN4 A;  3GQB A;  4DV7 Q;  2A69 C;  2JA6 H;  2QIL A;  5LL6 S;  1M8A A;  3PV0 A;  3SVM A;  4YCW A;  1Y69 U;  1OXV A;  1HNZ L;  5ELD A;  4QIW B;  4YWK A;  4A3G G;  3G48 A;  4JVZ A;  2B2Y A;  4A3F H;  4B3S Q;  4OGQ C;  4DV6 Q;  1I6H H;  1I5F A;  2QDL A;  1L2F A;  2NBF A;  1XMQ L;  4P72 A;  4HSV A;  2P5Z X;  3UE1 A;  3SDZ A;  2ZM6 Q;  2WAQ E;  3N52 A;  3HOV G;  5C6A A;  3GTM B;  3K57 A;  3OYY A;  3IRB A;  3TRE A;  4GNX C;  1R4Q B;  4KD4 A;  2K4K A;  5FJ8 H;  4UP9 A;  3KBG A;  3L9A X;  2F52 A;  5DM7 3;  1MKH A;  4PMB A;  3ERO A;  1Y1W G;  3MEH A;  1JE4 A;  2ZTD A;  4JI8 Q;  4G4K A;  3M85 A;  4NDX A;  3OIP A;  1A15 A;  1WCM B;  1WD1 A;  1YEZ A;  5DM6 3;  4RHS A;  3FPP A;  2K32 A;  1I50 H;  3VDY A;  3TZD A;  3Q8D A;  2EY1 A;  1XMO L;  3GTJ B;  1ICF B;  1JWS D;  1EU3 A;  3IFT A;  1STA A;  3CKI B;  4JI7 Q;  4C3J B;  5M5W B;  4BY1 G;  3FP9 A;  2V1C C;  3MZ5 A;  1VQN A;  4KK7 A;  1YJ9 A;  3UI2 A;  4NXM L;  2JK8 A;  4GKK L;  1H9S A;  2F0P A;  1E22 A;  4C2M B;  1EYC A;  5ELF A;  4KV6 A;  2O5I C;  4F7X A;  1YHA A;  2QKI C;  3QOJ A;  5D3D A;  3HOZ G;  3U9S A;  3PQI A;  4OIK A;  1CA6 A;  1G91 A;  3CCQ A;  4WJW A;  3GTQ B;  1E2Z A;  2FMM A;  5FO7 B;  2UUB Q;  1CFM A;  1V9P A;  1N34 Q;  3TQY A;  4GN3 B;  1RJT A;  1PTO B;  2ZT9 C;  3FKI G;  2XNA C;  1MJE A;  3CPF A;  3TP8 A;  1PH8 A;  1FJG L;  4J15 A;  4A3M H;  2OTL A;  3J80 E;  3J7A V;  4DR6 Q;  4PZ8 A;  3OWF A;  4OWT B;  4DR4 Q;  1STB A;  2AWN A;  5JVG 3;  2JP1 A;  4A3G H;  1IZ6 A;  1UE7 A;  5JVH 3;  2K5H A;  4QJF A;  4PZ7 A;  4H0L C;  3RLN A;  3SGI A;  2F4I A;  1RL2 A;  4GNX B;  2EE1 A;  2IX0 A;  1EZ6 A;  2PO4 A;  2I5L X;  5IYC H;  3I4N H;  2CH4 A;  5C0X H;  4N8F A;  2F4V L;  5ELO A;  3NXW A;  2L15 A;  4AQY Q;  4Q0F A;  1SYB A;  2WAQ G;  5IYB H;  1LTA D;  5T1G A;  3QJY A;  1OXX K;  1CK1 A;  1BCP C;  4IPG A;  4X62 Q;  2NUC A;  5I6W A;  4A75 A;  3T1H Q;  3S1N B;  1CSP A;  5FK9 C;  2IHE A;  3S9W A;  1F9Q A;  2B2W C;  4DR3 L;  2NVT B;  4PMW A;  2Q8T A;  2HHH L;  5COR A;  4A3C G;  3HZX A;  1PTO C;  2RBM A;  2Q8I B;  5IGF A;  3PO2 B;  1CZW A;  2B2U A;  3SE0 A;  1GHK A;  3G6E A;  3CCU A;  2PW5 A;  2Z1C A;  4DF7 A;  1JOO A;  3R3O A;  2CKZ B;  2KVM A;  2ID0 A;  2D0P A;  1II3 A;  1A3T A;  5C3W A;  1GM5 A;  2YYZ A;  4RAU C;  5IGE A;  4RKL A;  1XNR L;  1VS0 A;  4ME5 A;  1PLF A;  2YV5 A;  1AZP A;  4DAM A;  1E24 A;  2EYM A;  1VQF A;  4JI5 L;  3R2I A;  4GLA C;  3S15 B;  3MXP A;  1KLG D;  3ZJY C;  1O7Y A;  1VQG A;  2K75 A;  1JB3 A;  1N8R C;  3CD6 A;  1CQV A;  1IBL Q;  4LF9 L;  5IGC A;  1LM0 A;  2VL6 A;  2KED A;  3V96 A;  4ULL A;  2ENB A;  3FVQ A;  1JOR A;  1LTG D;  4AIM A;  3H3V H;  4FF4 A;  4A3C H;  1WCM G;  2L9H A;  4DAP A;  4MN3 A;  5ELB A;  1I4Q A;  3F2D A;  2F0G A;  5J22 A;  1E7Z A;  4PMC A;  1XXG A;  1L0X B;  3PIP 3;  5CR3 A;  3OTO Q;  4DKA C;  3A74 A;  1UNS A;  4V19 0;  3I3C A;  4H44 C;  1Z7T A;  2N8N A;  2EXD A;  4HJ7 A;  3BYT B;  5F2D A;  4A3F G;  1CUK A;  5TSS A;  4IPH A;  4DV3 Q;  2R93 G;  3NTK A;  5LMU Q;  1CSQ A;  1PH5 A;  1VMP A;  2ATW A;  4DFA A;  4DAV A;  1CQF A;  3I2Z A;  5E7N A;  3A7A B;  3T53 B;  2E5L L;  2JE6 I;  4LJZ C;  3L3O C;  5M5Y B;  1CKN A;  3QR8 A;  2Y0S E;  1I94 L;  2NTT A;  4B3R Q;  4IUN A;  4OX9 Q;  1TS3 A;  1BCP D;  3Q0A A;  1VQM A;  2M00 A;  3UDF A;  3A8K E;  1GUW A;  5C3E G;  1WTQ A;  1JC7 A;  2VB3 X;  4G57 A;  1MSG A;  1J5E Q;  4WJ3 M;  1S4Z A;  5FLX c;  2EY6 A;  1PRT C;  4XQJ A;  1H9S B;  4OX9 L;  2EYO A;  1I94 Q;  3BDO A;  1SRO A;  1U4L A;  3RD4 A;  4ZUI A;  3K0Y A;  1CTM A;  2D62 A;  2TSS A;  3W1B A;  2KEE A;  1N33 Q;  4RHR A;  2VUM B;  3VYU A;  2C5C A;  4IQZ A;  1QG7 A;  4NPS A;  4PV1 C;  1FNV A;  1GO3 E;  3W1G A;  4FVM A;  2Z6B A;  4XYQ A;  4EQ5 A;  2VNU D;  4X65 L;  4R8N A;  3FHW A;  3I4M H;  2UU9 Q;  4IUQ A;  1PRT B;  1UE1 A;  2F0K A;  1WTO A;  4F87 A;  3S17 B;  2KJX A;  2EYF A;  4RH6 A;  4ZKB B;  1N32 Q;  1Q12 A;  1NUC A;  2JSO A;  1PH4 A;  2HIX A;  4L5S A;  4PQX A;  2A68 C;  1HUN A;  2I5H A;  4EQN A;  2E2J H;  4DR2 L;  1U4P A;  3BYY B;  1MJC A;  4JV5 L;  2PI2 E;  2UUC L;  1XNR Q;  3FDT A;  1N32 L;  3W5O A;  3OTO L;  4JC0 A;  1LAC A;  1Q3L A;  1STN A;  2E2D C;  2C35 B;  4DV4 Q;  1Q81 C;  1AH9 A;  3DUZ A;  1E3P A;  1GJX A;  1HTP A;  1L1O C;  2CVR A;  4GKJ L;  1CA5 A;  4O2D A;  4JI2 Q;  3GV6 A;  1FNU A;  3RNU A;  3BVG A;  4DN4 M;  2MO0 A;  1NCV A;  3K7A H;  1TWH H;  2ZXP A;  1FR3 A;  3KOJ A;  1I4H A;  3V05 A;  5CGK A;  2F0N A;  3T51 B;  4Q5V A;  3PF4 A;  3CQZ H;  2RCN A;  3HOY G;  2OT2 A;  1HA6 A;  5KYL A;  2LMC B;  1D7Q A;  4R8I A;  1PFS A;  5JJK A;  4DR1 L;  4RGO S;  5LL6 X;  2HHH Q;  1S5D D;  1ZXT A;  3OOC A;  5I4D A;  4GOP C;  3R8B A;  3RR5 A;  4X3T A;  1SE3 A;  4GLV B;  2G5D A;  3CPW A;  4Y52 H;  1IBM Q;  4B9X A;  3CXC A;  4BBR B;  1EY9 A;  3GTM H;  2A69 D;  4NP5 A;  2MQH A;  1W6J A;  3E0E A;  4BY1 B;  4DV1 L;  1YHQ A;  2ZJQ A;  2R7D A;  3NUC A;  1YNN C;  1AZQ A;  5KEE A;  1B1Z A;  2QGQ A;  1E1O A;  2K6A A;  2K05 A;  2EJM A;  2KA7 A;  5GAE C;  1HQM C;  1I3Q B;  2B63 B;  4BY1 H;  2JA5 B;  3WDN A;  1EFW A;  2BH8 A;  4PZ6 A;  5KNB A;  1GVP A;  4HSP A;  5E4W C;  1R4P B;  1QZH A;  4X6A H;  1PTO D;  3A56 A;  3CCE A;  1FYC A;  2HCI A;  5KND A;  4AYB G;  2NVX H;  3GTJ H;  4K8I A;  2EY2 A;  3Q6S A;  1X9N A;  5IYD H;  1LLR D;  4UAI A;  1Q82 C;  2VB2 X;  4K8J A;  4DPG A;  1Y8O B;  3I73 A;  3TS2 A;  3PO3 H;  3SHL A;  1EOV A;  4DAY A;  1BBW A;  4R9W A;  3OMC A;  1K8A C;  2BE5 D;  5IGD A;  4JI7 L;  1SN8 A;  3AEV A;  2F0D A;  3DWP A;  1VMC A;  4NB3 A;  3UDI A;  1PMR A;  1VQ6 A;  2YTV A;  3CP0 A;  4I7A A;  1BO0 A;  1TWG H;  1EQR A;  3CCJ A;  2MUY A;  4QCL A;  2FXQ A;  1SNQ A;  2N49 A;  1Q86 C;  3JC6 6;  2NB0 A;  4A3B G;  2IY5 B;  2E2H B;  2AKW B;  1HXY D;  3OSO A;  3KBX A;  2GA4 B;  2R92 G;  1OXT A;  2PQA B;  1STG A;  4HJ8 A;  5I6Y A;  3J80 c;  3TBI B;  3WOF A;  1B53 A;  1J6Q A;  1W6K A;  2XN9 C;  1ASZ A;  3K8A A;  3ONA B;  5C3E H;  4B3M L;  2JA6 B;  1V43 A;  3I55 A;  1K8O A;  1SFO B;  3E3X A;  1B50 A;  3NPP A;  1PH7 A;  1HR0 W;  4K2L A;  1PYS B;  2RSN A;  3SXH A;  1K3R A;  1G8Z D;  1EEI D;  4LF8 L;  2JA8 H;  2RDG A;  1WYD A;  4OWW B;  4PNY A;  3CAM A;  1EIF A;  1FNW A;  2DY8 A;  1XPU A;  3EQL C;  3GTO B;  1KQS A;  2K5W A;  2JYO A;  4OON A;  4A3K G;  1BR9 A;  2K28 A;  1XNQ Q;  4LF8 Q;  1B2T A;  4OEL B;  3T1H L;  5E1F A;  3T13 A;  2NYZ D;  4KN4 C;  3JAM c;  1KAW A;  1QJO A;  5CV6 A;  3IFD A;  3M4Y A;  4C3J H;  3KF8 B;  1HZA A;  1SE2 A;  3MFY A;  2M2L A;  1HNZ Q;  3I90 A;  1CKO A;  3T56 B;  1TY0 A;  3MXG A;  5BR8 Q;  4HJ9 A;  2UUC Q;  1S5F D;  4KY5 A;  1LT4 D;  2SDF A;  1K28 A;  4A3E G;  1EYG A;  3FRP B;  4RCN A;  4FF3 A;  2L12 A;  1B9N A;  4A3J G;  2F03 A;  1GHJ A;  1TXY A;  5CBE E;  1DOM A;  1X65 A;  1K9M C;  1BQQ T;  3KF6 B;  3NP8 A;  2EIF A;  1X54 A;  1YHB A;  5IP9 H;  5IP7 G;  1EWC A;  1B70 B;  3LWU A;  1VQE A;  1B3Q A;  3DEO A;  5CMD A;  3C2P A;  2JEB I;  1RTN A;  1SMX A;  1F9R A;  2Z4I A;  3F1Z A;  3PIO A;  1CHQ D;  1CI3 M;  4R1J A;  4FYD A;  2R7F A;  1WFQ A;  5C4X H;  1JT8 A;  1KL9 A;  4P73 A;  1V1O A;  1WJJ A;  5G3L F;  1JIC A;  2E8G A;  5C4J B;  4C2M H;  4LF4 L;  3I8Z A;  3GTK H;  3J81 j;  4K5X A;  1K8M A;  3R2T A;  4CDF C;  3PIP A;  3KUP A;  5GAH C;  1HPC A;  3SK6 A;  1VQD A;  3MVV A;  1IBK L;  2WB1 G;  2L11 A;  4L6T B;  1I4R A;  5C3E B;  2LS0 1;  4AYB E;  2HQL A;  1Q46 A;  4C3I G;  5C0X G;  1YBY A;  1Q8I A;  4BWG B;  3BVZ A;  2DNE A;  3DHQ A;  4LNQ A;  4OO1 I;  4JI4 Q;  1JOK A;  2CWP A;  3D3R A;  4KMU C;  2K50 A;  2KEN A;  5KNC A;  1EIH A;  3SEB A;  3OMG A;  2PNR C;  4QUC A;  3MHB A;  2EZV A;  4OWX B;  1A2T A;  3FPU B;  3LGJ A;  4DR7 Q;  3MXU A;  1BDO A;  3ULJ A;  4FO2 A;  3A0J A;  1UUP A;  4XT1 B;  4LAA A;  1ENC A;  4KY7 A;  2ZJR A;  1HFN A;  1CZG A;  3ERS X;  3I70 A;  4LK1 C;  3M4Q A;  4YWM A;  1IBM L;  3MAQ A;  3CCL A;  2RHQ B;  1PYB A;  3HOZ H;  4TVA B;  3ULP A;  4CDC C;  3AYH B;  1KDB A;  3KJP A;  3I4M B;  4DU9 A;  3BDC A;  1UE6 A;  1K83 H;  4TSS A;  3HOU G;  1F77 A;  2DGY A;  4DV0 Q;  1HR0 Q;  4L5R C;  1G29 1;  1N9W A;  3GDE A;  2F0T A;  4HJ5 A;  2JA5 H;  4DAY B;  2EJF C;  2EPB A;  4P71 A;  3A54 A;  5ISR A;  2CWA A;  1LT3 D;  2MGS A;  2AHO B;  1RD9 D;  4A3K H;  1S3O A;  3F2U A;  4BY7 B;  1IL8 A;  1DON A;  5JEA J;  1TS4 A;  4GLX A;  1C8C A;  1B44 D;  1E2V A;  1SEB D;  3GP7 A;  3R93 A;  4ILW A;  2A74 C;  4RG1 A;  2HCC A;  2PI2 A;  4DUY L;  1PFM A;  2VUM H;  2F0H A;  1SLJ A;  1DJR D;  3LWE A;  5ELC A;  1DOK A;  3MA2 B;  1Q7Y C;  3URY A;  3PMF A;  3AU7 A;  3RN2 A;  1VCI A;  3GTK B;  2NVY H;  2FMC A;  3D6W A;  4C3H B;  1GUS A;  4XQN A;  5FLX L;  5DAU A;  1QVF A;  2PQA A;  4JV5 Q;  5IWA L;  1LUZ A;  5C4H A;  5FJ8 G;  2N88 A;  5JOB A;  3H6M A;  1NR4 A;  2F0U A;  1BF4 A;  1KRT A;  3PO3 B;  1IHZ A;  2ZXO A;  4LFA L;  1XWE A;  1LYL A;  5GAG C;  5BN5 A;  4LFB L;  4IUU A;  5C3X A;  2E2H H;  4WFN 3;  1WTX A;  1PH9 A;  2R61 A;  2E2J B;  1LTR D;  2CW0 D;  1EY4 A;  2UXC Q;  3ERQ A;  2B2Y C;  3TZU A;  1ML0 D;  1TT2 A;  2NVQ H;  2HDL A;  1E2W A;  4A3I B;  2K04 A;  5GAD C;  2JA6 G;  3A7L A;  4MHE A;  1JJ2 A;  5CC4 A;  3RMH A;  2F0L A;  5IT9 L;  1TVX A;  3HOV H;  2DJF C;  3TRZ A;  1PYW D;  4DV2 L;  3UDG A;  4YWL A;  4JBJ A;  1QUQ A;  1IYU A;  5M3M B;  1G6Z A;  1SMY C;  1SXT A;  4HJA A;  4A3B B;  1Q8K A;  1SR3 A;  3AQQ A;  2AQ3 B;  2I07 B;  2Q2T A;  1TWC B;  3GV3 A;  4ABN A;  2RKS A;  2QCP X;  4CJ0 B;  4C3H G;  4YHH Q;  1ESR A;  4DR3 Q;  3MC0 B;  4HCS A;  4FP5 D;  1BCP B;  1N36 Q;  4IUV A;  4YY3 Q;  1H95 A;  3K5M A;  2RDH A;  1LT5 D;  4KI0 A;  2YTY A;  5LMN W;  4JBM A;  2A19 A;  3QIA A;  4DR6 L;  2O5J C;  3A5U A;  3S15 H;  5FOB B;  1IYV A;  1NBW A;  1QVC A;  1C9O A;  3L2P A;  1VF5 C;  2F0J A;  1SYC A;  1BUV T;  1ZYR D;  2WKC A;  4AYB B;  4BXX H;  3OHX C;  3DWQ A;  4CJ2 C;  3J81 E;  1RTO A;  1QCB D;  2F0O A;  1PV4 A;  3IAY A;  1D8L A;  2Q2H A;  5AJ3 Q;  1EWH A;  2ICI A;  1FJG Q;  1KXL A;  5IYD G;  3N6R A;  3W2D A;  3I4M G;  5IOC A;  5E3F A;  1RKN A;  4TRD A;  2NWG A;  1RCV D;  3NQT A;  1QNK A;  1XPR A;  1VQ4 A;  5C0X J;  5M3F B;  4JOI C;  4FXD A;  2N55 A;  1QWY A;  2NVX B;  3DEP A;  2F0I A;  2UXB Q;  2B2T A;  1VQ7 A;  3ICE A;  2XRS D;  3DLL A;  5D65 A;  2I5M X;  4RGM A;  4MZ9 A;  2BE5 C;  1SND A;  2EQS A;  2BA0 A;  5M5X B;  3KLS A;  1GD7 A;  4A3L H;  3GD7 A;  1S72 A;  2RQX A;  5J3B A;  1X55 A;  2CFM A;  2YU9 B;  1DM0 B;  1RIP A;  2WV6 D;  1NTG A;  5AFW A;  4DK1 A;  1V1P A;  3WWV A;  1S5E D;  1IW7 C;  1WTH A;  3CCV A;  2F0W A;  1GXD C;  5LMN L;  5IT9 c;  4IPD A;  2DY7 A;  4JYA Q;  1RHP A;  4KKU A;  2K01 A;  5C44 G;  5IOD A;  5DLQ E;  1YZ6 A;  1MIU A;  4X3K A;  4P2C B;  5CV9 A;  5C5M A;  3OIQ A;  2EDG A;  5JAV A;  4IJH A;  1XPO A;  3DM1 A;  1W3S A;  1KNE A;  4RGT A;  2D5D A;  2JEA I;  5FKA C;  1EQV A;  1DYQ A;  1YNN D;  4RA8 A;  3P7J A;  5FLX E;  3QB3 A;  3S16 B;  1XNQ L;  1G2T A;  2F0V A;  2VQF L;  4ALP A;  1XJV A;  5A2Q L;  1TKW B;  4POG A;  3J81 L;  1BNZ A;  5JPM C;  2ZTE A;  3I4O A;  4POF A;  2BOS A;  3HOW B;  1NE3 A;  4GN5 A;  4ID6 A;  4GNX A;  5CV4 A;  2XVS A;  2Z0S A;  3A55 A;  3E5S A;  4A3D B;  2YTX A;  4DV2 Q;  3I91 A;  1LAB A;  4AQY L;  2K03 A;  2B8F A;  2OQ0 A;  4JI2 L;  3M7G A;  1GUT A;  1JJC B;  4DV7 L;  4K0K L;  2XGT A;  1E1T A;  3M3Y H;  3ND8 A;  1PFN A;  5EKL A;  2HUG A;  1KDA A;  4L5Q A;  2RF4 A;  3L0O A;  1SYG A;  4CKB A;  3GTP H;  3J80 i;  1DXM A;  3PO2 G;  1A6X A;  1WTV A;  3P20 A;  2VUM G;  1HTL D;  3BVM A;  4DNI A;  5ELE A;  4JI0 L;  1M90 C;  1X32 A;  3STB C;  4JYA L;  5JJI A;  3KYH C;  2YU9 H;  3J7A 5;  1MI2 A;  1TWA B;  1SSO A;  2AUJ D;  2WAQ B;  1NY4 A;  4JW0 A;  1HNX L;  2MHV A;  2B2U C;  3H0G B;  2NTS A;  1EY5 A;  4KY6 A;  5M9O A;  3CCS A;  4KLK A;  4A3M G;  3CC4 A;  2FIN B;  2M9V A;  4HID A;  3FKI H;  2KCN A;  4DUY Q;  1I4X A;  4FF2 A;  3HGB A;  2K5Q A;  1AE2 A;  2SNS A;  3M9B A;  2PMZ E;  1JB7 A;  2VQE L;  4QB4 A;  4JG2 A;  5AJ3 L;  4RCO A;  1YIJ A;  4YY3 L;  5EJW A;  4X64 Q;  4EVO A;  4F8M A;  2NVQ B;  3K5O A;  1IKM A;  2B2V A;  1ET9 A;  1SMY D;  2BCO A;  3KF8 A;  4HCE A;  4FDB A;  4UPA A;  3HOX H;  5JEA H;  5IYB G;  3I72 A;  2F0E A;  1PZJ D;  3S14 H;  2F3I A;  2H1E A;  1IXR A;  1AP0 A;  1QIL A;  2WII B;  2Z6K C;  3J7A F;  1CKN B;  4N9T A;  2A6E C;  1LTS D;  3C1E A;  4APV A;  5HGT A;  3PF5 A;  1GUO A;  5BN3 A;  4XTC S;  1C7Y A;  2CW0 C;  3NEN A;  1A3V A;  2PQE A;  3LNN A;  5FLM H;  2WAC A;  2GVA A;  4C56 C;  4XDX A;  1EUJ A;  2ES2 A;  4FNF A;  4H02 A;  4QQB X;  4MTK A;  1Y1V B;  4YCV A;  5G3L D;  2ZM6 L;  4IAL A;  4DK3 C;  2B2T C;  2HD3 A;  4OEM B;  1KNA A;  3H94 A;  3BG3 A;  3NTI A;  3VR2 A;  4JI4 L;  3Q22 A;  1EOT A;  3OW2 A;  3QO2 A;  3ITP A;  4ME3 A;  3NBH A;  2F0M A;  5C4X G;  5DNF A;  2NN6 H;  3QWN A;  1KD1 C;  2JA8 G;  3G4S A;  1Y1W B;  4IUT A;  1GKH A;  1TQO A;  2HIV A;  2PCF B;  3JAM L;  4BBR H;  1SYE A;  5C4J H;  4DGZ A;  4LF4 Q;  4ZAI A;  2FJ2 A;  2KUM A;  2NZ1 D;  3D6C A;  3DXJ C;  3U4Z A;  5M5X H;  4HED A;  4JI3 L;  1EFI D;  3OPO A;  4XXE A;  1NSN S;  5FO9 B;  4A3B H;  5J39 A;  2Y0S B;  1OTC A;  2LY7 A;  4A3G B;  1F2M A;  1TWC H;  1STH A;  3CHB D;  1T5E A;  1KAA A;  4LF9 Q;  4DV5 Q;  3ZYY X;  4RWS C;  4X65 Q;  2A8V A;  2R7Z H;  4CKC A;  4V0B A;  1P8L A;  3HOX B;  2MO1 A;  5ELN A;  1HNW Q;  4JBW A;  4QF4 A;  4JI1 L;  2E74 C;  3EA6 A;  3NTH A;  3LX0 A;  4RFB A;  3CCR A;  4JPB W;  2HQE A;  3H0G G;  1PH2 A;  3K59 A;  1CM9 A;  4GOP A;  1VQH A;  5CV7 A;  1Q90 A;  4QGU A;  1D5Z C;  3M7N A;  2JN4 A;  2L0C A;  4DK6 C;  1X6O A;  2TMP A;  4DV0 L;  3JAM i;  5IYC G;  1HR0 L;  3KK7 A;  2IT1 A;  3NWT A;  1EL0 A;  3HOW H;  4IOC A;  5EKK A;  4LF7 L;  2R92 H;  1YJN A;  3X3M A;  3SR1 A;  3PUX A;  3S16 H;  3S2D B;  3PO3 G;  4CJ1 B;  3MFG A;  3A8J E;  2NVT H;  1VQI A;  3PO2 H;  1IBK Q;  1K3B C;  4UY8 C;  4B3M Q;  2QW7 A;  3SK4 A;  1EIG A;  3CW2 C;  2F3V A;  1A63 A;  1NNX A;  4JI6 Q;  4L8J A;  5EBD A;  1QNU A;  3T16 A;  1BKB A;  4QMG A;  2JA8 B;  2QEX A;  4WRD A;  2IX1 A;  4DXF A;  3P1H A;  1L0Y B;  5C4X B;  1MGS A;  2QDB A;  2WP8 J;  2DNC A;  3CF5 A;  1N34 L;  4BY7 G;  2E5L Q;  2C9O A;  1WD0 A;  1BOS A;  2IHF A;  5I9P A;  1PA6 A;  1AE3 A;  2IWH A;  2Q2I A;  3RN5 A;  4X64 L;  4DR5 Q;  4U67 3;  4G7H C;  2F1M A;  1M4V A;  3HOU B;  1PRT D;  2ICE C;  1A3U A;  2J7Z A;  4K14 A;  4KTA A;  2Z9H A;  3S1M B;  2I46 A;  5HUR A;  3S17 H;  2DN8 A;  3KDF A;  2Z6K A;  1AFP A;  5DEH A;  1NMF A;  5C0X I;  5EAY A;  2HDM A;  1IKL A;  1HJP A;  2WIN B;  4KHZ A;  4L5T A;  1UEB A;  3AFQ A;  1AN8 A;  2EVB A;  4NXN Q;  1VQ9 A;  2SEB D;  1K8G A;  4RKB A;  4DNT B;  2R93 B;  3PUV A;  2IJ0 A;  2X6G A;  2CQA A;  4HN7 A;  4IUP A;  4A3F B;  3E9I A;  2L5T A;  4K5V A;  1WTP A;  2NZH A;  4JI0 Q;  1H9M A;  4OL7 A;  3H3V I;  4R4O A;  1JOQ A;  5EBC A;  4XIG S;  3AFP A;  1WTR A;  3HOY H;  1V8Q A;  1RF2 D;  4H13 C;  4PG3 A;  3C3L A;  4LF5 L;  1NMG A;  3BZK A;  2RDF A;  1QE6 A;  3BZC A;  2WB1 E;  1F9S A;  5COY A;  4JI5 Q;  4O1N A;  3HKZ E;  1S5C D;  1PDQ A;  1KAB A;  2R3Z A;  1WVL A;  1ENA A;  2E76 C;  1KRS A;  4J8Q A;  3NQI A;  4K6D A;  4IPC A;  1U0L A;  2LSS A;  1EYA A;  4NXN L;  4DXG A;  1GOZ A;  4LUZ A;  5EPJ A;  3ULL A;  1T9H A;  3I56 A;  3CME A;  3CMA A;  4WOR A;  1VQP A;  1HH2 P;  3RLO A;  1BBX C;  5EPK A;  1BVS A;  5M5W H;  2D2C C;  5HGQ A;  2I0Q A;  4ZQ3 A;  2EOT A;  2WFW A;  4DV4 L;  2VXW A;  4B9W A;  3IKJ A;  3F2C A;  4LWC A;  3B6Y A;  2XRQ D;  1HZ9 A;  3KLR A;  4X62 L;  2PPB C;  1JWU D;  3TP5 A;  2F0Q A;  2AQ1 B;  2MFI A;  4A3E B;  4DR4 L;  1VQ8 A;  4OO1 G;  4IFD J;  4YCU A;  5K36 H;  2L55 A;  3DWA A;  1EY8 A;  5FLM G;  3J81 c;  3H3V C;  1HHV A;  1EY6 A;  3J81 i;  2CH4 W;  1CKM A;  1DD2 A;  5D3I B;  1JWM D;  1NR2 A;  4DR5 L;  1HZB A;  4N8X 1;  3HOW G;  5M3M G;  3HKZ G;  5KYI A;  4C1N I;  3TEH B;  4X3U A;  3X3N A;  3OW7 A;  3I7F A;  4F88 A;  1PXU A;  1PVO A;  1O78 A;  1TU2 B;  1FGU A;  3IL8 A;  4BS9 A;  4CBV A;  2QF7 A;  3FEW X;  4RGN A;  4A3I G;  4NXM Q;  4ODG A;  2PZW A;  1TWH B;  1UAP A;  1BCP F;  2N78 A;  1PH6 A;  2PMZ B;  4JK1 C;  5M3M H;  3E0J A;  3JAM E;  1SNP A;  4X66 Q;  2G9H D;  3S2H H;  3FKI B;  2Q8R E;  5C44 B;  3J80 L;  3RZO B;  1O7L A;  2R7Z G;  1XMO Q;  3C1F A;  2A6E D;  2Y0S G;  2AQ2 B;  4C3I H;  1EYD A;  1PTO F;  2H4O A;  4DR1 Q;  1EU4 A;  1J8I A;  2E2I H;  4OO1 H;  2EYL A;  1Y8P B;  3H91 A;  2IX3 A;  3M4O B;  4KHP L;  1EY7 A;  4LMQ D;  4DV1 Q;  3HOZ B;  1EZ8 A;  3UE0 A;  3RZD B;  4JI8 L;  3M4P A;  1VF7 A;  2AUK A;  2O4X A;  1LV9 A;  1SDF A;  4BBS G;  2B29 A;  2PZT A;  5EKI A;  1J9O A;  4IZ8 A;  3D4R A;  4RMF A;  1MD2 D;  3RZD H;  1XTD A;  2JQO A;  4B3T L;  5CV5 A;  1X3P A;  5K36 G;  5IGB A;  1SYF A;  5IE8 A;  4LFC L;  2K5D A;  4IO9 A;  5M3F G;  1YVC A;  1XMQ Q;  2K5N A;  1EIY B;  2A6H C;  1EY0 A;  4TKO B;  4UHV A;  3PCO B;  4CDE C;  5IP9 G;  3VR6 A;  3VYR A;  4IFD G;  4QUF A;  2JA9 A;  3K58 A;  2NN6 G;  1LTL A;  4A3J H;  1WCM H;  2LXK A;  5I9O A;  1E0B A;  4DR2 Q;  2BH2 A;  1FD7 D;  1DCZ A;  4DUZ L;  1SNM A;  4R4C A;  1U4M A;  1Y1V G;  3RUZ A;  3T1Y L;  1KHI A;  1I4P A;  3KJO A;  1HZC A;  4I65 A;  1D6E C;  2JA5 G;  1SJE D;  2B63 G;  4B3S L;  3U50 C;  1FVI A;  1HUM A;  3O13 A;  1Z6H A;  4J6H A;  2BDN A;  3EFX D;  2SOB A;  3NK9 A;  1NAP A;  4QY7 A;  5LHY 1;  2X6L A;  4C3H H;  4NW2 A;  4A4I A;  3AB9 A;  2ASB A;  4IUR A;  1PH1 A;  1T5X D;  2ZXR A;  3GTL B;  2R6G A;  5A35 A;  1ICW A;  2EJG C;  3KF6 A;  1K73 C;  2PZU A;  2XIW A;  3HG9 A;  5D14 A;  1STE A;  4OHJ A;  4K2K A;  1XX8 A;  3KFU A;  1IBL L;  3K7A B;  4LFC Q;  1G2S A;  1QZG A;  1VQB A;  4AH6 A;  2FFK B;  4I7Z C;  4DUZ Q;  3Q24 A;  3EBE A;  5JJL A;  5KIX A;  2JXM B;  3K80 C;  2Z4H A;  5IIF A;  5L37 A;  5IWA Q;  1MHW C;  2OEO A;  4CDD C;  4ZK9 B;  4A3M B;  1YNJ C;  4KD3 A;  4L63 B;  1VQ5 A;  1ZKO A;  4KJN A;  1LTT D;  2XSC A;  4XQQ A;  3VYT A;  1PRT F;  4FXG C;  5GRO A;  1N33 L;  2MP1 A;  1HA5 A;  4BY7 H;  1DZ1 A;  2K52 A;  5CYU A;  2UUA L;  4B3T Q;  3UDX A;  4LW1 A;  2QEJ C;  2JA7 B;  3HEJ A;  5FO8 B;  5M5Y H;  1VQA A;  1PH3 A;  5JPN C;  1D1K A;  2KOL A;  2DUD A;  2B39 A;  3SK5 A;  4HMJ A;  4UP8 A;  4M1U B;  1J5E L;  1H9K A;  5I2X A;  1C0A A;  4IOA A;  1YIT A;  4KHP Q;  4YIJ A;  1RDP D;  3HKZ B;  1D2B A;  4ZYS A;  1JE5 A;  2OF1 A;  4UP7 A;  3PUZ A;  2GN5 A;  1CT1 D;  2Q2U A;  1XTC D;  1IW7 D;  3RZO H;  3M3Y B;  4HMI A;  3VA7 A;  1P16 A;  2VS1 A;  1KDC A;  3GTP B;  4XYO A;  2AMC B;  3MXN B;  2E2I B;  1VQO A;  2K14 A;  4G7Z C;  4P75 A;  2L1B A;  2OTJ A;  3H15 A;  4A3D G;  2F0S A;  4U68 A;  4A3E H;  4LUV A;  2N3S A;  4FF1 A;  5LMU L;  1YNX A;  4DV3 L;  1EEF D;  3MWY W;  2ZJP A;  4A3K B;  5I2Y A;  4A93 B;  4EGV A;  2VW9 A;  2CCZ A;  1F2L A;  1G51 A;  1HCZ A;  5IGG A;  1MSH A;  1X3E A;  1Y1W H;  4A3D H;  1LT6 D;  3PIO 3;  5HY6 A;  2IL8 A;  3PSI A;  1QOH A;  2VQE Q;  4NKL A;  3BJU A;  1VQL A;  1R9T H;  2RA4 A;  3NE5 B;  2V4D A;  3AMU A;  1O7I A;  1HQR D;  4EX5 A;  1KC8 C;  2OWO A;  1JMC A;  1WOC A;  1D5M C;  1B8A A;  4DK0 A;  4MTN A;  3D4D A;  1F2Y A;  3GTQ H;  3EN2 A;  1HNX Q;  3K5N A;  1Y14 B;  4N9P A;  1A2U A;  3I4N B;  1TY2 A;  1JCK B;  3T1Y Q;  3S2H B;  2A68 D;  1LTI D;  1SFO H;  5C44 H;  3E6Z X;  1TWF H;  3K0X A;  3CU7 A;  3TS0 A;  1MBY A;  4GOP B;  3BU2 A;  3U58 A;  1OO9 B;  3EVQ A;  1PZK D;  1V1P B;  4FXK C;  3PUY A;  3VR3 A;  3PGZ A;  2OCE A;  1W2B A;  1HRJ A;  3DMU A;  3NWS A;  3S1Q H;  2H5X A;  4GN4 B;  3NHH A;  4JBK A;  4HIM A;  3GTL H;  5E4X A;  2K5V A;  3GTO H;  2UXD L;  2IW3 A;  3VR4 A;  1GUG A;  3H0G H;  4BA2 I;  2EY5 A;  1DOL A;  3U4V A;  4LF6 L;  4K0K Q;  1SJH D;  1K83 B;  1Y1V H;  2WB1 B;  4CKE A;  4GZY C;  2F4V Q;  3K7U C;  1BBU A;  5BR8 L;  2VQF Q;  3G6J B;  4IFD I;  4EQP A;  1A0I A;  1X3F A;  1U9R A;  3DM3 A;  2B8G A;  3TP6 A;  4IFD H;  4ZRZ A;  1Y8N B;  4LF5 Q;  2UXD Q;  2LKV A;  5M3F H;  3F2B A;  4GS3 A;  1V1Q A;  1WTW A;  2GVB A;  3BZD B;  4ZLT F;  3TDQ A;  5IP7 H;  2FHT A;  4R4T A;  1C48 A;  1S40 A;  2MPM A;  1VQK A;  1G6P A;  4A93 H;  1JQY D;  4XT3 B;  2MNA A;  1B4O A;  3C46 A;  4QIW E;  2RCF A;  5NUC A;  3A8I E;  3J7Y W;  2OQK A;  2A73 B;  1UE5 A;  1Z47 A;  4A3J B;  1EQQ A;  4BBR G;  5IT9 E;  1ENF A;  4P74 A;  5EPL A;  1R9T B;  4GKK Q;  3MTS A;  3HOU H;  2CHB D;  4BBS B;  3BS1 A;  3ND9 A;  1TWA H;  5EGT A;  1CHP D;  3S1M H;  2QA4 A;  1SNO A;  2KHI A;  3A5Z B;  2PNH A;  1B3A A;  1C4Q A;  4R4Q A;  5C5L A;  2CQO A;  4DNR B;  2NVY B;  1EWI A;  4ZKC B;  1XYI A;  1JJG A;  1H9J A;  1QUQ B;  1Q1B A;  4CHT B;  1PZI D;  2RHS B;  3VR5 A;  5JEA G;  3F8T A;  2XWJ B;  2KCC A;  4ZUJ A;  3K5L A;  3G7L A;  1IL2 A;  2UUB L;  2ZTC A;  2JA7 G;  1NJI C;  4KKS A;  3S1Q B;  2PW7 A;  2DJG C;  1X3G A;  1L0W A;  5A2Q E;  2KEC A;  2UXB L;  1VQC A;  2NZO A;  2Z8L A;  1EQT A;  3SK8 A;  3VA5 A;  4JI6 L;  4OXP A;  5H1S E;  1I6H B;  3V2T A;  3PUW A;  3S1N H;  3T4A C;  1X56 A;  2KHS A;  4LF7 Q;  2XWB B;  1IYJ B;  3EIV A;  4YHH L;  3QG1 A;  2KQ3 A;  2R93 H;  4NMZ A;  3HRZ C;  2J4X A;  2XTI A;  1SE4 A;  1X3Q A;  3MXN A;  1KIX A;  3HOX G;  1I3Q H;  2B63 H;  3KDF B;  3HFZ B;  4E6I A;  4A76 A;  1N36 L;  4LUO A;  2F0F A;  2O2L D;  3CQZ B;  1PFB A;  2HT1 A;  1D5X C;  4GKJ Q;  3CC2 A;  2KHJ A;  1QVG A;  1ZYR C;  4LF6 Q;  1SAP A;  5KRU A;  1SYD A;  3NEM A;  4IN3 A;  4M8A A;  2UXC L;  4Z9C B;  5JJZ A;  2LXJ A;  4WJ4 A;  2IPK D;  2SNM A;  2EXZ A;  3K6O A;  3KLS X;  3J7Z C;  1A62 A;  1M1K C;  2D0O A;  2K33 A;  4DV6 L;  1ZEQ X;  4JI1 Q;  1STY A;  3OWE B;  1ESF A;  3KLW A;  1K0R A;  2G9D A;  1GUN A;  2VZA A;  1YNJ D;  1I50 B;  1WI5 A;  4BBS H;  1SBB B;  1PHJ A;  5LMN Q;  4J1M A;  4C3J G;  3W3A A;  2B2V C;  4O0A A;  4DV5 L;  1TS2 A;  3BDL A;  5C4Z A;  1TII D;  1I6V C;  4Y7N B;  3CCM A;  3D0F A;  1I4G A;  4LFA Q;  1FL0 A;  2NN6 I;  2D9U A;  3H09 A;  1K0S A;  2BA1 A;  4JI3 Q;  1B9M A;  3TP7 A;  1KLU D;  3GTG H;  4JCV E;  3K81 C;  1QB5 D;  1SRU A;  2KCM A;  3CRL C;  2EYJ A;  1H9R A;  3I4L A;  3RLF A;  3S14 B;  1SE8 A;  2MJ8 A;  3GTG B;  1VDZ A;  1O80 A;  4ZCK A;  4LFB Q;  3HS0 C;  4A3L G;  4H7B A;  3NBI A;  3HOV B;  3CC7 A;  4EQO A;  2KCT A;  1AW7 A;  5IY0 A;  1U5K A;  3S1R B;  4QL5 A;  2RVL A;  3MEF A;  3I4N G;  3HOY B;  4C3I B;  1OXU A;  2F3W A;  3CRK C;  2B3G A;  1TWG B;  3TSS A;  3E9H A;  1BXT A;  1F9P A;  1ASY A;  5CBA E;  2R7Z B;  4S3S A;  2E75 C;  3D8G A;  3TN2 A;  3S1R H;  1OXS C;  1TWF B;  4C1N K;  1ET6 A;  2UU9 L;  3L7Z C;  1KTK A;  4BA1 I;  4OIJ A;  5T1I A;  2A6H D;  5K5P A;  1YJW A;  2VY3 A;  2WKD A;  4DR7 L;  5CV8 A;  1D1I A;  1F2Z A;  4UDU C;  4KHV A;  4KN7 C;  1LTB D;  4HIO A;  3WOE A;  1FGB D;  2AWO A;  1B7Y B;  3EJI A;  3STB D;  4IJL A;  3QOL A;  2EYH A;  3HP3 A;  3TME A;  3M4O H;  3P75 A;  2JJQ A;  1TR5 A;  4A93 G;  4HR7 B;  1UEA B;  4HIK A;  4A3I H;  4O42 A;  1A8V A;  1S5B D;  2JA7 H;  4G7O C;  1U4R A;  4R4I A;  4K6L A;  3S2D H;  1ILQ A;  3D31 A;  2UUA Q;  2PYK A;  3FMC A; 
#chains in the Genus database with same CATH homology
 2K5N A;  1EIY B;  3PCO B;  2QGQ A;  1E1O A;  5IP9 G;  5GAE C;  1Z9F A;  4AQY L;  4BY1 H;  2OQ0 A;  4IFD G;  4X66 L;  2JA9 A;  1L1O A;  4Y7N H;  4JI2 L;  2NN6 G;  3G71 A;  4BXX G;  1EFW A;  1LTL A;  1JJC B;  2BH8 A;  4DV7 L;  1WCM H;  2LXK A;  4A3J H;  4PZ6 A;  4K0K L;  1GVP A;  4DR2 Q;  2XGT A;  2BH2 A;  4DUZ L;  1UWV A;  1QZH A;  4X6A H;  1HNW L;  4R4C A;  1E1T A;  3M3Y H;  1Y1V G;  3CCE A;  4B3R L;  2KBN A;  4JOI A;  1KHI A;  3T1Y L;  4L5Q A;  2RF4 A;  3L0O A;  2A1A A;  4AYB G;  3KJO A;  3GTP H;  3J80 i;  1HZC A;  2NVX H;  3PO2 G;  3GTJ H;  2JA5 G;  2B63 G;  4B3S L;  1X9N A;  3U50 C;  1FVI A;  5IYD H;  2VUM G;  1Q82 C;  3S24 A;  4DNI A;  4DPG A;  4JI0 L;  2ALY B;  1M90 C;  3TS2 A;  3ER0 A;  3STB C;  4JYA L;  3PO3 H;  5JJI A;  4QY7 A;  3KYH C;  1EOV A;  4TQU S;  1L1O B;  1BBW A;  4MNO A;  1K8A C;  2YU9 H;  4JI7 L;  4C3H H;  3J7A 5;  5GQO A;  1SN8 A;  3AEV A;  4A4I A;  3GO5 A;  3NBH B;  2ASB A;  4NB3 A;  1VQ6 A;  3UDI A;  1PH1 A;  1NY4 A;  2YTV A;  2R6G A;  3CP0 A;  1HNX L;  1YI2 A;  3KF6 A;  1K73 C;  3HKS A;  3CCS A;  1DGS A;  1VQJ A;  1TWG H;  1EQR A;  3NEL A;  3CCJ A;  4KLK A;  4A3M G;  3CC4 A;  4HID A;  3KFU A;  1IBL L;  1Q1E A;  3FKI H;  2FXQ A;  4LFC Q;  4DUY Q;  1QZG A;  1VQB A;  2N49 A;  4AH6 A;  1Q86 C;  1AE2 A;  3JC6 6;  3M9B A;  4DUZ Q;  4A3B G;  2PMZ E;  2AKW B;  2IY5 B;  3EBE A;  2VQE L;  1JB7 A;  5JJL A;  3K80 C;  4JG2 A;  5AJ3 L;  4DV7 Q;  1YIJ A;  2R92 G;  2JA6 H;  1OXT A;  4YY3 L;  5IWA Q;  2PQA B;  3PV0 A;  4HJ8 A;  4YCW A;  3J80 c;  4X64 Q;  1OXV A;  1J6Q A;  1HNZ L;  4YWK A;  1ASZ A;  3K8A A;  5C3E H;  4B3M L;  4A3G G;  3G48 A;  1VQ5 A;  4A3F H;  4DV2 Q;  4B3S Q;  4DV6 Q;  1I6H H;  1I5F A;  1V43 A;  3I55 A;  1L2F A;  5GRO A;  1N33 L;  4FDB A;  4UPA A;  3HOX H;  1XMQ L;  2K52 A;  5IYB G;  4BY7 H;  4P72 A;  1PH7 A;  3S14 H;  2UUA L;  2F3I A;  1HR0 W;  1IXR A;  4B3T Q;  3UE1 A;  1PYS B;  3UDX A;  2ZM6 Q;  1K3R A;  2WAQ E;  3HOV G;  4LF8 L;  4LW1 A;  2JA8 H;  1WYD A;  4OWW B;  3OYY A;  5M5Y H;  1VQA A;  3IRB A;  3CAM A;  1PH3 A;  2Z6K C;  3TRE A;  4GNX C;  1CKN B;  1EIF A;  2DUD A;  2K4K A;  5FJ8 H;  4APV A;  3PF5 A;  4UP9 A;  2F52 A;  4UP8 A;  4XTC S;  3NEN A;  1J5E L;  1C7Y A;  1XPU A;  1KQS A;  1MKH A;  1C0A A;  5FLM H;  4IOA A;  1YIT A;  4KHP Q;  1Y1W G;  4OON A;  4A3K G;  2GVA A;  1JE5 A;  3HOZ H;  2ZTD A;  4UP7 A;  1EUJ A;  4JI8 Q;  4H02 A;  3M85 A;  2ES2 A;  1XNQ Q;  4QQB X;  3PUZ A;  2GN5 A;  4YCV A;  2Q2U A;  4LF8 Q;  2ZM6 L;  1YEZ A;  4DK3 C;  3T1H L;  3RZO H;  3JAM c;  1KAW A;  1P16 A;  2VS1 A;  4C3J H;  3KF8 B;  1HZA A;  1I50 H;  1HNZ Q;  2AMC B;  3MXN B;  1CKO A;  3Q8D A;  4HJ9 A;  3VDY A;  5BR8 Q;  1VQO A;  1XMO L;  2K14 A;  2UUC Q;  4JI4 L;  3OW2 A;  4A3E G;  1EYG A;  4P75 A;  4ME3 A;  5C4X G;  2OTJ A;  3H15 A;  4A3J G;  1TXY A;  4A3D G;  4A3E H;  4JI7 Q;  4LUV A;  2N3S A;  1X65 A;  1K9M C;  3KF6 B;  4BY1 G;  3FP9 A;  5LMU L;  2V1C C;  1KD1 C;  1YNX A;  2EIF A;  1X54 A;  1YHB A;  5IP9 H;  5IP7 G;  4DV3 L;  1VQN A;  2JA8 G;  2ZJP A;  3G4S A;  1YJ9 A;  1B70 B;  1VQE A;  4NXM L;  2JK8 A;  4GKK L;  1GKH A;  2HIV A;  2VW9 A;  2CCZ A;  4BBR H;  2JEB I;  1E22 A;  5C4J H;  1G51 A;  1SMX A;  4LF4 Q;  1X3E A;  3F1Z A;  3PIO A;  1Y1W H;  4R1J A;  4A3D H;  1YHA A;  2R7F A;  1WFQ A;  5C4X H;  3HOZ G;  5HY6 A;  3U4Z A;  1JT8 A;  1KL9 A;  3PSI A;  5M5X H;  4P73 A;  4JI3 L;  1WJJ A;  2VQE Q;  2E8G A;  3CCQ A;  4C2M H;  4LF4 L;  3BJU A;  1VQL A;  1R9T H;  3GTK H;  3J81 j;  2UUB Q;  4A3B H;  1O7I A;  1V9P A;  4EX5 A;  1KC8 C;  1OTC A;  1JMC A;  1WOC A;  1N34 Q;  2OWO A;  3PIP A;  3TQY A;  5GAH C;  4GN3 B;  1TWC H;  1B8A A;  1VQD A;  3FKI G;  4MTN A;  1MJE A;  3CPF A;  1PH8 A;  2WB1 G;  1IBK L;  4J15 A;  4DV5 Q;  4A3M H;  2OTL A;  4LF9 Q;  1FJG L;  3EN2 A;  1HNX Q;  4AYB E;  1Y14 B;  3GTQ H;  2HQL A;  4DR6 Q;  1Q46 A;  4PZ8 A;  4OWT B;  4DR4 Q;  2AWN A;  4X65 Q;  5C0X G;  2A8V A;  3T1Y Q;  2R7Z H;  1YBY A;  4A3G H;  1SFO H;  1IZ6 A;  5C44 H;  1P8L A;  1UE7 A;  4OO1 I;  1TWF H;  2MO1 A;  3K0X A;  5ELN A;  4LNQ A;  2K5H A;  3TS0 A;  4JBW A;  2CWP A;  4PZ7 A;  4QJF A;  3RLN A;  3SGI A;  4JI1 L;  4GOP B;  4GNX B;  1RL2 A;  2K50 A;  3BU2 A;  2KEN A;  2IX0 A;  3U58 A;  2I5L X;  5IYC H;  3CCR A;  3I4N H;  3PUY A;  2F4V L;  3PGZ A;  2OCE A;  1W2B A;  3H0G G;  5ELO A;  3S1Q H;  2H5X A;  2L15 A;  4GN4 B;  1PH2 A;  4AQY Q;  4OWX B;  2WAQ G;  5IYB H;  4JBK A;  4GOP A;  1VQH A;  3LGJ A;  4HIM A;  4DR7 Q;  1OXX K;  3ULJ A;  4QGU A;  2K5V A;  3GTO H;  3GTL H;  2UXD L;  3M7N A;  4IPG A;  3A0J A;  4DK6 C;  4X62 Q;  1X6O A;  4A75 A;  3T1H Q;  2ZJR A;  1CSP A;  3H0G H;  4BA2 I;  2IHE A;  3JAM i;  3U4V A;  5IYC G;  4DV0 L;  1HR0 L;  4LF6 L;  4K0K Q;  1Y1V H;  3ERS X;  2IT1 A;  3M4Q A;  4DR3 L;  4YWM A;  2F4V Q;  1IBM L;  3HOW H;  3K7U C;  4PMW A;  4IOC A;  2RHQ B;  3CCL A;  4LF7 L;  1BBU A;  5BR8 L;  1PYB A;  2VQF Q;  2HHH L;  4TVA B;  2R92 H;  3ULP A;  1YJN A;  1A0I A;  1X3F A;  3AYH B;  3PUX A;  3S16 H;  4IFD I;  3KJP A;  3DM3 A;  3PO3 G;  1UE6 A;  4LF5 Q;  1K83 H;  3HOU G;  2UXD Q;  2DGY A;  3G6E A;  3CCU A;  4DV0 Q;  1HR0 Q;  4L5R C;  1G29 1;  2NVT H;  1N9W A;  3GDE A;  5M3F H;  2CKZ B;  3F2B A;  2ID0 A;  2D0P A;  1V1Q A;  4GS3 A;  4HJ5 A;  2JA5 H;  2GVB A;  4DAY B;  1VQI A;  3PO2 H;  1IBK Q;  4UY8 C;  4P71 A;  5IP7 H;  4R4T A;  1GM5 A;  4B3M Q;  2YYZ A;  1S40 A;  1VQK A;  2CWA A;  1XNR L;  1G6P A;  2AHO B;  1VS0 A;  3CW2 C;  1S3O A;  2YV5 A;  4A3K H;  4A93 H;  1A63 A;  4DAM A;  1E24 A;  4JI6 Q;  2MNA A;  5JEA J;  1VQF A;  4GLX A;  1BKB A;  4QIW E;  4JI5 L;  4GLA C;  2QEX A;  2OQK A;  4RG1 A;  2IX1 A;  3ZJY C;  1VQG A;  2PI2 A;  1UE5 A;  2K75 A;  1Z47 A;  4DUY L;  1N8R C;  3CD6 A;  2VUM H;  1EQQ A;  1SLJ A;  4BBR G;  1IBL Q;  4LF9 L;  2WP8 J;  4P74 A;  1LM0 A;  2VL6 A;  1Q7Y C;  3CF5 A;  1N34 L;  4BY7 G;  2E5L Q;  3RN2 A;  1VCI A;  2NVY H;  2IHF A;  1PA6 A;  4GKK Q;  1AE3 A;  3HOU H;  3S1M H;  1TWA H;  2QA4 A;  2Q2I A;  2KHI A;  3RN5 A;  3A5Z B;  4X64 L;  4DR5 Q;  2PNH A;  1QVF A;  4AIM A;  3H3V H;  2PQA A;  4JV5 Q;  5IWA L;  4R4Q A;  1LUZ A;  1WCM G;  4A3C H;  2CQO A;  5FJ8 G;  1EWI A;  3F2D A;  1KRT A;  3S17 H;  1E7Z A;  1JJG A;  3KDF A;  4LFA L;  1LYL A;  2Z6K A;  5GAG C;  3OTO Q;  1QUQ B;  1NMF A;  5C0X I;  1Q1B A;  5EAY A;  4DKA C;  4LFB L;  3A74 A;  2RHS B;  5JEA G;  2E2H H;  1HJP A;  3F8T A;  4KHZ A;  4L5T A;  1PH9 A;  1UEB A;  2N8N A;  3AFQ A;  1IL2 A;  2EXD A;  4HJ7 A;  2ZTC A;  2UUB L;  1VQ9 A;  1NJI C;  4NXN Q;  2JA7 G;  4A3F G;  2UXC Q;  1CUK A;  1K8G A;  1L0W A;  1X3G A;  4IPH A;  4DV3 Q;  2NVQ H;  2UXB L;  1VQC A;  2R93 G;  2NZO A;  3PUV A;  5LMU Q;  1CSQ A;  1PH5 A;  4JI6 L;  3E9I A;  4OXP A;  2ATW A;  5H1S E;  5GAD C;  2JA6 G;  1JJ2 A;  3PUW A;  3S1N H;  1X56 A;  2NZH A;  4JI0 Q;  4LF7 Q;  4YHH L;  1IYJ B;  3EIV A;  3I2Z A;  5E7N A;  2R93 H;  3HOV H;  3TRZ A;  3H3V I;  4R4O A;  4DV2 L;  2E5L L;  2JE6 I;  3AFP A;  2XTI A;  4XIG S;  3UDG A;  4YWL A;  4JBJ A;  1QUQ A;  1HNW Q;  3HOY H;  1KIX A;  3HOX G;  1CKN A;  1I3Q H;  2B63 H;  2Y0S E;  4PG3 A;  4HJA A;  1I94 L;  4LF5 L;  1Q8K A;  1NMG A;  1SR3 A;  3BZK A;  3KDF B;  3AQQ A;  3HFZ B;  4OX9 Q;  4A3C G;  4B3R Q;  4A76 A;  1N36 L;  1VQM A;  3UDF A;  3BZC A;  2Q2T A;  2WB1 E;  5C3E G;  4LUO A;  4JI5 Q;  3HKZ E;  4YHH Q;  4DR3 Q;  1J5E Q;  4WJ3 M;  2HT1 A;  5FLX c;  1N36 Q;  1KRS A;  4GKJ Q;  3CC2 A;  4YY3 Q;  1H95 A;  2KHJ A;  4OX9 L;  1QVG A;  4IPC A;  1I94 Q;  4KI0 A;  4LF6 Q;  1SRO A;  1U0L A;  3NEM A;  2LSS A;  2YTY A;  5LMN W;  4JBM A;  2A19 A;  2UXC L;  4DR6 L;  4WJ4 A;  2LXJ A;  4NXN L;  3A5U A;  3S15 H;  2D62 A;  4LUZ A;  3W1B A;  3J7Z C;  3ULL A;  1T9H A;  1A62 A;  1NBW A;  3I56 A;  1M1K C;  2D0O A;  3CME A;  3CMA A;  1N33 Q;  1VQP A;  1HH2 P;  3RLO A;  4DV6 L;  1QVC A;  1BVS A;  4JI1 Q;  1C9O A;  5M5W H;  3L2P A;  4JI4 Q;  5HGQ A;  2I0Q A;  4BXX H;  4NPS A;  3KLW A;  1K0R A;  2WFW A;  2VZA A;  4DV4 L;  4BBS H;  1WI5 A;  3F2C A;  1GO3 E;  3W1G A;  5LMN Q;  4LWC A;  1PV4 A;  1PHJ A;  3B6Y A;  1D8L A;  1HZ9 A;  2Q2H A;  4X62 L;  5AJ3 Q;  4O0A A;  4DV5 L;  1FJG Q;  1KXL A;  5IYD G;  4EQ5 A;  2VNU D;  4X65 L;  2MFI A;  4DR4 L;  3FHW A;  3I4M H;  1VQ8 A;  3I4M G;  2UU9 Q;  4OO1 G;  3CCM A;  1UE1 A;  3D0F A;  4LFA Q;  4IFD J;  4YCU A;  1N32 Q;  1FL0 A;  1Q12 A;  2NN6 I;  1XPR A;  2BA1 A;  3J81 c;  2HIX A;  5FLM G;  5C0X J;  1VQ4 A;  1PH4 A;  4JI3 Q;  4L5S A;  4JOI C;  3J81 i;  3GTG H;  1CKM A;  4JCV E;  3K81 C;  2I5H A;  2E2J H;  4DR5 L;  4DR2 L;  2UXB Q;  1SRU A;  2KCM A;  1VQ7 A;  1MJC A;  3ICE A;  1HZB A;  3HOW G;  3DLL A;  5M3M G;  2I5M X;  3HKZ G;  4JV5 L;  2PI2 E;  4MZ9 A;  3RLF A;  3TEH B;  1SE8 A;  2EQS A;  2UUC L;  2BA0 A;  3I7F A;  1PVO A;  1XNR Q;  1GD7 A;  4A3L H;  1N32 L;  1FGU A;  3W5O A;  3GD7 A;  1S72 A;  3OTO L;  4LFB Q;  5J3B A;  1X55 A;  2CFM A;  4JC0 A;  4A3L G;  1RIP A;  1NTG A;  4A3I G;  4NXM Q;  3CC7 A;  2KCT A;  3WWV A;  2C35 B;  2N78 A;  3CCV A;  4DV4 Q;  5IY0 A;  1U5K A;  1PH6 A;  4QL5 A;  3MEF A;  1Q81 C;  3I4N G;  1AH9 A;  5M3M H;  1E3P A;  1OXU A;  5LMN L;  5IT9 c;  1L1O C;  4IPD A;  4GKJ L;  2B3G A;  4O2D A;  4JI2 Q;  4X66 Q;  4JYA Q;  3E9H A;  1ASY A;  3RNU A;  3S2H H;  2MO0 A;  3K7A H;  1TWH H;  5C44 G;  3KOJ A;  3S1R H;  5DLQ E;  1OXS C;  1XMO Q;  2R7Z G;  1YZ6 A;  2Y0S G;  4C3I H;  3PF4 A;  1MIU A;  4DR1 Q;  2UU9 L;  3CQZ H;  1XPO A;  4IJH A;  3L7Z C;  2E2I H;  2RCN A;  3HOY G;  4BA1 I;  1W3S A;  1YJW A;  2VY3 A;  2JEA I;  4DR7 L;  1D7Q A;  1PFS A;  4KHP L;  4DV1 Q;  3UE0 A;  5JJK A;  4DR1 L;  4JI8 L;  1XNQ L;  4HIO A;  3M4P A;  2AWO A;  2VQF L;  4ALP A;  2HHH Q;  1B7Y B;  3STB D;  1XJV A;  4BBS G;  2B29 A;  4IJL A;  4GOP C;  4POG A;  3M4O H;  3RR5 A;  2JJQ A;  4GLV B;  4RMF A;  2ZTE A;  3CPW A;  3RZD H;  4Y52 H;  3I4O A;  1IBM Q;  4A93 G;  4POF A;  1XTD A;  2JQO A;  3CXC A;  1NE3 A;  4HIK A;  4GN5 A;  4A3I H;  4B3T L;  3GTM H;  1A8V A;  5K36 G;  2MQH A;  2JA7 H;  3E0E A;  4R4I A;  4DV1 L;  4GNX A;  1YHQ A;  3S2D H;  2ZJQ A;  2R7D A;  2Z0S A;  5IE8 A;  3D31 A;  4LFC L;  2YTX A;  4IO9 A;  2UUA Q;  5M3F G;  1YVC A;  1XMQ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...