4AQYL

Structure of ribosome-apramycin complexes
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aqyL00
1N9WA 1Q8KA 2ALYB 1W3SA 2JA9A 3K8AA 4JOIA 3KJPA 1EIYB 3CMEA 4BBSG 1IBLL 4GN3B 4JBWA 1VQ9A 3STBC 1G6PA 1E1TA 4GNXC 4O2DA 1V9PA 3J80c 5JEAG 1KC8C 1N34L 1NY4A 5M3FH 5M5WH 5GAEC 4UY8C 2R7ZH 1SROA 1E1OA 5FJ8H 2AKWB 2FXQA 3GO5A 1NBWA 1I5FA 3NEMA 1A62A 2JA7G 4JI7Q 1K0RA 1EQRA 5IYCH 4P75A 1X3FA 3RLOA 4X64L 3GTOH 2CWAA 4GLXA 2ZTEA 4YHHL 1DGSA 1FVIA 5LMNQ 4DR3Q 1E22A 1X56A 3KYHC 3I4NH 4X66L 3KLWA 2AWOA 4UP9A 1VQCA 3CCUA 1QUQB 2UUAQ 4YY3L 5JJIA 2BA1A 4QQBX 4HJAA 1SR3A 3CPWA 1AE3A 3HKZE 2JA5G 1KL9A 4L5RC 4B3TL 1VQJA 3MEFA 4X62L 4B3RQ 3G48A 3TRZA 1Q1BA 1HZBA 2Z6KC 1B7YB 4R4IA 1ASYA 1JJGA 2CCZA 2UUCL 1QVGA 2XGTA 5C3EG 4A3BH 5HGQA 2JE6I 1HNZL 1XNQL 3K7UC 4GNXB 4DV3Q 4LFBL 4GS3A 4P72A 2HHHQ 2Q2TA 4A76A 5IWAQ 4L5SA 5C4XH 3TS2A 1TXYA 4DV7Q 1V43A 3UDGA 4OWTB 2NVTH 4R1JA 4B3SQ 4DAMA 3F2CA 3J81i 4IFDJ 2JQOA 3BZCA 4BY7H 3L0OA 4GOPC 1PHJA 1L1OC 1HR0W 4DV2Q 1HR0L 4BXXH 4IPGA 3PIPA 3H15A 3Q8DA 1NE3A 4ALPA 2MQHA 3T1HL 2UUCQ 4DR4Q 2CQOA 4JI6L 1C9OA 5M5YH 4DR6L 1WJJA 4DKAC 3CD6A 2F3IA 3PO3H 2UXBQ 1H95A 4JI3Q 4BA1I 5EAYA 4HJ7A 2PNHA 1I6HH 1N32Q 1VQ6A 3H3VH 2VW9A 4B3SL 1JE5A 4A3KH 1XPOA 2R6GA 4X66Q 5C44H 1UE6A 3B6YA 3OYYA 5C0XJ 3S1RH 4LF4L 4JV5Q 1SE8A 3HOYG 5JJLA 1XMQQ 3KF8B 4UP8A 4X62Q 4DR7Q 1KHIA 4R4CA 3M3YH 4IPHA 2JEBI 4GN4B 2IY5B 4R4TA 1B8AA 4PG3A 1TWHH 1YHBA 4P73A 1JJCB 2UU9Q 4BXXG 3DM3A 3TEHB 1PH7A 1W2BA 1K9MC 3A5ZB 4NPSA 2E5LQ 4PZ7A 4LF9Q 3E9HA 4JBJA 1NMGA 5GADC 3HOXH 1HNXL 3I4MH 3PF4A 1IBLQ 4PZ8A 4JI0Q 3CP0A 3KDFA 4OWWB 5BR8Q 1XJVA 1TWFH 3S17H 2D62A 3W5OA 4A3CG 1D7QA 4YCUA 2YTVA 1Q81C 1CKMA 3I2ZA 4OO1I 1M1KC 2K14A 1MJCA 4C3HH 4DUZL 1V1QA 4JI7L 5JJKA 4O0AA 2Q2HA 3RLFA 3G4SA 1OXSC 1PYSB 3ER0A 3KOJA 2IX0A 1X3EA 2E5LL 5FLMH 4JI3L 4A4IA 1IXRA 1A8VA 3JAMc 3FKIG 4DV6Q 1XMQL 4A93G 4JI8L 1PH4A 2VZAA 2OWOA 4A93H 5IY0A 4DV1L 2UXBL 2WAQG 3CPFA 1IBKL 3GTLH 3PUVA 5FJ8G 3M7NA 3CW2C 2F4VQ 3HOUH 4DPGA 5AJ3Q 4DK6C 4JV5L 3K0XA 3RZDH 2WFWA 2JA6G 1VQ7A 1GKHA 1SLJA 3J7ZC 1ASZA 2OCEA 4QJFA 4LFCL 2E2HH 3CF5A 4DV7L 1BBWA 1NTGA 1X54A 4JI5L 4IJLA 4JCVE 3KF6B 4PMWA 1YI2A 2UUBQ 3M85A 2NZHA 1VS0A 1XTDA 2Y0SE 2YTYA 4DR5Q 1HNZQ 3J81c 2NVXH 2VUMH 1A0IA 1PH8A 3J7A5 4KHZA 4J15A 3F2DA 2LSSA 4JI6Q 3CC2A 5AJ3L 3HOVG 4LF8L 3E0EA 1EOVA 4GOPA 4AIMA 2DUDA 2NN6G 2NVYH 2PQAA 4AYBE 3OTOQ 5IE8A 1HZCA 4AQYQ 1VCIA 1X3GA 2F52A 4A3MG 1VQMA 1X9NA 2UUBL 4EX5A 2R93G 1XNRL 2R7FA 5IP7G 1MJEA 1PVOA 1J5EQ 1KRTA 1S72A 1FJGL 3EIVA 3AQQA 4A3DH 4DR1L 1PH1A 4LF4Q 2Z0SA 4DV4Q 4A3DG 4X64Q 5C0XG 3CCVA 1N8RC 1YJWA 2Z6KA 5J3BA 4POFA 2JK8A 4HIDA 4A3GG 3F8TA 1NJIC 3WWVA 1P16A 3ULLA 2GN5A 1B70B 5IYDG 3S1MH 4X65L 3NELA 4WJ3M 3VDYA 1K73C 1YEZA 4YWKA 1VQOA 1L0WA 4IOCA 2VY3A 3PO3G 2I5LX 3CCMA 1K3RA 5IYBG 2K75A 4LF9L 5M3MH 4MTNA 1L1OA 1UWVA 2EIFA 2PQAB 2RF4A 4QL5A 2UXCQ 1YVCA 2NVQH 2K5NA 3RN5A 4JI8Q 4BBRH 3S14H 3IRBA 2B29A 3K80C 3ERSX 5DLQE 1EWIA 2MFIA 3TQYA 3KDFB 5GAHC 3HOZH 1UEBA 2R7DA 3S1QH 4LFBQ 1VQNA 4YWLA 2BA0A 4K0KQ 3RNUA 3M4PA 1I3QH 1Y1VG 1K8AC 2ID0A 3GTQH 4LFCQ 1WI5A 3ULPA 2OQKA 4Y7NH 3OW2A 1JJ2A 3CC4A 4A3MH 4NXNQ 2UXDQ 4YHHQ 4TQUS 1X65A 1LYLA 5H1SE 2ZM6L 1VQPA 3PIOA 5FLMG 3F2BA 1S3OA 1TWAH 3GTGH 3S16H 3PUYA 4A3JH 2MO1A 2A1AA 4B3ML 3U4ZA 2B63H 2L15A 4WJ4A 2HQLA 3PUWA 5IYBH 2YV5A 1SMXA 2ASBA 2JEAI 1TWGH 3UDXA 4GLVB 1IL2A 4DR7L 1SFOH 3G71A 4LF6Q 1FL0A 2VUMG 4A3KG 2B3GA 1KRSA 2PI2E 2PI2A 1WYDA 4QGUA 4DV4L 1N34Q 4OX9Q 1N33L 5C44G 3FHWA 3PO2H 2UU9L 1RIPA 3SGIA 3M9BA 1Q12A 4GLAC 4JBMA 4AQYL 5ELOA 4DV5L 2MO0A 1Y1WH 3UE1A 4LFAQ 2RHQB 1S40A 4MNOA 2A8VA 3AEVA 2DGYA 3ICEA 4HJ8A 4LW1A 1YHAA 4OWXB 3RLNA 4DR1Q 1PH9A 4XTCS 3T1HQ 2LXKA 4DAYB 3I56A 2ZJPA 3EBEA 1VQKA 3GTJH 3UDFA 2OTLA 2ZJQA 1VQIA 1I94L 4B3TQ 2ZTDA 4JBKA 4LF5L 2I5HA 4JI2Q 1Q1EA 1E3PA 3OTOL 2I0QA 2N49A 4IPDA 2UUAL 1CKNA 5C4JH 4DUYQ 1LUZA 1PH3A 3GTMH 2EXDA 4KHPL 1P8LA 3CCQA 3UE0A 4MZ9A 4C3JH 3L2PA 1YITA 2ES2A 4RG1A 4IFDG 4DR2L 1VQHA 2JA5H 2XTIA 1WFQA 2UXDL 5M3MG 4P74A 4QIWE 1FJGQ 2JJQA 2KENA 1QUQA 3HOWG 3H0GG 2HHHL 2ATWA 1CUKA 3D0FA 1VQ5A 2H5XA 3PSIA 4JG2A 3PF5A 1IYJB 1UE1A 2GVBA 4APVA 4JYAL 1BBUA 3FP9A 2AMCB 3HKSA 2D0OA 1LTLA 1G291 4ME3A 1QZHA 3W1BA 4POGA 4A3LG 3H0GH 4GKKL 1K83H 1IBML 4RMFA 5IP7H 2JA7H 1C7YA 1C0AA 4YY3Q 1PYBA 1Z47A 2IT1A 4LF7Q 2KCMA 4A3JG 2C35B 3LGJA 1NMFA 4NXML 1PFSA 2QGQA 2RCNA 3K7AH 3JAMi 5LMNW 4DR3L 2R92H 4DK3C 4DV1Q 1Q86C 3D31A 3CCRA 4GN5A 4LF6L 4A3GH 3RR5A 3U50C 4X6AH 2A19A 1M90C 1U5KA 2KBNA 3CCSA 4IFDI 4EQ5A 4JC0A 4B3RL 1QZGA 4A3CH 4GOPB 1VQDA 4BY1H 1XPUA 4IOAA 1EYGA 4BY7G 3F1ZA 3RN2A 1XMOQ 4PZ6A 1IBMQ 3L7ZC 3PCOB 1QVCA 3CAMA 3I4OA 2K52A 3T1YQ 3HOZG 1HNXQ 4H02A 1CKOA 3NENA 1X6OA 4DR2Q 1FGUA 3HOYH 2KHIA 5HY6A 4UPAA 4JI4Q 3PUZA 2K50A 4LWCA 4YCWA 2R92G 1GO3E 4A3BG 3UDIA 4GKKQ 3CCJA 4A75A 3A0JA 4DV0Q 2IHEA 1VQFA 3CXCA 1VQ8A 3GDEA 3S15H 3TREA 1BVSA 2B63G 1E7ZA 1RL2A 4LF5Q 1MIUA 1GVPA 2N8NA 1N32L 1G51A 4P71A 5IT9c 1J5EL 5GAGC 2VS1A 3CCEA 3I4NG 3BJUA 4FDBA 2JA6H 1YZ6A 4JI1Q 3S2HH 1VQGA 1I94Q 2HIXA 2WB1G 4JI2L 1T9HA 1UE5A 1PH6A 4XIGS 5ELNA 2N78A 3GD7A 3U58A 1GD7A 4C2MH 2WAQE 4LNQA 2Q2UA 5E7NA 3M4OH 5C3EH 2QEXA 1SRUA 3M4QA 3PGZA 5M5XH 1N36L 1VQLA 4DV3L 3AFQA 5BR8L 2JA8G 2VNUD 2R7ZG 4JI5Q 3GTPH 2BH8A 4B3MQ 1VQEA 3G6EA 5M3FG 2IHFA 5GQOA 2VQFQ 2VQEL 1YJNA 1K8GA 4GKJQ 3ZJYC 2ZJRA 4A3FH 4BBSH 1X55A 2KCTA 4QY7A 4OX9L 4DNIA 2LXJA 1XPRA 1Q82C 3AFPA 4AH6A 3PUXA 1VQ4A 3GTKH 1UE7A 1HNWQ 2KHJA 3FKIH 1EFWA 2EQSA 4LF7L 1R9TH 4HJ9A 2V1CC 4DUZQ 1Q7YC 1KAWA 3KF6A 2PMZE 2ZM6Q 3HOWH 2Q2IA 1L2FA 1HJPA 4AYBG 4KI0A 2YYZA 3KFUA 4JI0L 5C0XI 2NZOA 3T1YL 1E24A 1A63A 2K4KA 1L1OB 4HJ5A 3J81j 3KJOA 1CSPA 2VQEQ 2HIVA 2K5HA 4NXNL 1HZ9A 3CQZH 4R4QA 1Y1WG 4UP7A 3BZKA 4DV5Q 1OXXK 2WP8J 3BU2A 4X65Q 1YHQA 1JMCA 1SN8A 2NN6I 3CMAA 2ZTCA 4A3IG 4A3EH 3S24A 4A3FG 1Y14B 1PA6A 4DR6Q 3JC66 1N36Q 3HKZG 4NB3A 4GNXA 4BA2I 1N33Q 1TWCH 2UXCL 4K0KL 1YJ9A 2GVAA 4JOIC 4OONA 2VL6A 3MXNB 2CKZB 2MNAA 5LMUL 4HIKA 4LUZA 3PV0A 1XMOL 1EQQA 2E2IH 4GKJL 1Q46A 5IP9G 4HIMA 3S2DH 3J80i 4A3LH 3E9IA 3HOUG 5IYDH 4DUYL 2BH2A 2IX1A 1OXVA 2HT1A 5IYCG 4C3IH 4KHPQ 4IPCA 1YIJA 2D0PA 3CC7A 5C4XG 2CFMA 2N3SA 4IJHA 2AWNA 1PV4A 1EUJA 1KQSA 3W1GA 1Y1VH 1EIFA 5JEAJ 5IP9H 1OXTA 1D8LA 1YNXA 2RHSB 3A74A 2VQFL 4DV0L 1XNRQ 1LM0A 2R93H 3TS0A 1VQBA 1HNWL 3HOVH 2E8GA 3AYHB 1YBYA 1U0LA 4JI1L 4TVAB 1HZAA 4DR4L 2OTJA 1J6QA 3S1NH 1JT8A 1WCMG 3DLLA 1OXUA 1I50H 1CSQA 2K5VA 1KXLA 1OTCA 5K36G 2AHOB 2Y0SG 1HH2P 5FLXc 3RZOH 1PH5A 4OXPA 4DV2L 1HR0Q 3HFZB 4IO9A 4A3EG 4A3IH 3K81C 1KD1C 4DR5L 1KIXA 1AE2A 2YTXA 2JA8H 4KLKA 1JB7A 4JYAQ 4OO1G 3EN2A 1QVFA 3HOXG 3U4VA 2CWPA 3I4MG 1IZ6A 5IWAL 2WB1E 1PH2A 4LF8Q 1VQAA 4R4OA 2E2JH 3ULJA 4YCVA 2OQ0A 4L5TA 4LFAL 4LUVA 5LMUQ 3H3VI 4BY1G 5GROA 1CKNB 1XNQQ 1BKBA 3NBHB 4L5QA 2F4VL 3I55A 1MKHA 1O7IA 3STBD 1WOCA 4HIOA 4YWMA 4DV6L 4LUOA 4NXMQ 1GM5A 3PO2G 1AH9A 2YU9H 4Y52H 2QA4A 2I5MX 3I7FA 1IBKQ 3CCLA 1Z9FA 3A5UA 4JI4L 1WCMH 5LMNL 4BBRG
chains in the Genus database with same CATH superfamily
1TS2A 3KJPA 1EIYB 4GN3B 1WTQA 1SJED 4YIJA 5C5LA 1V9PA 1N34L 1NY4A 4UY8C 2SDFA 3QOJA 1CA6A 2R7ZH 1FNUA 1IYVA 2EYHA 5FJ8H 2KOLA 1I5FA 1J9OA 2JA7G 3D8GA 1EQRA 5IYCH 4V190 4X64L 1F9PA 1NUCA 2IL8A 4GLXA 2FMCA 5LMNQ 1EU4A 3G6JB 3TP5A 4X66L 4ULLA 2Q8RE 2I07B 1VQCA 1QUQB 2UUAQ 2QILA 2BA1A 4QQBX 1SR3A 2EYPA 1XWEA 3CRLC 4L5RC 3MEFA 3TRZA 1Q1BA 2L0CA 3HOUB 1TWGB 3DWQA 1JWUD 4R4IA 1JJGA 2CCZA 2JA7B 2KCNA 3K59A 1HNZL 4HMIA 4DGZA 3K7UC 4DV3Q 4GS3A 4P72A 3G7LA 5C4XH 1TXYA 1V43A 4OWTB 5FLXE 4R1JA 2B2YC 4B3SQ 1ENCA 4H0LC 3HOWB 2JQOA 4BWGB 4RGTA 4BXXH 3PIPA 3H15A 3Q8DA 2MQHA 2IJ0A 4I65A 4KHVA 1EL0A 2UXBQ 4IUTA 4ME5A 5EAYA 1KNEA 2PNHA 3A56A 4A3EB 3H3VH 4J6HA 1IL8A 1XPOA 3S1RB 3J7AF 3IL8A 3I3CA 1IHZA 4R9WA 4IALA 5JJLA 1TS4A 1Y8NB 1XMQQ 1PFMA 1XYIA 1ICFB 2D2CC 1BCPF 1KHIA 3M3YH 1PRTB 1B8AA 4DA2A 3GTLB 2E5LQ 4NPSA 4RA8A 1TWHB 1DXMA 3OWEB 4OIJA 2DN8A 4OL7A 3E9HA 3D6CA 4JBJA 5GADC 1H9MA 4CKBA 3PF4A 1RCVD 1SYEA 2KJXA 1IBLQ 3KDFA 3H09A 4B9XA 4X3SA 1TWFH 2D62A 1D7QA 5M3FB 1MGSA 2K14A 1CT1D 4TKOB 3N6RA 2ZXRA 2Q2HA 3G4SA 1H9RA 1LTTD 2P5ZX 1OXSC 3IFTA 3KOJA 2KUMA 2G5DA 3K6OA 4OIKA 3VYTA 5JAVA 1XMQL 4A93G 4A93H 3J80L 1LT4D 1KLGD 3HOUH 5EKKA 4DV7L 1VDZA 3FRPB 2O5JC 4CKCA 4BBSB 2A74C 3MXGA 4WORA 1SE4A 1PRTF 4JI6Q 2PW7A 1D1KA 4FF1A 3HOVG 4LF8L 1G91A 1LO5D 3J81E 3WOFA 5FO8B 4AYBE 1HZCA 1AW7A 1VCIA 1VQMA 4A3MG 2UUBL 3WDNA 5CV5A 1FD7D 1MJEA 1J5EQ 2NZ1D 5C4HA 1FJGL 1GOZA 4A3DH 4IN3A 5D14A 2Z0SA 2F0KA 3KLRA 2JA8B 3CCVA 1N8RC 4IUNA 4H13C 1NJIC 3WWVA 3GTKB 2GN5A 1B70B 1LT5D 5IYDG 4X65L 3NELA 2CW0C 3BVMA 2XVSA 1L0WA 4IOCA 4NDXA 1K3RA 4LF9L 1B9MA 4MTNA 1D5MC 3DWAA 2EIFA 4QL5A 2RF4A 4EQOA 3C3LA 2UXCQ 3RN5A 2EYLA 1WTWA 3S14H 5GAHC 3D4WA 2E76C 1ET9A 5M5YB 1VQNA 4XT3B 2BA0A 4K0KQ 3RNUA 1ML0D 2ENBA 1B44D 1Y1VG 2NUCA 1HUMA 3CC4A 4NXNQ 4A3MH 1UUPA 2RDFA 4TQUS 4YHHQ 3IFDA 1PZID 3C1FA 1LYLA 1UNSA 1EQTA 1S4ZA 1VMPA 2F0OA 1STHA 1I6VC 3VYSA 4C3IG 4FF2A 1CQVA 3PUYA 2MO1A 1A3UA 1D6EC 3PUWA 1SMXA 1IL2A 1F9SA 1FL0A 2VUMG 2PI2E 1K83B 2DJGC 2DNCA 3TN2A 3J7YW 4DV4L 3RZDB 3CRKC 1TWAB 3LX0A 2JP1A 1SFOB 2B2WA 2UU9L 3SGIA 4GLAC 3KUPA 4CJ0B 1I4XA 2MO0A 4LFAQ 1CQFA 4BY7B 1SYCA 5J1ZA 2A8VA 2DGYA 1QJOA 1ZEQX 1VQKA 4DAYB 1H9SA 2F1MA 3HOZB 2CQAA 1VQIA 1I94L 4B3TQ 4JBKA 2PZWA 3URYA 1Q3LA 3GTMH 3UE0A 4C3JH 1YITA 2ES2A 4RG1A 5FO9B 1HRJA 2XIWA 3EFXD 1MI2A 1TY2A 3R2TA 3LNNA 2HHHL 1GUTA 1F77A 1NSNS 1LTID 4ZYSA 1EQVA 4JYAL 1YNND 2D0OA 4K14A 3I73A 4ME3A 3OPOA 4POGA 4K8JA 3H0GH 1K83H 1LLRD 1QG7A 1D5ZC 1IYUA 5CGKA 4YY3Q 3BDOA 4RWSC 3TP6A 2KCMA 2C35B 1HA6A 1F2ZA 3CCRA 1F9QA 3E6ZX 1RKNA 1I4GA 1XX8A 1B2TA 4UDUC 1U5KA 5C4JB 2KBNA 1PFNA 1RDPD 1XPUA 1RF2D 2J0TD 3F1ZA 5IODA 1G6ZA 1XMOQ 4BY1B 3L7ZC 3I4OA 4RH6A 2K52A 3T1YQ 3PIO3 3VR3A 2HDLA 4UAIA 4ZLTF 4H02A 1CKOA 5C3XA 5E3FA 1X6OA 3HOYH 2WAQB 4KKUA 1ESRA 5C44B 4A75A 2EYMA 5JEAH 2XRQD 1A3VA 2RSNA 2B63G 1E7ZA 1RL2A 1CA5A 2B2YA 4P71A 1II3A 2QDLA 5I6WA 1M8AA 1HA5A 5IGFA 2JA6H 5NUCA 1SXTA 4F88A 3MFYA 1I94Q 2HIXA 2WB1G 4QF4A 4JI2L 2FJ2A 4F7XA 1SSOA 3U58A 2E75C 1BOSA 2ICEC 2Z4HA 5C3EH 4EVOA 1SRUA 5M5XH 1N36L 3AFQA 4G7OC 1NCVA 4A3JB 3TZUA 2F0LA 3G6EA 2VQEL 4GKJQ 1TT2A 4BBSH 1X55A 2KCTA 1PMRA 1XPRA 1Q82C 3GTKH 3PUXA 3DEOA 1HNWQ 1R9TH 3SK8A 1MSGA 4DUZQ 2EZVA 1Q7YC 3PMFA 2PMZE 2Q2IA 4AYBG 4KI0A 4JI0L 5C0XI 3T1YL 1KDCA 4C3HB 4NXNL 5DEHA 2H4OA 3DMUA 2MJ8A 1OXXK 4UP7A 5JPNC 4X65Q 1F9RA 3CMAA 5HGTA 1PA6A 1SEBD 4HSPA 1QILA 1N33Q 1TWCH 3E3XA 3VYUA 3MVVA 2MNAA 3MXNB 1I6HB 5LMUL 4GKJL 1CHPD 4LUZA 2XRSD 5IP9G 1RD9D 2CHBD 3J80i 2E2HB 3HS0C 4DUYL 1ENAA 5IYCG 4C3IH 4KHPQ 4IPCA 1YIJA 1R4PB 1SNOA 5C0XH 1EUJA 1RHPA 2F3WA 3W1GA 4K6LA 2VQFL 1F2YA 3NBHA 2E8GA 4ABNA 3S1NH 1EY5A 3K7AB 4IURA 1E2WA 1OXUA 1GXDC 3DLLA 3A54A 4Q0FA 2Y0SG 3RZOH 1KIXA 1HFGA 1JB7A 4OO1G 1TU2B 4FXDA 5A2QE 2RKSA 1SE3A 2A5HA 5IWAL 2EY2A 2CH4W 4Y7NB 2OQ0A 4L5TA 4BY1G 5IGBA 3M3YB 1LTGD 1BKBA 2F4VL 4L5QA 3TP8A 2ZXOA 1O7IA 2KCCA 4HIOA 1ILQA 3ERQA 1GM5A 1AH9A 2YU9H 5CMDA 2QA4A 4Y52H 4WRDA 2I5MX 3FVQA 1Q8KA 5M3MB 1LABA 1IBLL 3RMHA 1E1TA 4O2DA 1V1PB 4C3JB 5JEAG 2L4NA 4ZCKA 1KC8C 5M3FH 3J7AV 5GAEC 1ICWA 1TR5A 4XQNA 1LT6D 2A69D 3NEMA 1A62A 4JI7Q 1M4VA 1STBA 4P75A 2SNSA 4LK1C 1X3FA 3GTOH 4YHHL 1BBXC 2F0HA 5JJIA 3VR2A 4A3KB 3CPWA 3HKZE 3DWPA 3QOLA 1KL9A 4QUCA 5CV4A 1VQJA 4X3UA 4X62L 2K32A 3K5NA 4B3TL 4B3RQ 1WD1A 1PDQA 2Z6KC 1B7YB 4NP5A 5DNFA 3D6WA 3M7GA 1SNQA 1BR9A 2DY7A 3P1HA 1J8IA 2Q2TA 3TS2A 2NVTH 1YNJC 3J81i 3BZCA 2KA7A 3L0OA 3ONAB 4RKBA 1PHJA 4FF3A 1Y8OB 4IPGA 4ALPA 3TZDA 4DR4Q 1EU3A 2CQOA 3VA5A 2JYOA 1WJJA 4DR6L 2F3IA 1QNUA 1HHVA 5CC4A 4B3SL 1JE5A 4A3IB 4U673 1SMYD 4X66Q 5C44H 2QEJC 3B6YA 1NAPA 3QIAA 2A6HC 1T5EA 1TS5A 2K5QA 4LF4L 4JV5Q 1SE8A 3KF8B 4X62Q 4FXGC 3DM1A 3EQLC 2R3ZA 4PG3A 1FGBD 1JJCB 5C4XB 5CYUA 1PH7A 1W2BA 2EOTA 1K9MC 3PO2B 4LF9Q 1NMGA 1HNXL 1FNWA 4KN7C 3SDZA 1NNXA 3CP0A 4OWWB 4ZKCB 4PMBA 1DONA 2YTVA 1Q81C 3I2ZA 5KNCA 1M1KC 1KNAA 3R8BA 1MJCA 4C3HH 4Z9CB 4CKEA 4JI7L 4K8IA 2X6LA 1KTKA 1VMCA 1PYSB 2XNAC 1X3EA 4JI3L 3JAMc 1TQOA 3FKIG 5I6YA 2WB1B 4JI8L 1PH4A 1R9TB 3QR8A 2G9DA 2NVQB 1DM0B 5FJ8G 3GTLH 3M7NA 4K5VA 3CW2C 2F4VQ 4DPGA 5AJ3Q 1HPCA 3RZDH 4KD4A 4XYOA 5I4DA 1VQ7A 1SLJA 2BOSA 2E2HH 5ISRA 4LFCL 3T51B 1NTGA 1YI2A 3KF8A 2UUBQ 3T13A 1D2BA 3J81c 2B2TA 1PH8A 3H6MA 1SNMA 3CC2A 3A55A 4ID6A 3E0EA 4GOPA 2BDNA 2NN6G 4AQYQ 5IE8A 1ZYRC 3M4OB 1FNVA 1TY0A 5C4ZA 2R93G 4MHEA 1PVOA 2H1EA 4H44C 1KRTA 1S72A 3AQQA 2CW0D 4LF4Q 1S5DD 4A3DG 4H7BA 4G7ZC 3ITPA 2Z6KA 1K28A 3Q22A 2JK8A 2WACA 2EY6A 1KABA 4HIDA 3F8TA 1P16A 2K05A 3A8JE 4KJNA 2F0MA 2SEBD 4P2CB 3R2IA 4YWKA 1G2TA 4ZQ3A 2KHSA 2VY3A 2I5LX 2NTTA 1L1OA 2PQAB 1YVCA 2NVQH 2YU9B 1TKWB 3I72A 3K80C 3TQYA 2MFIA 1LTRD 4G57A 3KDFB 4RAUC 5CBAE 1UEBA 4YWLA 2B2UA 3I70A 5IGGA 3S1QB 3ULPA 2OQKA 4Y7NH 3OW2A 3P7JA 3S14B 2ZM6L 1VQPA 1QB5D 1H9JA 3GTGH 3S16H 2F0TA 3MEHA 2A1AA 5BN5A 5E4XA 1TWGH 2EYFA 3G71A 4LF6Q 4CDCC 1JCKB 3ND9A 4IFDH 1KRSA 2L5TA 4QGUA 1N34Q 4RHSA 4QUFA 3P20A 4JBMA 4OGQC 4LJZC 4CJ2C 3HOXB 3FEWX 1QNKA 4MNOA 5IGEA 1MHWC 4N9PA 4OWXB 1PH9A 3TDQA 4XTCS 3I56A 1V1PA 2VNUD 2HD3A 3EBEA 2NN6H 3UDFA 5KGUA 2ZTDA 4JI2Q 1Q1EA 1E3PA 1PLFA 2F0QA 2UUAL 2Y0SB 1CKNA 3OIQA 3JAML 2LMCB 2WKDA 4KHPL 3CCQA 4QMGA 3T53B 1A2UA 2L9HA 4DR2L 3U9OA 4QIWE 1FJGQ 3HOWG 4G7HC 5EKIA 1CUKA 3D0FA 2GVBA 3NQTA 4APVA 3J81L 1Y69U 2HCCA 2AMCB 2NVTB 2MGSA 5IIFA 1IW7C 1QZHA 3CU7A 3W1BA 1O7YA 4BBRB 5EQ0A 1C7YA 1KDAA 1RJTA 5K36H 1NMFA 2RCNA 4IUUA 4DR3L 2R92H 4PNYA 3D31A 3H0GB 2RDGA 3NP8A 2JSOA 4R8IA 4X6AH 2A19A 3CCSA 3C46A 4IFDI 4ZKBB 1EZ8A 2B2VA 4PMCA 2AQ2B 4A3IH 2QF7A 3A8IE 5I9OA 4BY7G 5IGCA 5EPLA 1CK1A 1FYCA 4PZ6A 3PCOB 2B2WC 1JE4A 3CHBD 1PZKD 1EIGA 3EROA 1PTOC 4A93B 3NENA 1FGUA 2B2TC 2KHIA 4C1NK 2PYKA 4JI4Q 4LWCA 1EY9A 1GO3E 5HURA 4A3BG 3S15B 4HCSA 2IPKD 4NMZA 3NE5B 5DM63 2IHEA 4A3FB 1VQ8A 3K5OA 2A68D 1LV9A 2N8NA 4QB4A 5D3IB 2VS1A 2L1BA 3I4NG 3BJUA 1EY7A 1GUNA 4JI1Q 3RD4A 3KLSA 3S2HH 2PCFB 2KVMA 1UE5A 1PH6A 3SK5A 1BCPB 2JA6B 2Q2UA 3M4OH 3M4QA 1VQLA 4DV3L 2B63B 1AEXA 4HAEA 4JI5Q 3GTPH 2PQEA 1VQEA 4HCEA 3BVZA 2IHFA 5GQOA 1R4QB 3ZJYC 3DEPA 4QY7A 4DNIA 5M5XB 2LXJA 5IOCA 3MXPA 4AH6A 1VQ4A 1UE7A 2OF1A 1GUSA 3HOWH 2K7VA 2K33A 2J4XA 4FVMA 3MZ5A 3NBIA 1A63A 3VR6A 3OHXC 1ESFA 3V05A 2K4KA 4HJ5A 3KJOA 1CSPA 4ZRZA 1Y1WG 1HZ9A 3CQZH 4DV5Q 1PTOB 1EY6A 4A3IG 4A3EH 4A3FG 2AQ3B 1GUWA 5FO7B 4GNXA 4BA2I 3ZYYX 2UXCL 4DNTB 4K0KL 1XMOL 4HIKA 2E2IH 4HIMA 1JC7A 3NTIA 3E9IA 2D0PA 2LKVA 2F3VA 1KQSA 1Y1VH 1EIFA 5FKAC 4A3BB 1OXTA 3BDCA 3IAYA 3FDTA 2M2LA 3TP7A 4C3IB 1DZ1A 3TS0A 3HOVH 1YBYA 1TVXA 2M9VA 1HZAA 4TVAB 1BQQT 3Q6SA 2IWHA 1HH2P 2EY5A 2QDBA 1PH5A 5I9PA 1O80A 2FINB 4IO9A 3K81C 4A3EG 4DR5L 4IUPA 2YTXA 3NXWA 3SK4A 4JYAQ 5J22A 2LS01 1BUVT 3HOXG 1KLUD 3U4VA 3I4MG 4NKLA 1IZ6A 2Z8LA 3BYTB 4LF8Q 2E2JH 4YCVA 2NTSA 4LUVA 2L55A 1H9KA 2NYZD 1XNQQ 3N52A 5CV8A 1STGA 1WOCA 5EGTA 3BDLA 4YWMA 4DV6L 4NXMQ 3ND8A 4L63B 1YNNC 1X3PA 1Z9FA 1AZQA 3A5UA 4JI4L 1WCMH 5EJWA 1DYQA 4BBRG 2JA9A 3K8AA 1E0BA 4F8MA 4JBWA 3STBC 2O4XA 3I4MB 3J80c 2F0UA 1Z7TA 1LTSD 3I8ZA 4JK1C 1ET6A 1E1OA 2AKWB 3GO5A 1NBWA 2Z4IA 4M1UB 2F4IA 2F0EA 2ZT9C 3V2TA 3RLOA 4FF4A 3GTQB 1B3AA 1KDBA 3H91A 3NTKA 1DGSA 2OEOA 1FVIA 4L6TB 4DR3Q 1EZ6A 4JW0A 4K2KA 3I4NH 3KLWA 4HJAA 2JA5G 4DAYA 3NQIA 5ELDA 3G48A 1Q8IA 1GHKA 3KK7A 1I4PA 4JPBW 5C3EG 4A3BH 5HGQA 4HR7B 1XNQL 3L3OC 4GNXB 1BDOA 3SEBA 4L5SA 3GQBA 5IWAQ 3NWSA 3K57A 1O7LA 5LHY1 3F2CA 1B1ZA 1HCZA 2PMZB 3AU7A 3SXHA 1HR0W 3JAME 2UUCQ 3T1HL 5KIXA 5M5YH 1AZPA 2NVYB 1AN8A 2Z6BA 2Z9HA 4JI3Q 4BA1I 4HJ7A 5EPJA 1N32Q 2VW9A 4A3KH 3OSOA 4G4KA 4CDDC 5C0XJ 5ELFA 3S1RH 4O42A 1WTOA 4N8FA 1PFBA 4ILWA 5JJZA 3HOYG 1PRTC 4DR7Q 3EVQA 4IPHA 2JEBI 2VXWA 2IY5B 1TWHH 1YHBA 4P73A 3I4LA 4BXXG 3DM3A 3A5ZB 4I7ZC 4PZ7A 3I4MH 5CBEE 4IUVA 4ZAIA 2RBMA 4JI0Q 1U4LA 5BR8Q 1DOMA 1XJVA 3GTMB 1LTAD 1CKMA 4PQXA 3KBXA 5CV9A 1I50B 5T1GA 1V1QA 2A69C 3RLFA 4C1NI 1GUGA 5JPMC 3J80E 1GUOA 4XYQA 3HEJA 4A4IA 1A8VA 1BCPC 2KECA 2VZAA 2OWOA 4IZ8A 5IY0A 3MXUA 2UXBL 2WAQG 1IBKL 1SJHD 1EIHA 4JV5L 3K0XA 1GKHA 3BS1A 4QJFA 3PIP3 3HKZB 2B8GA 1BBWA 1X54A 4A3CG 4JI5L 1JQYD 2EJMA 3KF6B 4IJLA 3LWEA 4JCVE 4PMWA 2NZHA 3DHQA 1XTDA 2YTYA 4KV6A 3OMCA 4MIUA 3F2DA 3T4AC 1BF4A 2NB0A 1CFMA 1JWMD 4UHVA 1SYDA 2NVYH 1X3GA 2F52A 3SVMA 1JT8A 1XNRL 2R7FA 3K0YA 5IGDA 1BXTA 3EIVA 3K5LA 4DR1L 1PH1A 3OOCA 4CDEC 1DJRD 4J1MA 4XQQA 1YJWA 4POFA 1ZKOA 2TMPA 4DAVA 1S5CD 3S1MH 1MSHA 3OMGA 1K73C 2GA4B 3W2DA 1VQOA 2K04A 3PO3G 2K75A 5M3MH 5KNDA 2L12A 1UWVA 1D5XC 3MTSA 4EQNA 2V4DA 4JI8Q 4BBRH 2B29A 1EY8A 3ERSX 5F2DA 1C8CA 3S17B 1STAA 2R61A 4KN4C 3FKIB 1I3QH 1K8AC 2ID0A 3GTOB 4LFCQ 2BCOA 1SNPA 2RCFA 2UXDQ 5A35A 1I4RA 5H1SE 3PIOA 1NR4A 5FLMG 2EVBA 3QO2A 1S3OA 4A3JH 2TSSA 4B3ML 3U4ZA 3NHHA 2HQLA 1E2VA 2YV5A 2ASBA 2JEAI 1SFOH 3I91A 3P75A 2CVRA 3BVGA 4A3KG 1WYDA 2EE1A 1SAPA 5C44G 3FHWA 3GTGB 3T56B 3S16B 2PZUA 3M9BA 2A68C 3EA6A 3O13A 3HRZC 2WKCA 2C5CA 4AQYL 4DV5L 1B53A 1S40A 3ICEA 2X69A 4AYBB 4HJ8A 2DJFC 4LW1A 1YHAA 2LXKA 2ZJPA 2OTLA 4KY5A 3GTJH 4LF5L 2O5IC 2I5HA 4A3GB 3OTOL 2WIIB 2N49A 1KAAA 2VUMB 4DUYQ 1LUZA 2JN4A 1PH3A 2EXDA 2F0JA 3L2PA 4IFDG 5BN4A 4RFBA 5C6AA 1K8MA 5FLXL 2JA5H 1WFQA 2UXDL 3MC0B 3HP3A 3I90A 1C48A 1ZYRD 5DAUA 2O2LD 5M9OA 2JJQA 3X3MA 1SMYC 2ATWA 1VQ5A 3PF5A 1IKMA 3HG9A 5AFWA 2MHVA 1VF5C 2F0VA 3HKSA 1G291 2LFNA 1ONLA 1HUNA 4A3LG 3UI2A 3S9WA 5IP7H 2DNEA 3Q23A 1PYBA 2IT1A 1AFPA 3TBIB 4A3JG 3D4DA 3LGJA 1PFSA 2QGQA 2RA4A 3K7AH 5LMNW 3S1NB 1Q86C 4GN5A 4LF6L 3U50C 2F0PA 1SNDA 1M90C 1DOKA 5E1FA 4JVZA 4B3RL 1QZGA 1VQDA 4BY1H 4NW2A 4IOAA 3RN2A 1IBMQ 3R3OA 1QVCA 3E0JA 4QCLA 1JORA 2LY7A 2G9HD 1ENFA 2E2IB 3PUZA 2K50A 4YCWA 1HTLD 5D65A 3UDIA 4GKKQ 4DV0Q 1U4RA 1VQFA 4RCOA 3CXCA 2F0NA 3TREA 1WD0A 4LF5Q 1MIUA 1G51A 1J5EL 5GAGC 1A2TA 3QG1A 4GZYC 1D1IA 4XT1B 1YZ6A 3HOVB 1JOQA 1T9HA 4PV1C 2MUYA 4XIGS 5COYA 1GD7A 1S5FD 3S2DB 2WAQE 4LNQA 1Z6HA 2QEXA 3NWTA 4TRDA 5BR8L 2JA8G 5JVG3 2BH8A 4B3MQ 1CTMA 1MD2D 5M3FG 2VQFQ 4RHRA 1YJNA 1K8GA 4KKSA 4A3FH 1V8QA 4OX9L 2R93B 3NK9A 1ILPA 4WJWA 2AUJD 1RODA 3FPPA 4FO2A 4HJ9A 4FNFA 2V1CC 1KAWA 3KF6A 1VF7A 1L2FA 2YYZA 2PZTA 2NZOA 1E24A 1DD2A 3L9AX 2PPBC 4DNRB 5CORA 1QCBD 2HIVA 2K5HA 2VB2X 4R4QA 1YHQA 3BZKA 2K01A 1SYFA 2VB3X 2WP8J 3BU2A 3C2PA 1SN8A 2NN6I 2BE5C 1TWFB 1Y14B 2C9OA 3OW7A 2F0SA 2Q8IB 4B9WA 1EWCA 1YJ9A 2GVAA 3Q0AA 4OONA 2VL6A 2K1BA 2CKZB 2A73B 3S2DH 1UAPA 2IX3A 1STEA 4OELB 2XWJB 3CC7A 5C4XG 2CFMA 2N3SA 4IJHA 4E6IA 2AWNA 1PV4A 4ODGA 3M4YA 4LMQD 5C5MA 4DV0L 1XNRQ 1LM0A 2R93H 4DF7A 4TSSA 1VQBA 2OTJA 4DR4L 1EY4A 4RGNA 1WCMG 3MXNA 4I7AA 2FFKB 1KXLA 1OTCA 5K36G 5FLXc 3NTHA 3HFZB 1K8OA 1KD1C 1GHJA 3H94A 1AE2A 1W6KA 3EN2A 3QB3A 1PTOH 2SOBA 3MAQA 1QVFA 2X6GA 3FPUB 1NR2A 3NPPA 1PH2A 1VQAA 4LFAL 1EOTA 3HOYB 1ZXTA 5LMUQ 2NWGA 3MHBA 2B8FA 2WINB 1JOKA 3NBHB 3I55A 4KY7A 3QWNA 1MKHA 1CI3M 2OT2A 3A7AB 3STBD 5FOBB 4EGVA 1EWHA 4MTKA 3PO2G 3A8KE 3I7FA 1IBKQ 3CCLA 4K5XA 3D4RA 1A6XA 1N9WA 2ALYB 1W3SA 5JOBA 4CJ1B 4B08A 4JOIA 4BBSG 3CMEA 1G6PA 1VQ9A 1HQRD 4GNXC 1U9RA 1WTRA 5KRUA 4QIWB 5M5WH 5ELBA 1WTPA 4CBVA 1BNZA 1SROA 2EDGA 2FXQA 3V96A 3E5SA 2EYOA 3NSWA 1DCZA 4A3MB 1K0RA 5C3EB 3OWFA 4CDFC 2B39A 4KMUC 4ZUJA 2CWAA 5E4WC 1JR0D 2ZTEA 3WOEA 1E22A 1X56A 3KYHC 2MP1A 2AWOA 4UP9A 3CCUA 2D9UA 4YY3L 3NUCA 4C3JG 4BS9A 1AE3A 1WCMB 3X3NA 1HZBA 1ASYA 2EPBA 2UUCL 3SK6A 1QVGA 2XGTA 1K0SA 2KQ3A 2F0DA 2OXPA 2JE6I 2QW7A 4LFBL 3VR4A 3HGBA 4KTAA 1HQMC 4A76A 2HHHQ 4DV7Q 3UDGA 4FP5D 3RUZA 4DAMA 4IFDJ 3BYYB 4BY7H 3TMEA 4GOPC 1L1OC 4DV2Q 1HR0L 2BDOA 1A3TA 1NE3A 4V0BA 4JI6L 1C9OA 3AB9A 4R8NA 3DUZA 4DKAC 1G8ZD 3CD6A 2KEDA 1EEFD 4RGMA 3PO3H 1H95A 2K28A 2A6EC 1I6HH 1S5BD 5C3WA 1VQ6A 1EYCA 1QWYA 2R6GA 5ELCA 1UE6A 1F2MA 2J7ZA 3OYYA 3GTPB 1SYBA 1UEAB 3KBGA 4UP8A 1LT3D 4R4CA 2EY1A 4GN4B 4R4TA 2PW5A 4OEMB 5DM73 2UU9Q 3TEHB 1XXGA 1PTOD 3HOXH 4HTHA 2ICIA 4PZ8A 2M00A 2HDMA 3S17H 3W5OA 4YCUA 1WTXA 4OO1I 3CQZB 4FYDA 1C4QA 4DUZL 3AMUA 1F2LA 1B3QA 1EYAA 4HMJA 4K2LA 5JJKA 4O0AA 1WTVA 3ER0A 2IX0A 2E5LL 4EQPA 4HSVA 5FLMH 1SYGA 1IXRA 4DV6Q 1Y1VB 4LAAA 1PTOF 4DV1L 3EJIA 3CPFA 1I4HA 3PUVA 4DK6C 2WFWA 1AP0A 3DXJC 2JA6G 3J7ZC 1ASZA 2OCEA 3CF5A 1HFNA 1Y1WB 1BCPD 2N88A 3MWYW 1EFID 3M85A 4DR5Q 3LWUA 1VS0A 1JB3A 2Y0SE 4RGOS 1CZWA 1HNZQ 1SDFA 2NVXH 2VUMH 1A0IA 1SBBB 2K6AA 3GV3A 3KLSX 4KHZA 3J7A5 4J15A 2LSSA 5AJ3L 5IT9L 1L0YB 3GTJB 1EOVA 4AIMA 3FMCA 2DUDA 2DY8A 2PQAA 3OTOQ 2E74C 1X9NA 3BG3A 4Q5VA 4EX5A 5IP7G 2B2VC 1TS3A 5KNBA 2XN9C 2HQEA 1U4MA 2HCIA 4DV4Q 5LL6S 4X64Q 5C0XG 3QJYA 4J8QA 5J3BA 4KD3A 1B9NA 4A3GG 3ULLA 4CHTB 1IKLA 4WJ3M 3MA2B 3VDYA 2MPMA 1YEZA 2QKIC 1LACA 3CCMA 5IYBG 1LTBD 1YNJD 1OO9B 1QOHA 3R93A 4DXGA 2N55A 5LL6X 2K5NA 4IQZA 5EBCA 3CKIB 3IRBA 5DLQE 1EWIA 3HOZH 2R7DA 3S1QH 4LFBQ 3S2HB 3OIPA 3M4PA 1FR3A 3GTQH 1WI5A 1JJ2A 3BZDB 1X65A 2JXMB 3F2BA 2K5DA 1TWAH 4DAPA 2B63H 2L15A 4WJ4A 5IYBH 1TWCB 3S1MB 3UDXA 4GLVB 4DR7L 1DOLA 1SNCA 4OX9Q 2B3GA 2PI2A 5I2XA 4KKTA 1N33L 2FMMA 3PO2H 1RIPA 1Q12A 4DXFA 2F0FA 4L8JA 1CM9A 5ELOA 1Y1WH 3UE1A 4N8X1 2RHQB 3K5MA 3AEVA 5CR3A 5T1IA 1EEID 4U68A 2Z1CA 4DR1Q 4RCNA 3RLNA 3U9SA 3T1HQ 2ZJQA 5L37A 4KJOA 4RKLA 1STNA 1TIID 5A2QL 2I0QA 4IPDA 1JWSD 5C4JH 3VYRA 2ZXPA 4DN4M 1P8LA 4MZ9A 2KEEA 4XXEA 1VQHA 2XTIA 4N9TA 1CZGA 4K5WA 5M3MG 5I2YA 4P74A 4XQJA 1EYDA 3H3VC 2KENA 1QUQA 2EYJA 3H0GG 5BN3A 4A3DB 1HTPA 2H5XA 3PSIA 4JG2A 1IYJB 1QE6A 1UE1A 4FXKC 1BBUA 2QCPX 3FP9A 1RTNA 5G3LF 1LTLA 2K5WA 5EBDA 1O78A 4GKKL 5EKLA 1IBML 1CHQD 4RMFA 1W6JA 1U4PA 4S3SA 2JA7H 1X32A 1Y8PB 1C0AA 3T16A 1Z47A 4LF7Q 4NXML 4DK0A 3JAMi 1JOOA 4DK3C 4DV1Q 4C2MB 4A3GH 2R92B 3RR5A 1WVLA 1GJXA 4EQ5A 4JC0A 3F2UA 4A3CH 4GOPB 1EYGA 1I4QA 3SE0A 5KYIA 1WTHA 3CAMA 3HOZG 1HNXQ 2RSOA 4ZUIA 4C3HG 4DR2Q 5TSSA 2RVLA 5HY6A 1IW7D 4UPAA 3SHLA 5FK9C 2R92G 4OHJA 3CCJA 4HEDA 3A0JA 3VR5A 4HN7A 2E2DC 3GDEA 3S15H 4DU9A 1BVSA 3VA7A 1PRTD 1GVPA 3MFGA 3Q24A 1N32L 5IT9c 2SNMA 4K6DA 5ELEA 3CCEA 5D3DA 5JVH3 4FDBA 2F0IA 1K3BC 1PXUA 1VQGA 2EJFC 5ELNA 4O1NA 2N78A 3GD7A 1XTCD 4C2MH 2PO4A 5E7NA 4F87A 3PGZA 1PZJD 1L0XB 2WV6D 2R7ZG 4X3TA 2NBFA 5K5PA 1X3QA 1STYA 4WFN3 3D3RA 2ZJRA 3I4NB 2NVXB 1B4OA 1A15A 1E2ZA 2Q8TA 3AFPA 2AQ1B 2KHJA 3FKIH 1EFWA 2EQSA 4LF7L 1I3QB 4CGYB 1HXYD 3GP7A 4DFAA 2ZM6Q 3KFUA 1HJPA 2FHTA 4KK7A 1O7ZA 2A6HD 2R7ZB 2AUKA 1BO0A 5M5WB 5CV6A 1L1OB 3RZOB 3J81j 1T5XD 2VQEQ 1EY0A 1JMCA 2EXZA 2ZTCA 4DR6Q 3S24A 3JC66 1N36Q 3HKZG 4NB3A 2RQXA 1B50A 5CV7A 4JOIC 2L11A 1EQQA 3PV0A 4C56C 1Q46A 4A3LH 1PYWD 5IYDH 3HOUG 2BE5D 2F0GA 2XWBB 3A7LA 3HZXA 2BH2A 1OXVA 2HT1A 2IX1A 2CH4A 3SR1A 4DK1A 1H9SB 4XDXA 5KEEA 5G3LD 3K58A 2HUGA 5EPKA 5JEAJ 5KYLA 5IP9H 2RDHA 1D8LA 1S5ED 1YNXA 2RHSB 3A74A 3TSSA 3IKJA 3W3AA 1HNWL 4JI1L 3AYHB 1U0LA 1J6QA 2JA5B 4M8AA 2EJGC 3PO3B 1I50H 1CSQA 2K5VA 2AHOB 1SE2A 2D5DA 4OXPA 2PNRC 4DV2L 1HR0Q 4X3KA 1Q90A 4ZK9B 4IUQA 2K03A 2JA8H 4KLKA 2B2UC 3GV6A 2F03A 2CWPA 5J39A 2WB1E 1MBYA 4R4OA 1JICA 3ULJA 5IT9E 3H3VI 4KY6A 1V1OA 2F0WA 5GROA 1CKNB 3PQIA 2E2JB 4MN3A 4OO1H 1RTOA 2I46A 2XSCA 4LUOA 3C1EA 1G2SA 2A6ED 5LMNL 2IW3A
chains in the Genus database with same CATH topology
1N9WA 1Q8KA 2ALYB 1W3SA 2JA9A 3K8AA 4JOIA 3KJPA 1EIYB 3CMEA 4BBSG 1IBLL 4GN3B 4JBWA 1VQ9A 3STBC 1G6PA 1E1TA 4GNXC 4O2DA 1V9PA 3J80c 5JEAG 1KC8C 1N34L 1NY4A 5M3FH 5M5WH 5GAEC 4UY8C 2R7ZH 1SROA 1E1OA 5FJ8H 2AKWB 2FXQA 3GO5A 1NBWA 1I5FA 3NEMA 1A62A 2JA7G 4JI7Q 1K0RA 1EQRA 5IYCH 4P75A 1X3FA 3RLOA 4X64L 3GTOH 2CWAA 4GLXA 2ZTEA 4YHHL 1DGSA 1FVIA 5LMNQ 4DR3Q 1E22A 1X56A 3KYHC 3I4NH 4X66L 3KLWA 2AWOA 4UP9A 1VQCA 3CCUA 1QUQB 2UUAQ 4YY3L 5JJIA 2BA1A 4QQBX 4HJAA 1SR3A 3CPWA 1AE3A 3HKZE 2JA5G 1KL9A 4L5RC 4B3TL 1VQJA 3MEFA 4X62L 4B3RQ 3G48A 3TRZA 1Q1BA 1HZBA 2Z6KC 1B7YB 4R4IA 1ASYA 1JJGA 2CCZA 2UUCL 1QVGA 2XGTA 5C3EG 4A3BH 5HGQA 2JE6I 1HNZL 1XNQL 3K7UC 4GNXB 4DV3Q 4LFBL 4GS3A 4P72A 2HHHQ 2Q2TA 4A76A 5IWAQ 4L5SA 5C4XH 3TS2A 1TXYA 4DV7Q 1V43A 3UDGA 4OWTB 2NVTH 4R1JA 4B3SQ 4DAMA 3F2CA 3J81i 4IFDJ 2JQOA 3BZCA 4BY7H 3L0OA 4GOPC 1PHJA 1L1OC 1HR0W 4DV2Q 1HR0L 4BXXH 4IPGA 3PIPA 3H15A 3Q8DA 1NE3A 4ALPA 2MQHA 3T1HL 2UUCQ 4DR4Q 2CQOA 4JI6L 1C9OA 5M5YH 4DR6L 1WJJA 4DKAC 3CD6A 2F3IA 3PO3H 2UXBQ 1H95A 4JI3Q 4BA1I 5EAYA 4HJ7A 2PNHA 1I6HH 1N32Q 1VQ6A 3H3VH 2VW9A 4B3SL 1JE5A 4A3KH 1XPOA 2R6GA 4X66Q 5C44H 1UE6A 3B6YA 3OYYA 5C0XJ 3S1RH 4LF4L 4JV5Q 1SE8A 3HOYG 5JJLA 1XMQQ 3KF8B 4UP8A 4X62Q 4DR7Q 1KHIA 4R4CA 3M3YH 4IPHA 2JEBI 4GN4B 2IY5B 4R4TA 1B8AA 4PG3A 1TWHH 1YHBA 4P73A 1JJCB 2UU9Q 4BXXG 3DM3A 3TEHB 1PH7A 1W2BA 1K9MC 3A5ZB 4NPSA 2E5LQ 4PZ7A 4LF9Q 3E9HA 4JBJA 1NMGA 5GADC 3HOXH 1HNXL 3I4MH 3PF4A 1IBLQ 4PZ8A 4JI0Q 3CP0A 3KDFA 4OWWB 5BR8Q 1XJVA 1TWFH 3S17H 2D62A 3W5OA 4A3CG 1D7QA 4YCUA 2YTVA 1Q81C 1CKMA 3I2ZA 4OO1I 1M1KC 2K14A 1MJCA 4C3HH 4DUZL 1V1QA 4JI7L 5JJKA 4O0AA 2Q2HA 3RLFA 3G4SA 1OXSC 1PYSB 3ER0A 3KOJA 2IX0A 1X3EA 2E5LL 5FLMH 4JI3L 4A4IA 1IXRA 1A8VA 3JAMc 3FKIG 4DV6Q 1XMQL 4A93G 4JI8L 1PH4A 2VZAA 2OWOA 4A93H 5IY0A 4DV1L 2UXBL 2WAQG 3CPFA 1IBKL 3GTLH 3PUVA 5FJ8G 3M7NA 3CW2C 2F4VQ 3HOUH 4DPGA 5AJ3Q 4DK6C 4JV5L 3K0XA 3RZDH 2WFWA 2JA6G 1VQ7A 1GKHA 1SLJA 3J7ZC 1ASZA 2OCEA 4QJFA 4LFCL 2E2HH 3CF5A 4DV7L 1BBWA 1NTGA 1X54A 4JI5L 4IJLA 4JCVE 3KF6B 4PMWA 1YI2A 2UUBQ 3M85A 2NZHA 1VS0A 1XTDA 2Y0SE 2YTYA 4DR5Q 1HNZQ 3J81c 2NVXH 2VUMH 1A0IA 1PH8A 3J7A5 4KHZA 4J15A 3F2DA 2LSSA 4JI6Q 3CC2A 5AJ3L 3HOVG 4LF8L 3E0EA 1EOVA 4GOPA 4AIMA 2DUDA 2NN6G 2NVYH 2PQAA 4AYBE 3OTOQ 5IE8A 1HZCA 4AQYQ 1VCIA 1X3GA 2F52A 4A3MG 1VQMA 1X9NA 2UUBL 4EX5A 2R93G 1XNRL 2R7FA 5IP7G 1MJEA 1PVOA 1J5EQ 1KRTA 1S72A 1FJGL 3EIVA 3AQQA 4A3DH 4DR1L 1PH1A 4LF4Q 2Z0SA 4DV4Q 4A3DG 4X64Q 5C0XG 3CCVA 1N8RC 1YJWA 2Z6KA 5J3BA 4POFA 2JK8A 4HIDA 4A3GG 3F8TA 1NJIC 3WWVA 1P16A 3ULLA 2GN5A 1B70B 5IYDG 3S1MH 4X65L 3NELA 4WJ3M 3VDYA 1K73C 1YEZA 4YWKA 1VQOA 1L0WA 4IOCA 2VY3A 3PO3G 2I5LX 3CCMA 1K3RA 5IYBG 2K75A 4LF9L 5M3MH 4MTNA 1L1OA 1UWVA 2EIFA 2PQAB 2RF4A 4QL5A 2UXCQ 1YVCA 2NVQH 2K5NA 3RN5A 4JI8Q 4BBRH 3S14H 3IRBA 2B29A 3K80C 3ERSX 5DLQE 1EWIA 2MFIA 3TQYA 3KDFB 5GAHC 3HOZH 1UEBA 2R7DA 3S1QH 4LFBQ 1VQNA 4YWLA 2BA0A 4K0KQ 3RNUA 3M4PA 1I3QH 1Y1VG 1K8AC 2ID0A 3GTQH 4LFCQ 1WI5A 3ULPA 2OQKA 4Y7NH 3OW2A 1JJ2A 3CC4A 4A3MH 4NXNQ 2UXDQ 4YHHQ 4TQUS 1X65A 1LYLA 5H1SE 2ZM6L 1VQPA 3PIOA 5FLMG 3F2BA 1S3OA 1TWAH 3GTGH 3S16H 3PUYA 4A3JH 2MO1A 2A1AA 4B3ML 3U4ZA 2B63H 2L15A 4WJ4A 2HQLA 3PUWA 5IYBH 2YV5A 1SMXA 2ASBA 2JEAI 1TWGH 3UDXA 4GLVB 1IL2A 4DR7L 1SFOH 3G71A 4LF6Q 1FL0A 2VUMG 4A3KG 2B3GA 1KRSA 2PI2E 2PI2A 1WYDA 4QGUA 4DV4L 1N34Q 4OX9Q 1N33L 5C44G 3FHWA 3PO2H 2UU9L 1RIPA 3SGIA 3M9BA 1Q12A 4GLAC 4JBMA 4AQYL 5ELOA 4DV5L 2MO0A 1Y1WH 3UE1A 4LFAQ 2RHQB 1S40A 4MNOA 2A8VA 3AEVA 2DGYA 3ICEA 4HJ8A 4LW1A 1YHAA 4OWXB 3RLNA 4DR1Q 1PH9A 4XTCS 3T1HQ 2LXKA 4DAYB 3I56A 2ZJPA 3EBEA 1VQKA 3GTJH 3UDFA 2OTLA 2ZJQA 1VQIA 1I94L 4B3TQ 2ZTDA 4JBKA 4LF5L 2I5HA 4JI2Q 1Q1EA 1E3PA 3OTOL 2I0QA 2N49A 4IPDA 2UUAL 1CKNA 5C4JH 4DUYQ 1LUZA 1PH3A 3GTMH 2EXDA 4KHPL 1P8LA 3CCQA 3UE0A 4MZ9A 4C3JH 3L2PA 1YITA 2ES2A 4RG1A 4IFDG 4DR2L 1VQHA 2JA5H 2XTIA 1WFQA 2UXDL 5M3MG 4P74A 4QIWE 1FJGQ 2JJQA 2KENA 1QUQA 3HOWG 3H0GG 2HHHL 2ATWA 1CUKA 3D0FA 1VQ5A 2H5XA 3PSIA 4JG2A 3PF5A 1IYJB 1UE1A 2GVBA 4APVA 4JYAL 1BBUA 3FP9A 2AMCB 3HKSA 2D0OA 1LTLA 1G291 4ME3A 1QZHA 3W1BA 4POGA 4A3LG 3H0GH 4GKKL 1K83H 1IBML 4RMFA 5IP7H 2JA7H 1C7YA 1C0AA 4YY3Q 1PYBA 1Z47A 2IT1A 4LF7Q 2KCMA 4A3JG 2C35B 3LGJA 1NMFA 4NXML 1PFSA 2QGQA 2RCNA 3K7AH 3JAMi 5LMNW 4DR3L 2R92H 4DK3C 4DV1Q 1Q86C 3D31A 3CCRA 4GN5A 4LF6L 4A3GH 3RR5A 3U50C 4X6AH 2A19A 1M90C 1U5KA 2KBNA 3CCSA 4IFDI 4EQ5A 4JC0A 4B3RL 1QZGA 4A3CH 4GOPB 1VQDA 4BY1H 1XPUA 4IOAA 1EYGA 4BY7G 3F1ZA 3RN2A 1XMOQ 4PZ6A 1IBMQ 3L7ZC 3PCOB 1QVCA 3CAMA 3I4OA 2K52A 3T1YQ 3HOZG 1HNXQ 4H02A 1CKOA 3NENA 1X6OA 4DR2Q 1FGUA 3HOYH 2KHIA 5HY6A 4UPAA 4JI4Q 3PUZA 2K50A 4LWCA 4YCWA 2R92G 1GO3E 4A3BG 3UDIA 4GKKQ 3CCJA 4A75A 3A0JA 4DV0Q 2IHEA 1VQFA 3CXCA 1VQ8A 3GDEA 3S15H 3TREA 1BVSA 2B63G 1E7ZA 1RL2A 4LF5Q 1MIUA 1GVPA 2N8NA 1N32L 1G51A 4P71A 5IT9c 1J5EL 5GAGC 2VS1A 3CCEA 3I4NG 3BJUA 4FDBA 2JA6H 1YZ6A 4JI1Q 3S2HH 1VQGA 1I94Q 2HIXA 2WB1G 4JI2L 1T9HA 1UE5A 1PH6A 4XIGS 5ELNA 2N78A 3GD7A 3U58A 1GD7A 4C2MH 2WAQE 4LNQA 2Q2UA 5E7NA 3M4OH 5C3EH 2QEXA 1SRUA 3M4QA 3PGZA 5M5XH 1N36L 1VQLA 4DV3L 3AFQA 5BR8L 2JA8G 2VNUD 2R7ZG 4JI5Q 3GTPH 2BH8A 4B3MQ 1VQEA 3G6EA 5M3FG 2IHFA 5GQOA 2VQFQ 2VQEL 1YJNA 1K8GA 4GKJQ 3ZJYC 2ZJRA 4A3FH 4BBSH 1X55A 2KCTA 4QY7A 4OX9L 4DNIA 2LXJA 1XPRA 1Q82C 3AFPA 4AH6A 3PUXA 1VQ4A 3GTKH 1UE7A 1HNWQ 2KHJA 3FKIH 1EFWA 2EQSA 4LF7L 1R9TH 4HJ9A 2V1CC 4DUZQ 1Q7YC 1KAWA 3KF6A 2PMZE 2ZM6Q 3HOWH 2Q2IA 1L2FA 1HJPA 4AYBG 4KI0A 2YYZA 3KFUA 4JI0L 5C0XI 2NZOA 3T1YL 1E24A 1A63A 2K4KA 1L1OB 4HJ5A 3J81j 3KJOA 1CSPA 2VQEQ 2HIVA 2K5HA 4NXNL 1HZ9A 3CQZH 4R4QA 1Y1WG 4UP7A 3BZKA 4DV5Q 1OXXK 2WP8J 3BU2A 4X65Q 1YHQA 1JMCA 1SN8A 2NN6I 3CMAA 2ZTCA 4A3IG 4A3EH 3S24A 4A3FG 1Y14B 1PA6A 4DR6Q 3JC66 1N36Q 3HKZG 4NB3A 4GNXA 4BA2I 1N33Q 1TWCH 2UXCL 4K0KL 1YJ9A 2GVAA 4JOIC 4OONA 2VL6A 3MXNB 2CKZB 2MNAA 5LMUL 4HIKA 4LUZA 3PV0A 1XMOL 1EQQA 2E2IH 4GKJL 1Q46A 5IP9G 4HIMA 3S2DH 3J80i 4A3LH 3E9IA 3HOUG 5IYDH 4DUYL 2BH2A 2IX1A 1OXVA 2HT1A 5IYCG 4C3IH 4KHPQ 4IPCA 1YIJA 2D0PA 3CC7A 5C4XG 2CFMA 2N3SA 4IJHA 2AWNA 1PV4A 1EUJA 1KQSA 3W1GA 1Y1VH 1EIFA 5JEAJ 5IP9H 1OXTA 1D8LA 1YNXA 2RHSB 3A74A 2VQFL 4DV0L 1XNRQ 1LM0A 2R93H 3TS0A 1VQBA 1HNWL 3HOVH 2E8GA 3AYHB 1YBYA 1U0LA 4JI1L 4TVAB 1HZAA 4DR4L 2OTJA 1J6QA 3S1NH 1JT8A 1WCMG 3DLLA 1OXUA 1I50H 1CSQA 2K5VA 1KXLA 1OTCA 5K36G 2AHOB 2Y0SG 1HH2P 5FLXc 3RZOH 1PH5A 4OXPA 4DV2L 1HR0Q 3HFZB 4IO9A 4A3EG 4A3IH 3K81C 1KD1C 4DR5L 1KIXA 1AE2A 2YTXA 2JA8H 4KLKA 1JB7A 4JYAQ 4OO1G 3EN2A 1QVFA 3HOXG 3U4VA 2CWPA 3I4MG 1IZ6A 5IWAL 2WB1E 1PH2A 4LF8Q 1VQAA 4R4OA 2E2JH 3ULJA 4YCVA 2OQ0A 4L5TA 4LFAL 4LUVA 5LMUQ 3H3VI 4BY1G 5GROA 1CKNB 1XNQQ 1BKBA 3NBHB 4L5QA 2F4VL 3I55A 1MKHA 1O7IA 3STBD 1WOCA 4HIOA 4YWMA 4DV6L 4LUOA 4NXMQ 1GM5A 3PO2G 1AH9A 2YU9H 4Y52H 2QA4A 2I5MX 3I7FA 1IBKQ 3CCLA 1Z9FA 3A5UA 4JI4L 1WCMH 5LMNL 4BBRG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9W A;  1Q8K A;  2ALY B;  1W3S A;  2JA9 A;  3K8A A;  4JOI A;  3KJP A;  1EIY B;  3CME A;  4BBS G;  1IBL L;  4GN3 B;  4JBW A;  1VQ9 A;  3STB C;  1G6P A;  1E1T A;  4GNX C;  4O2D A;  1V9P A;  3J80 c;  5JEA G;  1KC8 C;  1N34 L;  1NY4 A;  5M3F H;  5M5W H;  5GAE C;  4UY8 C;  2R7Z H;  1SRO A;  1E1O A;  5FJ8 H;  2AKW B;  2FXQ A;  3GO5 A;  1NBW A;  1I5F A;  3NEM A;  1A62 A;  2JA7 G;  4JI7 Q;  1K0R A;  1EQR A;  5IYC H;  4P75 A;  1X3F A;  3RLO A;  4X64 L;  3GTO H;  2CWA A;  4GLX A;  2ZTE A;  4YHH L;  1DGS A;  1FVI A;  5LMN Q;  4DR3 Q;  1E22 A;  1X56 A;  3KYH C;  3I4N H;  4X66 L;  3KLW A;  2AWO A;  4UP9 A;  1VQC A;  3CCU A;  1QUQ B;  2UUA Q;  4YY3 L;  5JJI A;  2BA1 A;  4QQB X;  4HJA A;  1SR3 A;  3CPW A;  1AE3 A;  3HKZ E;  2JA5 G;  1KL9 A;  4L5R C;  4B3T L;  1VQJ A;  3MEF A;  4X62 L;  4B3R Q;  3G48 A;  3TRZ A;  1Q1B A;  1HZB A;  2Z6K C;  1B7Y B;  4R4I A;  1ASY A;  1JJG A;  2CCZ A;  2UUC L;  1QVG A;  2XGT A;  5C3E G;  4A3B H;  5HGQ A;  2JE6 I;  1HNZ L;  1XNQ L;  3K7U C;  4GNX B;  4DV3 Q;  4LFB L;  4GS3 A;  4P72 A;  2HHH Q;  2Q2T A;  4A76 A;  5IWA Q;  4L5S A;  5C4X H;  3TS2 A;  1TXY A;  4DV7 Q;  1V43 A;  3UDG A;  4OWT B;  2NVT H;  4R1J A;  4B3S Q;  4DAM A;  3F2C A;  3J81 i;  4IFD J;  2JQO A;  3BZC A;  4BY7 H;  3L0O A;  4GOP C;  1PHJ A;  1L1O C;  1HR0 W;  4DV2 Q;  1HR0 L;  4BXX H;  4IPG A;  3PIP A;  3H15 A;  3Q8D A;  1NE3 A;  4ALP A;  2MQH A;  3T1H L;  2UUC Q;  4DR4 Q;  2CQO A;  4JI6 L;  1C9O A;  5M5Y H;  4DR6 L;  1WJJ A;  4DKA C;  3CD6 A;  2F3I A;  3PO3 H;  2UXB Q;  1H95 A;  4JI3 Q;  4BA1 I;  5EAY A;  4HJ7 A;  2PNH A;  1I6H H;  1N32 Q;  1VQ6 A;  3H3V H;  2VW9 A;  4B3S L;  1JE5 A;  4A3K H;  1XPO A;  2R6G A;  4X66 Q;  5C44 H;  1UE6 A;  3B6Y A;  3OYY A;  5C0X J;  3S1R H;  4LF4 L;  4JV5 Q;  1SE8 A;  3HOY G;  5JJL A;  1XMQ Q;  3KF8 B;  4UP8 A;  4X62 Q;  4DR7 Q;  1KHI A;  4R4C A;  3M3Y H;  4IPH A;  2JEB I;  4GN4 B;  2IY5 B;  4R4T A;  1B8A A;  4PG3 A;  1TWH H;  1YHB A;  4P73 A;  1JJC B;  2UU9 Q;  4BXX G;  3DM3 A;  3TEH B;  1PH7 A;  1W2B A;  1K9M C;  3A5Z B;  4NPS A;  2E5L Q;  4PZ7 A;  4LF9 Q;  3E9H A;  4JBJ A;  1NMG A;  5GAD C;  3HOX H;  1HNX L;  3I4M H;  3PF4 A;  1IBL Q;  4PZ8 A;  4JI0 Q;  3CP0 A;  3KDF A;  4OWW B;  5BR8 Q;  1XJV A;  1TWF H;  3S17 H;  2D62 A;  3W5O A;  4A3C G;  1D7Q A;  4YCU A;  2YTV A;  1Q81 C;  1CKM A;  3I2Z A;  4OO1 I;  1M1K C;  2K14 A;  1MJC A;  4C3H H;  4DUZ L;  1V1Q A;  4JI7 L;  5JJK A;  4O0A A;  2Q2H A;  3RLF A;  3G4S A;  1OXS C;  1PYS B;  3ER0 A;  3KOJ A;  2IX0 A;  1X3E A;  2E5L L;  5FLM H;  4JI3 L;  4A4I A;  1IXR A;  1A8V A;  3JAM c;  3FKI G;  4DV6 Q;  1XMQ L;  4A93 G;  4JI8 L;  1PH4 A;  2VZA A;  2OWO A;  4A93 H;  5IY0 A;  4DV1 L;  2UXB L;  2WAQ G;  3CPF A;  1IBK L;  3GTL H;  3PUV A;  5FJ8 G;  3M7N A;  3CW2 C;  2F4V Q;  3HOU H;  4DPG A;  5AJ3 Q;  4DK6 C;  4JV5 L;  3K0X A;  3RZD H;  2WFW A;  2JA6 G;  1VQ7 A;  1GKH A;  1SLJ A;  3J7Z C;  1ASZ A;  2OCE A;  4QJF A;  4LFC L;  2E2H H;  3CF5 A;  4DV7 L;  1BBW A;  1NTG A;  1X54 A;  4JI5 L;  4IJL A;  4JCV E;  3KF6 B;  4PMW A;  1YI2 A;  2UUB Q;  3M85 A;  2NZH A;  1VS0 A;  1XTD A;  2Y0S E;  2YTY A;  4DR5 Q;  1HNZ Q;  3J81 c;  2NVX H;  2VUM H;  1A0I A;  1PH8 A;  3J7A 5;  4KHZ A;  4J15 A;  3F2D A;  2LSS A;  4JI6 Q;  3CC2 A;  5AJ3 L;  3HOV G;  4LF8 L;  3E0E A;  1EOV A;  4GOP A;  4AIM A;  2DUD A;  2NN6 G;  2NVY H;  2PQA A;  4AYB E;  3OTO Q;  5IE8 A;  1HZC A;  4AQY Q;  1VCI A;  1X3G A;  2F52 A;  4A3M G;  1VQM A;  1X9N A;  2UUB L;  4EX5 A;  2R93 G;  1XNR L;  2R7F A;  5IP7 G;  1MJE A;  1PVO A;  1J5E Q;  1KRT A;  1S72 A;  1FJG L;  3EIV A;  3AQQ A;  4A3D H;  4DR1 L;  1PH1 A;  4LF4 Q;  2Z0S A;  4DV4 Q;  4A3D G;  4X64 Q;  5C0X G;  3CCV A;  1N8R C;  1YJW A;  2Z6K A;  5J3B A;  4POF A;  2JK8 A;  4HID A;  4A3G G;  3F8T A;  1NJI C;  3WWV A;  1P16 A;  3ULL A;  2GN5 A;  1B70 B;  5IYD G;  3S1M H;  4X65 L;  3NEL A;  4WJ3 M;  3VDY A;  1K73 C;  1YEZ A;  4YWK A;  1VQO A;  1L0W A;  4IOC A;  2VY3 A;  3PO3 G;  2I5L X;  3CCM A;  1K3R A;  5IYB G;  2K75 A;  4LF9 L;  5M3M H;  4MTN A;  1L1O A;  1UWV A;  2EIF A;  2PQA B;  2RF4 A;  4QL5 A;  2UXC Q;  1YVC A;  2NVQ H;  2K5N A;  3RN5 A;  4JI8 Q;  4BBR H;  3S14 H;  3IRB A;  2B29 A;  3K80 C;  3ERS X;  5DLQ E;  1EWI A;  2MFI A;  3TQY A;  3KDF B;  5GAH C;  3HOZ H;  1UEB A;  2R7D A;  3S1Q H;  4LFB Q;  1VQN A;  4YWL A;  2BA0 A;  4K0K Q;  3RNU A;  3M4P A;  1I3Q H;  1Y1V G;  1K8A C;  2ID0 A;  3GTQ H;  4LFC Q;  1WI5 A;  3ULP A;  2OQK A;  4Y7N H;  3OW2 A;  1JJ2 A;  3CC4 A;  4A3M H;  4NXN Q;  2UXD Q;  4YHH Q;  4TQU S;  1X65 A;  1LYL A;  5H1S E;  2ZM6 L;  1VQP A;  3PIO A;  5FLM G;  3F2B A;  1S3O A;  1TWA H;  3GTG H;  3S16 H;  3PUY A;  4A3J H;  2MO1 A;  2A1A A;  4B3M L;  3U4Z A;  2B63 H;  2L15 A;  4WJ4 A;  2HQL A;  3PUW A;  5IYB H;  2YV5 A;  1SMX A;  2ASB A;  2JEA I;  1TWG H;  3UDX A;  4GLV B;  1IL2 A;  4DR7 L;  1SFO H;  3G71 A;  4LF6 Q;  1FL0 A;  2VUM G;  4A3K G;  2B3G A;  1KRS A;  2PI2 E;  2PI2 A;  1WYD A;  4QGU A;  4DV4 L;  1N34 Q;  4OX9 Q;  1N33 L;  5C44 G;  3FHW A;  3PO2 H;  2UU9 L;  1RIP A;  3SGI A;  3M9B A;  1Q12 A;  4GLA C;  4JBM A;  4AQY L;  5ELO A;  4DV5 L;  2MO0 A;  1Y1W H;  3UE1 A;  4LFA Q;  2RHQ B;  1S40 A;  4MNO A;  2A8V A;  3AEV A;  2DGY A;  3ICE A;  4HJ8 A;  4LW1 A;  1YHA A;  4OWX B;  3RLN A;  4DR1 Q;  1PH9 A;  4XTC S;  3T1H Q;  2LXK A;  4DAY B;  3I56 A;  2ZJP A;  3EBE A;  1VQK A;  3GTJ H;  3UDF A;  2OTL A;  2ZJQ A;  1VQI A;  1I94 L;  4B3T Q;  2ZTD A;  4JBK A;  4LF5 L;  2I5H A;  4JI2 Q;  1Q1E A;  1E3P A;  3OTO L;  2I0Q A;  2N49 A;  4IPD A;  2UUA L;  1CKN A;  5C4J H;  4DUY Q;  1LUZ A;  1PH3 A;  3GTM H;  2EXD A;  4KHP L;  1P8L A;  3CCQ A;  3UE0 A;  4MZ9 A;  4C3J H;  3L2P A;  1YIT A;  2ES2 A;  4RG1 A;  4IFD G;  4DR2 L;  1VQH A;  2JA5 H;  2XTI A;  1WFQ A;  2UXD L;  5M3M G;  4P74 A;  4QIW E;  1FJG Q;  2JJQ A;  2KEN A;  1QUQ A;  3HOW G;  3H0G G;  2HHH L;  2ATW A;  1CUK A;  3D0F A;  1VQ5 A;  2H5X A;  3PSI A;  4JG2 A;  3PF5 A;  1IYJ B;  1UE1 A;  2GVB A;  4APV A;  4JYA L;  1BBU A;  3FP9 A;  2AMC B;  3HKS A;  2D0O A;  1LTL A;  1G29 1;  4ME3 A;  1QZH A;  3W1B A;  4POG A;  4A3L G;  3H0G H;  4GKK L;  1K83 H;  1IBM L;  4RMF A;  5IP7 H;  2JA7 H;  1C7Y A;  1C0A A;  4YY3 Q;  1PYB A;  1Z47 A;  2IT1 A;  4LF7 Q;  2KCM A;  4A3J G;  2C35 B;  3LGJ A;  1NMF A;  4NXM L;  1PFS A;  2QGQ A;  2RCN A;  3K7A H;  3JAM i;  5LMN W;  4DR3 L;  2R92 H;  4DK3 C;  4DV1 Q;  1Q86 C;  3D31 A;  3CCR A;  4GN5 A;  4LF6 L;  4A3G H;  3RR5 A;  3U50 C;  4X6A H;  2A19 A;  1M90 C;  1U5K A;  2KBN A;  3CCS A;  4IFD I;  4EQ5 A;  4JC0 A;  4B3R L;  1QZG A;  4A3C H;  4GOP B;  1VQD A;  4BY1 H;  1XPU A;  4IOA A;  1EYG A;  4BY7 G;  3F1Z A;  3RN2 A;  1XMO Q;  4PZ6 A;  1IBM Q;  3L7Z C;  3PCO B;  1QVC A;  3CAM A;  3I4O A;  2K52 A;  3T1Y Q;  3HOZ G;  1HNX Q;  4H02 A;  1CKO A;  3NEN A;  1X6O A;  4DR2 Q;  1FGU A;  3HOY H;  2KHI A;  5HY6 A;  4UPA A;  4JI4 Q;  3PUZ A;  2K50 A;  4LWC A;  4YCW A;  2R92 G;  1GO3 E;  4A3B G;  3UDI A;  4GKK Q;  3CCJ A;  4A75 A;  3A0J A;  4DV0 Q;  2IHE A;  1VQF A;  3CXC A;  1VQ8 A;  3GDE A;  3S15 H;  3TRE A;  1BVS A;  2B63 G;  1E7Z A;  1RL2 A;  4LF5 Q;  1MIU A;  1GVP A;  2N8N A;  1N32 L;  1G51 A;  4P71 A;  5IT9 c;  1J5E L;  5GAG C;  2VS1 A;  3CCE A;  3I4N G;  3BJU A;  4FDB A;  2JA6 H;  1YZ6 A;  4JI1 Q;  3S2H H;  1VQG A;  1I94 Q;  2HIX A;  2WB1 G;  4JI2 L;  1T9H A;  1UE5 A;  1PH6 A;  4XIG S;  5ELN A;  2N78 A;  3GD7 A;  3U58 A;  1GD7 A;  4C2M H;  2WAQ E;  4LNQ A;  2Q2U A;  5E7N A;  3M4O H;  5C3E H;  2QEX A;  1SRU A;  3M4Q A;  3PGZ A;  5M5X H;  1N36 L;  1VQL A;  4DV3 L;  3AFQ A;  5BR8 L;  2JA8 G;  2VNU D;  2R7Z G;  4JI5 Q;  3GTP H;  2BH8 A;  4B3M Q;  1VQE A;  3G6E A;  5M3F G;  2IHF A;  5GQO A;  2VQF Q;  2VQE L;  1YJN A;  1K8G A;  4GKJ Q;  3ZJY C;  2ZJR A;  4A3F H;  4BBS H;  1X55 A;  2KCT A;  4QY7 A;  4OX9 L;  4DNI A;  2LXJ A;  1XPR A;  1Q82 C;  3AFP A;  4AH6 A;  3PUX A;  1VQ4 A;  3GTK H;  1UE7 A;  1HNW Q;  2KHJ A;  3FKI H;  1EFW A;  2EQS A;  4LF7 L;  1R9T H;  4HJ9 A;  2V1C C;  4DUZ Q;  1Q7Y C;  1KAW A;  3KF6 A;  2PMZ E;  2ZM6 Q;  3HOW H;  2Q2I A;  1L2F A;  1HJP A;  4AYB G;  4KI0 A;  2YYZ A;  3KFU A;  4JI0 L;  5C0X I;  2NZO A;  3T1Y L;  1E24 A;  1A63 A;  2K4K A;  1L1O B;  4HJ5 A;  3J81 j;  3KJO A;  1CSP A;  2VQE Q;  2HIV A;  2K5H A;  4NXN L;  1HZ9 A;  3CQZ H;  4R4Q A;  1Y1W G;  4UP7 A;  3BZK A;  4DV5 Q;  1OXX K;  2WP8 J;  3BU2 A;  4X65 Q;  1YHQ A;  1JMC A;  1SN8 A;  2NN6 I;  3CMA A;  2ZTC A;  4A3I G;  4A3E H;  3S24 A;  4A3F G;  1Y14 B;  1PA6 A;  4DR6 Q;  3JC6 6;  1N36 Q;  3HKZ G;  4NB3 A;  4GNX A;  4BA2 I;  1N33 Q;  1TWC H;  2UXC L;  4K0K L;  1YJ9 A;  2GVA A;  4JOI C;  4OON A;  2VL6 A;  3MXN B;  2CKZ B;  2MNA A;  5LMU L;  4HIK A;  4LUZ A;  3PV0 A;  1XMO L;  1EQQ A;  2E2I H;  4GKJ L;  1Q46 A;  5IP9 G;  4HIM A;  3S2D H;  3J80 i;  4A3L H;  3E9I A;  3HOU G;  5IYD H;  4DUY L;  2BH2 A;  2IX1 A;  1OXV A;  2HT1 A;  5IYC G;  4C3I H;  4KHP Q;  4IPC A;  1YIJ A;  2D0P A;  3CC7 A;  5C4X G;  2CFM A;  2N3S A;  4IJH A;  2AWN A;  1PV4 A;  1EUJ A;  1KQS A;  3W1G A;  1Y1V H;  1EIF A;  5JEA J;  5IP9 H;  1OXT A;  1D8L A;  1YNX A;  2RHS B;  3A74 A;  2VQF L;  4DV0 L;  1XNR Q;  1LM0 A;  2R93 H;  3TS0 A;  1VQB A;  1HNW L;  3HOV H;  2E8G A;  3AYH B;  1YBY A;  1U0L A;  4JI1 L;  4TVA B;  1HZA A;  4DR4 L;  2OTJ A;  1J6Q A;  3S1N H;  1JT8 A;  1WCM G;  3DLL A;  1OXU A;  1I50 H;  1CSQ A;  2K5V A;  1KXL A;  1OTC A;  5K36 G;  2AHO B;  2Y0S G;  1HH2 P;  5FLX c;  3RZO H;  1PH5 A;  4OXP A;  4DV2 L;  1HR0 Q;  3HFZ B;  4IO9 A;  4A3E G;  4A3I H;  3K81 C;  1KD1 C;  4DR5 L;  1KIX A;  1AE2 A;  2YTX A;  2JA8 H;  4KLK A;  1JB7 A;  4JYA Q;  4OO1 G;  3EN2 A;  1QVF A;  3HOX G;  3U4V A;  2CWP A;  3I4M G;  1IZ6 A;  5IWA L;  2WB1 E;  1PH2 A;  4LF8 Q;  1VQA A;  4R4O A;  2E2J H;  3ULJ A;  4YCV A;  2OQ0 A;  4L5T A;  4LFA L;  4LUV A;  5LMU Q;  3H3V I;  4BY1 G;  5GRO A;  1CKN B;  1XNQ Q;  1BKB A;  3NBH B;  4L5Q A;  2F4V L;  3I55 A;  1MKH A;  1O7I A;  3STB D;  1WOC A;  4HIO A;  4YWM A;  4DV6 L;  4LUO A;  4NXM Q;  1GM5 A;  3PO2 G;  1AH9 A;  2YU9 H;  4Y52 H;  2QA4 A;  2I5M X;  3I7F A;  1IBK Q;  3CCL A;  1Z9F A;  3A5U A;  4JI4 L;  1WCM H;  5LMN L;  4BBR G; 
#chains in the Genus database with same CATH topology
 1TS2 A;  3KJP A;  1EIY B;  4GN3 B;  1WTQ A;  1SJE D;  4YIJ A;  5C5L A;  1V9P A;  1N34 L;  1NY4 A;  4UY8 C;  2SDF A;  3QOJ A;  1CA6 A;  2R7Z H;  1FNU A;  1IYV A;  2EYH A;  5FJ8 H;  2KOL A;  1I5F A;  1J9O A;  2JA7 G;  3D8G A;  1EQR A;  5IYC H;  4V19 0;  4X64 L;  1F9P A;  1NUC A;  2IL8 A;  4GLX A;  2FMC A;  5LMN Q;  1EU4 A;  3G6J B;  3TP5 A;  4X66 L;  4ULL A;  2Q8R E;  2I07 B;  1VQC A;  1QUQ B;  2UUA Q;  2QIL A;  2BA1 A;  4QQB X;  1SR3 A;  2EYP A;  1XWE A;  3CRL C;  4L5R C;  3MEF A;  3TRZ A;  1Q1B A;  2L0C A;  3HOU B;  1TWG B;  3DWQ A;  1JWU D;  4R4I A;  1JJG A;  2CCZ A;  2JA7 B;  2KCN A;  3K59 A;  1HNZ L;  4HMI A;  4DGZ A;  3K7U C;  4DV3 Q;  4GS3 A;  4P72 A;  3G7L A;  5C4X H;  1TXY A;  1V43 A;  4OWT B;  5FLX E;  4R1J A;  2B2Y C;  4B3S Q;  1ENC A;  4H0L C;  3HOW B;  2JQO A;  4BWG B;  4RGT A;  4BXX H;  3PIP A;  3H15 A;  3Q8D A;  2MQH A;  2IJ0 A;  4I65 A;  4KHV A;  1EL0 A;  2UXB Q;  4IUT A;  4ME5 A;  5EAY A;  1KNE A;  2PNH A;  3A56 A;  4A3E B;  3H3V H;  4J6H A;  1IL8 A;  1XPO A;  3S1R B;  3J7A F;  3IL8 A;  3I3C A;  1IHZ A;  4R9W A;  4IAL A;  5JJL A;  1TS4 A;  1Y8N B;  1XMQ Q;  1PFM A;  1XYI A;  1ICF B;  2D2C C;  1BCP F;  1KHI A;  3M3Y H;  1PRT B;  1B8A A;  4DA2 A;  3GTL B;  2E5L Q;  4NPS A;  4RA8 A;  1TWH B;  1DXM A;  3OWE B;  4OIJ A;  2DN8 A;  4OL7 A;  3E9H A;  3D6C A;  4JBJ A;  5GAD C;  1H9M A;  4CKB A;  3PF4 A;  1RCV D;  1SYE A;  2KJX A;  1IBL Q;  3KDF A;  3H09 A;  4B9X A;  4X3S A;  1TWF H;  2D62 A;  1D7Q A;  5M3F B;  1MGS A;  2K14 A;  1CT1 D;  4TKO B;  3N6R A;  2ZXR A;  2Q2H A;  3G4S A;  1H9R A;  1LTT D;  2P5Z X;  1OXS C;  3IFT A;  3KOJ A;  2KUM A;  2G5D A;  3K6O A;  4OIK A;  3VYT A;  5JAV A;  1XMQ L;  4A93 G;  4A93 H;  3J80 L;  1LT4 D;  1KLG D;  3HOU H;  5EKK A;  4DV7 L;  1VDZ A;  3FRP B;  2O5J C;  4CKC A;  4BBS B;  2A74 C;  3MXG A;  4WOR A;  1SE4 A;  1PRT F;  4JI6 Q;  2PW7 A;  1D1K A;  4FF1 A;  3HOV G;  4LF8 L;  1G91 A;  1LO5 D;  3J81 E;  3WOF A;  5FO8 B;  4AYB E;  1HZC A;  1AW7 A;  1VCI A;  1VQM A;  4A3M G;  2UUB L;  3WDN A;  5CV5 A;  1FD7 D;  1MJE A;  1J5E Q;  2NZ1 D;  5C4H A;  1FJG L;  1GOZ A;  4A3D H;  4IN3 A;  5D14 A;  2Z0S A;  2F0K A;  3KLR A;  2JA8 B;  3CCV A;  1N8R C;  4IUN A;  4H13 C;  1NJI C;  3WWV A;  3GTK B;  2GN5 A;  1B70 B;  1LT5 D;  5IYD G;  4X65 L;  3NEL A;  2CW0 C;  3BVM A;  2XVS A;  1L0W A;  4IOC A;  4NDX A;  1K3R A;  4LF9 L;  1B9M A;  4MTN A;  1D5M C;  3DWA A;  2EIF A;  4QL5 A;  2RF4 A;  4EQO A;  3C3L A;  2UXC Q;  3RN5 A;  2EYL A;  1WTW A;  3S14 H;  5GAH C;  3D4W A;  2E76 C;  1ET9 A;  5M5Y B;  1VQN A;  4XT3 B;  2BA0 A;  4K0K Q;  3RNU A;  1ML0 D;  2ENB A;  1B44 D;  1Y1V G;  2NUC A;  1HUM A;  3CC4 A;  4NXN Q;  4A3M H;  1UUP A;  2RDF A;  4TQU S;  4YHH Q;  3IFD A;  1PZI D;  3C1F A;  1LYL A;  1UNS A;  1EQT A;  1S4Z A;  1VMP A;  2F0O A;  1STH A;  1I6V C;  3VYS A;  4C3I G;  4FF2 A;  1CQV A;  3PUY A;  2MO1 A;  1A3U A;  1D6E C;  3PUW A;  1SMX A;  1IL2 A;  1F9S A;  1FL0 A;  2VUM G;  2PI2 E;  1K83 B;  2DJG C;  2DNC A;  3TN2 A;  3J7Y W;  4DV4 L;  3RZD B;  3CRK C;  1TWA B;  3LX0 A;  2JP1 A;  1SFO B;  2B2W A;  2UU9 L;  3SGI A;  4GLA C;  3KUP A;  4CJ0 B;  1I4X A;  2MO0 A;  4LFA Q;  1CQF A;  4BY7 B;  1SYC A;  5J1Z A;  2A8V A;  2DGY A;  1QJO A;  1ZEQ X;  1VQK A;  4DAY B;  1H9S A;  2F1M A;  3HOZ B;  2CQA A;  1VQI A;  1I94 L;  4B3T Q;  4JBK A;  2PZW A;  3URY A;  1Q3L A;  3GTM H;  3UE0 A;  4C3J H;  1YIT A;  2ES2 A;  4RG1 A;  5FO9 B;  1HRJ A;  2XIW A;  3EFX D;  1MI2 A;  1TY2 A;  3R2T A;  3LNN A;  2HHH L;  1GUT A;  1F77 A;  1NSN S;  1LTI D;  4ZYS A;  1EQV A;  4JYA L;  1YNN D;  2D0O A;  4K14 A;  3I73 A;  4ME3 A;  3OPO A;  4POG A;  4K8J A;  3H0G H;  1K83 H;  1LLR D;  1QG7 A;  1D5Z C;  1IYU A;  5CGK A;  4YY3 Q;  3BDO A;  4RWS C;  3TP6 A;  2KCM A;  2C35 B;  1HA6 A;  1F2Z A;  3CCR A;  1F9Q A;  3E6Z X;  1RKN A;  1I4G A;  1XX8 A;  1B2T A;  4UDU C;  1U5K A;  5C4J B;  2KBN A;  1PFN A;  1RDP D;  1XPU A;  1RF2 D;  2J0T D;  3F1Z A;  5IOD A;  1G6Z A;  1XMO Q;  4BY1 B;  3L7Z C;  3I4O A;  4RH6 A;  2K52 A;  3T1Y Q;  3PIO 3;  3VR3 A;  2HDL A;  4UAI A;  4ZLT F;  4H02 A;  1CKO A;  5C3X A;  5E3F A;  1X6O A;  3HOY H;  2WAQ B;  4KKU A;  1ESR A;  5C44 B;  4A75 A;  2EYM A;  5JEA H;  2XRQ D;  1A3V A;  2RSN A;  2B63 G;  1E7Z A;  1RL2 A;  1CA5 A;  2B2Y A;  4P71 A;  1II3 A;  2QDL A;  5I6W A;  1M8A A;  1HA5 A;  5IGF A;  2JA6 H;  5NUC A;  1SXT A;  4F88 A;  3MFY A;  1I94 Q;  2HIX A;  2WB1 G;  4QF4 A;  4JI2 L;  2FJ2 A;  4F7X A;  1SSO A;  3U58 A;  2E75 C;  1BOS A;  2ICE C;  2Z4H A;  5C3E H;  4EVO A;  1SRU A;  5M5X H;  1N36 L;  3AFQ A;  4G7O C;  1NCV A;  4A3J B;  3TZU A;  2F0L A;  3G6E A;  2VQE L;  4GKJ Q;  1TT2 A;  4BBS H;  1X55 A;  2KCT A;  1PMR A;  1XPR A;  1Q82 C;  3GTK H;  3PUX A;  3DEO A;  1HNW Q;  1R9T H;  3SK8 A;  1MSG A;  4DUZ Q;  2EZV A;  1Q7Y C;  3PMF A;  2PMZ E;  2Q2I A;  4AYB G;  4KI0 A;  4JI0 L;  5C0X I;  3T1Y L;  1KDC A;  4C3H B;  4NXN L;  5DEH A;  2H4O A;  3DMU A;  2MJ8 A;  1OXX K;  4UP7 A;  5JPN C;  4X65 Q;  1F9R A;  3CMA A;  5HGT A;  1PA6 A;  1SEB D;  4HSP A;  1QIL A;  1N33 Q;  1TWC H;  3E3X A;  3VYU A;  3MVV A;  2MNA A;  3MXN B;  1I6H B;  5LMU L;  4GKJ L;  1CHP D;  4LUZ A;  2XRS D;  5IP9 G;  1RD9 D;  2CHB D;  3J80 i;  2E2H B;  3HS0 C;  4DUY L;  1ENA A;  5IYC G;  4C3I H;  4KHP Q;  4IPC A;  1YIJ A;  1R4P B;  1SNO A;  5C0X H;  1EUJ A;  1RHP A;  2F3W A;  3W1G A;  4K6L A;  2VQF L;  1F2Y A;  3NBH A;  2E8G A;  4ABN A;  3S1N H;  1EY5 A;  3K7A B;  4IUR A;  1E2W A;  1OXU A;  1GXD C;  3DLL A;  3A54 A;  4Q0F A;  2Y0S G;  3RZO H;  1KIX A;  1HFG A;  1JB7 A;  4OO1 G;  1TU2 B;  4FXD A;  5A2Q E;  2RKS A;  1SE3 A;  2A5H A;  5IWA L;  2EY2 A;  2CH4 W;  4Y7N B;  2OQ0 A;  4L5T A;  4BY1 G;  5IGB A;  3M3Y B;  1LTG D;  1BKB A;  2F4V L;  4L5Q A;  3TP8 A;  2ZXO A;  1O7I A;  2KCC A;  4HIO A;  1ILQ A;  3ERQ A;  1GM5 A;  1AH9 A;  2YU9 H;  5CMD A;  2QA4 A;  4Y52 H;  4WRD A;  2I5M X;  3FVQ A;  1Q8K A;  5M3M B;  1LAB A;  1IBL L;  3RMH A;  1E1T A;  4O2D A;  1V1P B;  4C3J B;  5JEA G;  2L4N A;  4ZCK A;  1KC8 C;  5M3F H;  3J7A V;  5GAE C;  1ICW A;  1TR5 A;  4XQN A;  1LT6 D;  2A69 D;  3NEM A;  1A62 A;  4JI7 Q;  1M4V A;  1STB A;  4P75 A;  2SNS A;  4LK1 C;  1X3F A;  3GTO H;  4YHH L;  1BBX C;  2F0H A;  5JJI A;  3VR2 A;  4A3K B;  3CPW A;  3HKZ E;  3DWP A;  3QOL A;  1KL9 A;  4QUC A;  5CV4 A;  1VQJ A;  4X3U A;  4X62 L;  2K32 A;  3K5N A;  4B3T L;  4B3R Q;  1WD1 A;  1PDQ A;  2Z6K C;  1B7Y B;  4NP5 A;  5DNF A;  3D6W A;  3M7G A;  1SNQ A;  1BR9 A;  2DY7 A;  3P1H A;  1J8I A;  2Q2T A;  3TS2 A;  2NVT H;  1YNJ C;  3J81 i;  3BZC A;  2KA7 A;  3L0O A;  3ONA B;  4RKB A;  1PHJ A;  4FF3 A;  1Y8O B;  4IPG A;  4ALP A;  3TZD A;  4DR4 Q;  1EU3 A;  2CQO A;  3VA5 A;  2JYO A;  1WJJ A;  4DR6 L;  2F3I A;  1QNU A;  1HHV A;  5CC4 A;  4B3S L;  1JE5 A;  4A3I B;  4U67 3;  1SMY D;  4X66 Q;  5C44 H;  2QEJ C;  3B6Y A;  1NAP A;  3QIA A;  2A6H C;  1T5E A;  1TS5 A;  2K5Q A;  4LF4 L;  4JV5 Q;  1SE8 A;  3KF8 B;  4X62 Q;  4FXG C;  3DM1 A;  3EQL C;  2R3Z A;  4PG3 A;  1FGB D;  1JJC B;  5C4X B;  5CYU A;  1PH7 A;  1W2B A;  2EOT A;  1K9M C;  3PO2 B;  4LF9 Q;  1NMG A;  1HNX L;  1FNW A;  4KN7 C;  3SDZ A;  1NNX A;  3CP0 A;  4OWW B;  4ZKC B;  4PMB A;  1DON A;  2YTV A;  1Q81 C;  3I2Z A;  5KNC A;  1M1K C;  1KNA A;  3R8B A;  1MJC A;  4C3H H;  4Z9C B;  4CKE A;  4JI7 L;  4K8I A;  2X6L A;  1KTK A;  1VMC A;  1PYS B;  2XNA C;  1X3E A;  4JI3 L;  3JAM c;  1TQO A;  3FKI G;  5I6Y A;  2WB1 B;  4JI8 L;  1PH4 A;  1R9T B;  3QR8 A;  2G9D A;  2NVQ B;  1DM0 B;  5FJ8 G;  3GTL H;  3M7N A;  4K5V A;  3CW2 C;  2F4V Q;  4DPG A;  5AJ3 Q;  1HPC A;  3RZD H;  4KD4 A;  4XYO A;  5I4D A;  1VQ7 A;  1SLJ A;  2BOS A;  2E2H H;  5ISR A;  4LFC L;  3T51 B;  1NTG A;  1YI2 A;  3KF8 A;  2UUB Q;  3T13 A;  1D2B A;  3J81 c;  2B2T A;  1PH8 A;  3H6M A;  1SNM A;  3CC2 A;  3A55 A;  4ID6 A;  3E0E A;  4GOP A;  2BDN A;  2NN6 G;  4AQY Q;  5IE8 A;  1ZYR C;  3M4O B;  1FNV A;  1TY0 A;  5C4Z A;  2R93 G;  4MHE A;  1PVO A;  2H1E A;  4H44 C;  1KRT A;  1S72 A;  3AQQ A;  2CW0 D;  4LF4 Q;  1S5D D;  4A3D G;  4H7B A;  4G7Z C;  3ITP A;  2Z6K A;  1K28 A;  3Q22 A;  2JK8 A;  2WAC A;  2EY6 A;  1KAB A;  4HID A;  3F8T A;  1P16 A;  2K05 A;  3A8J E;  4KJN A;  2F0M A;  2SEB D;  4P2C B;  3R2I A;  4YWK A;  1G2T A;  4ZQ3 A;  2KHS A;  2VY3 A;  2I5L X;  2NTT A;  1L1O A;  2PQA B;  1YVC A;  2NVQ H;  2YU9 B;  1TKW B;  3I72 A;  3K80 C;  3TQY A;  2MFI A;  1LTR D;  4G57 A;  3KDF B;  4RAU C;  5CBA E;  1UEB A;  4YWL A;  2B2U A;  3I70 A;  5IGG A;  3S1Q B;  3ULP A;  2OQK A;  4Y7N H;  3OW2 A;  3P7J A;  3S14 B;  2ZM6 L;  1VQP A;  1QB5 D;  1H9J A;  3GTG H;  3S16 H;  2F0T A;  3MEH A;  2A1A A;  5BN5 A;  5E4X A;  1TWG H;  2EYF A;  3G71 A;  4LF6 Q;  4CDC C;  1JCK B;  3ND9 A;  4IFD H;  1KRS A;  2L5T A;  4QGU A;  1N34 Q;  4RHS A;  4QUF A;  3P20 A;  4JBM A;  4OGQ C;  4LJZ C;  4CJ2 C;  3HOX B;  3FEW X;  1QNK A;  4MNO A;  5IGE A;  1MHW C;  4N9P A;  4OWX B;  1PH9 A;  3TDQ A;  4XTC S;  3I56 A;  1V1P A;  2VNU D;  2HD3 A;  3EBE A;  2NN6 H;  3UDF A;  5KGU A;  2ZTD A;  4JI2 Q;  1Q1E A;  1E3P A;  1PLF A;  2F0Q A;  2UUA L;  2Y0S B;  1CKN A;  3OIQ A;  3JAM L;  2LMC B;  2WKD A;  4KHP L;  3CCQ A;  4QMG A;  3T53 B;  1A2U A;  2L9H A;  4DR2 L;  3U9O A;  4QIW E;  1FJG Q;  3HOW G;  4G7H C;  5EKI A;  1CUK A;  3D0F A;  2GVB A;  3NQT A;  4APV A;  3J81 L;  1Y69 U;  2HCC A;  2AMC B;  2NVT B;  2MGS A;  5IIF A;  1IW7 C;  1QZH A;  3CU7 A;  3W1B A;  1O7Y A;  4BBR B;  5EQ0 A;  1C7Y A;  1KDA A;  1RJT A;  5K36 H;  1NMF A;  2RCN A;  4IUU A;  4DR3 L;  2R92 H;  4PNY A;  3D31 A;  3H0G B;  2RDG A;  3NP8 A;  2JSO A;  4R8I A;  4X6A H;  2A19 A;  3CCS A;  3C46 A;  4IFD I;  4ZKB B;  1EZ8 A;  2B2V A;  4PMC A;  2AQ2 B;  4A3I H;  2QF7 A;  3A8I E;  5I9O A;  4BY7 G;  5IGC A;  5EPL A;  1CK1 A;  1FYC A;  4PZ6 A;  3PCO B;  2B2W C;  1JE4 A;  3CHB D;  1PZK D;  1EIG A;  3ERO A;  1PTO C;  4A93 B;  3NEN A;  1FGU A;  2B2T C;  2KHI A;  4C1N K;  2PYK A;  4JI4 Q;  4LWC A;  1EY9 A;  1GO3 E;  5HUR A;  4A3B G;  3S15 B;  4HCS A;  2IPK D;  4NMZ A;  3NE5 B;  5DM6 3;  2IHE A;  4A3F B;  1VQ8 A;  3K5O A;  2A68 D;  1LV9 A;  2N8N A;  4QB4 A;  5D3I B;  2VS1 A;  2L1B A;  3I4N G;  3BJU A;  1EY7 A;  1GUN A;  4JI1 Q;  3RD4 A;  3KLS A;  3S2H H;  2PCF B;  2KVM A;  1UE5 A;  1PH6 A;  3SK5 A;  1BCP B;  2JA6 B;  2Q2U A;  3M4O H;  3M4Q A;  1VQL A;  4DV3 L;  2B63 B;  1AEX A;  4HAE A;  4JI5 Q;  3GTP H;  2PQE A;  1VQE A;  4HCE A;  3BVZ A;  2IHF A;  5GQO A;  1R4Q B;  3ZJY C;  3DEP A;  4QY7 A;  4DNI A;  5M5X B;  2LXJ A;  5IOC A;  3MXP A;  4AH6 A;  1VQ4 A;  1UE7 A;  2OF1 A;  1GUS A;  3HOW H;  2K7V A;  2K33 A;  2J4X A;  4FVM A;  3MZ5 A;  3NBI A;  1A63 A;  3VR6 A;  3OHX C;  1ESF A;  3V05 A;  2K4K A;  4HJ5 A;  3KJO A;  1CSP A;  4ZRZ A;  1Y1W G;  1HZ9 A;  3CQZ H;  4DV5 Q;  1PTO B;  1EY6 A;  4A3I G;  4A3E H;  4A3F G;  2AQ3 B;  1GUW A;  5FO7 B;  4GNX A;  4BA2 I;  3ZYY X;  2UXC L;  4DNT B;  4K0K L;  1XMO L;  4HIK A;  2E2I H;  4HIM A;  1JC7 A;  3NTI A;  3E9I A;  2D0P A;  2LKV A;  2F3V A;  1KQS A;  1Y1V H;  1EIF A;  5FKA C;  4A3B B;  1OXT A;  3BDC A;  3IAY A;  3FDT A;  2M2L A;  3TP7 A;  4C3I B;  1DZ1 A;  3TS0 A;  3HOV H;  1YBY A;  1TVX A;  2M9V A;  1HZA A;  4TVA B;  1BQQ T;  3Q6S A;  2IWH A;  1HH2 P;  2EY5 A;  2QDB A;  1PH5 A;  5I9P A;  1O80 A;  2FIN B;  4IO9 A;  3K81 C;  4A3E G;  4DR5 L;  4IUP A;  2YTX A;  3NXW A;  3SK4 A;  4JYA Q;  5J22 A;  2LS0 1;  1BUV T;  3HOX G;  1KLU D;  3U4V A;  3I4M G;  4NKL A;  1IZ6 A;  2Z8L A;  3BYT B;  4LF8 Q;  2E2J H;  4YCV A;  2NTS A;  4LUV A;  2L55 A;  1H9K A;  2NYZ D;  1XNQ Q;  3N52 A;  5CV8 A;  1STG A;  1WOC A;  5EGT A;  3BDL A;  4YWM A;  4DV6 L;  4NXM Q;  3ND8 A;  4L63 B;  1YNN C;  1X3P A;  1Z9F A;  1AZQ A;  3A5U A;  4JI4 L;  1WCM H;  5EJW A;  1DYQ A;  4BBR G;  2JA9 A;  3K8A A;  1E0B A;  4F8M A;  4JBW A;  3STB C;  2O4X A;  3I4M B;  3J80 c;  2F0U A;  1Z7T A;  1LTS D;  3I8Z A;  4JK1 C;  1ET6 A;  1E1O A;  2AKW B;  3GO5 A;  1NBW A;  2Z4I A;  4M1U B;  2F4I A;  2F0E A;  2ZT9 C;  3V2T A;  3RLO A;  4FF4 A;  3GTQ B;  1B3A A;  1KDB A;  3H91 A;  3NTK A;  1DGS A;  2OEO A;  1FVI A;  4L6T B;  4DR3 Q;  1EZ6 A;  4JW0 A;  4K2K A;  3I4N H;  3KLW A;  4HJA A;  2JA5 G;  4DAY A;  3NQI A;  5ELD A;  3G48 A;  1Q8I A;  1GHK A;  3KK7 A;  1I4P A;  4JPB W;  5C3E G;  4A3B H;  5HGQ A;  4HR7 B;  1XNQ L;  3L3O C;  4GNX B;  1BDO A;  3SEB A;  4L5S A;  3GQB A;  5IWA Q;  3NWS A;  3K57 A;  1O7L A;  5LHY 1;  3F2C A;  1B1Z A;  1HCZ A;  2PMZ B;  3AU7 A;  3SXH A;  1HR0 W;  3JAM E;  2UUC Q;  3T1H L;  5KIX A;  5M5Y H;  1AZP A;  2NVY B;  1AN8 A;  2Z6B A;  2Z9H A;  4JI3 Q;  4BA1 I;  4HJ7 A;  5EPJ A;  1N32 Q;  2VW9 A;  4A3K H;  3OSO A;  4G4K A;  4CDD C;  5C0X J;  5ELF A;  3S1R H;  4O42 A;  1WTO A;  4N8F A;  1PFB A;  4ILW A;  5JJZ A;  3HOY G;  1PRT C;  4DR7 Q;  3EVQ A;  4IPH A;  2JEB I;  2VXW A;  2IY5 B;  1TWH H;  1YHB A;  4P73 A;  3I4L A;  4BXX G;  3DM3 A;  3A5Z B;  4I7Z C;  4PZ7 A;  3I4M H;  5CBE E;  4IUV A;  4ZAI A;  2RBM A;  4JI0 Q;  1U4L A;  5BR8 Q;  1DOM A;  1XJV A;  3GTM B;  1LTA D;  1CKM A;  4PQX A;  3KBX A;  5CV9 A;  1I50 B;  5T1G A;  1V1Q A;  2A69 C;  3RLF A;  4C1N I;  1GUG A;  5JPM C;  3J80 E;  1GUO A;  4XYQ A;  3HEJ A;  4A4I A;  1A8V A;  1BCP C;  2KEC A;  2VZA A;  2OWO A;  4IZ8 A;  5IY0 A;  3MXU A;  2UXB L;  2WAQ G;  1IBK L;  1SJH D;  1EIH A;  4JV5 L;  3K0X A;  1GKH A;  3BS1 A;  4QJF A;  3PIP 3;  3HKZ B;  2B8G A;  1BBW A;  1X54 A;  4A3C G;  4JI5 L;  1JQY D;  2EJM A;  3KF6 B;  4IJL A;  3LWE A;  4JCV E;  4PMW A;  2NZH A;  3DHQ A;  1XTD A;  2YTY A;  4KV6 A;  3OMC A;  4MIU A;  3F2D A;  3T4A C;  1BF4 A;  2NB0 A;  1CFM A;  1JWM D;  4UHV A;  1SYD A;  2NVY H;  1X3G A;  2F52 A;  3SVM A;  1JT8 A;  1XNR L;  2R7F A;  3K0Y A;  5IGD A;  1BXT A;  3EIV A;  3K5L A;  4DR1 L;  1PH1 A;  3OOC A;  4CDE C;  1DJR D;  4J1M A;  4XQQ A;  1YJW A;  4POF A;  1ZKO A;  2TMP A;  4DAV A;  1S5C D;  3S1M H;  1MSH A;  3OMG A;  1K73 C;  2GA4 B;  3W2D A;  1VQO A;  2K04 A;  3PO3 G;  2K75 A;  5M3M H;  5KND A;  2L12 A;  1UWV A;  1D5X C;  3MTS A;  4EQN A;  2V4D A;  4JI8 Q;  4BBR H;  2B29 A;  1EY8 A;  3ERS X;  5F2D A;  1C8C A;  3S17 B;  1STA A;  2R61 A;  4KN4 C;  3FKI B;  1I3Q H;  1K8A C;  2ID0 A;  3GTO B;  4LFC Q;  2BCO A;  1SNP A;  2RCF A;  2UXD Q;  5A35 A;  1I4R A;  5H1S E;  3PIO A;  1NR4 A;  5FLM G;  2EVB A;  3QO2 A;  1S3O A;  4A3J H;  2TSS A;  4B3M L;  3U4Z A;  3NHH A;  2HQL A;  1E2V A;  2YV5 A;  2ASB A;  2JEA I;  1SFO H;  3I91 A;  3P75 A;  2CVR A;  3BVG A;  4A3K G;  1WYD A;  2EE1 A;  1SAP A;  5C44 G;  3FHW A;  3GTG B;  3T56 B;  3S16 B;  2PZU A;  3M9B A;  2A68 C;  3EA6 A;  3O13 A;  3HRZ C;  2WKC A;  2C5C A;  4AQY L;  4DV5 L;  1B53 A;  1S40 A;  3ICE A;  2X69 A;  4AYB B;  4HJ8 A;  2DJF C;  4LW1 A;  1YHA A;  2LXK A;  2ZJP A;  2OTL A;  4KY5 A;  3GTJ H;  4LF5 L;  2O5I C;  2I5H A;  4A3G B;  3OTO L;  2WII B;  2N49 A;  1KAA A;  2VUM B;  4DUY Q;  1LUZ A;  2JN4 A;  1PH3 A;  2EXD A;  2F0J A;  3L2P A;  4IFD G;  5BN4 A;  4RFB A;  5C6A A;  1K8M A;  5FLX L;  2JA5 H;  1WFQ A;  2UXD L;  3MC0 B;  3HP3 A;  3I90 A;  1C48 A;  1ZYR D;  5DAU A;  2O2L D;  5M9O A;  2JJQ A;  3X3M A;  1SMY C;  2ATW A;  1VQ5 A;  3PF5 A;  1IKM A;  3HG9 A;  5AFW A;  2MHV A;  1VF5 C;  2F0V A;  3HKS A;  1G29 1;  2LFN A;  1ONL A;  1HUN A;  4A3L G;  3UI2 A;  3S9W A;  5IP7 H;  2DNE A;  3Q23 A;  1PYB A;  2IT1 A;  1AFP A;  3TBI B;  4A3J G;  3D4D A;  3LGJ A;  1PFS A;  2QGQ A;  2RA4 A;  3K7A H;  5LMN W;  3S1N B;  1Q86 C;  4GN5 A;  4LF6 L;  3U50 C;  2F0P A;  1SND A;  1M90 C;  1DOK A;  5E1F A;  4JVZ A;  4B3R L;  1QZG A;  1VQD A;  4BY1 H;  4NW2 A;  4IOA A;  3RN2 A;  1IBM Q;  3R3O A;  1QVC A;  3E0J A;  4QCL A;  1JOR A;  2LY7 A;  2G9H D;  1ENF A;  2E2I B;  3PUZ A;  2K50 A;  4YCW A;  1HTL D;  5D65 A;  3UDI A;  4GKK Q;  4DV0 Q;  1U4R A;  1VQF A;  4RCO A;  3CXC A;  2F0N A;  3TRE A;  1WD0 A;  4LF5 Q;  1MIU A;  1G51 A;  1J5E L;  5GAG C;  1A2T A;  3QG1 A;  4GZY C;  1D1I A;  4XT1 B;  1YZ6 A;  3HOV B;  1JOQ A;  1T9H A;  4PV1 C;  2MUY A;  4XIG S;  5COY A;  1GD7 A;  1S5F D;  3S2D B;  2WAQ E;  4LNQ A;  1Z6H A;  2QEX A;  3NWT A;  4TRD A;  5BR8 L;  2JA8 G;  5JVG 3;  2BH8 A;  4B3M Q;  1CTM A;  1MD2 D;  5M3F G;  2VQF Q;  4RHR A;  1YJN A;  1K8G A;  4KKS A;  4A3F H;  1V8Q A;  4OX9 L;  2R93 B;  3NK9 A;  1ILP A;  4WJW A;  2AUJ D;  1ROD A;  3FPP A;  4FO2 A;  4HJ9 A;  4FNF A;  2V1C C;  1KAW A;  3KF6 A;  1VF7 A;  1L2F A;  2YYZ A;  2PZT A;  2NZO A;  1E24 A;  1DD2 A;  3L9A X;  2PPB C;  4DNR B;  5COR A;  1QCB D;  2HIV A;  2K5H A;  2VB2 X;  4R4Q A;  1YHQ A;  3BZK A;  2K01 A;  1SYF A;  2VB3 X;  2WP8 J;  3BU2 A;  3C2P A;  1SN8 A;  2NN6 I;  2BE5 C;  1TWF B;  1Y14 B;  2C9O A;  3OW7 A;  2F0S A;  2Q8I B;  4B9W A;  1EWC A;  1YJ9 A;  2GVA A;  3Q0A A;  4OON A;  2VL6 A;  2K1B A;  2CKZ B;  2A73 B;  3S2D H;  1UAP A;  2IX3 A;  1STE A;  4OEL B;  2XWJ B;  3CC7 A;  5C4X G;  2CFM A;  2N3S A;  4IJH A;  4E6I A;  2AWN A;  1PV4 A;  4ODG A;  3M4Y A;  4LMQ D;  5C5M A;  4DV0 L;  1XNR Q;  1LM0 A;  2R93 H;  4DF7 A;  4TSS A;  1VQB A;  2OTJ A;  4DR4 L;  1EY4 A;  4RGN A;  1WCM G;  3MXN A;  4I7A A;  2FFK B;  1KXL A;  1OTC A;  5K36 G;  5FLX c;  3NTH A;  3HFZ B;  1K8O A;  1KD1 C;  1GHJ A;  3H94 A;  1AE2 A;  1W6K A;  3EN2 A;  3QB3 A;  1PTO H;  2SOB A;  3MAQ A;  1QVF A;  2X6G A;  3FPU B;  1NR2 A;  3NPP A;  1PH2 A;  1VQA A;  4LFA L;  1EOT A;  3HOY B;  1ZXT A;  5LMU Q;  2NWG A;  3MHB A;  2B8F A;  2WIN B;  1JOK A;  3NBH B;  3I55 A;  4KY7 A;  3QWN A;  1MKH A;  1CI3 M;  2OT2 A;  3A7A B;  3STB D;  5FOB B;  4EGV A;  1EWH A;  4MTK A;  3PO2 G;  3A8K E;  3I7F A;  1IBK Q;  3CCL A;  4K5X A;  3D4R A;  1A6X A;  1N9W A;  2ALY B;  1W3S A;  5JOB A;  4CJ1 B;  4B08 A;  4JOI A;  4BBS G;  3CME A;  1G6P A;  1VQ9 A;  1HQR D;  4GNX C;  1U9R A;  1WTR A;  5KRU A;  4QIW B;  5M5W H;  5ELB A;  1WTP A;  4CBV A;  1BNZ A;  1SRO A;  2EDG A;  2FXQ A;  3V96 A;  3E5S A;  2EYO A;  3NSW A;  1DCZ A;  4A3M B;  1K0R A;  5C3E B;  3OWF A;  4CDF C;  2B39 A;  4KMU C;  4ZUJ A;  2CWA A;  5E4W C;  1JR0 D;  2ZTE A;  3WOE A;  1E22 A;  1X56 A;  3KYH C;  2MP1 A;  2AWO A;  4UP9 A;  3CCU A;  2D9U A;  4YY3 L;  3NUC A;  4C3J G;  4BS9 A;  1AE3 A;  1WCM B;  3X3N A;  1HZB A;  1ASY A;  2EPB A;  2UUC L;  3SK6 A;  1QVG A;  2XGT A;  1K0S A;  2KQ3 A;  2F0D A;  2OXP A;  2JE6 I;  2QW7 A;  4LFB L;  3VR4 A;  3HGB A;  4KTA A;  1HQM C;  4A76 A;  2HHH Q;  4DV7 Q;  3UDG A;  4FP5 D;  3RUZ A;  4DAM A;  4IFD J;  3BYY B;  4BY7 H;  3TME A;  4GOP C;  1L1O C;  4DV2 Q;  1HR0 L;  2BDO A;  1A3T A;  1NE3 A;  4V0B A;  4JI6 L;  1C9O A;  3AB9 A;  4R8N A;  3DUZ A;  4DKA C;  1G8Z D;  3CD6 A;  2KED A;  1EEF D;  4RGM A;  3PO3 H;  1H95 A;  2K28 A;  2A6E C;  1I6H H;  1S5B D;  5C3W A;  1VQ6 A;  1EYC A;  1QWY A;  2R6G A;  5ELC A;  1UE6 A;  1F2M A;  2J7Z A;  3OYY A;  3GTP B;  1SYB A;  1UEA B;  3KBG A;  4UP8 A;  1LT3 D;  4R4C A;  2EY1 A;  4GN4 B;  4R4T A;  2PW5 A;  4OEM B;  5DM7 3;  2UU9 Q;  3TEH B;  1XXG A;  1PTO D;  3HOX H;  4HTH A;  2ICI A;  4PZ8 A;  2M00 A;  2HDM A;  3S17 H;  3W5O A;  4YCU A;  1WTX A;  4OO1 I;  3CQZ B;  4FYD A;  1C4Q A;  4DUZ L;  3AMU A;  1F2L A;  1B3Q A;  1EYA A;  4HMJ A;  4K2L A;  5JJK A;  4O0A A;  1WTV A;  3ER0 A;  2IX0 A;  2E5L L;  4EQP A;  4HSV A;  5FLM H;  1SYG A;  1IXR A;  4DV6 Q;  1Y1V B;  4LAA A;  1PTO F;  4DV1 L;  3EJI A;  3CPF A;  1I4H A;  3PUV A;  4DK6 C;  2WFW A;  1AP0 A;  3DXJ C;  2JA6 G;  3J7Z C;  1ASZ A;  2OCE A;  3CF5 A;  1HFN A;  1Y1W B;  1BCP D;  2N88 A;  3MWY W;  1EFI D;  3M85 A;  4DR5 Q;  3LWU A;  1VS0 A;  1JB3 A;  2Y0S E;  4RGO S;  1CZW A;  1HNZ Q;  1SDF A;  2NVX H;  2VUM H;  1A0I A;  1SBB B;  2K6A A;  3GV3 A;  3KLS X;  4KHZ A;  3J7A 5;  4J15 A;  2LSS A;  5AJ3 L;  5IT9 L;  1L0Y B;  3GTJ B;  1EOV A;  4AIM A;  3FMC A;  2DUD A;  2DY8 A;  2PQA A;  3OTO Q;  2E74 C;  1X9N A;  3BG3 A;  4Q5V A;  4EX5 A;  5IP7 G;  2B2V C;  1TS3 A;  5KNB A;  2XN9 C;  2HQE A;  1U4M A;  2HCI A;  4DV4 Q;  5LL6 S;  4X64 Q;  5C0X G;  3QJY A;  4J8Q A;  5J3B A;  4KD3 A;  1B9N A;  4A3G G;  3ULL A;  4CHT B;  1IKL A;  4WJ3 M;  3MA2 B;  3VDY A;  2MPM A;  1YEZ A;  2QKI C;  1LAC A;  3CCM A;  5IYB G;  1LTB D;  1YNJ D;  1OO9 B;  1QOH A;  3R93 A;  4DXG A;  2N55 A;  5LL6 X;  2K5N A;  4IQZ A;  5EBC A;  3CKI B;  3IRB A;  5DLQ E;  1EWI A;  3HOZ H;  2R7D A;  3S1Q H;  4LFB Q;  3S2H B;  3OIP A;  3M4P A;  1FR3 A;  3GTQ H;  1WI5 A;  1JJ2 A;  3BZD B;  1X65 A;  2JXM B;  3F2B A;  2K5D A;  1TWA H;  4DAP A;  2B63 H;  2L15 A;  4WJ4 A;  5IYB H;  1TWC B;  3S1M B;  3UDX A;  4GLV B;  4DR7 L;  1DOL A;  1SNC A;  4OX9 Q;  2B3G A;  2PI2 A;  5I2X A;  4KKT A;  1N33 L;  2FMM A;  3PO2 H;  1RIP A;  1Q12 A;  4DXF A;  2F0F A;  4L8J A;  1CM9 A;  5ELO A;  1Y1W H;  3UE1 A;  4N8X 1;  2RHQ B;  3K5M A;  3AEV A;  5CR3 A;  5T1I A;  1EEI D;  4U68 A;  2Z1C A;  4DR1 Q;  4RCN A;  3RLN A;  3U9S A;  3T1H Q;  2ZJQ A;  5L37 A;  4KJO A;  4RKL A;  1STN A;  1TII D;  5A2Q L;  2I0Q A;  4IPD A;  1JWS D;  5C4J H;  3VYR A;  2ZXP A;  4DN4 M;  1P8L A;  4MZ9 A;  2KEE A;  4XXE A;  1VQH A;  2XTI A;  4N9T A;  1CZG A;  4K5W A;  5M3M G;  5I2Y A;  4P74 A;  4XQJ A;  1EYD A;  3H3V C;  2KEN A;  1QUQ A;  2EYJ A;  3H0G G;  5BN3 A;  4A3D B;  1HTP A;  2H5X A;  3PSI A;  4JG2 A;  1IYJ B;  1QE6 A;  1UE1 A;  4FXK C;  1BBU A;  2QCP X;  3FP9 A;  1RTN A;  5G3L F;  1LTL A;  2K5W A;  5EBD A;  1O78 A;  4GKK L;  5EKL A;  1IBM L;  1CHQ D;  4RMF A;  1W6J A;  1U4P A;  4S3S A;  2JA7 H;  1X32 A;  1Y8P B;  1C0A A;  3T16 A;  1Z47 A;  4LF7 Q;  4NXM L;  4DK0 A;  3JAM i;  1JOO A;  4DK3 C;  4DV1 Q;  4C2M B;  4A3G H;  2R92 B;  3RR5 A;  1WVL A;  1GJX A;  4EQ5 A;  4JC0 A;  3F2U A;  4A3C H;  4GOP B;  1EYG A;  1I4Q A;  3SE0 A;  5KYI A;  1WTH A;  3CAM A;  3HOZ G;  1HNX Q;  2RSO A;  4ZUI A;  4C3H G;  4DR2 Q;  5TSS A;  2RVL A;  5HY6 A;  1IW7 D;  4UPA A;  3SHL A;  5FK9 C;  2R92 G;  4OHJ A;  3CCJ A;  4HED A;  3A0J A;  3VR5 A;  4HN7 A;  2E2D C;  3GDE A;  3S15 H;  4DU9 A;  1BVS A;  3VA7 A;  1PRT D;  1GVP A;  3MFG A;  3Q24 A;  1N32 L;  5IT9 c;  2SNM A;  4K6D A;  5ELE A;  3CCE A;  5D3D A;  5JVH 3;  4FDB A;  2F0I A;  1K3B C;  1PXU A;  1VQG A;  2EJF C;  5ELN A;  4O1N A;  2N78 A;  3GD7 A;  1XTC D;  4C2M H;  2PO4 A;  5E7N A;  4F87 A;  3PGZ A;  1PZJ D;  1L0X B;  2WV6 D;  2R7Z G;  4X3T A;  2NBF A;  5K5P A;  1X3Q A;  1STY A;  4WFN 3;  3D3R A;  2ZJR A;  3I4N B;  2NVX B;  1B4O A;  1A15 A;  1E2Z A;  2Q8T A;  3AFP A;  2AQ1 B;  2KHJ A;  3FKI H;  1EFW A;  2EQS A;  4LF7 L;  1I3Q B;  4CGY B;  1HXY D;  3GP7 A;  4DFA A;  2ZM6 Q;  3KFU A;  1HJP A;  2FHT A;  4KK7 A;  1O7Z A;  2A6H D;  2R7Z B;  2AUK A;  1BO0 A;  5M5W B;  5CV6 A;  1L1O B;  3RZO B;  3J81 j;  1T5X D;  2VQE Q;  1EY0 A;  1JMC A;  2EXZ A;  2ZTC A;  4DR6 Q;  3S24 A;  3JC6 6;  1N36 Q;  3HKZ G;  4NB3 A;  2RQX A;  1B50 A;  5CV7 A;  4JOI C;  2L11 A;  1EQQ A;  3PV0 A;  4C56 C;  1Q46 A;  4A3L H;  1PYW D;  5IYD H;  3HOU G;  2BE5 D;  2F0G A;  2XWB B;  3A7L A;  3HZX A;  2BH2 A;  1OXV A;  2HT1 A;  2IX1 A;  2CH4 A;  3SR1 A;  4DK1 A;  1H9S B;  4XDX A;  5KEE A;  5G3L D;  3K58 A;  2HUG A;  5EPK A;  5JEA J;  5KYL A;  5IP9 H;  2RDH A;  1D8L A;  1S5E D;  1YNX A;  2RHS B;  3A74 A;  3TSS A;  3IKJ A;  3W3A A;  1HNW L;  4JI1 L;  3AYH B;  1U0L A;  1J6Q A;  2JA5 B;  4M8A A;  2EJG C;  3PO3 B;  1I50 H;  1CSQ A;  2K5V A;  2AHO B;  1SE2 A;  2D5D A;  4OXP A;  2PNR C;  4DV2 L;  1HR0 Q;  4X3K A;  1Q90 A;  4ZK9 B;  4IUQ A;  2K03 A;  2JA8 H;  4KLK A;  2B2U C;  3GV6 A;  2F03 A;  2CWP A;  5J39 A;  2WB1 E;  1MBY A;  4R4O A;  1JIC A;  3ULJ A;  5IT9 E;  3H3V I;  4KY6 A;  1V1O A;  2F0W A;  5GRO A;  1CKN B;  3PQI A;  2E2J B;  4MN3 A;  4OO1 H;  1RTO A;  2I46 A;  2XSC A;  4LUO A;  3C1E A;  1G2S A;  2A6E D;  5LMN L;  2IW3 A; 
#chains in the Genus database with same CATH homology
 1N9W A;  1Q8K A;  2ALY B;  1W3S A;  2JA9 A;  3K8A A;  4JOI A;  3KJP A;  1EIY B;  3CME A;  4BBS G;  1IBL L;  4GN3 B;  4JBW A;  1VQ9 A;  3STB C;  1G6P A;  1E1T A;  4GNX C;  4O2D A;  1V9P A;  3J80 c;  5JEA G;  1KC8 C;  1N34 L;  1NY4 A;  5M3F H;  5M5W H;  5GAE C;  4UY8 C;  2R7Z H;  1SRO A;  1E1O A;  5FJ8 H;  2AKW B;  2FXQ A;  3GO5 A;  1NBW A;  1I5F A;  3NEM A;  1A62 A;  2JA7 G;  4JI7 Q;  1K0R A;  1EQR A;  5IYC H;  4P75 A;  1X3F A;  3RLO A;  4X64 L;  3GTO H;  2CWA A;  4GLX A;  2ZTE A;  4YHH L;  1DGS A;  1FVI A;  5LMN Q;  4DR3 Q;  1E22 A;  1X56 A;  3KYH C;  3I4N H;  4X66 L;  3KLW A;  2AWO A;  4UP9 A;  1VQC A;  3CCU A;  1QUQ B;  2UUA Q;  4YY3 L;  5JJI A;  2BA1 A;  4QQB X;  4HJA A;  1SR3 A;  3CPW A;  1AE3 A;  3HKZ E;  2JA5 G;  1KL9 A;  4L5R C;  4B3T L;  1VQJ A;  3MEF A;  4X62 L;  4B3R Q;  3G48 A;  3TRZ A;  1Q1B A;  1HZB A;  2Z6K C;  1B7Y B;  4R4I A;  1ASY A;  1JJG A;  2CCZ A;  2UUC L;  1QVG A;  2XGT A;  5C3E G;  4A3B H;  5HGQ A;  2JE6 I;  1HNZ L;  1XNQ L;  3K7U C;  4GNX B;  4DV3 Q;  4LFB L;  4GS3 A;  4P72 A;  2HHH Q;  2Q2T A;  4A76 A;  5IWA Q;  4L5S A;  5C4X H;  3TS2 A;  1TXY A;  4DV7 Q;  1V43 A;  3UDG A;  4OWT B;  2NVT H;  4R1J A;  4B3S Q;  4DAM A;  3F2C A;  3J81 i;  4IFD J;  2JQO A;  3BZC A;  4BY7 H;  3L0O A;  4GOP C;  1PHJ A;  1L1O C;  1HR0 W;  4DV2 Q;  1HR0 L;  4BXX H;  4IPG A;  3PIP A;  3H15 A;  3Q8D A;  1NE3 A;  4ALP A;  2MQH A;  3T1H L;  2UUC Q;  4DR4 Q;  2CQO A;  4JI6 L;  1C9O A;  5M5Y H;  4DR6 L;  1WJJ A;  4DKA C;  3CD6 A;  2F3I A;  3PO3 H;  2UXB Q;  1H95 A;  4JI3 Q;  4BA1 I;  5EAY A;  4HJ7 A;  2PNH A;  1I6H H;  1N32 Q;  1VQ6 A;  3H3V H;  2VW9 A;  4B3S L;  1JE5 A;  4A3K H;  1XPO A;  2R6G A;  4X66 Q;  5C44 H;  1UE6 A;  3B6Y A;  3OYY A;  5C0X J;  3S1R H;  4LF4 L;  4JV5 Q;  1SE8 A;  3HOY G;  5JJL A;  1XMQ Q;  3KF8 B;  4UP8 A;  4X62 Q;  4DR7 Q;  1KHI A;  4R4C A;  3M3Y H;  4IPH A;  2JEB I;  4GN4 B;  2IY5 B;  4R4T A;  1B8A A;  4PG3 A;  1TWH H;  1YHB A;  4P73 A;  1JJC B;  2UU9 Q;  4BXX G;  3DM3 A;  3TEH B;  1PH7 A;  1W2B A;  1K9M C;  3A5Z B;  4NPS A;  2E5L Q;  4PZ7 A;  4LF9 Q;  3E9H A;  4JBJ A;  1NMG A;  5GAD C;  3HOX H;  1HNX L;  3I4M H;  3PF4 A;  1IBL Q;  4PZ8 A;  4JI0 Q;  3CP0 A;  3KDF A;  4OWW B;  5BR8 Q;  1XJV A;  1TWF H;  3S17 H;  2D62 A;  3W5O A;  4A3C G;  1D7Q A;  4YCU A;  2YTV A;  1Q81 C;  1CKM A;  3I2Z A;  4OO1 I;  1M1K C;  2K14 A;  1MJC A;  4C3H H;  4DUZ L;  1V1Q A;  4JI7 L;  5JJK A;  4O0A A;  2Q2H A;  3RLF A;  3G4S A;  1OXS C;  1PYS B;  3ER0 A;  3KOJ A;  2IX0 A;  1X3E A;  2E5L L;  5FLM H;  4JI3 L;  4A4I A;  1IXR A;  1A8V A;  3JAM c;  3FKI G;  4DV6 Q;  1XMQ L;  4A93 G;  4JI8 L;  1PH4 A;  2VZA A;  2OWO A;  4A93 H;  5IY0 A;  4DV1 L;  2UXB L;  2WAQ G;  3CPF A;  1IBK L;  3GTL H;  3PUV A;  5FJ8 G;  3M7N A;  3CW2 C;  2F4V Q;  3HOU H;  4DPG A;  5AJ3 Q;  4DK6 C;  4JV5 L;  3K0X A;  3RZD H;  2WFW A;  2JA6 G;  1VQ7 A;  1GKH A;  1SLJ A;  3J7Z C;  1ASZ A;  2OCE A;  4QJF A;  4LFC L;  2E2H H;  3CF5 A;  4DV7 L;  1BBW A;  1NTG A;  1X54 A;  4JI5 L;  4IJL A;  4JCV E;  3KF6 B;  4PMW A;  1YI2 A;  2UUB Q;  3M85 A;  2NZH A;  1VS0 A;  1XTD A;  2Y0S E;  2YTY A;  4DR5 Q;  1HNZ Q;  3J81 c;  2NVX H;  2VUM H;  1A0I A;  1PH8 A;  3J7A 5;  4KHZ A;  4J15 A;  3F2D A;  2LSS A;  4JI6 Q;  3CC2 A;  5AJ3 L;  3HOV G;  4LF8 L;  3E0E A;  1EOV A;  4GOP A;  4AIM A;  2DUD A;  2NN6 G;  2NVY H;  2PQA A;  4AYB E;  3OTO Q;  5IE8 A;  1HZC A;  4AQY Q;  1VCI A;  1X3G A;  2F52 A;  4A3M G;  1VQM A;  1X9N A;  2UUB L;  4EX5 A;  2R93 G;  1XNR L;  2R7F A;  5IP7 G;  1MJE A;  1PVO A;  1J5E Q;  1KRT A;  1S72 A;  1FJG L;  3EIV A;  3AQQ A;  4A3D H;  4DR1 L;  1PH1 A;  4LF4 Q;  2Z0S A;  4DV4 Q;  4A3D G;  4X64 Q;  5C0X G;  3CCV A;  1N8R C;  1YJW A;  2Z6K A;  5J3B A;  4POF A;  2JK8 A;  4HID A;  4A3G G;  3F8T A;  1NJI C;  3WWV A;  1P16 A;  3ULL A;  2GN5 A;  1B70 B;  5IYD G;  3S1M H;  4X65 L;  3NEL A;  4WJ3 M;  3VDY A;  1K73 C;  1YEZ A;  4YWK A;  1VQO A;  1L0W A;  4IOC A;  2VY3 A;  3PO3 G;  2I5L X;  3CCM A;  1K3R A;  5IYB G;  2K75 A;  4LF9 L;  5M3M H;  4MTN A;  1L1O A;  1UWV A;  2EIF A;  2PQA B;  2RF4 A;  4QL5 A;  2UXC Q;  1YVC A;  2NVQ H;  2K5N A;  3RN5 A;  4JI8 Q;  4BBR H;  3S14 H;  3IRB A;  2B29 A;  3K80 C;  3ERS X;  5DLQ E;  1EWI A;  2MFI A;  3TQY A;  3KDF B;  5GAH C;  3HOZ H;  1UEB A;  2R7D A;  3S1Q H;  4LFB Q;  1VQN A;  4YWL A;  2BA0 A;  4K0K Q;  3RNU A;  3M4P A;  1I3Q H;  1Y1V G;  1K8A C;  2ID0 A;  3GTQ H;  4LFC Q;  1WI5 A;  3ULP A;  2OQK A;  4Y7N H;  3OW2 A;  1JJ2 A;  3CC4 A;  4A3M H;  4NXN Q;  2UXD Q;  4YHH Q;  4TQU S;  1X65 A;  1LYL A;  5H1S E;  2ZM6 L;  1VQP A;  3PIO A;  5FLM G;  3F2B A;  1S3O A;  1TWA H;  3GTG H;  3S16 H;  3PUY A;  4A3J H;  2MO1 A;  2A1A A;  4B3M L;  3U4Z A;  2B63 H;  2L15 A;  4WJ4 A;  2HQL A;  3PUW A;  5IYB H;  2YV5 A;  1SMX A;  2ASB A;  2JEA I;  1TWG H;  3UDX A;  4GLV B;  1IL2 A;  4DR7 L;  1SFO H;  3G71 A;  4LF6 Q;  1FL0 A;  2VUM G;  4A3K G;  2B3G A;  1KRS A;  2PI2 E;  2PI2 A;  1WYD A;  4QGU A;  4DV4 L;  1N34 Q;  4OX9 Q;  1N33 L;  5C44 G;  3FHW A;  3PO2 H;  2UU9 L;  1RIP A;  3SGI A;  3M9B A;  1Q12 A;  4GLA C;  4JBM A;  4AQY L;  5ELO A;  4DV5 L;  2MO0 A;  1Y1W H;  3UE1 A;  4LFA Q;  2RHQ B;  1S40 A;  4MNO A;  2A8V A;  3AEV A;  2DGY A;  3ICE A;  4HJ8 A;  4LW1 A;  1YHA A;  4OWX B;  3RLN A;  4DR1 Q;  1PH9 A;  4XTC S;  3T1H Q;  2LXK A;  4DAY B;  3I56 A;  2ZJP A;  3EBE A;  1VQK A;  3GTJ H;  3UDF A;  2OTL A;  2ZJQ A;  1VQI A;  1I94 L;  4B3T Q;  2ZTD A;  4JBK A;  4LF5 L;  2I5H A;  4JI2 Q;  1Q1E A;  1E3P A;  3OTO L;  2I0Q A;  2N49 A;  4IPD A;  2UUA L;  1CKN A;  5C4J H;  4DUY Q;  1LUZ A;  1PH3 A;  3GTM H;  2EXD A;  4KHP L;  1P8L A;  3CCQ A;  3UE0 A;  4MZ9 A;  4C3J H;  3L2P A;  1YIT A;  2ES2 A;  4RG1 A;  4IFD G;  4DR2 L;  1VQH A;  2JA5 H;  2XTI A;  1WFQ A;  2UXD L;  5M3M G;  4P74 A;  4QIW E;  1FJG Q;  2JJQ A;  2KEN A;  1QUQ A;  3HOW G;  3H0G G;  2HHH L;  2ATW A;  1CUK A;  3D0F A;  1VQ5 A;  2H5X A;  3PSI A;  4JG2 A;  3PF5 A;  1IYJ B;  1UE1 A;  2GVB A;  4APV A;  4JYA L;  1BBU A;  3FP9 A;  2AMC B;  3HKS A;  2D0O A;  1LTL A;  1G29 1;  4ME3 A;  1QZH A;  3W1B A;  4POG A;  4A3L G;  3H0G H;  4GKK L;  1K83 H;  1IBM L;  4RMF A;  5IP7 H;  2JA7 H;  1C7Y A;  1C0A A;  4YY3 Q;  1PYB A;  1Z47 A;  2IT1 A;  4LF7 Q;  2KCM A;  4A3J G;  2C35 B;  3LGJ A;  1NMF A;  4NXM L;  1PFS A;  2QGQ A;  2RCN A;  3K7A H;  3JAM i;  5LMN W;  4DR3 L;  2R92 H;  4DK3 C;  4DV1 Q;  1Q86 C;  3D31 A;  3CCR A;  4GN5 A;  4LF6 L;  4A3G H;  3RR5 A;  3U50 C;  4X6A H;  2A19 A;  1M90 C;  1U5K A;  2KBN A;  3CCS A;  4IFD I;  4EQ5 A;  4JC0 A;  4B3R L;  1QZG A;  4A3C H;  4GOP B;  1VQD A;  4BY1 H;  1XPU A;  4IOA A;  1EYG A;  4BY7 G;  3F1Z A;  3RN2 A;  1XMO Q;  4PZ6 A;  1IBM Q;  3L7Z C;  3PCO B;  1QVC A;  3CAM A;  3I4O A;  2K52 A;  3T1Y Q;  3HOZ G;  1HNX Q;  4H02 A;  1CKO A;  3NEN A;  1X6O A;  4DR2 Q;  1FGU A;  3HOY H;  2KHI A;  5HY6 A;  4UPA A;  4JI4 Q;  3PUZ A;  2K50 A;  4LWC A;  4YCW A;  2R92 G;  1GO3 E;  4A3B G;  3UDI A;  4GKK Q;  3CCJ A;  4A75 A;  3A0J A;  4DV0 Q;  2IHE A;  1VQF A;  3CXC A;  1VQ8 A;  3GDE A;  3S15 H;  3TRE A;  1BVS A;  2B63 G;  1E7Z A;  1RL2 A;  4LF5 Q;  1MIU A;  1GVP A;  2N8N A;  1N32 L;  1G51 A;  4P71 A;  5IT9 c;  1J5E L;  5GAG C;  2VS1 A;  3CCE A;  3I4N G;  3BJU A;  4FDB A;  2JA6 H;  1YZ6 A;  4JI1 Q;  3S2H H;  1VQG A;  1I94 Q;  2HIX A;  2WB1 G;  4JI2 L;  1T9H A;  1UE5 A;  1PH6 A;  4XIG S;  5ELN A;  2N78 A;  3GD7 A;  3U58 A;  1GD7 A;  4C2M H;  2WAQ E;  4LNQ A;  2Q2U A;  5E7N A;  3M4O H;  5C3E H;  2QEX A;  1SRU A;  3M4Q A;  3PGZ A;  5M5X H;  1N36 L;  1VQL A;  4DV3 L;  3AFQ A;  5BR8 L;  2JA8 G;  2VNU D;  2R7Z G;  4JI5 Q;  3GTP H;  2BH8 A;  4B3M Q;  1VQE A;  3G6E A;  5M3F G;  2IHF A;  5GQO A;  2VQF Q;  2VQE L;  1YJN A;  1K8G A;  4GKJ Q;  3ZJY C;  2ZJR A;  4A3F H;  4BBS H;  1X55 A;  2KCT A;  4QY7 A;  4OX9 L;  4DNI A;  2LXJ A;  1XPR A;  1Q82 C;  3AFP A;  4AH6 A;  3PUX A;  1VQ4 A;  3GTK H;  1UE7 A;  1HNW Q;  2KHJ A;  3FKI H;  1EFW A;  2EQS A;  4LF7 L;  1R9T H;  4HJ9 A;  2V1C C;  4DUZ Q;  1Q7Y C;  1KAW A;  3KF6 A;  2PMZ E;  2ZM6 Q;  3HOW H;  2Q2I A;  1L2F A;  1HJP A;  4AYB G;  4KI0 A;  2YYZ A;  3KFU A;  4JI0 L;  5C0X I;  2NZO A;  3T1Y L;  1E24 A;  1A63 A;  2K4K A;  1L1O B;  4HJ5 A;  3J81 j;  3KJO A;  1CSP A;  2VQE Q;  2HIV A;  2K5H A;  4NXN L;  1HZ9 A;  3CQZ H;  4R4Q A;  1Y1W G;  4UP7 A;  3BZK A;  4DV5 Q;  1OXX K;  2WP8 J;  3BU2 A;  4X65 Q;  1YHQ A;  1JMC A;  1SN8 A;  2NN6 I;  3CMA A;  2ZTC A;  4A3I G;  4A3E H;  3S24 A;  4A3F G;  1Y14 B;  1PA6 A;  4DR6 Q;  3JC6 6;  1N36 Q;  3HKZ G;  4NB3 A;  4GNX A;  4BA2 I;  1N33 Q;  1TWC H;  2UXC L;  4K0K L;  1YJ9 A;  2GVA A;  4JOI C;  4OON A;  2VL6 A;  3MXN B;  2CKZ B;  2MNA A;  5LMU L;  4HIK A;  4LUZ A;  3PV0 A;  1XMO L;  1EQQ A;  2E2I H;  4GKJ L;  1Q46 A;  5IP9 G;  4HIM A;  3S2D H;  3J80 i;  4A3L H;  3E9I A;  3HOU G;  5IYD H;  4DUY L;  2BH2 A;  2IX1 A;  1OXV A;  2HT1 A;  5IYC G;  4C3I H;  4KHP Q;  4IPC A;  1YIJ A;  2D0P A;  3CC7 A;  5C4X G;  2CFM A;  2N3S A;  4IJH A;  2AWN A;  1PV4 A;  1EUJ A;  1KQS A;  3W1G A;  1Y1V H;  1EIF A;  5JEA J;  5IP9 H;  1OXT A;  1D8L A;  1YNX A;  2RHS B;  3A74 A;  2VQF L;  4DV0 L;  1XNR Q;  1LM0 A;  2R93 H;  3TS0 A;  1VQB A;  1HNW L;  3HOV H;  2E8G A;  3AYH B;  1YBY A;  1U0L A;  4JI1 L;  4TVA B;  1HZA A;  4DR4 L;  2OTJ A;  1J6Q A;  3S1N H;  1JT8 A;  1WCM G;  3DLL A;  1OXU A;  1I50 H;  1CSQ A;  2K5V A;  1KXL A;  1OTC A;  5K36 G;  2AHO B;  2Y0S G;  1HH2 P;  5FLX c;  3RZO H;  1PH5 A;  4OXP A;  4DV2 L;  1HR0 Q;  3HFZ B;  4IO9 A;  4A3E G;  4A3I H;  3K81 C;  1KD1 C;  4DR5 L;  1KIX A;  1AE2 A;  2YTX A;  2JA8 H;  4KLK A;  1JB7 A;  4JYA Q;  4OO1 G;  3EN2 A;  1QVF A;  3HOX G;  3U4V A;  2CWP A;  3I4M G;  1IZ6 A;  5IWA L;  2WB1 E;  1PH2 A;  4LF8 Q;  1VQA A;  4R4O A;  2E2J H;  3ULJ A;  4YCV A;  2OQ0 A;  4L5T A;  4LFA L;  4LUV A;  5LMU Q;  3H3V I;  4BY1 G;  5GRO A;  1CKN B;  1XNQ Q;  1BKB A;  3NBH B;  4L5Q A;  2F4V L;  3I55 A;  1MKH A;  1O7I A;  3STB D;  1WOC A;  4HIO A;  4YWM A;  4DV6 L;  4LUO A;  4NXM Q;  1GM5 A;  3PO2 G;  1AH9 A;  2YU9 H;  4Y52 H;  2QA4 A;  2I5M X;  3I7F A;  1IBK Q;  3CCL A;  1Z9F A;  3A5U A;  4JI4 L;  1WCM H;  5LMN L;  4BBR G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...