4AQYL

Structure of ribosome-apramycin complexes
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aqyL00
5C3EG 4DKAC 3GD7A 3L2PA 5LMUL 3PF5A 3STBC 3U4ZA 2F52A 5C44H 2JEAI 3ULPA 2UUBQ 3CCEA 4JI0L 5C44G 4A3LH 1NMGA 4GOPC 2EIFA 2DUDA 3NBHB 4A3IG 2ES2A 2L15A 4L5SA 4A3FG 2OCEA 4IJLA 4KHZA 3I4MH 2KHIA 4RG1A 4X6AH 4JI5L 1X65A 1QVGA 3AQQA 3S17H 2E2IH 4DR5Q 4IFDJ 1VQKA 5BR8L 5M5XH 3H15A 1N34Q 2ZJQA 4A3BG 4YY3L 4A3JH 2R6GA 4GLAC 4JOIA 4A3JG 4DV5L 1U0LA 2PQAA 2YYZA 1VQFA 3UDIA 1K8GA 3CC7A 1OXSC 5FJ8H 4LF9L 4X62L 1HR0Q 5IYBH 3MXNB 5C4JH 1KD1C 2JA6G 1D7QA 3KJPA 4JI8Q 3AEVA 3OTOL 4OO1G 3CD6A 3KDFB 4DR7L 1SFOH 2RHQB 2WB1E 2AWNA 4POFA 1N32L 2PQAB 2V1CC 5IE8A 4Y52H 5H1SE 2NVTH 3CC2A 4JI7Q 1CUKA 3CCSA 3J81c 3G6EA 4DV1L 4JI5Q 2MFIA 1CKOA 3ERSX 4C3HH 2NVXH 3K8AA 1E1TA 1BKBA 1BVSA 4LF4Q 3PO2G 5DLQE 1IZ6A 1E22A 2K14A 3UDFA 1Y1VG 5ELNA 2Z0SA 1JJCB 4YY3Q 1Q86C 1VQCA 4IPCA 3H0GH 1PYBA 4DK6C 4A3EG 3CF5A 2UU9L 1HNWL 4ALPA 3GTQH 4UP9A 4GKJQ 1Q8KA 3HOUH 4HIDA 2N3SA 4JI6L 4LFAQ 2R93H 1VQMA 1IXRA 2IY5B 3VDYA 1TWFH 2PNHA 3J7ZC 1YI2A 4NXMQ 4GOPB 3CPWA 1IBMQ 1YZ6A 1A0IA 4BY1H 1X54A 3UDGA 1K0RA 2B29A 1OXXK 4A3GH 5IP9G 3CCRA 2E5LL 4JI1Q 2R92H 4APVA 1XMQQ 1IBLL 3DM3A 2R92G 3GTOH 2CFMA 4YWLA 1NBWA 2ZTDA 3HFZB 3STBD 2CCZA 3PF4A 3SGIA 1A63A 3F1ZA 2F4VQ 1E1OA 2A1AA 4B3SL 1PH5A 2AHOB 4JI3Q 1GO3E 2UU9Q 4UY8C 5IT9c 2K5NA 3CP0A 1UE6A 3NENA 4OO1I 3KF6A 1Q12A 2OQKA 1YJWA 4WJ4A 3CAMA 1Q1BA 4LFCL 1L1OA 2IHEA 4DV4Q 2ZM6L 5FLMH 1PA6A 2UUBL 3A0JA 3W1GA 4P75A 5JEAJ 1PFSA 3CCLA 2HT1A 4L5QA 3JC66 1B8AA 1JJ2A 1I94L 1E3PA 3BZCA 4B3TQ 3E9IA 1VQ8A 2E5LQ 4LUVA 3HOVG 1EYGA 4JI4Q 1VQOA 2VUMH 2UXCL 1QUQB 2KCTA 3OYYA 4OWWB 3S2DH 4DUYL 5J3BA 1MJCA 4B3MQ 2NVYH 4HIKA 4OWTB 4YCVA 3K7AH 1BBWA 2WAQG 4H02A 4X62Q 4DR4L 1Q81C 4JI8L 1N8RC 1SR3A 1KRTA 1UE7A 5GAGC 2ZM6Q 3GTMH 2K5HA 3TRZA 5JEAG 3M4PA 1VQIA 4YWKA 1AE2A 4YCWA 1N32Q 4YWMA 2NN6I 1NMFA 4NPSA 3RLOA 3I4NG 4A93H 4DV7Q 4JC0A 5ELOA 2HHHL 3A5ZB 1FL0A 4OX9Q 1AH9A 1XJVA 5IP7G 4KHPQ 4DR1Q 4TVAB 2A8VA 4DV2Q 3S2HH 4C3IH 3J80c 4JYAQ 1NJIC 4JI4L 2VS1A 4IO9A 1YITA 3JAMi 3BZKA 4DUYQ 2QEXA 4DV6L 3M7NA 3HOYH 4DR4Q 1PVOA 1X3EA 1HNWQ 1GKHA 1B70B 3RN2A 5GAHC 2VW9A 3HOVH 1D8LA 2VY3A 4QY7A 3FHWA 1X6OA 4Y7NH 4PZ7A 1TWHH 1H95A 3K0XA 4LF7L 3LGJA 2EXDA 3B6YA 3PO3G 2Q2IA 3M9BA 3PV0A 4GNXA 1WI5A 3CCQA 2E2HH 2DGYA 3KOJA 4LF8Q 2K5VA 3ULLA 3TS2A 4POGA 2UXDQ 4DPGA 4DR1L 1S3OA 4JG2A 3RLNA 4DR5L 1Y1VH 4X66L 3W1BA 5AJ3L 1LM0A 4R4IA 5BR8Q 1XMQL 1XNRL 3M4OH 5K36G 3K81C 3L7ZC 1L0WA 2R7ZG 2PI2A 2E8GA 1DGSA 2C35B 1JMCA 2OWOA 2VZAA 2XTIA 2F4VL 3HOZH 5EAYA 4YHHL 1YHBA 3HOXG 1I6HH 2PMZE 2MO1A 5IP7H 3F2CA 3RZDH 2UUAQ 3KYHC 2Q2UA 4NXNQ 2KBNA 5IY0A 4P71A 1YJNA 2R93G 1Q1EA 1N33Q 4DR7Q 1VQJA 3W5OA 2Z6KC 4LNQA 3D0FA 1KHIA 2JEBI 1KAWA 1Y14B 1IBKQ 2CWPA 4BBSH 4GKKL 1LTLA 3I7FA 4PG3A 4HJ5A 3PUWA 1X56A 1C9OA 1XPUA 1GD7A 4WJ3M 4B3RQ 3PO2H 2QA4A 3AFPA 5HY6A 2NZOA 3UDXA 1I94Q 4A4IA 3GO5A 3F2DA 4DV3L 2ZTCA 4BY7G 3Q8DA 3PIPA 2GVAA 2B63H 2JJQA 4GOPA 4LF5Q 5M3MH 2K52A 5GADC 3HOUG 5C0XI 4XTCS 3TQYA 2IX0A 1I50H 2IT1A 2Y0SG 4LW1A 5FLMG 1RIPA 2AMCB 1VQ4A 5LMUQ 1PH1A 4AQYL 2BA1A 2LXKA 1AE3A 2CKZB 1KQSA 2KHJA 3MEFA 2JK8A 2LXJA 4IOCA 1HNXL 4NXML 4BA1I 4GKKQ 2JA5H 2JA6H 1PH2A 3S1RH 1TXYA 1HJPA 3J81i 1XNQL 4DAYB 2HHHQ 4LUZA 1VQ6A 1I3QH 1YIJA 2JE6I 4R4CA 4IFDG 3CQZH 3ER0A 1K83H 5IWAL 2VUMG 1MIUA 2K4KA 4HJ8A 3KLWA 1U5KA 1C7YA 5JJKA 4JV5L 4P73A 4LWCA 1ASZA 2UXBQ 3J7A5 1EQRA 1TWAH 4B3SQ 1VQAA 4DNIA 3G71A 4JI3L 1UE1A 4DV0Q 4OXPA 5M5YH 2VQFL 1M1KC 5GQOA 2I5HA 3NEMA 3GTGH 3KFUA 4LF6L 3T1HL 1EOVA 1CSPA 4A3DH 2ZTEA 1EQQA 3F8TA 5FJ8G 3GTLH 2H5XA 4AIMA 2ID0A 3E0EA 1V1QA 3CW2C 3OW2A 1TWGH 4QL5A 3AFQA 3RR5A 4LF8L 1G6PA 3IRBA 3UE0A 4IPHA 1WYDA 2ASBA 1CKNB 1XPRA 2VQEQ 3L0OA 5IWAQ 5AJ3Q 1S40A 1XNRQ 1UE5A 2CWAA 3HKZE 2UUCQ 3G48A 2N78A 2Q2TA 4QGUA 1V9PA 2JA7H 3S1NH 4UP8A 4GN3B 4YHHQ 4DUZL 4JCVE 1I5FA 1NE3A 3T1YL 3EIVA 1SROA 1X3GA 3E9HA 2Z6KA 1NTGA 4A3IH 1XMOL 3J80i 2OQ0A 1L2FA 1HNZQ 3F2BA 1OTCA 4A3FH 1LUZA 1OXTA 1VQHA 1MJEA 4LF6Q 2R7DA 3EN2A 1EIYB 3K80C 4LFAL 4IJHA 3ICEA 2XGTA 4LFBQ 2ALYB 3CPFA 4QJFA 1YNXA 4HJAA 1HZAA 3S1QH 1IBML 4XIGS 1IL2A 4AH6A 4DV7L 2OTJA 4K0KL 2A19A 3M3YH 2YTYA 2D0PA 2Y0SE 5LMNQ 2VQEL 2JA8G 3RZOH 4A3DG 5IYDH 5IYDG 2JA8H 1XTDA 2WP8J 2R7ZH 2CQOA 3A5UA 4X65L 1IBLQ 4JYAL 3ZJYC 4R4QA 1Z9FA 1OXUA 2UUCL 3RLFA 1J6QA 3HOXH 4A3GG 1SE8A 2AKWB 4GNXC 2JQOA 1X3FA 1VCIA 1P16A 1VQBA 2WB1G 1CKMA 4BBRG 3D31A 1EWIA 2F3IA 3FP9A 1V43A 1W3SA 1W2BA 3PUZA 4DAMA 4ME3A 4C2MH 3I56A 1KIXA 4LFCQ 3ULJA 4UPAA 4IFDI 4DV4L 4AQYQ 2D0OA 2HQLA 2LSSA 4O0AA 4MNOA 1Q7YC 1P8LA 4GLVB 4DR6L 2KENA 1A62A 1HNXQ 4RMFA 3RNUA 4O2DA 1FGUA 1SMXA 2Q2HA 2HIXA 2BH8A 1TWCH 1IYJB 1XNQQ 2GVBA 3PUVA 3CCVA 1QZGA 4B3TL 1VS0A 4KLKA 4TQUS 4X65Q 5C0XG 1X55A 3PIOA 1VQ5A 3I4NH 4A75A 1EFWA 3DLLA 1BBUA 3EBEA 3KJOA 4HJ7A 4GS3A 3HOWH 4JI2Q 4DR2L 4GN5A 2UUAL 2I5MX 4BY1G 4GKJL 3GTJH 1N33L 3T1HQ 3FKIG 1YBYA 5FLXc 2N49A 3HKSA 1WCMH 2N8NA 1O7IA 4L5TA 4QIWE 3RN5A 1QZHA 3HOYG 1PH3A 3S16H 4DR6Q 2BA0A 1R9TH 2K50A 3CC4A 1PH6A 1C0AA 1OXVA 3CCUA 1UEBA 5IYCG 1ASYA 3GTKH 3H0GG 2I0QA 1GVPA 4X64L 1LYLA 1NY4A 1HH2P 3H3VI 1PHJA 1Y1WG 5JJIA 4OONA 3BJUA 1Q82C 4OWXB 1N34L 2B63G 5JJLA 1E7ZA 3G4SA 4DV5Q 4DV6Q 2ATWA 1G291 4A3BH 4GNXB 5HGQA 4LF5L 1E24A 1YEZA 3K7UC 4GN4B 4IOAA 1XMOQ 1L1OC 3OTOQ 3TS0A 3PCOB 2JA5G 4HIOA 3M85A 1Q46A 5C3EH 1VQPA 2VNUD 3WWVA 3S15H 2QGQA 1VQEA 1J5EL 1JJGA 1K73C 4A3CH 1MKHA 2B3GA 4BA2I 1VQ9A 4JBWA 4HJ9A 1PYSB 1FVIA 1PH8A 4JI7L 3U58A 3PO3H 1EIFA 1WFQA 4MTNA 1FJGQ 2WFWA 1SRUA 4JBMA 4C3JH 4A3KH 5C4XG 2WAQE 1WOCA 1L1OB 1KRSA 4X66Q 3KDFA 1KL9A 2AWOA 2EQSA 1VQ7A 1S72A 2ZJPA 4HIMA 4AYBG 3CXCA 4JV5Q 1HZCA 2PI2E 4IPGA 5C0XJ 1PV4A 2UXBL 2E2JH 4A3MH 2VL6A 3M4QA 1SLJA 2RF4A 1CKNA 2D62A 4DR3L 4A93G 1JT8A 4JI6Q 1JE5A 3U50C 3CMAA 1QUQA 4BXXG 1JB7A 3UE1A 4JI0Q 4BXXH 1J5EQ 1IBKL 2MO0A 3HOWG 1QVFA 4K0KQ 3S24A 3PUXA 3S14H 2R7FA 2YTXA 4OX9L 3GDEA 3I55A 1G51A 1VQGA 3FKIH 4JI1L 3I2ZA 4PMWA 4DV3Q 4DV2L 1SN8A 4JBKA 3PSIA 2ZJRA 1RL2A 2KCMA 4R1JA 4IPDA 4BBRH 5LMNW 4A3CG 4DUZQ 2OTLA 5IYCH 2I5LX 4P72A 3T1YQ 2YU9H 4EQ5A 2NVQH 4LUOA 1HR0L 4DR2Q 4JI2L 1Y1WH 3I4MG 3CCMA 4FDBA 1HNZL 1GM5A 1K3RA 1EUJA 2HIVA 4PZ6A 2BH2A 5M3MG 3PUYA 4LFBL 4LF7Q 4YCUA 2YV5A 4GLXA 1K8AC 1YJ9A 4A3MG 1VQDA 1A8VA 4JOIC 1Z47A 2GN5A 2JA9A 3KF6B 4X64Q 4DV1Q 5LMNL 1PH9A 3HOZG 2UXDL 4LF4L 4JBJA 4NB3A 5IP9H 3BU2A 2UXCQ 5M3FH 3NELA 2IX1A 1QVCA 5M3FG 2YTVA 2FXQA 4B3ML 3PGZA 5GAEC 1PH4A 1N36Q 4A3LG 3I4OA 2MNAA 5C4XH 4DV0L 4A3KG 1HZBA 2MQHA 2VQFQ 4BBSG 3KF8B 3TREA 1B7YB 4NXNL 5E7NA 2K75A 5GROA 1WJJA 1HR0W 3TEHB 1X9NA 1KC8C 2RHSB 2RCNA 4AYBE 3S1MH 2NZHA 1CSQA 1YHQA 1PH7A 1VQLA 4A76A 3U4VA 1HZ9A 1XPOA 1VQNA 4UP7A 1YHAA 4A3EH 1FJGL 4BY7H 3CCJA 1YVCA 4B3RL 4KHPL 5IYBG 4L5RC 1N9WA 2IHFA 1M90C 4QQBX 3JAMc 3J81j 4MZ9A 3A74A 3AYHB 4EX5A 1UWVA 3H3VH 2NN6G 4DK3C 4P74A 5M5WH 4R4OA 1N36L 3GTPH 1KXLA 3CMEA 4J15A 4LF9Q 2JA7G 1T9HA 1K9MC 4PZ8A 4R4TA 3HKZG 4KI0A 1WCMG 4DR3Q
chains in the Genus database with same CATH superfamily
3GD7A 4B08A 3L2PA 3HRZC 2SDFA 3U4ZA 3S9WA 2EJFC 3FMCA 4B9WA 5C44G 2DUDA 1I4HA 3DHQA 3NBHB 2L15A 3MXNA 1LTRD 3I4MH 4RG1A 1TIID 4RH6A 3P20A 2E2IH 5M5XH 1LTID 5EKLA 3H15A 1GXDC 1U4MA 1SDFA 2R6GA 3CRLC 4DV5L 3A7AB 1LT3D 3UDIA 4CKBA 3TP8A 4X62L 5C4JH 1Q90A 2D2CC 3AEVA 1EQVA 3ONAB 3CD6A 4PQXA 1HQRD 4DNRB 3GTGB 5HURA 1B44D 3SK5A 5IE8A 3GTJB 2NVTH 4K2KA 1CUKA 3SK4A 4K2LA 3A7LA 1JORA 1QE6A 3DWAA 1Q86C 1IKLA 1Y1VG 5ELNA 1JJCB 2Z0SA 4CGYB 4DK6C 2UU9L 3FKIB 1AW7A 3GTMB 5D3DA 4HIDA 2N3SA 4K14A 3P75A 2R93H 1VQMA 1IXRA 1CA6A 3VDYA 4JVZA 4NXMQ 2KHSA 4ZAIA 1CZWA 3K7AB 1A0IA 1K0RA 1B50A 1OXXK 1M4VA 2K28A 1B53A 3S2DB 2DY8A 4JI1Q 1G91A 4ZKCB 2R92H 4APVA 1IBLL 3DM3A 4YIJA 5G3LF 2A1AA 1PH5A 4G4KA 2JP1A 4JI3Q 2UU9Q 4P2CB 1HXYD 4UY8C 4CJ0B 5IT9c 5CMDA 1UE6A 4WJ4A 1Q1BA 1L1OA 3K5OA 4R8NA 2ZM6L 5FLMH 1H9KA 3A0JA 1SMYD 5JEAJ 5C3EB 1XX8A 2HDMA 2HT1A 4L5QA 1T5EA 3JC66 1B8AA 1JJ2A 4KJOA 4LUVA 3R93A 5IOCA 1EYGA 4L8JA 3SVMA 3S2DH 4FF2A 3MHBA 2QCPX 3K7AH 5A2QE 4XYOA 4ZK9B 1K8OA 1PTOD 1Q81C 1BDOA 3E3XA 1FD7D 4JI8L 2F0VA 1N8RC 1SR3A 1KRTA 1TWGB 1BF4A 1UE7A 1X32A 3HOUB 2K5HA 3S16B 1GUOA 1AE2A 1ML0D 3HOYB 4CKEA 1JOOA 1I4GA 5M5YB 1JR0D 4NMZA 2DNCA 2FMMA 4DR1Q 1MSHA 1DCZA 2CW0C 3J80L 2R61A 2A5HA 4IO9A 1YITA 3JAMi 3C3LA 1HNWQ 4RKLA 3RN2A 4EQOA 1D8LA 2VY3A 4QY7A 5EBDA 1X6OA 4LK1C 2OXPA 3K0XA 3PO3G 2EXDA 3B6YA 4NDXA 2E2HH 3CCQA 4HCEA 2DGYA 3KOJA 1HTLD 2B2UC 3TS2A 4JK1C 2Z9HA 3RLNA 5E4XA 5AJ3L 2CW0D 3L7ZC 4WFN3 3DMUA 2E2IB 2C35B 1SJHD 2QF7A 4OGQC 2OWOA 2VZAA 1WD0A 2B2VA 5C0XH 1LV9A 5DEHA 5I6YA 2PMZE 4JPBW 1I4QA 3M3YB 1DYQA 1OO9B 1H9RA 1YJNA 3FPUB 5CV9A 1JOQA 2Z6KC 2JEBI 1JICA 4BBSH 1IKMA 1B2TA 1C4QA 2K5DA 1C9OA 1B3QA 4B3RQ 3PO2H 3UDXA 5HY6A 2NZOA 1I94Q 1IHZA 2L5TA 4KN7C 1ONLA 1SE3A 1LTAD 2FMCA 3A8JE 3Q8DA 3PIPA 2GVAA 1I4XA 1STAA 5EKKA 5GADC 4K6DA 5C0XI 3TQYA 4LW1A 2WB1B 1TS2A 1VQ4A 1YNNC 1X3PA 2XNAC 2BA1A 2CKZB 1KLUD 3MEFA 4NXML 4BA1I 2JA5H 5C4XB 4O42A 4DAYB 1XNQL 1YIJA 2J4XA 4CJ2C 4DK0A 1TS5A 3U9OA 4IFDH 5IWAL 2VUMG 4PMBA 2K4KA 5J22A 4FF3A 2NBFA 4JV5L 4P73A 3GP7A 1WVLA 2UXBQ 1EQRA 4DNIA 2HCCA 3H91A 2E75C 2VQFL 1DOLA 2FJ2A 2XIWA 1SFOB 3KFUA 1TU2B 2PPBC 1PTOB 1IW7C 2JYOA 2H5XA 1Y69U 5ELEA 1LABA 3OWFA 1G6PA 4N8X1 4IPHA 3L0OA 1B1ZA 5IWAQ 1XNRQ 2CWAA 2EE1A 2JA7H 1SYFA 2VUMB 2AQ1B 3T16A 1NE3A 3EFXD 4X3SA 1EFID 3HEJA 3J80i 1OTCA 5C44B 1LUZA 5KNDA 1VQHA 4LF6Q 1GUWA 4KN4C 3LX0A 4IJHA 4LFBQ 5KIXA 1GUNA 1HZAA 2F0OA 3S1QH 1IL2A 1STEA 3EVQA 5C4HA 3K5LA 2JA8G 3RZOH 1I6HB 1IBLQ 4CDEC 3ZJYC 2SNSA 4A3KB 2L1BA 4HSVA 3H6MA 1VQBA 1CKMA 4L6TB 1RCVD 2A6HC 3D3RA 3FP9A 1V43A 5G3LD 4KHVA 1W2BA 4ME3A 4C2MH 4TRDA 1KIXA 4LFCQ 3ULJA 1QWYA 2B2YA 3M7GA 3TMEA 4AQYQ 1SNOA 1P8LA 3JAML 1HNXQ 2A68D 2BH8A 2M9VA 1QZGA 4TQUS 5C0XG 1VQ5A 4ODGA 3I4NH 3K58A 4A75A 1JOKA 1PRTF 3A8KE 4TKOB 3EBEA 1Z7TA 2RSOA 2FFKB 3N6RA 5FLXc 1WCMH 1CM9A 1O7IA 3MXPA 1CI3M 1QZHA 3HOYG 1PH3A 1ICWA 1OXVA 3CCUA 4KJNA 3H0GG 1GVPA 4Z9CB 1LYLA 4DK1A 1V1OA 3CHBD 1HH2P 1EIHA 1F9QA 2H4OA 1AFPA 3BJUA 3OHXC 1E7ZA 2ATWA 4GNXB 2NN6H 3KBGA 4IURA 3S17B 1E24A 4GN4B 1TT2A 2PNRC 4DU9A 1B9MA 4E6IA 3MFYA 3PCOB 2JA5G 2PYKA 2VNUD 5C3EH 1QJOA 5FK9C 1J5EL 1VDZA 2F0HA 4BA2I 3RUZA 5HGTA 1PYSB 2HDLA 4J1MA 3PO3H 2E2JB 1EIFA 4MTNA 3OW7A 1I4RA 2K01A 1KLGD 4JBMA 1MI2A 5C4XG 2WAQE 1L1OB 4C3JG 4MTKA 3LNNA 2EY5A 1VQ7A 2X6LA 2JA8B 1PTOF 1R4QB 4HMIA 3CXCA 4JV5Q 3GTOB 2A6ED 2E2JH 4K5XA 3SE0A 4A3MH 1RHPA 3M4QA 1D1KA 1ZEQX 4A93G 1S5BD 1I6VC 3CMAA 4BXXG 1JB7A 3VYRA 1J5EQ 2R93B 3DWQA 2MO0A 2SOBA 3KBXA 2R7FA 3GDEA 3ITPA 1CK1A 2KA7A 3ND9A 4M1UB 3SK8A 2OTLA 5IYCH 3HG9A 4EQ5A 4LUOA 1HR0L 2NB0A 4DR2Q 3K57A 3R8BA 1JQYD 3D8GA 4XQQA 2NVTB 2RDHA 4LF7Q 4YCUA 3BS1A 2GN5A 1H9JA 4X64Q 3HOZG 2UXDL 3X3MA 1PH9A 2NTSA 2PZUA 3CU7A 1JWUD 3NP8A 3QOJA 4JBJA 2BDOA 2UXCQ 5M3FG 4B3ML 5GAEC 1WTQA 1PH4A 1N36Q 1QNKA 2PZTA 1QG7A 2K03A 1B7YB 5CORA 2BOSA 2RCNA 2F4IA 1EL0A 1XPOA 1AN8A 1YHAA 4XYQA 1FJGL 1PZKD 5IYBG 1N9WA 1HCZA 3J81j 5CYUA 4MZ9A 3A74A 4EX5A 3A54A 4QIWB 4DK3C 1HRJA 4IUTA 1N36L 3GTPH 2F0GA 5IT9E 4J15A 2KVMA 4PZ8A 4R4TA 4KI0A 4HEDA 2K33A 1ET9A 4DKAC 3PF5A 2XWJB 3C2PA 4EVOA 5C44H 2UUBQ 3S15B 3CCEA 4JI0L 4A3LH 4RGTA 2EIFA 2MHVA 4L5SA 4KHZA 2K04A 1GHJA 4K8JA 4XQNA 3AQQA 2VXWA 4DR5Q 1IYUA 5BR8L 5CBEE 2ZJQA 4ULLA 4YY3L 4A3JH 4JOIA 2G9DA 2IPKD 1EYDA 2V4DA 1K8GA 4DAYA 5FJ8H 4LF9L 2JA6G 1D7QA 4HMJA 1PTOH 1VF7A 4OO1G 1EEID 2QW7A 4DR7L 1SXTA 4R9WA 3H3VC 3CCSA 4DV1L 3G6EA 4U68A 3K8AA 4LF4Q 3PO2G 5DLQE 1IZ6A 1E22A 1VQCA 3DUZA 4V0BA 1HFNA 3Q0AA 2Q8IB 3CF5A 1HNWL 2AQ2B 1PRTD 1G2TA 3NK9A 1Q8KA 2KCNA 4BWGB 4LFAQ 3X3NA 2O5JC 1HFGA 1YI2A 1STBA 2WKDA 3CPWA 4GOPB 2A68C 1IBMQ 1IL8A 1G6ZA 4BY1H 3UDGA 2F0SA 2B29A 1MBYA 1A2UA 1TY2A 4OO1H 2E5LL 4RHRA 1XMQQ 3GTOH 3STBD 2ZTDA 3SGIA 3PO2B 4B3SL 2AHOB 1XTCD 5CGKA 1PXUA 4OO1I 3KF6A 1Q12A 1YJWA 2MUYA 2SNMA 4DV4Q 4DF7A 5CV7A 3MC0B 4RA8A 1PFSA 5CV8A 2K05A 3CCLA 3NTHA 3W3AA 1TQOA 1I94L 1D6EC 1EU4A 3BZCA 2E5LQ 3QB3A 1EU3A 2QILA 3HOVG 4HTHA 2B2WA 1JWMD 1QUQB 3OYYA 1RDPD 3A8IE 1MJCA 4DUYL 4B3MQ 4OEMB 4O1NA 1BBWA 4X62Q 4JW0A 1D5ZC 4DAPA 1W6JA 1GUSA 3GTLB 5JEAH 4IALA 2B2TA 5BN5A 1DZ1A 1RTNA 4NP5A 4A3DB 4A93H 4JC0A 2QDBA 2BE5D 1FL0A 4KHPQ 1E2WA 3HOWB 1LTBD 2MP1A 1PFBA 4TVAB 3S2HH 5EJWA 4JYAQ 5T1IA 2F03A 2NVXB 4DUYQ 2IL8A 1V8QA 1X3EA 1GKHA 1B70B 5GAHC 2VW9A 4KY6A 3HOVH 4FXDA 3Q24A 1TWHH 1H95A 4LF7L 2Q2IA 4GNXA 2IJ0A 3GQBA 1WTVA 4LF8Q 5IGCA 1S3OA 4JG2A 4DR5L 1Y1VH 1XNRL 4R4IA 5BR8Q 2LKVA 5LHY1 3M4OH 5K36G 1V1PB 1DGSA 3NBHA 1SMYC 2F4VL 1UAPA 5D65A 5EAYA 1FR3A 3R3OA 1I6HH 3RZOB 2MO1A 2KBNA 5IY0A 2OF1A 4K6LA 4DR7Q 1VQJA 3NPPA 3W5OA 4IQZA 1Y14B 2XSCA 1IBKQ 4J6HA 2JXMB 1SJED 1XPUA 4HJ5A 3PUWA 1X56A 5I9OA 5M9OA 2QA4A 4DV3L 1AEXA 2ZTCA 3NSWA 1EQTA 3P7JA 2JA7B 2F0JA 2CH4A 1KDCA 2JJQA 4LF5Q 1U4RA 1Y1VB 1K28A 2AQ3B 4XTCS 3EA6A 2Y0SG 1K0SA 5FLMG 2AMCB 1C48A 1PH1A 1KQSA 2KHJA 3ERQA 1HNXL 5E3FA 3NXWA 3OWEB 2NWGA 1SEBD 1VMPA 4RGMA 1K83H 5M3FB 1MIUA 5JJKA 3J80E 5A35A 4LWCA 2MPMA 1TWAH 3S2HB 3G71A 1Y8NB 1UE1A 3CQZB 5I6WA 3VR4A 5FLXE 1F77A 5GQOA 3GTGH 4EQNA 3T1HL 3T51B 2JA6B 1EQQA 4PV1C 5FJ8G 1EY7A 4AIMA 2ID0A 3E0EA 1WTWA 3CW2C 3RR5A 2KCCA 4K5WA 3UE0A 3VA5A 2ASBA 1CKNB 5AJ3Q 1S40A 1BOSA 2AUJD 4Q0FA 1D1IA 4QGUA 4GN3B 3I4MB 1SNMA 1I5FA 2WIIB 2KEDA 1G2SA 3EIVA 1SROA 3E9HA 1NTGA 4A3IH 1L2FA 3F2BA 2B8GA 3D6CA 2ZT9C 2F3VA 1MJEA 2FINB 2R7DA 5C5MA 4LFAL 4QJFA 2EPBA 2FHTA 1YNXA 1IBML 4XIGS 1BCPF 1KTKA 4DNTB 1EOTA 3M3YH 4CJ1B 2ZXPA 3DWPA 1XTDA 2WP8J 3NE5B 4QB4A 4JYAL 4C3JB 3HOXH 1SE8A 3QO2A 2AKWB 3HGBA 2WB1G 1D5XC 4QMGA 4BBRG 3MZ5A 3BYYB 1EWIA 2F3IA 3T13A 5EPLA 3I56A 3NWTA 4DV4L 3EJIA 2LSSA 3BZDB 2H1EA 4DR6L 2Y0SB 3T4AC 2F0IA 1CQFA 4HSPA 1TWCH 1XNQQ 1F2ZA 2KUMA 3PUVA 1F2MA 2NUCA 5KEEA 3CCVA 4RHSA 4B3TL 1H9MA 1TS3A 1X55A 1WTOA 5CV5A 1GUGA 1EFWA 1O7ZA 3FEWX 3GTKB 2XVSA 1A3VA 1BBUA 2F0TA 2B39A 4DR2L 4GN5A 3TZDA 4FP5D 2JSOA 5AFWA 2N49A 5LL6S 4DR6Q 4F7XA 3S16H 3V05A 1R9TH 2K50A 4ZUJA 3CC4A 1C0AA 1UEBA 1NR2A 3EQLC 3GTKH 2X6GA 3H3VI 1PHJA 5I4DA 5JJIA 5KNBA 4OONA 2F0UA 2WACA 4GZYC 1G291 1BUVT 3S14B 4LF5L 5HGQA 3MWYW 1SNQA 4IOAA 1DD2A 3TS0A 1Q46A 3KUPA 4ZQ3A 3IFDA 2QGQA 3MAQA 1VQ9A 4JI7L 3VR6A 4RGOS 4OELB 5D14A 4C3JH 1HUMA 1FGBD 1SNCA 2DJGC 2WINB 4X66Q 3JAME 1KL9A 2EQSA 3GTPB 1LACA 2BCOA 4LAAA 4AYBG 2TMPA 2PI2E 5C0XJ 2EJGC 2RBMA 5D3IB 2DJFC 2F0DA 1RKNA 1SLJA 1AZQA 3TZUA 1CT1D 1ENCA 2RF4A 5FOBB 1JT8A 4JI6Q 1JE5A 3U50C 2DN8A 1QUQA 1II3A 4Q5VA 4A3FB 1QILA 1LT5D 1IBKL 3QJYA 3PUXA 1EWHA 4OX9L 3O13A 3FKIH 4DXGA 4LJZC 5CC4A 3I2ZA 3NBIA 4DV3Q 2ZJRA 4HN7A 4P72A 3T1YQ 4C3HB 1DONA 1Y1WH 3I4MG 3CCMA 4FDBA 1GM5A 1K3RA 1ILQA 1EWCA 4CKCA 2F0KA 4ZCKA 4GLXA 1YJ9A 4A3MG 1WTXA 1Y1WB 4DV1Q 5LMNL 1SYGA 5FO8B 3BU2A 5JOBA 1K83B 5M3FH 4CBVA 4ZYSA 1QVCA 5IGDA 4A3KG 3KF8B 3TREA 2EVBA 1SSOA 2RCFA 1KC8C 4RCOA 4AYBE 4C2MB 3S1MH 1PH7A 1VQLA 2KQ3A 3U4VA 2CVRA 5M3MB 4G7HC 1E2VA 1Z6HA 4BY7H 1KABA 4A3MB 1EY5A 3TDQA 2IHFA 4L5RC 5L37A 3GV3A 1M90C 3JAMc 4V190 3AYHB 1UWVA 2NN6G 4P74A 1KXLA 5E4WC 2L0CA 1T9HA 1QOHA 2TSSA 5ELCA 3BDLA 1UUPA 4ZUIA 5JPNC 2K32A 3MVVA 1NMGA 3LWUA 4A3IG 3IL8A 2ES2A 2OCEA 2A6HD 4IJLA 2KHIA 1A3UA 1BCPB 4JI5L 1X65A 3NQTA 1ESFA 1BCPD 1N34Q 2F3WA 1U0LA 2LMCB 4J8QA 1GOZA 2X69A 3HP3A 1OXSC 1WTPA 1HR0Q 5IYBH 1D2BA 1KD1C 1GHKA 1MHWC 4KY5A 3K6OA 4CDFC 3OTOL 2C5CA 3OMGA 2A73B 3KDFB 1UNSA 1SFOH 2EYOA 4XT3B 2WB1E 5FO7B 5IIFA 4KV6A 1N32L 2PQAB 5EGTA 3WDNA 3CC2A 4JI7Q 4JI5Q 2MFIA 2NVQB 3ERSX 2NVXH 1E1TA 5EPKA 2PQEA 4ABNA 4CHTB 4IPCA 4N9PA 3Q22A 4G7ZC 1PYBA 1ZYRC 4FYDA 4A93B 1STHA 4ALPA 3GTQH 4UP9A 1SYDA 1TWCB 2HD3A 4KKSA 4GKJQ 4JI6L 3W2DA 3C1EA 5CBAE 1I50B 2G5DA 3BVGA 2PNHA 1ZXTA 3J7ZC 3I8ZA 2RVLA 1YZ6A 1X54A 2NVYB 2B63B 2NYZD 4A3GH 5IP9G 3OPOA 3CCRA 1TR5A 4EGVA 2R92G 2CFMA 3HOXB 2O5IC 1A63A 2N55A 3F1ZA 2F4VQ 5DM63 1GO3E 3D4WA 2I46A 3TP7A 2K5NA 3NENA 4DXFA 2OQKA 4LFCL 2IHEA 3R2TA 1ESRA 4QF4A 1PA6A 2UUBL 3W1GA 1PZID 1M8AA 3BYTB 3RZDB 5KYIA 3I91A 1DOKA 2L4NA 1RODA 4A3IB 2K5WA 3VR5A 5F2DA 4KY7A 1VQ8A 4IZ8A 1A15A 5TSSA 5IGFA 4JI4Q 1VQOA 2VUMH 3OIQA 1BO0A 4OWWB 2KCTA 4WORA 1FNVA 2NVYH 4HIKA 4YCVA 4DR4L 1A3TA 4KMUC 2E2HB 1F9RA 4KD4A 5EBCA 2ZM6Q 1KNEA 5JEAG 1DOMA 3M4PA 4YWKA 1X3QA 1KAAA 2NN6I 4NPSA 3RLOA 4XXEA 2EYMA 3BDOA 4DV7Q 3I4NG 5ELOA 2HHHL 3A5ZB 1EEFD 4OX9Q 1XJVA 5IP7G 3BDCA 1GUTA 4DV2Q 1TWAB 2OEOA 4C3IH 3J80c 4JI4L 3AMUA 3WOFA 4H44C 4DV6L 3M7NA 3HOYH 1B3AA 2EDGA 4DR4Q 3BVMA 1PVOA 1JCKB 2E74C 1V1PA 4Y7NH 4PZ7A 1EY0A 3LGJA 3PV0A 2B8FA 5JVG3 2K5VA 3ULLA 1BBXC 5KYLA 4DR1L 3NTKA 4BS9A 1LM0A 1XMQL 3K81C 2R7ZG 2E8GA 3NTIA 4DAVA 3HOZH 1XYIA 1GJXA 3P1HA 5IP7H 2B2WC 3F2CA 1AZPA 2UUAQ 3KYHC 2Q2UA 4NXNQ 2A69D 2R93G 3QR8A 4IUPA 4BBSB 1K8MA 4LNQA 3D0FA 2EZVA 1KAWA 2KECA 1S4ZA 3BVZA 5C5LA 5C6AA 1LTLA 4WJ3M 3OMCA 1GD7A 1CQVA 2QKIC 1C8CA 4A4IA 2MJ8A 2PW7A 4BY7G 2CHBD 4C1NK 3M4OB 2F0MA 5M3MH 2QDLA 1EY8A 5C3XA 4ZRZA 3V96A 4FNFA 2IT1A 1KNAA 4QUFA 1RIPA 3CKIB 1DJRD 1AE3A 5IGBA 2JK8A 2LXJA 4IOCA 4DN4M 2LY7A 3NWSA 1PH2A 1KDBA 1TXYA 1HJPA 2JN4A 1VQ6A 3PMFA 4LUZA 4IFDG 2EYFA 5ISRA 2C9OA 2K6AA 3A56A 1HUNA 3KLWA 1C7YA 4HAEA 1ASZA 3J7A5 1VQAA 2EYHA 4JI3L 5C3WA 4DV0Q 3NQIA 4C1NI 1LT6D 1SBBB 1M1KC 4A3DH 4LF6L 1EOVA 3S1RB 4I7AA 1A6XA 2F0QA 2ZTEA 1F9PA 1SNPA 4UDUC 1NR4A 5I2XA 3C46A 3GTLH 3QWNA 5EQ0A 1V1QA 5C4JB 2R3ZA 4LF8L 3IRBA 1WYDA 2VQEQ 1E0BA 1MSGA 2HCIA 1UE5A 2EYLA 2BDNA 1O78A 2N78A 2Q2TA 1V9PA 3MXUA 5A2QL 4YHHQ 4JCVE 1NNXA 2L12A 2OQ0A 1BR9A 4A3FH 2B2UA 3EN2A 4G7OC 2XGTA 4RWSC 3CPFA 3J81L 1PFMA 4AH6A 4DV7L 2OTJA 2A19A 3FDTA 2YTYA 4B9XA 2VQEL 4A3DG 1LTGD 1FNWA 1BXTA 5IYDG 1FNUA 4R4QA 1Z9FA 1J6QA 4GNXC 2JQOA 1X3FA 3T56B 1P16A 4FF4A 5I2YA 3D31A 3E0JA 4DAMA 2RDFA 4UPAA 4IFDI 1PDQA 4ID6A 4O0AA 1Q7YC 4R8IA 2KENA 1A62A 3RNUA 1FGUA 2HIXA 1IYJB 2GVBA 1HPCA 4F87A 1Q3LA 1STYA 1VS0A 4TSSA 4FXKC 3PIOA 5E1FA 3DLLA 2B2TC 5KRUA 2XRSD 4GS3A 1R9TB 4JI2Q 2UUAL 2I5MX 2KEEA 3K0YA 3FKIG 1YBYA 3T1HQ 3K5NA 3HKSA 4QIWE 1F2LA 2Z8LA 2BA0A 1DXMA 4ME5A 2I07B 2IWHA 5IYCG 1ASYA 3H94A 1NY4A 4MIUA 3I4NB 3C1FA 3I3CA 2DNEA 1Y1WG 5JJLA 3G4SA 4DV6Q 4A3BH 4C3IG 5KNCA 3K7UC 1XMOQ 2M00A 5CV4A 1STNA 2EYJA 4HIOA 3M85A 1VQPA 3J7AV 2F0NA 3WWVA 3S15H 1VQEA 1K73C 2P5ZX 4A3CH 1MKHA 4HJ9A 1PH8A 1FVIA 1WFQA 5CV6A 1WOCA 1KRSA 4QCLA 4M8AA 1S72A 5JVH3 4HIMA 4IPGA 2UXBL 1TY0A 5EKIA 4A3GB 3TP6A 1PZJD 4A3EB 2DY7A 2D62A 2PCFB 2VB2X 2M2LA 2CQAA 3KK7A 4KD3A 2O2LD 3FRPB 1RTOA 1U9RA 1AP0A 3HOWG 1TS4A 2KOLA 4CDCC 3URYA 4OIJA 4A3BB 3QIAA 1I4PA 1LO5D 3I55A 3GTQB 1VQGA 1EY9A 4PMWA 4MN3A 3SHLA 3PSIA 5EPJA 3DEOA 5DM73 2KCMA 3D6WA 4IPDA 1S5ED 1Q8IA 2Q8TA 2HQEA 2YU9H 3RMHA 2IW3A 4OIKA 2A69C 3KLSX 1EUJA 2HIVA 1O7LA 4C56C 2BH2A 5M3MG 4LFBL 4IN3A 5J39A 2PZWA 1K8AC 1VQDA 3G6JB 1A8VA 4JOIC 1Z47A 2JA9A 3KF6B 2OT2A 4NB3A 2E2DC 5C4ZA 4CDDC 5BN3A 2IX1A 2YTVA 2FXQA 2MNAA 3U9SA 5C4XH 4DV0L 1HZBA 2MQHA 2JA5B 2VQFQ 3PQIA 5E7NA 1CFMA 1HR0W 1TVXA 2RHSB 2NZHA 1CSQA 1ICFB 5JPMC 1VMCA 3L3OC 1ENFA 2EJMA 3AB9A 5IODA 1HZ9A 3WOEA 1LTSD 4UHVA 1YVCA 2E76C 4KHPL 1SAPA 1CA5A 1PRTC 4G57A 1NCVA 5M5WH 4L63B 2EY1A 4R4OA 3CMEA 4LF9Q 1L0XB 1K9MC 3SK6A 3BG3A 1PMRA 3PO3B 3J81c 4DR3Q 5C3EG 3L9AX 2EYPA 2F0WA 5LMUL 3STBC 2F52A 1H9SB 2JEAI 3ULPA 2RKSA 1EY4A 2RSNA 4GOPC 5ELFA 4DFAA 4A3FG 3VYTA 3VR2A 5BN4A 4X6AH 1QVGA 1UEAB 3S17H 4PMCA 1VQKA 4IFDJ 4A3BG 4GLAC 3UI2A 3FVQA 4A3JG 2EY2A 2PQAA 2YYZA 1VQFA 1ZYRD 1MD2D 3CC7A 2G9HD 2LFNA 3MXNB 3ZYYX 3KJPA 4RAUC 4JI8Q 2RHQB 1WCMB 2AWNA 4POFA 1ENAA 2V1CC 4Y52H 2SEBD 1XXGA 5H1SE 5COYA 5DAUA 3QOLA 1CKOA 3MTSA 1JC7A 4C3HH 1BKBA 1BVSA 5T1GA 1S5FD 2K14A 3UDFA 4YY3Q 4ILWA 2ZXOA 3H0GH 4A3EG 2RQXA 1NUCA 3HOUH 1Y8OB 2IY5B 1TWFH 4WJWA 2ZXRA 1DM0B 1U4LA 2IX3A 2RDGA 1LT4D 4YWLA 1NBWA 3HFZB 2CCZA 3PF4A 1RJTA 1J9OA 1E1OA 2K1BA 2R7ZB 2Z6BA 3CP0A 3CAMA 1EIGA 1CTMA 4P75A 1LLRD 2L9HA 4DA2A 5I9PA 4H7BA 4I7ZC 4ZLTF 4KKUA 1E3PA 3KLSA 4B3TQ 3E9IA 5KGUA 5K5PA 4XT1B 4XQJA 2UXCL 5FLXL 3I73A 2J0TD 3MFGA 5J3BA 5J1ZA 2KJXA 3MEHA 5ELDA 4OWTB 4BY1B 2WAQG 4H02A 1HA6A 2J7ZA 1EY6A 2F0PA 4X3UA 1HHVA 2A74C 5GAGC 2QEJC 5LL6X 4X3KA 2L55A 3GTMH 3TRZA 1VQIA 1EYCA 4YCWA 1N32Q 3T53B 4IUQA 3LWEA 4YWMA 1NMFA 1AH9A 4OHJA 2A8VA 1T5XD 1BCPC 2GA4B 4C3IB 1NJIC 2VS1A 3PIP3 4IUNA 3BZKA 4N8FA 1O80A 2QEXA 1HQMC 1JWSD 3MXGA 1BNZA 1I3QB 1SNDA 2B2YC 1D5MC 2D9UA 1SE2A 3FHWA 4N9TA 3M9BA 3J7YW 1WI5A 1YNJD 4POGA 2UXDQ 4DPGA 4KK7A 4A3JB 1YNND 4X66L 3W1BA 1CHQD 3IAYA 1L0WA 2PI2A 1JMCA 2XTIA 4YHHL 1YHBA 1W6KA 3HOXG 3AU7A 3RZDH 4P71A 2ICEC 1Q1EA 1N33Q 4KKTA 1QCBD 2K7VA 1KHIA 2CWPA 4GKKL 2K5QA 4PG3A 3I7FA 3EROA 2AUKA 2D5DA 4FVMA 3I90A 3AFPA 4DGZA 4EQPA 3GO5A 3SEBA 3F2DA 3IFTA 4FXGC 3VA7A 1IYVA 1SYCA 4RGNA 2B63H 1S5DD 3HKZB 3TBIB 4GOPA 2K52A 4K5VA 4S3SA 2BE5C 3HOUG 3OOCA 2IX0A 1I50H 4F88A 4I65A 2EOTA 2XN9C 5LMUQ 4AQYL 2LXKA 2CH4W 4U673 4GKKQ 4IUUA 2JA6H 3VYSA 3S1RH 2WKCA 1A2TA 3J81i 2HHHQ 1I3QH 2Z1CA 2JE6I 4R4CA 3CQZH 4PNYA 3ER0A 4AYBB 1ZKOA 1Y8PB 4HJ8A 3GV6A 1U5KA 3I70A 2LS01 4B3SQ 2N88A 5IT9L 4OXPA 5M5YH 2I5HA 3NEMA 1B4OA 2PMZB 1CSPA 1STGA 2PW5A 5FO9B 3F8TA 4H0LC 3FPPA 3OW2A 1TWGH 1JE4A 4XDXA 4WRDA 1CZGA 3AFQA 1B9NA 4QL5A 4X3TA 1XPRA 3Q6SA 1F2YA 3I72A 3HKZE 2UUCQ 3G48A 2WAQB 3E6ZX 3S1NH 1S5CD 4UP8A 4DUZL 3T1YL 1RD9D 4LMQD 1X3GA 3N52A 2Z6KA 4QUCA 1XMOL 1HNZQ 1OXTA 4KTAA 1EIYB 3SXHA 3K80C 3ICEA 4F8MA 2ALYB 3SR1A 3G7LA 4HJAA 1U4PA 1SE4A 3VYUA 2D0PA 2Y0SE 4RCNA 5LMNQ 5IYDH 5JJZA 1L0YB 2JA8H 2R7ZH 1XWEA 2CQOA 3A5UA 4X65L 3RD4A 1FYCA 3HOZB 1OXUA 2UUCL 3RLFA 4A3GG 2Z4HA 4BY7B 1VCIA 2R92B 2ENBA 4FO2A 2Z4IA 1F9SA 1RF2D 1W3SA 2WV6D 1WTHA 3PUZA 3S1MB 3A55A 2D0OA 2HQLA 4MNOA 1TWFB 4GLVB 1TWHB 4RMFA 4Y7NB 4O2DA 3V2TA 1SMXA 2Q2HA 3Q23A 3HOVB 2RA4A 3KF8A 3HZXA 4KLKA 3H0GB 4X65Q 1IW7D 1WD1A 3E5SA 3KJOA 4HJ7A 3HOWH 5JAVA 2XRQD 3DM1A 5IGGA 4BY1G 4GKJL 3GTJH 1N33L 1WTRA 2ICIA 1PYWD 4HCSA 2N8NA 3RN5A 4L5TA 1EYAA 3M4YA 1PH6A 2EXZA 2YU9B 2I0QA 4X64L 1NSNS 2F1MA 3F2UA 1PLFA 1SYEA 1N34L 2B63G 1Q82C 4OWXB 3CRKC 1TKWB 2F0LA 4DV5Q 5IGEA 5M5XB 1E2ZA 3D4RA 4K8IA 1YEZA 1R4PB 5K36H 1CHPD 1L1OC 3OTOQ 1G8ZD 4MHEA 3TN2A 2NZ1D 1JJGA 5FKAC 3K59A 2B3GA 3DEPA 4JBWA 3K5MA 4K0KL 3U58A 4ZKBB 1FJGQ 2WFWA 1PFNA 1SRUA 4OL7A 4A3KH 3KDFA 2AWOA 5M5WB 2ZJPA 5NUCA 2HUGA 4H13C 4C3HG 3R2IA 1HZCA 1PV4A 5DNFA 3QG1A 2VL6A 3J81E 3I4LA 3S1QB 3J7AF 1CKNA 4IUVA 4DR3L 1QNUA 3VR3A 3NHHA 3PIO3 2F0EA 3UE1A 4JI0Q 4BXXH 3OIPA 2MGSA 3H09A 1K3BC 1LTTD 3SDZA 1QVFA 3S24A 4K0KQ 3S14H 2VB3X 2XWBB 2YTXA 3S1NB 1PRTB 1G51A 1JB3A 4JI1L 4DV2L 3DXJC 1SN8A 4JBKA 1RL2A 1HTPA 4R1JA 4BBRH 4A3CG 5LMNW 4DUZQ 2I5LX 3HS0C 2NVQH 4JI2L 1EZ6A 1HNZL 3MA2B 4FF1A 4PZ6A 3TP5A 3PUYA 2Q8RE 1ILPA 2YV5A 1ET6A 2B2VC 3ND8A 2F0FA 1VF5C 4LF4L 5IP9H 1O7YA 4BBRB 1EZ8A 3NELA 2L11A 4HR7B 3IKJA 3PGZA 4A3LG 3I4OA 1HA5A 4BBSG 1J8IA 4NXNL 2K75A 5GROA 1NAPA 1WJJA 3TEHB 1X9NA 3OSOA 1YHQA 4A76A 4RKBA 4UAIA 1SYBA 3TSSA 1VQNA 4UP7A 3KLRA 4A3EH 4B3RL 3CCJA 3NUCA 1KDAA 5ELBA 4NKLA 1H9SA 4QQBX 3H3VH 1MGSA 4NW2A 1BQQT 2PO4A 2EY6A 2A6EC 1YNJC 5CR3A 2JA7G 3D4DA 1PTOC 4RFBA 1QB5D 2NTTA 3HKZG 1WCMG 2O4XA
chains in the Genus database with same CATH topology
5C3EG 4DKAC 3GD7A 3L2PA 5LMUL 3PF5A 3STBC 3U4ZA 2F52A 5C44H 2JEAI 3ULPA 2UUBQ 3CCEA 4JI0L 5C44G 4A3LH 1NMGA 4GOPC 2EIFA 2DUDA 3NBHB 4A3IG 2ES2A 2L15A 4L5SA 4A3FG 2OCEA 4IJLA 4KHZA 3I4MH 2KHIA 4RG1A 4X6AH 4JI5L 1X65A 1QVGA 3AQQA 3S17H 2E2IH 4DR5Q 4IFDJ 1VQKA 5BR8L 5M5XH 3H15A 1N34Q 2ZJQA 4A3BG 4YY3L 4A3JH 2R6GA 4GLAC 4JOIA 4A3JG 4DV5L 1U0LA 2PQAA 2YYZA 1VQFA 3UDIA 1K8GA 3CC7A 1OXSC 5FJ8H 4LF9L 4X62L 1HR0Q 5IYBH 3MXNB 5C4JH 1KD1C 2JA6G 1D7QA 3KJPA 4JI8Q 3AEVA 3OTOL 4OO1G 3CD6A 3KDFB 4DR7L 1SFOH 2RHQB 2WB1E 2AWNA 4POFA 1N32L 2PQAB 2V1CC 5IE8A 4Y52H 5H1SE 2NVTH 3CC2A 4JI7Q 1CUKA 3CCSA 3J81c 3G6EA 4DV1L 4JI5Q 2MFIA 1CKOA 3ERSX 4C3HH 2NVXH 3K8AA 1E1TA 1BKBA 1BVSA 4LF4Q 3PO2G 5DLQE 1IZ6A 1E22A 2K14A 3UDFA 1Y1VG 5ELNA 2Z0SA 1JJCB 4YY3Q 1Q86C 1VQCA 4IPCA 3H0GH 1PYBA 4DK6C 4A3EG 3CF5A 2UU9L 1HNWL 4ALPA 3GTQH 4UP9A 4GKJQ 1Q8KA 3HOUH 4HIDA 2N3SA 4JI6L 4LFAQ 2R93H 1VQMA 1IXRA 2IY5B 3VDYA 1TWFH 2PNHA 3J7ZC 1YI2A 4NXMQ 4GOPB 3CPWA 1IBMQ 1YZ6A 1A0IA 4BY1H 1X54A 3UDGA 1K0RA 2B29A 1OXXK 4A3GH 5IP9G 3CCRA 2E5LL 4JI1Q 2R92H 4APVA 1XMQQ 1IBLL 3DM3A 2R92G 3GTOH 2CFMA 4YWLA 1NBWA 2ZTDA 3HFZB 3STBD 2CCZA 3PF4A 3SGIA 1A63A 3F1ZA 2F4VQ 1E1OA 2A1AA 4B3SL 1PH5A 2AHOB 4JI3Q 1GO3E 2UU9Q 4UY8C 5IT9c 2K5NA 3CP0A 1UE6A 3NENA 4OO1I 3KF6A 1Q12A 2OQKA 1YJWA 4WJ4A 3CAMA 1Q1BA 4LFCL 1L1OA 2IHEA 4DV4Q 2ZM6L 5FLMH 1PA6A 2UUBL 3A0JA 3W1GA 4P75A 5JEAJ 1PFSA 3CCLA 2HT1A 4L5QA 3JC66 1B8AA 1JJ2A 1I94L 1E3PA 3BZCA 4B3TQ 3E9IA 1VQ8A 2E5LQ 4LUVA 3HOVG 1EYGA 4JI4Q 1VQOA 2VUMH 2UXCL 1QUQB 2KCTA 3OYYA 4OWWB 3S2DH 4DUYL 5J3BA 1MJCA 4B3MQ 2NVYH 4HIKA 4OWTB 4YCVA 3K7AH 1BBWA 2WAQG 4H02A 4X62Q 4DR4L 1Q81C 4JI8L 1N8RC 1SR3A 1KRTA 1UE7A 5GAGC 2ZM6Q 3GTMH 2K5HA 3TRZA 5JEAG 3M4PA 1VQIA 4YWKA 1AE2A 4YCWA 1N32Q 4YWMA 2NN6I 1NMFA 4NPSA 3RLOA 3I4NG 4A93H 4DV7Q 4JC0A 5ELOA 2HHHL 3A5ZB 1FL0A 4OX9Q 1AH9A 1XJVA 5IP7G 4KHPQ 4DR1Q 4TVAB 2A8VA 4DV2Q 3S2HH 4C3IH 3J80c 4JYAQ 1NJIC 4JI4L 2VS1A 4IO9A 1YITA 3JAMi 3BZKA 4DUYQ 2QEXA 4DV6L 3M7NA 3HOYH 4DR4Q 1PVOA 1X3EA 1HNWQ 1GKHA 1B70B 3RN2A 5GAHC 2VW9A 3HOVH 1D8LA 2VY3A 4QY7A 3FHWA 1X6OA 4Y7NH 4PZ7A 1TWHH 1H95A 3K0XA 4LF7L 3LGJA 2EXDA 3B6YA 3PO3G 2Q2IA 3M9BA 3PV0A 4GNXA 1WI5A 3CCQA 2E2HH 2DGYA 3KOJA 4LF8Q 2K5VA 3ULLA 3TS2A 4POGA 2UXDQ 4DPGA 4DR1L 1S3OA 4JG2A 3RLNA 4DR5L 1Y1VH 4X66L 3W1BA 5AJ3L 1LM0A 4R4IA 5BR8Q 1XMQL 1XNRL 3M4OH 5K36G 3K81C 3L7ZC 1L0WA 2R7ZG 2PI2A 2E8GA 1DGSA 2C35B 1JMCA 2OWOA 2VZAA 2XTIA 2F4VL 3HOZH 5EAYA 4YHHL 1YHBA 3HOXG 1I6HH 2PMZE 2MO1A 5IP7H 3F2CA 3RZDH 2UUAQ 3KYHC 2Q2UA 4NXNQ 2KBNA 5IY0A 4P71A 1YJNA 2R93G 1Q1EA 1N33Q 4DR7Q 1VQJA 3W5OA 2Z6KC 4LNQA 3D0FA 1KHIA 2JEBI 1KAWA 1Y14B 1IBKQ 2CWPA 4BBSH 4GKKL 1LTLA 3I7FA 4PG3A 4HJ5A 3PUWA 1X56A 1C9OA 1XPUA 1GD7A 4WJ3M 4B3RQ 3PO2H 2QA4A 3AFPA 5HY6A 2NZOA 3UDXA 1I94Q 4A4IA 3GO5A 3F2DA 4DV3L 2ZTCA 4BY7G 3Q8DA 3PIPA 2GVAA 2B63H 2JJQA 4GOPA 4LF5Q 5M3MH 2K52A 5GADC 3HOUG 5C0XI 4XTCS 3TQYA 2IX0A 1I50H 2IT1A 2Y0SG 4LW1A 5FLMG 1RIPA 2AMCB 1VQ4A 5LMUQ 1PH1A 4AQYL 2BA1A 2LXKA 1AE3A 2CKZB 1KQSA 2KHJA 3MEFA 2JK8A 2LXJA 4IOCA 1HNXL 4NXML 4BA1I 4GKKQ 2JA5H 2JA6H 1PH2A 3S1RH 1TXYA 1HJPA 3J81i 1XNQL 4DAYB 2HHHQ 4LUZA 1VQ6A 1I3QH 1YIJA 2JE6I 4R4CA 4IFDG 3CQZH 3ER0A 1K83H 5IWAL 2VUMG 1MIUA 2K4KA 4HJ8A 3KLWA 1U5KA 1C7YA 5JJKA 4JV5L 4P73A 4LWCA 1ASZA 2UXBQ 3J7A5 1EQRA 1TWAH 4B3SQ 1VQAA 4DNIA 3G71A 4JI3L 1UE1A 4DV0Q 4OXPA 5M5YH 2VQFL 1M1KC 5GQOA 2I5HA 3NEMA 3GTGH 3KFUA 4LF6L 3T1HL 1EOVA 1CSPA 4A3DH 2ZTEA 1EQQA 3F8TA 5FJ8G 3GTLH 2H5XA 4AIMA 2ID0A 3E0EA 1V1QA 3CW2C 3OW2A 1TWGH 4QL5A 3AFQA 3RR5A 4LF8L 1G6PA 3IRBA 3UE0A 4IPHA 1WYDA 2ASBA 1CKNB 1XPRA 2VQEQ 3L0OA 5IWAQ 5AJ3Q 1S40A 1XNRQ 1UE5A 2CWAA 3HKZE 2UUCQ 3G48A 2N78A 2Q2TA 4QGUA 1V9PA 2JA7H 3S1NH 4UP8A 4GN3B 4YHHQ 4DUZL 4JCVE 1I5FA 1NE3A 3T1YL 3EIVA 1SROA 1X3GA 3E9HA 2Z6KA 1NTGA 4A3IH 1XMOL 3J80i 2OQ0A 1L2FA 1HNZQ 3F2BA 1OTCA 4A3FH 1LUZA 1OXTA 1VQHA 1MJEA 4LF6Q 2R7DA 3EN2A 1EIYB 3K80C 4LFAL 4IJHA 3ICEA 2XGTA 4LFBQ 2ALYB 3CPFA 4QJFA 1YNXA 4HJAA 1HZAA 3S1QH 1IBML 4XIGS 1IL2A 4AH6A 4DV7L 2OTJA 4K0KL 2A19A 3M3YH 2YTYA 2D0PA 2Y0SE 5LMNQ 2VQEL 2JA8G 3RZOH 4A3DG 5IYDH 5IYDG 2JA8H 1XTDA 2WP8J 2R7ZH 2CQOA 3A5UA 4X65L 1IBLQ 4JYAL 3ZJYC 4R4QA 1Z9FA 1OXUA 2UUCL 3RLFA 1J6QA 3HOXH 4A3GG 1SE8A 2AKWB 4GNXC 2JQOA 1X3FA 1VCIA 1P16A 1VQBA 2WB1G 1CKMA 4BBRG 3D31A 1EWIA 2F3IA 3FP9A 1V43A 1W3SA 1W2BA 3PUZA 4DAMA 4ME3A 4C2MH 3I56A 1KIXA 4LFCQ 3ULJA 4UPAA 4IFDI 4DV4L 4AQYQ 2D0OA 2HQLA 2LSSA 4O0AA 4MNOA 1Q7YC 1P8LA 4GLVB 4DR6L 2KENA 1A62A 1HNXQ 4RMFA 3RNUA 4O2DA 1FGUA 1SMXA 2Q2HA 2HIXA 2BH8A 1TWCH 1IYJB 1XNQQ 2GVBA 3PUVA 3CCVA 1QZGA 4B3TL 1VS0A 4KLKA 4TQUS 4X65Q 5C0XG 1X55A 3PIOA 1VQ5A 3I4NH 4A75A 1EFWA 3DLLA 1BBUA 3EBEA 3KJOA 4HJ7A 4GS3A 3HOWH 4JI2Q 4DR2L 4GN5A 2UUAL 2I5MX 4BY1G 4GKJL 3GTJH 1N33L 3T1HQ 3FKIG 1YBYA 5FLXc 2N49A 3HKSA 1WCMH 2N8NA 1O7IA 4L5TA 4QIWE 3RN5A 1QZHA 3HOYG 1PH3A 3S16H 4DR6Q 2BA0A 1R9TH 2K50A 3CC4A 1PH6A 1C0AA 1OXVA 3CCUA 1UEBA 5IYCG 1ASYA 3GTKH 3H0GG 2I0QA 1GVPA 4X64L 1LYLA 1NY4A 1HH2P 3H3VI 1PHJA 1Y1WG 5JJIA 4OONA 3BJUA 1Q82C 4OWXB 1N34L 2B63G 5JJLA 1E7ZA 3G4SA 4DV5Q 4DV6Q 2ATWA 1G291 4A3BH 4GNXB 5HGQA 4LF5L 1E24A 1YEZA 3K7UC 4GN4B 4IOAA 1XMOQ 1L1OC 3OTOQ 3TS0A 3PCOB 2JA5G 4HIOA 3M85A 1Q46A 5C3EH 1VQPA 2VNUD 3WWVA 3S15H 2QGQA 1VQEA 1J5EL 1JJGA 1K73C 4A3CH 1MKHA 2B3GA 4BA2I 1VQ9A 4JBWA 4HJ9A 1PYSB 1FVIA 1PH8A 4JI7L 3U58A 3PO3H 1EIFA 1WFQA 4MTNA 1FJGQ 2WFWA 1SRUA 4JBMA 4C3JH 4A3KH 5C4XG 2WAQE 1WOCA 1L1OB 1KRSA 4X66Q 3KDFA 1KL9A 2AWOA 2EQSA 1VQ7A 1S72A 2ZJPA 4HIMA 4AYBG 3CXCA 4JV5Q 1HZCA 2PI2E 4IPGA 5C0XJ 1PV4A 2UXBL 2E2JH 4A3MH 2VL6A 3M4QA 1SLJA 2RF4A 1CKNA 2D62A 4DR3L 4A93G 1JT8A 4JI6Q 1JE5A 3U50C 3CMAA 1QUQA 4BXXG 1JB7A 3UE1A 4JI0Q 4BXXH 1J5EQ 1IBKL 2MO0A 3HOWG 1QVFA 4K0KQ 3S24A 3PUXA 3S14H 2R7FA 2YTXA 4OX9L 3GDEA 3I55A 1G51A 1VQGA 3FKIH 4JI1L 3I2ZA 4PMWA 4DV3Q 4DV2L 1SN8A 4JBKA 3PSIA 2ZJRA 1RL2A 2KCMA 4R1JA 4IPDA 4BBRH 5LMNW 4A3CG 4DUZQ 2OTLA 5IYCH 2I5LX 4P72A 3T1YQ 2YU9H 4EQ5A 2NVQH 4LUOA 1HR0L 4DR2Q 4JI2L 1Y1WH 3I4MG 3CCMA 4FDBA 1HNZL 1GM5A 1K3RA 1EUJA 2HIVA 4PZ6A 2BH2A 5M3MG 3PUYA 4LFBL 4LF7Q 4YCUA 2YV5A 4GLXA 1K8AC 1YJ9A 4A3MG 1VQDA 1A8VA 4JOIC 1Z47A 2GN5A 2JA9A 3KF6B 4X64Q 4DV1Q 5LMNL 1PH9A 3HOZG 2UXDL 4LF4L 4JBJA 4NB3A 5IP9H 3BU2A 2UXCQ 5M3FH 3NELA 2IX1A 1QVCA 5M3FG 2YTVA 2FXQA 4B3ML 3PGZA 5GAEC 1PH4A 1N36Q 4A3LG 3I4OA 2MNAA 5C4XH 4DV0L 4A3KG 1HZBA 2MQHA 2VQFQ 4BBSG 3KF8B 3TREA 1B7YB 4NXNL 5E7NA 2K75A 5GROA 1WJJA 1HR0W 3TEHB 1X9NA 1KC8C 2RHSB 2RCNA 4AYBE 3S1MH 2NZHA 1CSQA 1YHQA 1PH7A 1VQLA 4A76A 3U4VA 1HZ9A 1XPOA 1VQNA 4UP7A 1YHAA 4A3EH 1FJGL 4BY7H 3CCJA 1YVCA 4B3RL 4KHPL 5IYBG 4L5RC 1N9WA 2IHFA 1M90C 4QQBX 3JAMc 3J81j 4MZ9A 3A74A 3AYHB 4EX5A 1UWVA 3H3VH 2NN6G 4DK3C 4P74A 5M5WH 4R4OA 1N36L 3GTPH 1KXLA 3CMEA 4J15A 4LF9Q 2JA7G 1T9HA 1K9MC 4PZ8A 4R4TA 3HKZG 4KI0A 1WCMG 4DR3Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E G;  4DKA C;  3GD7 A;  3L2P A;  5LMU L;  3PF5 A;  3STB C;  3U4Z A;  2F52 A;  5C44 H;  2JEA I;  3ULP A;  2UUB Q;  3CCE A;  4JI0 L;  5C44 G;  4A3L H;  1NMG A;  4GOP C;  2EIF A;  2DUD A;  3NBH B;  4A3I G;  2ES2 A;  2L15 A;  4L5S A;  4A3F G;  2OCE A;  4IJL A;  4KHZ A;  3I4M H;  2KHI A;  4RG1 A;  4X6A H;  4JI5 L;  1X65 A;  1QVG A;  3AQQ A;  3S17 H;  2E2I H;  4DR5 Q;  4IFD J;  1VQK A;  5BR8 L;  5M5X H;  3H15 A;  1N34 Q;  2ZJQ A;  4A3B G;  4YY3 L;  4A3J H;  2R6G A;  4GLA C;  4JOI A;  4A3J G;  4DV5 L;  1U0L A;  2PQA A;  2YYZ A;  1VQF A;  3UDI A;  1K8G A;  3CC7 A;  1OXS C;  5FJ8 H;  4LF9 L;  4X62 L;  1HR0 Q;  5IYB H;  3MXN B;  5C4J H;  1KD1 C;  2JA6 G;  1D7Q A;  3KJP A;  4JI8 Q;  3AEV A;  3OTO L;  4OO1 G;  3CD6 A;  3KDF B;  4DR7 L;  1SFO H;  2RHQ B;  2WB1 E;  2AWN A;  4POF A;  1N32 L;  2PQA B;  2V1C C;  5IE8 A;  4Y52 H;  5H1S E;  2NVT H;  3CC2 A;  4JI7 Q;  1CUK A;  3CCS A;  3J81 c;  3G6E A;  4DV1 L;  4JI5 Q;  2MFI A;  1CKO A;  3ERS X;  4C3H H;  2NVX H;  3K8A A;  1E1T A;  1BKB A;  1BVS A;  4LF4 Q;  3PO2 G;  5DLQ E;  1IZ6 A;  1E22 A;  2K14 A;  3UDF A;  1Y1V G;  5ELN A;  2Z0S A;  1JJC B;  4YY3 Q;  1Q86 C;  1VQC A;  4IPC A;  3H0G H;  1PYB A;  4DK6 C;  4A3E G;  3CF5 A;  2UU9 L;  1HNW L;  4ALP A;  3GTQ H;  4UP9 A;  4GKJ Q;  1Q8K A;  3HOU H;  4HID A;  2N3S A;  4JI6 L;  4LFA Q;  2R93 H;  1VQM A;  1IXR A;  2IY5 B;  3VDY A;  1TWF H;  2PNH A;  3J7Z C;  1YI2 A;  4NXM Q;  4GOP B;  3CPW A;  1IBM Q;  1YZ6 A;  1A0I A;  4BY1 H;  1X54 A;  3UDG A;  1K0R A;  2B29 A;  1OXX K;  4A3G H;  5IP9 G;  3CCR A;  2E5L L;  4JI1 Q;  2R92 H;  4APV A;  1XMQ Q;  1IBL L;  3DM3 A;  2R92 G;  3GTO H;  2CFM A;  4YWL A;  1NBW A;  2ZTD A;  3HFZ B;  3STB D;  2CCZ A;  3PF4 A;  3SGI A;  1A63 A;  3F1Z A;  2F4V Q;  1E1O A;  2A1A A;  4B3S L;  1PH5 A;  2AHO B;  4JI3 Q;  1GO3 E;  2UU9 Q;  4UY8 C;  5IT9 c;  2K5N A;  3CP0 A;  1UE6 A;  3NEN A;  4OO1 I;  3KF6 A;  1Q12 A;  2OQK A;  1YJW A;  4WJ4 A;  3CAM A;  1Q1B A;  4LFC L;  1L1O A;  2IHE A;  4DV4 Q;  2ZM6 L;  5FLM H;  1PA6 A;  2UUB L;  3A0J A;  3W1G A;  4P75 A;  5JEA J;  1PFS A;  3CCL A;  2HT1 A;  4L5Q A;  3JC6 6;  1B8A A;  1JJ2 A;  1I94 L;  1E3P A;  3BZC A;  4B3T Q;  3E9I A;  1VQ8 A;  2E5L Q;  4LUV A;  3HOV G;  1EYG A;  4JI4 Q;  1VQO A;  2VUM H;  2UXC L;  1QUQ B;  2KCT A;  3OYY A;  4OWW B;  3S2D H;  4DUY L;  5J3B A;  1MJC A;  4B3M Q;  2NVY H;  4HIK A;  4OWT B;  4YCV A;  3K7A H;  1BBW A;  2WAQ G;  4H02 A;  4X62 Q;  4DR4 L;  1Q81 C;  4JI8 L;  1N8R C;  1SR3 A;  1KRT A;  1UE7 A;  5GAG C;  2ZM6 Q;  3GTM H;  2K5H A;  3TRZ A;  5JEA G;  3M4P A;  1VQI A;  4YWK A;  1AE2 A;  4YCW A;  1N32 Q;  4YWM A;  2NN6 I;  1NMF A;  4NPS A;  3RLO A;  3I4N G;  4A93 H;  4DV7 Q;  4JC0 A;  5ELO A;  2HHH L;  3A5Z B;  1FL0 A;  4OX9 Q;  1AH9 A;  1XJV A;  5IP7 G;  4KHP Q;  4DR1 Q;  4TVA B;  2A8V A;  4DV2 Q;  3S2H H;  4C3I H;  3J80 c;  4JYA Q;  1NJI C;  4JI4 L;  2VS1 A;  4IO9 A;  1YIT A;  3JAM i;  3BZK A;  4DUY Q;  2QEX A;  4DV6 L;  3M7N A;  3HOY H;  4DR4 Q;  1PVO A;  1X3E A;  1HNW Q;  1GKH A;  1B70 B;  3RN2 A;  5GAH C;  2VW9 A;  3HOV H;  1D8L A;  2VY3 A;  4QY7 A;  3FHW A;  1X6O A;  4Y7N H;  4PZ7 A;  1TWH H;  1H95 A;  3K0X A;  4LF7 L;  3LGJ A;  2EXD A;  3B6Y A;  3PO3 G;  2Q2I A;  3M9B A;  3PV0 A;  4GNX A;  1WI5 A;  3CCQ A;  2E2H H;  2DGY A;  3KOJ A;  4LF8 Q;  2K5V A;  3ULL A;  3TS2 A;  4POG A;  2UXD Q;  4DPG A;  4DR1 L;  1S3O A;  4JG2 A;  3RLN A;  4DR5 L;  1Y1V H;  4X66 L;  3W1B A;  5AJ3 L;  1LM0 A;  4R4I A;  5BR8 Q;  1XMQ L;  1XNR L;  3M4O H;  5K36 G;  3K81 C;  3L7Z C;  1L0W A;  2R7Z G;  2PI2 A;  2E8G A;  1DGS A;  2C35 B;  1JMC A;  2OWO A;  2VZA A;  2XTI A;  2F4V L;  3HOZ H;  5EAY A;  4YHH L;  1YHB A;  3HOX G;  1I6H H;  2PMZ E;  2MO1 A;  5IP7 H;  3F2C A;  3RZD H;  2UUA Q;  3KYH C;  2Q2U A;  4NXN Q;  2KBN A;  5IY0 A;  4P71 A;  1YJN A;  2R93 G;  1Q1E A;  1N33 Q;  4DR7 Q;  1VQJ A;  3W5O A;  2Z6K C;  4LNQ A;  3D0F A;  1KHI A;  2JEB I;  1KAW A;  1Y14 B;  1IBK Q;  2CWP A;  4BBS H;  4GKK L;  1LTL A;  3I7F A;  4PG3 A;  4HJ5 A;  3PUW A;  1X56 A;  1C9O A;  1XPU A;  1GD7 A;  4WJ3 M;  4B3R Q;  3PO2 H;  2QA4 A;  3AFP A;  5HY6 A;  2NZO A;  3UDX A;  1I94 Q;  4A4I A;  3GO5 A;  3F2D A;  4DV3 L;  2ZTC A;  4BY7 G;  3Q8D A;  3PIP A;  2GVA A;  2B63 H;  2JJQ A;  4GOP A;  4LF5 Q;  5M3M H;  2K52 A;  5GAD C;  3HOU G;  5C0X I;  4XTC S;  3TQY A;  2IX0 A;  1I50 H;  2IT1 A;  2Y0S G;  4LW1 A;  5FLM G;  1RIP A;  2AMC B;  1VQ4 A;  5LMU Q;  1PH1 A;  4AQY L;  2BA1 A;  2LXK A;  1AE3 A;  2CKZ B;  1KQS A;  2KHJ A;  3MEF A;  2JK8 A;  2LXJ A;  4IOC A;  1HNX L;  4NXM L;  4BA1 I;  4GKK Q;  2JA5 H;  2JA6 H;  1PH2 A;  3S1R H;  1TXY A;  1HJP A;  3J81 i;  1XNQ L;  4DAY B;  2HHH Q;  4LUZ A;  1VQ6 A;  1I3Q H;  1YIJ A;  2JE6 I;  4R4C A;  4IFD G;  3CQZ H;  3ER0 A;  1K83 H;  5IWA L;  2VUM G;  1MIU A;  2K4K A;  4HJ8 A;  3KLW A;  1U5K A;  1C7Y A;  5JJK A;  4JV5 L;  4P73 A;  4LWC A;  1ASZ A;  2UXB Q;  3J7A 5;  1EQR A;  1TWA H;  4B3S Q;  1VQA A;  4DNI A;  3G71 A;  4JI3 L;  1UE1 A;  4DV0 Q;  4OXP A;  5M5Y H;  2VQF L;  1M1K C;  5GQO A;  2I5H A;  3NEM A;  3GTG H;  3KFU A;  4LF6 L;  3T1H L;  1EOV A;  1CSP A;  4A3D H;  2ZTE A;  1EQQ A;  3F8T A;  5FJ8 G;  3GTL H;  2H5X A;  4AIM A;  2ID0 A;  3E0E A;  1V1Q A;  3CW2 C;  3OW2 A;  1TWG H;  4QL5 A;  3AFQ A;  3RR5 A;  4LF8 L;  1G6P A;  3IRB A;  3UE0 A;  4IPH A;  1WYD A;  2ASB A;  1CKN B;  1XPR A;  2VQE Q;  3L0O A;  5IWA Q;  5AJ3 Q;  1S40 A;  1XNR Q;  1UE5 A;  2CWA A;  3HKZ E;  2UUC Q;  3G48 A;  2N78 A;  2Q2T A;  4QGU A;  1V9P A;  2JA7 H;  3S1N H;  4UP8 A;  4GN3 B;  4YHH Q;  4DUZ L;  4JCV E;  1I5F A;  1NE3 A;  3T1Y L;  3EIV A;  1SRO A;  1X3G A;  3E9H A;  2Z6K A;  1NTG A;  4A3I H;  1XMO L;  3J80 i;  2OQ0 A;  1L2F A;  1HNZ Q;  3F2B A;  1OTC A;  4A3F H;  1LUZ A;  1OXT A;  1VQH A;  1MJE A;  4LF6 Q;  2R7D A;  3EN2 A;  1EIY B;  3K80 C;  4LFA L;  4IJH A;  3ICE A;  2XGT A;  4LFB Q;  2ALY B;  3CPF A;  4QJF A;  1YNX A;  4HJA A;  1HZA A;  3S1Q H;  1IBM L;  4XIG S;  1IL2 A;  4AH6 A;  4DV7 L;  2OTJ A;  4K0K L;  2A19 A;  3M3Y H;  2YTY A;  2D0P A;  2Y0S E;  5LMN Q;  2VQE L;  2JA8 G;  3RZO H;  4A3D G;  5IYD H;  5IYD G;  2JA8 H;  1XTD A;  2WP8 J;  2R7Z H;  2CQO A;  3A5U A;  4X65 L;  1IBL Q;  4JYA L;  3ZJY C;  4R4Q A;  1Z9F A;  1OXU A;  2UUC L;  3RLF A;  1J6Q A;  3HOX H;  4A3G G;  1SE8 A;  2AKW B;  4GNX C;  2JQO A;  1X3F A;  1VCI A;  1P16 A;  1VQB A;  2WB1 G;  1CKM A;  4BBR G;  3D31 A;  1EWI A;  2F3I A;  3FP9 A;  1V43 A;  1W3S A;  1W2B A;  3PUZ A;  4DAM A;  4ME3 A;  4C2M H;  3I56 A;  1KIX A;  4LFC Q;  3ULJ A;  4UPA A;  4IFD I;  4DV4 L;  4AQY Q;  2D0O A;  2HQL A;  2LSS A;  4O0A A;  4MNO A;  1Q7Y C;  1P8L A;  4GLV B;  4DR6 L;  2KEN A;  1A62 A;  1HNX Q;  4RMF A;  3RNU A;  4O2D A;  1FGU A;  1SMX A;  2Q2H A;  2HIX A;  2BH8 A;  1TWC H;  1IYJ B;  1XNQ Q;  2GVB A;  3PUV A;  3CCV A;  1QZG A;  4B3T L;  1VS0 A;  4KLK A;  4TQU S;  4X65 Q;  5C0X G;  1X55 A;  3PIO A;  1VQ5 A;  3I4N H;  4A75 A;  1EFW A;  3DLL A;  1BBU A;  3EBE A;  3KJO A;  4HJ7 A;  4GS3 A;  3HOW H;  4JI2 Q;  4DR2 L;  4GN5 A;  2UUA L;  2I5M X;  4BY1 G;  4GKJ L;  3GTJ H;  1N33 L;  3T1H Q;  3FKI G;  1YBY A;  5FLX c;  2N49 A;  3HKS A;  1WCM H;  2N8N A;  1O7I A;  4L5T A;  4QIW E;  3RN5 A;  1QZH A;  3HOY G;  1PH3 A;  3S16 H;  4DR6 Q;  2BA0 A;  1R9T H;  2K50 A;  3CC4 A;  1PH6 A;  1C0A A;  1OXV A;  3CCU A;  1UEB A;  5IYC G;  1ASY A;  3GTK H;  3H0G G;  2I0Q A;  1GVP A;  4X64 L;  1LYL A;  1NY4 A;  1HH2 P;  3H3V I;  1PHJ A;  1Y1W G;  5JJI A;  4OON A;  3BJU A;  1Q82 C;  4OWX B;  1N34 L;  2B63 G;  5JJL A;  1E7Z A;  3G4S A;  4DV5 Q;  4DV6 Q;  2ATW A;  1G29 1;  4A3B H;  4GNX B;  5HGQ A;  4LF5 L;  1E24 A;  1YEZ A;  3K7U C;  4GN4 B;  4IOA A;  1XMO Q;  1L1O C;  3OTO Q;  3TS0 A;  3PCO B;  2JA5 G;  4HIO A;  3M85 A;  1Q46 A;  5C3E H;  1VQP A;  2VNU D;  3WWV A;  3S15 H;  2QGQ A;  1VQE A;  1J5E L;  1JJG A;  1K73 C;  4A3C H;  1MKH A;  2B3G A;  4BA2 I;  1VQ9 A;  4JBW A;  4HJ9 A;  1PYS B;  1FVI A;  1PH8 A;  4JI7 L;  3U58 A;  3PO3 H;  1EIF A;  1WFQ A;  4MTN A;  1FJG Q;  2WFW A;  1SRU A;  4JBM A;  4C3J H;  4A3K H;  5C4X G;  2WAQ E;  1WOC A;  1L1O B;  1KRS A;  4X66 Q;  3KDF A;  1KL9 A;  2AWO A;  2EQS A;  1VQ7 A;  1S72 A;  2ZJP A;  4HIM A;  4AYB G;  3CXC A;  4JV5 Q;  1HZC A;  2PI2 E;  4IPG A;  5C0X J;  1PV4 A;  2UXB L;  2E2J H;  4A3M H;  2VL6 A;  3M4Q A;  1SLJ A;  2RF4 A;  1CKN A;  2D62 A;  4DR3 L;  4A93 G;  1JT8 A;  4JI6 Q;  1JE5 A;  3U50 C;  3CMA A;  1QUQ A;  4BXX G;  1JB7 A;  3UE1 A;  4JI0 Q;  4BXX H;  1J5E Q;  1IBK L;  2MO0 A;  3HOW G;  1QVF A;  4K0K Q;  3S24 A;  3PUX A;  3S14 H;  2R7F A;  2YTX A;  4OX9 L;  3GDE A;  3I55 A;  1G51 A;  1VQG A;  3FKI H;  4JI1 L;  3I2Z A;  4PMW A;  4DV3 Q;  4DV2 L;  1SN8 A;  4JBK A;  3PSI A;  2ZJR A;  1RL2 A;  2KCM A;  4R1J A;  4IPD A;  4BBR H;  5LMN W;  4A3C G;  4DUZ Q;  2OTL A;  5IYC H;  2I5L X;  4P72 A;  3T1Y Q;  2YU9 H;  4EQ5 A;  2NVQ H;  4LUO A;  1HR0 L;  4DR2 Q;  4JI2 L;  1Y1W H;  3I4M G;  3CCM A;  4FDB A;  1HNZ L;  1GM5 A;  1K3R A;  1EUJ A;  2HIV A;  4PZ6 A;  2BH2 A;  5M3M G;  3PUY A;  4LFB L;  4LF7 Q;  4YCU A;  2YV5 A;  4GLX A;  1K8A C;  1YJ9 A;  4A3M G;  1VQD A;  1A8V A;  4JOI C;  1Z47 A;  2GN5 A;  2JA9 A;  3KF6 B;  4X64 Q;  4DV1 Q;  5LMN L;  1PH9 A;  3HOZ G;  2UXD L;  4LF4 L;  4JBJ A;  4NB3 A;  5IP9 H;  3BU2 A;  2UXC Q;  5M3F H;  3NEL A;  2IX1 A;  1QVC A;  5M3F G;  2YTV A;  2FXQ A;  4B3M L;  3PGZ A;  5GAE C;  1PH4 A;  1N36 Q;  4A3L G;  3I4O A;  2MNA A;  5C4X H;  4DV0 L;  4A3K G;  1HZB A;  2MQH A;  2VQF Q;  4BBS G;  3KF8 B;  3TRE A;  1B7Y B;  4NXN L;  5E7N A;  2K75 A;  5GRO A;  1WJJ A;  1HR0 W;  3TEH B;  1X9N A;  1KC8 C;  2RHS B;  2RCN A;  4AYB E;  3S1M H;  2NZH A;  1CSQ A;  1YHQ A;  1PH7 A;  1VQL A;  4A76 A;  3U4V A;  1HZ9 A;  1XPO A;  1VQN A;  4UP7 A;  1YHA A;  4A3E H;  1FJG L;  4BY7 H;  3CCJ A;  1YVC A;  4B3R L;  4KHP L;  5IYB G;  4L5R C;  1N9W A;  2IHF A;  1M90 C;  4QQB X;  3JAM c;  3J81 j;  4MZ9 A;  3A74 A;  3AYH B;  4EX5 A;  1UWV A;  3H3V H;  2NN6 G;  4DK3 C;  4P74 A;  5M5W H;  4R4O A;  1N36 L;  3GTP H;  1KXL A;  3CME A;  4J15 A;  4LF9 Q;  2JA7 G;  1T9H A;  1K9M C;  4PZ8 A;  4R4T A;  3HKZ G;  4KI0 A;  1WCM G;  4DR3 Q; 
#chains in the Genus database with same CATH topology
 3GD7 A;  4B08 A;  3L2P A;  3HRZ C;  2SDF A;  3U4Z A;  3S9W A;  2EJF C;  3FMC A;  4B9W A;  5C44 G;  2DUD A;  1I4H A;  3DHQ A;  3NBH B;  2L15 A;  3MXN A;  1LTR D;  3I4M H;  4RG1 A;  1TII D;  4RH6 A;  3P20 A;  2E2I H;  5M5X H;  1LTI D;  5EKL A;  3H15 A;  1GXD C;  1U4M A;  1SDF A;  2R6G A;  3CRL C;  4DV5 L;  3A7A B;  1LT3 D;  3UDI A;  4CKB A;  3TP8 A;  4X62 L;  5C4J H;  1Q90 A;  2D2C C;  3AEV A;  1EQV A;  3ONA B;  3CD6 A;  4PQX A;  1HQR D;  4DNR B;  3GTG B;  5HUR A;  1B44 D;  3SK5 A;  5IE8 A;  3GTJ B;  2NVT H;  4K2K A;  1CUK A;  3SK4 A;  4K2L A;  3A7L A;  1JOR A;  1QE6 A;  3DWA A;  1Q86 C;  1IKL A;  1Y1V G;  5ELN A;  1JJC B;  2Z0S A;  4CGY B;  4DK6 C;  2UU9 L;  3FKI B;  1AW7 A;  3GTM B;  5D3D A;  4HID A;  2N3S A;  4K14 A;  3P75 A;  2R93 H;  1VQM A;  1IXR A;  1CA6 A;  3VDY A;  4JVZ A;  4NXM Q;  2KHS A;  4ZAI A;  1CZW A;  3K7A B;  1A0I A;  1K0R A;  1B50 A;  1OXX K;  1M4V A;  2K28 A;  1B53 A;  3S2D B;  2DY8 A;  4JI1 Q;  1G91 A;  4ZKC B;  2R92 H;  4APV A;  1IBL L;  3DM3 A;  4YIJ A;  5G3L F;  2A1A A;  1PH5 A;  4G4K A;  2JP1 A;  4JI3 Q;  2UU9 Q;  4P2C B;  1HXY D;  4UY8 C;  4CJ0 B;  5IT9 c;  5CMD A;  1UE6 A;  4WJ4 A;  1Q1B A;  1L1O A;  3K5O A;  4R8N A;  2ZM6 L;  5FLM H;  1H9K A;  3A0J A;  1SMY D;  5JEA J;  5C3E B;  1XX8 A;  2HDM A;  2HT1 A;  4L5Q A;  1T5E A;  3JC6 6;  1B8A A;  1JJ2 A;  4KJO A;  4LUV A;  3R93 A;  5IOC A;  1EYG A;  4L8J A;  3SVM A;  3S2D H;  4FF2 A;  3MHB A;  2QCP X;  3K7A H;  5A2Q E;  4XYO A;  4ZK9 B;  1K8O A;  1PTO D;  1Q81 C;  1BDO A;  3E3X A;  1FD7 D;  4JI8 L;  2F0V A;  1N8R C;  1SR3 A;  1KRT A;  1TWG B;  1BF4 A;  1UE7 A;  1X32 A;  3HOU B;  2K5H A;  3S16 B;  1GUO A;  1AE2 A;  1ML0 D;  3HOY B;  4CKE A;  1JOO A;  1I4G A;  5M5Y B;  1JR0 D;  4NMZ A;  2DNC A;  2FMM A;  4DR1 Q;  1MSH A;  1DCZ A;  2CW0 C;  3J80 L;  2R61 A;  2A5H A;  4IO9 A;  1YIT A;  3JAM i;  3C3L A;  1HNW Q;  4RKL A;  3RN2 A;  4EQO A;  1D8L A;  2VY3 A;  4QY7 A;  5EBD A;  1X6O A;  4LK1 C;  2OXP A;  3K0X A;  3PO3 G;  2EXD A;  3B6Y A;  4NDX A;  2E2H H;  3CCQ A;  4HCE A;  2DGY A;  3KOJ A;  1HTL D;  2B2U C;  3TS2 A;  4JK1 C;  2Z9H A;  3RLN A;  5E4X A;  5AJ3 L;  2CW0 D;  3L7Z C;  4WFN 3;  3DMU A;  2E2I B;  2C35 B;  1SJH D;  2QF7 A;  4OGQ C;  2OWO A;  2VZA A;  1WD0 A;  2B2V A;  5C0X H;  1LV9 A;  5DEH A;  5I6Y A;  2PMZ E;  4JPB W;  1I4Q A;  3M3Y B;  1DYQ A;  1OO9 B;  1H9R A;  1YJN A;  3FPU B;  5CV9 A;  1JOQ A;  2Z6K C;  2JEB I;  1JIC A;  4BBS H;  1IKM A;  1B2T A;  1C4Q A;  2K5D A;  1C9O A;  1B3Q A;  4B3R Q;  3PO2 H;  3UDX A;  5HY6 A;  2NZO A;  1I94 Q;  1IHZ A;  2L5T A;  4KN7 C;  1ONL A;  1SE3 A;  1LTA D;  2FMC A;  3A8J E;  3Q8D A;  3PIP A;  2GVA A;  1I4X A;  1STA A;  5EKK A;  5GAD C;  4K6D A;  5C0X I;  3TQY A;  4LW1 A;  2WB1 B;  1TS2 A;  1VQ4 A;  1YNN C;  1X3P A;  2XNA C;  2BA1 A;  2CKZ B;  1KLU D;  3MEF A;  4NXM L;  4BA1 I;  2JA5 H;  5C4X B;  4O42 A;  4DAY B;  1XNQ L;  1YIJ A;  2J4X A;  4CJ2 C;  4DK0 A;  1TS5 A;  3U9O A;  4IFD H;  5IWA L;  2VUM G;  4PMB A;  2K4K A;  5J22 A;  4FF3 A;  2NBF A;  4JV5 L;  4P73 A;  3GP7 A;  1WVL A;  2UXB Q;  1EQR A;  4DNI A;  2HCC A;  3H91 A;  2E75 C;  2VQF L;  1DOL A;  2FJ2 A;  2XIW A;  1SFO B;  3KFU A;  1TU2 B;  2PPB C;  1PTO B;  1IW7 C;  2JYO A;  2H5X A;  1Y69 U;  5ELE A;  1LAB A;  3OWF A;  1G6P A;  4N8X 1;  4IPH A;  3L0O A;  1B1Z A;  5IWA Q;  1XNR Q;  2CWA A;  2EE1 A;  2JA7 H;  1SYF A;  2VUM B;  2AQ1 B;  3T16 A;  1NE3 A;  3EFX D;  4X3S A;  1EFI D;  3HEJ A;  3J80 i;  1OTC A;  5C44 B;  1LUZ A;  5KND A;  1VQH A;  4LF6 Q;  1GUW A;  4KN4 C;  3LX0 A;  4IJH A;  4LFB Q;  5KIX A;  1GUN A;  1HZA A;  2F0O A;  3S1Q H;  1IL2 A;  1STE A;  3EVQ A;  5C4H A;  3K5L A;  2JA8 G;  3RZO H;  1I6H B;  1IBL Q;  4CDE C;  3ZJY C;  2SNS A;  4A3K B;  2L1B A;  4HSV A;  3H6M A;  1VQB A;  1CKM A;  4L6T B;  1RCV D;  2A6H C;  3D3R A;  3FP9 A;  1V43 A;  5G3L D;  4KHV A;  1W2B A;  4ME3 A;  4C2M H;  4TRD A;  1KIX A;  4LFC Q;  3ULJ A;  1QWY A;  2B2Y A;  3M7G A;  3TME A;  4AQY Q;  1SNO A;  1P8L A;  3JAM L;  1HNX Q;  2A68 D;  2BH8 A;  2M9V A;  1QZG A;  4TQU S;  5C0X G;  1VQ5 A;  4ODG A;  3I4N H;  3K58 A;  4A75 A;  1JOK A;  1PRT F;  3A8K E;  4TKO B;  3EBE A;  1Z7T A;  2RSO A;  2FFK B;  3N6R A;  5FLX c;  1WCM H;  1CM9 A;  1O7I A;  3MXP A;  1CI3 M;  1QZH A;  3HOY G;  1PH3 A;  1ICW A;  1OXV A;  3CCU A;  4KJN A;  3H0G G;  1GVP A;  4Z9C B;  1LYL A;  4DK1 A;  1V1O A;  3CHB D;  1HH2 P;  1EIH A;  1F9Q A;  2H4O A;  1AFP A;  3BJU A;  3OHX C;  1E7Z A;  2ATW A;  4GNX B;  2NN6 H;  3KBG A;  4IUR A;  3S17 B;  1E24 A;  4GN4 B;  1TT2 A;  2PNR C;  4DU9 A;  1B9M A;  4E6I A;  3MFY A;  3PCO B;  2JA5 G;  2PYK A;  2VNU D;  5C3E H;  1QJO A;  5FK9 C;  1J5E L;  1VDZ A;  2F0H A;  4BA2 I;  3RUZ A;  5HGT A;  1PYS B;  2HDL A;  4J1M A;  3PO3 H;  2E2J B;  1EIF A;  4MTN A;  3OW7 A;  1I4R A;  2K01 A;  1KLG D;  4JBM A;  1MI2 A;  5C4X G;  2WAQ E;  1L1O B;  4C3J G;  4MTK A;  3LNN A;  2EY5 A;  1VQ7 A;  2X6L A;  2JA8 B;  1PTO F;  1R4Q B;  4HMI A;  3CXC A;  4JV5 Q;  3GTO B;  2A6E D;  2E2J H;  4K5X A;  3SE0 A;  4A3M H;  1RHP A;  3M4Q A;  1D1K A;  1ZEQ X;  4A93 G;  1S5B D;  1I6V C;  3CMA A;  4BXX G;  1JB7 A;  3VYR A;  1J5E Q;  2R93 B;  3DWQ A;  2MO0 A;  2SOB A;  3KBX A;  2R7F A;  3GDE A;  3ITP A;  1CK1 A;  2KA7 A;  3ND9 A;  4M1U B;  3SK8 A;  2OTL A;  5IYC H;  3HG9 A;  4EQ5 A;  4LUO A;  1HR0 L;  2NB0 A;  4DR2 Q;  3K57 A;  3R8B A;  1JQY D;  3D8G A;  4XQQ A;  2NVT B;  2RDH A;  4LF7 Q;  4YCU A;  3BS1 A;  2GN5 A;  1H9J A;  4X64 Q;  3HOZ G;  2UXD L;  3X3M A;  1PH9 A;  2NTS A;  2PZU A;  3CU7 A;  1JWU D;  3NP8 A;  3QOJ A;  4JBJ A;  2BDO A;  2UXC Q;  5M3F G;  4B3M L;  5GAE C;  1WTQ A;  1PH4 A;  1N36 Q;  1QNK A;  2PZT A;  1QG7 A;  2K03 A;  1B7Y B;  5COR A;  2BOS A;  2RCN A;  2F4I A;  1EL0 A;  1XPO A;  1AN8 A;  1YHA A;  4XYQ A;  1FJG L;  1PZK D;  5IYB G;  1N9W A;  1HCZ A;  3J81 j;  5CYU A;  4MZ9 A;  3A74 A;  4EX5 A;  3A54 A;  4QIW B;  4DK3 C;  1HRJ A;  4IUT A;  1N36 L;  3GTP H;  2F0G A;  5IT9 E;  4J15 A;  2KVM A;  4PZ8 A;  4R4T A;  4KI0 A;  4HED A;  2K33 A;  1ET9 A;  4DKA C;  3PF5 A;  2XWJ B;  3C2P A;  4EVO A;  5C44 H;  2UUB Q;  3S15 B;  3CCE A;  4JI0 L;  4A3L H;  4RGT A;  2EIF A;  2MHV A;  4L5S A;  4KHZ A;  2K04 A;  1GHJ A;  4K8J A;  4XQN A;  3AQQ A;  2VXW A;  4DR5 Q;  1IYU A;  5BR8 L;  5CBE E;  2ZJQ A;  4ULL A;  4YY3 L;  4A3J H;  4JOI A;  2G9D A;  2IPK D;  1EYD A;  2V4D A;  1K8G A;  4DAY A;  5FJ8 H;  4LF9 L;  2JA6 G;  1D7Q A;  4HMJ A;  1PTO H;  1VF7 A;  4OO1 G;  1EEI D;  2QW7 A;  4DR7 L;  1SXT A;  4R9W A;  3H3V C;  3CCS A;  4DV1 L;  3G6E A;  4U68 A;  3K8A A;  4LF4 Q;  3PO2 G;  5DLQ E;  1IZ6 A;  1E22 A;  1VQC A;  3DUZ A;  4V0B A;  1HFN A;  3Q0A A;  2Q8I B;  3CF5 A;  1HNW L;  2AQ2 B;  1PRT D;  1G2T A;  3NK9 A;  1Q8K A;  2KCN A;  4BWG B;  4LFA Q;  3X3N A;  2O5J C;  1HFG A;  1YI2 A;  1STB A;  2WKD A;  3CPW A;  4GOP B;  2A68 C;  1IBM Q;  1IL8 A;  1G6Z A;  4BY1 H;  3UDG A;  2F0S A;  2B29 A;  1MBY A;  1A2U A;  1TY2 A;  4OO1 H;  2E5L L;  4RHR A;  1XMQ Q;  3GTO H;  3STB D;  2ZTD A;  3SGI A;  3PO2 B;  4B3S L;  2AHO B;  1XTC D;  5CGK A;  1PXU A;  4OO1 I;  3KF6 A;  1Q12 A;  1YJW A;  2MUY A;  2SNM A;  4DV4 Q;  4DF7 A;  5CV7 A;  3MC0 B;  4RA8 A;  1PFS A;  5CV8 A;  2K05 A;  3CCL A;  3NTH A;  3W3A A;  1TQO A;  1I94 L;  1D6E C;  1EU4 A;  3BZC A;  2E5L Q;  3QB3 A;  1EU3 A;  2QIL A;  3HOV G;  4HTH A;  2B2W A;  1JWM D;  1QUQ B;  3OYY A;  1RDP D;  3A8I E;  1MJC A;  4DUY L;  4B3M Q;  4OEM B;  4O1N A;  1BBW A;  4X62 Q;  4JW0 A;  1D5Z C;  4DAP A;  1W6J A;  1GUS A;  3GTL B;  5JEA H;  4IAL A;  2B2T A;  5BN5 A;  1DZ1 A;  1RTN A;  4NP5 A;  4A3D B;  4A93 H;  4JC0 A;  2QDB A;  2BE5 D;  1FL0 A;  4KHP Q;  1E2W A;  3HOW B;  1LTB D;  2MP1 A;  1PFB A;  4TVA B;  3S2H H;  5EJW A;  4JYA Q;  5T1I A;  2F03 A;  2NVX B;  4DUY Q;  2IL8 A;  1V8Q A;  1X3E A;  1GKH A;  1B70 B;  5GAH C;  2VW9 A;  4KY6 A;  3HOV H;  4FXD A;  3Q24 A;  1TWH H;  1H95 A;  4LF7 L;  2Q2I A;  4GNX A;  2IJ0 A;  3GQB A;  1WTV A;  4LF8 Q;  5IGC A;  1S3O A;  4JG2 A;  4DR5 L;  1Y1V H;  1XNR L;  4R4I A;  5BR8 Q;  2LKV A;  5LHY 1;  3M4O H;  5K36 G;  1V1P B;  1DGS A;  3NBH A;  1SMY C;  2F4V L;  1UAP A;  5D65 A;  5EAY A;  1FR3 A;  3R3O A;  1I6H H;  3RZO B;  2MO1 A;  2KBN A;  5IY0 A;  2OF1 A;  4K6L A;  4DR7 Q;  1VQJ A;  3NPP A;  3W5O A;  4IQZ A;  1Y14 B;  2XSC A;  1IBK Q;  4J6H A;  2JXM B;  1SJE D;  1XPU A;  4HJ5 A;  3PUW A;  1X56 A;  5I9O A;  5M9O A;  2QA4 A;  4DV3 L;  1AEX A;  2ZTC A;  3NSW A;  1EQT A;  3P7J A;  2JA7 B;  2F0J A;  2CH4 A;  1KDC A;  2JJQ A;  4LF5 Q;  1U4R A;  1Y1V B;  1K28 A;  2AQ3 B;  4XTC S;  3EA6 A;  2Y0S G;  1K0S A;  5FLM G;  2AMC B;  1C48 A;  1PH1 A;  1KQS A;  2KHJ A;  3ERQ A;  1HNX L;  5E3F A;  3NXW A;  3OWE B;  2NWG A;  1SEB D;  1VMP A;  4RGM A;  1K83 H;  5M3F B;  1MIU A;  5JJK A;  3J80 E;  5A35 A;  4LWC A;  2MPM A;  1TWA H;  3S2H B;  3G71 A;  1Y8N B;  1UE1 A;  3CQZ B;  5I6W A;  3VR4 A;  5FLX E;  1F77 A;  5GQO A;  3GTG H;  4EQN A;  3T1H L;  3T51 B;  2JA6 B;  1EQQ A;  4PV1 C;  5FJ8 G;  1EY7 A;  4AIM A;  2ID0 A;  3E0E A;  1WTW A;  3CW2 C;  3RR5 A;  2KCC A;  4K5W A;  3UE0 A;  3VA5 A;  2ASB A;  1CKN B;  5AJ3 Q;  1S40 A;  1BOS A;  2AUJ D;  4Q0F A;  1D1I A;  4QGU A;  4GN3 B;  3I4M B;  1SNM A;  1I5F A;  2WII B;  2KED A;  1G2S A;  3EIV A;  1SRO A;  3E9H A;  1NTG A;  4A3I H;  1L2F A;  3F2B A;  2B8G A;  3D6C A;  2ZT9 C;  2F3V A;  1MJE A;  2FIN B;  2R7D A;  5C5M A;  4LFA L;  4QJF A;  2EPB A;  2FHT A;  1YNX A;  1IBM L;  4XIG S;  1BCP F;  1KTK A;  4DNT B;  1EOT A;  3M3Y H;  4CJ1 B;  2ZXP A;  3DWP A;  1XTD A;  2WP8 J;  3NE5 B;  4QB4 A;  4JYA L;  4C3J B;  3HOX H;  1SE8 A;  3QO2 A;  2AKW B;  3HGB A;  2WB1 G;  1D5X C;  4QMG A;  4BBR G;  3MZ5 A;  3BYY B;  1EWI A;  2F3I A;  3T13 A;  5EPL A;  3I56 A;  3NWT A;  4DV4 L;  3EJI A;  2LSS A;  3BZD B;  2H1E A;  4DR6 L;  2Y0S B;  3T4A C;  2F0I A;  1CQF A;  4HSP A;  1TWC H;  1XNQ Q;  1F2Z A;  2KUM A;  3PUV A;  1F2M A;  2NUC A;  5KEE A;  3CCV A;  4RHS A;  4B3T L;  1H9M A;  1TS3 A;  1X55 A;  1WTO A;  5CV5 A;  1GUG A;  1EFW A;  1O7Z A;  3FEW X;  3GTK B;  2XVS A;  1A3V A;  1BBU A;  2F0T A;  2B39 A;  4DR2 L;  4GN5 A;  3TZD A;  4FP5 D;  2JSO A;  5AFW A;  2N49 A;  5LL6 S;  4DR6 Q;  4F7X A;  3S16 H;  3V05 A;  1R9T H;  2K50 A;  4ZUJ A;  3CC4 A;  1C0A A;  1UEB A;  1NR2 A;  3EQL C;  3GTK H;  2X6G A;  3H3V I;  1PHJ A;  5I4D A;  5JJI A;  5KNB A;  4OON A;  2F0U A;  2WAC A;  4GZY C;  1G29 1;  1BUV T;  3S14 B;  4LF5 L;  5HGQ A;  3MWY W;  1SNQ A;  4IOA A;  1DD2 A;  3TS0 A;  1Q46 A;  3KUP A;  4ZQ3 A;  3IFD A;  2QGQ A;  3MAQ A;  1VQ9 A;  4JI7 L;  3VR6 A;  4RGO S;  4OEL B;  5D14 A;  4C3J H;  1HUM A;  1FGB D;  1SNC A;  2DJG C;  2WIN B;  4X66 Q;  3JAM E;  1KL9 A;  2EQS A;  3GTP B;  1LAC A;  2BCO A;  4LAA A;  4AYB G;  2TMP A;  2PI2 E;  5C0X J;  2EJG C;  2RBM A;  5D3I B;  2DJF C;  2F0D A;  1RKN A;  1SLJ A;  1AZQ A;  3TZU A;  1CT1 D;  1ENC A;  2RF4 A;  5FOB B;  1JT8 A;  4JI6 Q;  1JE5 A;  3U50 C;  2DN8 A;  1QUQ A;  1II3 A;  4Q5V A;  4A3F B;  1QIL A;  1LT5 D;  1IBK L;  3QJY A;  3PUX A;  1EWH A;  4OX9 L;  3O13 A;  3FKI H;  4DXG A;  4LJZ C;  5CC4 A;  3I2Z A;  3NBI A;  4DV3 Q;  2ZJR A;  4HN7 A;  4P72 A;  3T1Y Q;  4C3H B;  1DON A;  1Y1W H;  3I4M G;  3CCM A;  4FDB A;  1GM5 A;  1K3R A;  1ILQ A;  1EWC A;  4CKC A;  2F0K A;  4ZCK A;  4GLX A;  1YJ9 A;  4A3M G;  1WTX A;  1Y1W B;  4DV1 Q;  5LMN L;  1SYG A;  5FO8 B;  3BU2 A;  5JOB A;  1K83 B;  5M3F H;  4CBV A;  4ZYS A;  1QVC A;  5IGD A;  4A3K G;  3KF8 B;  3TRE A;  2EVB A;  1SSO A;  2RCF A;  1KC8 C;  4RCO A;  4AYB E;  4C2M B;  3S1M H;  1PH7 A;  1VQL A;  2KQ3 A;  3U4V A;  2CVR A;  5M3M B;  4G7H C;  1E2V A;  1Z6H A;  4BY7 H;  1KAB A;  4A3M B;  1EY5 A;  3TDQ A;  2IHF A;  4L5R C;  5L37 A;  3GV3 A;  1M90 C;  3JAM c;  4V19 0;  3AYH B;  1UWV A;  2NN6 G;  4P74 A;  1KXL A;  5E4W C;  2L0C A;  1T9H A;  1QOH A;  2TSS A;  5ELC A;  3BDL A;  1UUP A;  4ZUI A;  5JPN C;  2K32 A;  3MVV A;  1NMG A;  3LWU A;  4A3I G;  3IL8 A;  2ES2 A;  2OCE A;  2A6H D;  4IJL A;  2KHI A;  1A3U A;  1BCP B;  4JI5 L;  1X65 A;  3NQT A;  1ESF A;  1BCP D;  1N34 Q;  2F3W A;  1U0L A;  2LMC B;  4J8Q A;  1GOZ A;  2X69 A;  3HP3 A;  1OXS C;  1WTP A;  1HR0 Q;  5IYB H;  1D2B A;  1KD1 C;  1GHK A;  1MHW C;  4KY5 A;  3K6O A;  4CDF C;  3OTO L;  2C5C A;  3OMG A;  2A73 B;  3KDF B;  1UNS A;  1SFO H;  2EYO A;  4XT3 B;  2WB1 E;  5FO7 B;  5IIF A;  4KV6 A;  1N32 L;  2PQA B;  5EGT A;  3WDN A;  3CC2 A;  4JI7 Q;  4JI5 Q;  2MFI A;  2NVQ B;  3ERS X;  2NVX H;  1E1T A;  5EPK A;  2PQE A;  4ABN A;  4CHT B;  4IPC A;  4N9P A;  3Q22 A;  4G7Z C;  1PYB A;  1ZYR C;  4FYD A;  4A93 B;  1STH A;  4ALP A;  3GTQ H;  4UP9 A;  1SYD A;  1TWC B;  2HD3 A;  4KKS A;  4GKJ Q;  4JI6 L;  3W2D A;  3C1E A;  5CBA E;  1I50 B;  2G5D A;  3BVG A;  2PNH A;  1ZXT A;  3J7Z C;  3I8Z A;  2RVL A;  1YZ6 A;  1X54 A;  2NVY B;  2B63 B;  2NYZ D;  4A3G H;  5IP9 G;  3OPO A;  3CCR A;  1TR5 A;  4EGV A;  2R92 G;  2CFM A;  3HOX B;  2O5I C;  1A63 A;  2N55 A;  3F1Z A;  2F4V Q;  5DM6 3;  1GO3 E;  3D4W A;  2I46 A;  3TP7 A;  2K5N A;  3NEN A;  4DXF A;  2OQK A;  4LFC L;  2IHE A;  3R2T A;  1ESR A;  4QF4 A;  1PA6 A;  2UUB L;  3W1G A;  1PZI D;  1M8A A;  3BYT B;  3RZD B;  5KYI A;  3I91 A;  1DOK A;  2L4N A;  1ROD A;  4A3I B;  2K5W A;  3VR5 A;  5F2D A;  4KY7 A;  1VQ8 A;  4IZ8 A;  1A15 A;  5TSS A;  5IGF A;  4JI4 Q;  1VQO A;  2VUM H;  3OIQ A;  1BO0 A;  4OWW B;  2KCT A;  4WOR A;  1FNV A;  2NVY H;  4HIK A;  4YCV A;  4DR4 L;  1A3T A;  4KMU C;  2E2H B;  1F9R A;  4KD4 A;  5EBC A;  2ZM6 Q;  1KNE A;  5JEA G;  1DOM A;  3M4P A;  4YWK A;  1X3Q A;  1KAA A;  2NN6 I;  4NPS A;  3RLO A;  4XXE A;  2EYM A;  3BDO A;  4DV7 Q;  3I4N G;  5ELO A;  2HHH L;  3A5Z B;  1EEF D;  4OX9 Q;  1XJV A;  5IP7 G;  3BDC A;  1GUT A;  4DV2 Q;  1TWA B;  2OEO A;  4C3I H;  3J80 c;  4JI4 L;  3AMU A;  3WOF A;  4H44 C;  4DV6 L;  3M7N A;  3HOY H;  1B3A A;  2EDG A;  4DR4 Q;  3BVM A;  1PVO A;  1JCK B;  2E74 C;  1V1P A;  4Y7N H;  4PZ7 A;  1EY0 A;  3LGJ A;  3PV0 A;  2B8F A;  5JVG 3;  2K5V A;  3ULL A;  1BBX C;  5KYL A;  4DR1 L;  3NTK A;  4BS9 A;  1LM0 A;  1XMQ L;  3K81 C;  2R7Z G;  2E8G A;  3NTI A;  4DAV A;  3HOZ H;  1XYI A;  1GJX A;  3P1H A;  5IP7 H;  2B2W C;  3F2C A;  1AZP A;  2UUA Q;  3KYH C;  2Q2U A;  4NXN Q;  2A69 D;  2R93 G;  3QR8 A;  4IUP A;  4BBS B;  1K8M A;  4LNQ A;  3D0F A;  2EZV A;  1KAW A;  2KEC A;  1S4Z A;  3BVZ A;  5C5L A;  5C6A A;  1LTL A;  4WJ3 M;  3OMC A;  1GD7 A;  1CQV A;  2QKI C;  1C8C A;  4A4I A;  2MJ8 A;  2PW7 A;  4BY7 G;  2CHB D;  4C1N K;  3M4O B;  2F0M A;  5M3M H;  2QDL A;  1EY8 A;  5C3X A;  4ZRZ A;  3V96 A;  4FNF A;  2IT1 A;  1KNA A;  4QUF A;  1RIP A;  3CKI B;  1DJR D;  1AE3 A;  5IGB A;  2JK8 A;  2LXJ A;  4IOC A;  4DN4 M;  2LY7 A;  3NWS A;  1PH2 A;  1KDB A;  1TXY A;  1HJP A;  2JN4 A;  1VQ6 A;  3PMF A;  4LUZ A;  4IFD G;  2EYF A;  5ISR A;  2C9O A;  2K6A A;  3A56 A;  1HUN A;  3KLW A;  1C7Y A;  4HAE A;  1ASZ A;  3J7A 5;  1VQA A;  2EYH A;  4JI3 L;  5C3W A;  4DV0 Q;  3NQI A;  4C1N I;  1LT6 D;  1SBB B;  1M1K C;  4A3D H;  4LF6 L;  1EOV A;  3S1R B;  4I7A A;  1A6X A;  2F0Q A;  2ZTE A;  1F9P A;  1SNP A;  4UDU C;  1NR4 A;  5I2X A;  3C46 A;  3GTL H;  3QWN A;  5EQ0 A;  1V1Q A;  5C4J B;  2R3Z A;  4LF8 L;  3IRB A;  1WYD A;  2VQE Q;  1E0B A;  1MSG A;  2HCI A;  1UE5 A;  2EYL A;  2BDN A;  1O78 A;  2N78 A;  2Q2T A;  1V9P A;  3MXU A;  5A2Q L;  4YHH Q;  4JCV E;  1NNX A;  2L12 A;  2OQ0 A;  1BR9 A;  4A3F H;  2B2U A;  3EN2 A;  4G7O C;  2XGT A;  4RWS C;  3CPF A;  3J81 L;  1PFM A;  4AH6 A;  4DV7 L;  2OTJ A;  2A19 A;  3FDT A;  2YTY A;  4B9X A;  2VQE L;  4A3D G;  1LTG D;  1FNW A;  1BXT A;  5IYD G;  1FNU A;  4R4Q A;  1Z9F A;  1J6Q A;  4GNX C;  2JQO A;  1X3F A;  3T56 B;  1P16 A;  4FF4 A;  5I2Y A;  3D31 A;  3E0J A;  4DAM A;  2RDF A;  4UPA A;  4IFD I;  1PDQ A;  4ID6 A;  4O0A A;  1Q7Y C;  4R8I A;  2KEN A;  1A62 A;  3RNU A;  1FGU A;  2HIX A;  1IYJ B;  2GVB A;  1HPC A;  4F87 A;  1Q3L A;  1STY A;  1VS0 A;  4TSS A;  4FXK C;  3PIO A;  5E1F A;  3DLL A;  2B2T C;  5KRU A;  2XRS D;  4GS3 A;  1R9T B;  4JI2 Q;  2UUA L;  2I5M X;  2KEE A;  3K0Y A;  3FKI G;  1YBY A;  3T1H Q;  3K5N A;  3HKS A;  4QIW E;  1F2L A;  2Z8L A;  2BA0 A;  1DXM A;  4ME5 A;  2I07 B;  2IWH A;  5IYC G;  1ASY A;  3H94 A;  1NY4 A;  4MIU A;  3I4N B;  3C1F A;  3I3C A;  2DNE A;  1Y1W G;  5JJL A;  3G4S A;  4DV6 Q;  4A3B H;  4C3I G;  5KNC A;  3K7U C;  1XMO Q;  2M00 A;  5CV4 A;  1STN A;  2EYJ A;  4HIO A;  3M85 A;  1VQP A;  3J7A V;  2F0N A;  3WWV A;  3S15 H;  1VQE A;  1K73 C;  2P5Z X;  4A3C H;  1MKH A;  4HJ9 A;  1PH8 A;  1FVI A;  1WFQ A;  5CV6 A;  1WOC A;  1KRS A;  4QCL A;  4M8A A;  1S72 A;  5JVH 3;  4HIM A;  4IPG A;  2UXB L;  1TY0 A;  5EKI A;  4A3G B;  3TP6 A;  1PZJ D;  4A3E B;  2DY7 A;  2D62 A;  2PCF B;  2VB2 X;  2M2L A;  2CQA A;  3KK7 A;  4KD3 A;  2O2L D;  3FRP B;  1RTO A;  1U9R A;  1AP0 A;  3HOW G;  1TS4 A;  2KOL A;  4CDC C;  3URY A;  4OIJ A;  4A3B B;  3QIA A;  1I4P A;  1LO5 D;  3I55 A;  3GTQ B;  1VQG A;  1EY9 A;  4PMW A;  4MN3 A;  3SHL A;  3PSI A;  5EPJ A;  3DEO A;  5DM7 3;  2KCM A;  3D6W A;  4IPD A;  1S5E D;  1Q8I A;  2Q8T A;  2HQE A;  2YU9 H;  3RMH A;  2IW3 A;  4OIK A;  2A69 C;  3KLS X;  1EUJ A;  2HIV A;  1O7L A;  4C56 C;  2BH2 A;  5M3M G;  4LFB L;  4IN3 A;  5J39 A;  2PZW A;  1K8A C;  1VQD A;  3G6J B;  1A8V A;  4JOI C;  1Z47 A;  2JA9 A;  3KF6 B;  2OT2 A;  4NB3 A;  2E2D C;  5C4Z A;  4CDD C;  5BN3 A;  2IX1 A;  2YTV A;  2FXQ A;  2MNA A;  3U9S A;  5C4X H;  4DV0 L;  1HZB A;  2MQH A;  2JA5 B;  2VQF Q;  3PQI A;  5E7N A;  1CFM A;  1HR0 W;  1TVX A;  2RHS B;  2NZH A;  1CSQ A;  1ICF B;  5JPM C;  1VMC A;  3L3O C;  1ENF A;  2EJM A;  3AB9 A;  5IOD A;  1HZ9 A;  3WOE A;  1LTS D;  4UHV A;  1YVC A;  2E76 C;  4KHP L;  1SAP A;  1CA5 A;  1PRT C;  4G57 A;  1NCV A;  5M5W H;  4L63 B;  2EY1 A;  4R4O A;  3CME A;  4LF9 Q;  1L0X B;  1K9M C;  3SK6 A;  3BG3 A;  1PMR A;  3PO3 B;  3J81 c;  4DR3 Q;  5C3E G;  3L9A X;  2EYP A;  2F0W A;  5LMU L;  3STB C;  2F52 A;  1H9S B;  2JEA I;  3ULP A;  2RKS A;  1EY4 A;  2RSN A;  4GOP C;  5ELF A;  4DFA A;  4A3F G;  3VYT A;  3VR2 A;  5BN4 A;  4X6A H;  1QVG A;  1UEA B;  3S17 H;  4PMC A;  1VQK A;  4IFD J;  4A3B G;  4GLA C;  3UI2 A;  3FVQ A;  4A3J G;  2EY2 A;  2PQA A;  2YYZ A;  1VQF A;  1ZYR D;  1MD2 D;  3CC7 A;  2G9H D;  2LFN A;  3MXN B;  3ZYY X;  3KJP A;  4RAU C;  4JI8 Q;  2RHQ B;  1WCM B;  2AWN A;  4POF A;  1ENA A;  2V1C C;  4Y52 H;  2SEB D;  1XXG A;  5H1S E;  5COY A;  5DAU A;  3QOL A;  1CKO A;  3MTS A;  1JC7 A;  4C3H H;  1BKB A;  1BVS A;  5T1G A;  1S5F D;  2K14 A;  3UDF A;  4YY3 Q;  4ILW A;  2ZXO A;  3H0G H;  4A3E G;  2RQX A;  1NUC A;  3HOU H;  1Y8O B;  2IY5 B;  1TWF H;  4WJW A;  2ZXR A;  1DM0 B;  1U4L A;  2IX3 A;  2RDG A;  1LT4 D;  4YWL A;  1NBW A;  3HFZ B;  2CCZ A;  3PF4 A;  1RJT A;  1J9O A;  1E1O A;  2K1B A;  2R7Z B;  2Z6B A;  3CP0 A;  3CAM A;  1EIG A;  1CTM A;  4P75 A;  1LLR D;  2L9H A;  4DA2 A;  5I9P A;  4H7B A;  4I7Z C;  4ZLT F;  4KKU A;  1E3P A;  3KLS A;  4B3T Q;  3E9I A;  5KGU A;  5K5P A;  4XT1 B;  4XQJ A;  2UXC L;  5FLX L;  3I73 A;  2J0T D;  3MFG A;  5J3B A;  5J1Z A;  2KJX A;  3MEH A;  5ELD A;  4OWT B;  4BY1 B;  2WAQ G;  4H02 A;  1HA6 A;  2J7Z A;  1EY6 A;  2F0P A;  4X3U A;  1HHV A;  2A74 C;  5GAG C;  2QEJ C;  5LL6 X;  4X3K A;  2L55 A;  3GTM H;  3TRZ A;  1VQI A;  1EYC A;  4YCW A;  1N32 Q;  3T53 B;  4IUQ A;  3LWE A;  4YWM A;  1NMF A;  1AH9 A;  4OHJ A;  2A8V A;  1T5X D;  1BCP C;  2GA4 B;  4C3I B;  1NJI C;  2VS1 A;  3PIP 3;  4IUN A;  3BZK A;  4N8F A;  1O80 A;  2QEX A;  1HQM C;  1JWS D;  3MXG A;  1BNZ A;  1I3Q B;  1SND A;  2B2Y C;  1D5M C;  2D9U A;  1SE2 A;  3FHW A;  4N9T A;  3M9B A;  3J7Y W;  1WI5 A;  1YNJ D;  4POG A;  2UXD Q;  4DPG A;  4KK7 A;  4A3J B;  1YNN D;  4X66 L;  3W1B A;  1CHQ D;  3IAY A;  1L0W A;  2PI2 A;  1JMC A;  2XTI A;  4YHH L;  1YHB A;  1W6K A;  3HOX G;  3AU7 A;  3RZD H;  4P71 A;  2ICE C;  1Q1E A;  1N33 Q;  4KKT A;  1QCB D;  2K7V A;  1KHI A;  2CWP A;  4GKK L;  2K5Q A;  4PG3 A;  3I7F A;  3ERO A;  2AUK A;  2D5D A;  4FVM A;  3I90 A;  3AFP A;  4DGZ A;  4EQP A;  3GO5 A;  3SEB A;  3F2D A;  3IFT A;  4FXG C;  3VA7 A;  1IYV A;  1SYC A;  4RGN A;  2B63 H;  1S5D D;  3HKZ B;  3TBI B;  4GOP A;  2K52 A;  4K5V A;  4S3S A;  2BE5 C;  3HOU G;  3OOC A;  2IX0 A;  1I50 H;  4F88 A;  4I65 A;  2EOT A;  2XN9 C;  5LMU Q;  4AQY L;  2LXK A;  2CH4 W;  4U67 3;  4GKK Q;  4IUU A;  2JA6 H;  3VYS A;  3S1R H;  2WKC A;  1A2T A;  3J81 i;  2HHH Q;  1I3Q H;  2Z1C A;  2JE6 I;  4R4C A;  3CQZ H;  4PNY A;  3ER0 A;  4AYB B;  1ZKO A;  1Y8P B;  4HJ8 A;  3GV6 A;  1U5K A;  3I70 A;  2LS0 1;  4B3S Q;  2N88 A;  5IT9 L;  4OXP A;  5M5Y H;  2I5H A;  3NEM A;  1B4O A;  2PMZ B;  1CSP A;  1STG A;  2PW5 A;  5FO9 B;  3F8T A;  4H0L C;  3FPP A;  3OW2 A;  1TWG H;  1JE4 A;  4XDX A;  4WRD A;  1CZG A;  3AFQ A;  1B9N A;  4QL5 A;  4X3T A;  1XPR A;  3Q6S A;  1F2Y A;  3I72 A;  3HKZ E;  2UUC Q;  3G48 A;  2WAQ B;  3E6Z X;  3S1N H;  1S5C D;  4UP8 A;  4DUZ L;  3T1Y L;  1RD9 D;  4LMQ D;  1X3G A;  3N52 A;  2Z6K A;  4QUC A;  1XMO L;  1HNZ Q;  1OXT A;  4KTA A;  1EIY B;  3SXH A;  3K80 C;  3ICE A;  4F8M A;  2ALY B;  3SR1 A;  3G7L A;  4HJA A;  1U4P A;  1SE4 A;  3VYU A;  2D0P A;  2Y0S E;  4RCN A;  5LMN Q;  5IYD H;  5JJZ A;  1L0Y B;  2JA8 H;  2R7Z H;  1XWE A;  2CQO A;  3A5U A;  4X65 L;  3RD4 A;  1FYC A;  3HOZ B;  1OXU A;  2UUC L;  3RLF A;  4A3G G;  2Z4H A;  4BY7 B;  1VCI A;  2R92 B;  2ENB A;  4FO2 A;  2Z4I A;  1F9S A;  1RF2 D;  1W3S A;  2WV6 D;  1WTH A;  3PUZ A;  3S1M B;  3A55 A;  2D0O A;  2HQL A;  4MNO A;  1TWF B;  4GLV B;  1TWH B;  4RMF A;  4Y7N B;  4O2D A;  3V2T A;  1SMX A;  2Q2H A;  3Q23 A;  3HOV B;  2RA4 A;  3KF8 A;  3HZX A;  4KLK A;  3H0G B;  4X65 Q;  1IW7 D;  1WD1 A;  3E5S A;  3KJO A;  4HJ7 A;  3HOW H;  5JAV A;  2XRQ D;  3DM1 A;  5IGG A;  4BY1 G;  4GKJ L;  3GTJ H;  1N33 L;  1WTR A;  2ICI A;  1PYW D;  4HCS A;  2N8N A;  3RN5 A;  4L5T A;  1EYA A;  3M4Y A;  1PH6 A;  2EXZ A;  2YU9 B;  2I0Q A;  4X64 L;  1NSN S;  2F1M A;  3F2U A;  1PLF A;  1SYE A;  1N34 L;  2B63 G;  1Q82 C;  4OWX B;  3CRK C;  1TKW B;  2F0L A;  4DV5 Q;  5IGE A;  5M5X B;  1E2Z A;  3D4R A;  4K8I A;  1YEZ A;  1R4P B;  5K36 H;  1CHP D;  1L1O C;  3OTO Q;  1G8Z D;  4MHE A;  3TN2 A;  2NZ1 D;  1JJG A;  5FKA C;  3K59 A;  2B3G A;  3DEP A;  4JBW A;  3K5M A;  4K0K L;  3U58 A;  4ZKB B;  1FJG Q;  2WFW A;  1PFN A;  1SRU A;  4OL7 A;  4A3K H;  3KDF A;  2AWO A;  5M5W B;  2ZJP A;  5NUC A;  2HUG A;  4H13 C;  4C3H G;  3R2I A;  1HZC A;  1PV4 A;  5DNF A;  3QG1 A;  2VL6 A;  3J81 E;  3I4L A;  3S1Q B;  3J7A F;  1CKN A;  4IUV A;  4DR3 L;  1QNU A;  3VR3 A;  3NHH A;  3PIO 3;  2F0E A;  3UE1 A;  4JI0 Q;  4BXX H;  3OIP A;  2MGS A;  3H09 A;  1K3B C;  1LTT D;  3SDZ A;  1QVF A;  3S24 A;  4K0K Q;  3S14 H;  2VB3 X;  2XWB B;  2YTX A;  3S1N B;  1PRT B;  1G51 A;  1JB3 A;  4JI1 L;  4DV2 L;  3DXJ C;  1SN8 A;  4JBK A;  1RL2 A;  1HTP A;  4R1J A;  4BBR H;  4A3C G;  5LMN W;  4DUZ Q;  2I5L X;  3HS0 C;  2NVQ H;  4JI2 L;  1EZ6 A;  1HNZ L;  3MA2 B;  4FF1 A;  4PZ6 A;  3TP5 A;  3PUY A;  2Q8R E;  1ILP A;  2YV5 A;  1ET6 A;  2B2V C;  3ND8 A;  2F0F A;  1VF5 C;  4LF4 L;  5IP9 H;  1O7Y A;  4BBR B;  1EZ8 A;  3NEL A;  2L11 A;  4HR7 B;  3IKJ A;  3PGZ A;  4A3L G;  3I4O A;  1HA5 A;  4BBS G;  1J8I A;  4NXN L;  2K75 A;  5GRO A;  1NAP A;  1WJJ A;  3TEH B;  1X9N A;  3OSO A;  1YHQ A;  4A76 A;  4RKB A;  4UAI A;  1SYB A;  3TSS A;  1VQN A;  4UP7 A;  3KLR A;  4A3E H;  4B3R L;  3CCJ A;  3NUC A;  1KDA A;  5ELB A;  4NKL A;  1H9S A;  4QQB X;  3H3V H;  1MGS A;  4NW2 A;  1BQQ T;  2PO4 A;  2EY6 A;  2A6E C;  1YNJ C;  5CR3 A;  2JA7 G;  3D4D A;  1PTO C;  4RFB A;  1QB5 D;  2NTT A;  3HKZ G;  1WCM G;  2O4X A; 
#chains in the Genus database with same CATH homology
 5C3E G;  4DKA C;  3GD7 A;  3L2P A;  5LMU L;  3PF5 A;  3STB C;  3U4Z A;  2F52 A;  5C44 H;  2JEA I;  3ULP A;  2UUB Q;  3CCE A;  4JI0 L;  5C44 G;  4A3L H;  1NMG A;  4GOP C;  2EIF A;  2DUD A;  3NBH B;  4A3I G;  2ES2 A;  2L15 A;  4L5S A;  4A3F G;  2OCE A;  4IJL A;  4KHZ A;  3I4M H;  2KHI A;  4RG1 A;  4X6A H;  4JI5 L;  1X65 A;  1QVG A;  3AQQ A;  3S17 H;  2E2I H;  4DR5 Q;  4IFD J;  1VQK A;  5BR8 L;  5M5X H;  3H15 A;  1N34 Q;  2ZJQ A;  4A3B G;  4YY3 L;  4A3J H;  2R6G A;  4GLA C;  4JOI A;  4A3J G;  4DV5 L;  1U0L A;  2PQA A;  2YYZ A;  1VQF A;  3UDI A;  1K8G A;  3CC7 A;  1OXS C;  5FJ8 H;  4LF9 L;  4X62 L;  1HR0 Q;  5IYB H;  3MXN B;  5C4J H;  1KD1 C;  2JA6 G;  1D7Q A;  3KJP A;  4JI8 Q;  3AEV A;  3OTO L;  4OO1 G;  3CD6 A;  3KDF B;  4DR7 L;  1SFO H;  2RHQ B;  2WB1 E;  2AWN A;  4POF A;  1N32 L;  2PQA B;  2V1C C;  5IE8 A;  4Y52 H;  5H1S E;  2NVT H;  3CC2 A;  4JI7 Q;  1CUK A;  3CCS A;  3J81 c;  3G6E A;  4DV1 L;  4JI5 Q;  2MFI A;  1CKO A;  3ERS X;  4C3H H;  2NVX H;  3K8A A;  1E1T A;  1BKB A;  1BVS A;  4LF4 Q;  3PO2 G;  5DLQ E;  1IZ6 A;  1E22 A;  2K14 A;  3UDF A;  1Y1V G;  5ELN A;  2Z0S A;  1JJC B;  4YY3 Q;  1Q86 C;  1VQC A;  4IPC A;  3H0G H;  1PYB A;  4DK6 C;  4A3E G;  3CF5 A;  2UU9 L;  1HNW L;  4ALP A;  3GTQ H;  4UP9 A;  4GKJ Q;  1Q8K A;  3HOU H;  4HID A;  2N3S A;  4JI6 L;  4LFA Q;  2R93 H;  1VQM A;  1IXR A;  2IY5 B;  3VDY A;  1TWF H;  2PNH A;  3J7Z C;  1YI2 A;  4NXM Q;  4GOP B;  3CPW A;  1IBM Q;  1YZ6 A;  1A0I A;  4BY1 H;  1X54 A;  3UDG A;  1K0R A;  2B29 A;  1OXX K;  4A3G H;  5IP9 G;  3CCR A;  2E5L L;  4JI1 Q;  2R92 H;  4APV A;  1XMQ Q;  1IBL L;  3DM3 A;  2R92 G;  3GTO H;  2CFM A;  4YWL A;  1NBW A;  2ZTD A;  3HFZ B;  3STB D;  2CCZ A;  3PF4 A;  3SGI A;  1A63 A;  3F1Z A;  2F4V Q;  1E1O A;  2A1A A;  4B3S L;  1PH5 A;  2AHO B;  4JI3 Q;  1GO3 E;  2UU9 Q;  4UY8 C;  5IT9 c;  2K5N A;  3CP0 A;  1UE6 A;  3NEN A;  4OO1 I;  3KF6 A;  1Q12 A;  2OQK A;  1YJW A;  4WJ4 A;  3CAM A;  1Q1B A;  4LFC L;  1L1O A;  2IHE A;  4DV4 Q;  2ZM6 L;  5FLM H;  1PA6 A;  2UUB L;  3A0J A;  3W1G A;  4P75 A;  5JEA J;  1PFS A;  3CCL A;  2HT1 A;  4L5Q A;  3JC6 6;  1B8A A;  1JJ2 A;  1I94 L;  1E3P A;  3BZC A;  4B3T Q;  3E9I A;  1VQ8 A;  2E5L Q;  4LUV A;  3HOV G;  1EYG A;  4JI4 Q;  1VQO A;  2VUM H;  2UXC L;  1QUQ B;  2KCT A;  3OYY A;  4OWW B;  3S2D H;  4DUY L;  5J3B A;  1MJC A;  4B3M Q;  2NVY H;  4HIK A;  4OWT B;  4YCV A;  3K7A H;  1BBW A;  2WAQ G;  4H02 A;  4X62 Q;  4DR4 L;  1Q81 C;  4JI8 L;  1N8R C;  1SR3 A;  1KRT A;  1UE7 A;  5GAG C;  2ZM6 Q;  3GTM H;  2K5H A;  3TRZ A;  5JEA G;  3M4P A;  1VQI A;  4YWK A;  1AE2 A;  4YCW A;  1N32 Q;  4YWM A;  2NN6 I;  1NMF A;  4NPS A;  3RLO A;  3I4N G;  4A93 H;  4DV7 Q;  4JC0 A;  5ELO A;  2HHH L;  3A5Z B;  1FL0 A;  4OX9 Q;  1AH9 A;  1XJV A;  5IP7 G;  4KHP Q;  4DR1 Q;  4TVA B;  2A8V A;  4DV2 Q;  3S2H H;  4C3I H;  3J80 c;  4JYA Q;  1NJI C;  4JI4 L;  2VS1 A;  4IO9 A;  1YIT A;  3JAM i;  3BZK A;  4DUY Q;  2QEX A;  4DV6 L;  3M7N A;  3HOY H;  4DR4 Q;  1PVO A;  1X3E A;  1HNW Q;  1GKH A;  1B70 B;  3RN2 A;  5GAH C;  2VW9 A;  3HOV H;  1D8L A;  2VY3 A;  4QY7 A;  3FHW A;  1X6O A;  4Y7N H;  4PZ7 A;  1TWH H;  1H95 A;  3K0X A;  4LF7 L;  3LGJ A;  2EXD A;  3B6Y A;  3PO3 G;  2Q2I A;  3M9B A;  3PV0 A;  4GNX A;  1WI5 A;  3CCQ A;  2E2H H;  2DGY A;  3KOJ A;  4LF8 Q;  2K5V A;  3ULL A;  3TS2 A;  4POG A;  2UXD Q;  4DPG A;  4DR1 L;  1S3O A;  4JG2 A;  3RLN A;  4DR5 L;  1Y1V H;  4X66 L;  3W1B A;  5AJ3 L;  1LM0 A;  4R4I A;  5BR8 Q;  1XMQ L;  1XNR L;  3M4O H;  5K36 G;  3K81 C;  3L7Z C;  1L0W A;  2R7Z G;  2PI2 A;  2E8G A;  1DGS A;  2C35 B;  1JMC A;  2OWO A;  2VZA A;  2XTI A;  2F4V L;  3HOZ H;  5EAY A;  4YHH L;  1YHB A;  3HOX G;  1I6H H;  2PMZ E;  2MO1 A;  5IP7 H;  3F2C A;  3RZD H;  2UUA Q;  3KYH C;  2Q2U A;  4NXN Q;  2KBN A;  5IY0 A;  4P71 A;  1YJN A;  2R93 G;  1Q1E A;  1N33 Q;  4DR7 Q;  1VQJ A;  3W5O A;  2Z6K C;  4LNQ A;  3D0F A;  1KHI A;  2JEB I;  1KAW A;  1Y14 B;  1IBK Q;  2CWP A;  4BBS H;  4GKK L;  1LTL A;  3I7F A;  4PG3 A;  4HJ5 A;  3PUW A;  1X56 A;  1C9O A;  1XPU A;  1GD7 A;  4WJ3 M;  4B3R Q;  3PO2 H;  2QA4 A;  3AFP A;  5HY6 A;  2NZO A;  3UDX A;  1I94 Q;  4A4I A;  3GO5 A;  3F2D A;  4DV3 L;  2ZTC A;  4BY7 G;  3Q8D A;  3PIP A;  2GVA A;  2B63 H;  2JJQ A;  4GOP A;  4LF5 Q;  5M3M H;  2K52 A;  5GAD C;  3HOU G;  5C0X I;  4XTC S;  3TQY A;  2IX0 A;  1I50 H;  2IT1 A;  2Y0S G;  4LW1 A;  5FLM G;  1RIP A;  2AMC B;  1VQ4 A;  5LMU Q;  1PH1 A;  4AQY L;  2BA1 A;  2LXK A;  1AE3 A;  2CKZ B;  1KQS A;  2KHJ A;  3MEF A;  2JK8 A;  2LXJ A;  4IOC A;  1HNX L;  4NXM L;  4BA1 I;  4GKK Q;  2JA5 H;  2JA6 H;  1PH2 A;  3S1R H;  1TXY A;  1HJP A;  3J81 i;  1XNQ L;  4DAY B;  2HHH Q;  4LUZ A;  1VQ6 A;  1I3Q H;  1YIJ A;  2JE6 I;  4R4C A;  4IFD G;  3CQZ H;  3ER0 A;  1K83 H;  5IWA L;  2VUM G;  1MIU A;  2K4K A;  4HJ8 A;  3KLW A;  1U5K A;  1C7Y A;  5JJK A;  4JV5 L;  4P73 A;  4LWC A;  1ASZ A;  2UXB Q;  3J7A 5;  1EQR A;  1TWA H;  4B3S Q;  1VQA A;  4DNI A;  3G71 A;  4JI3 L;  1UE1 A;  4DV0 Q;  4OXP A;  5M5Y H;  2VQF L;  1M1K C;  5GQO A;  2I5H A;  3NEM A;  3GTG H;  3KFU A;  4LF6 L;  3T1H L;  1EOV A;  1CSP A;  4A3D H;  2ZTE A;  1EQQ A;  3F8T A;  5FJ8 G;  3GTL H;  2H5X A;  4AIM A;  2ID0 A;  3E0E A;  1V1Q A;  3CW2 C;  3OW2 A;  1TWG H;  4QL5 A;  3AFQ A;  3RR5 A;  4LF8 L;  1G6P A;  3IRB A;  3UE0 A;  4IPH A;  1WYD A;  2ASB A;  1CKN B;  1XPR A;  2VQE Q;  3L0O A;  5IWA Q;  5AJ3 Q;  1S40 A;  1XNR Q;  1UE5 A;  2CWA A;  3HKZ E;  2UUC Q;  3G48 A;  2N78 A;  2Q2T A;  4QGU A;  1V9P A;  2JA7 H;  3S1N H;  4UP8 A;  4GN3 B;  4YHH Q;  4DUZ L;  4JCV E;  1I5F A;  1NE3 A;  3T1Y L;  3EIV A;  1SRO A;  1X3G A;  3E9H A;  2Z6K A;  1NTG A;  4A3I H;  1XMO L;  3J80 i;  2OQ0 A;  1L2F A;  1HNZ Q;  3F2B A;  1OTC A;  4A3F H;  1LUZ A;  1OXT A;  1VQH A;  1MJE A;  4LF6 Q;  2R7D A;  3EN2 A;  1EIY B;  3K80 C;  4LFA L;  4IJH A;  3ICE A;  2XGT A;  4LFB Q;  2ALY B;  3CPF A;  4QJF A;  1YNX A;  4HJA A;  1HZA A;  3S1Q H;  1IBM L;  4XIG S;  1IL2 A;  4AH6 A;  4DV7 L;  2OTJ A;  4K0K L;  2A19 A;  3M3Y H;  2YTY A;  2D0P A;  2Y0S E;  5LMN Q;  2VQE L;  2JA8 G;  3RZO H;  4A3D G;  5IYD H;  5IYD G;  2JA8 H;  1XTD A;  2WP8 J;  2R7Z H;  2CQO A;  3A5U A;  4X65 L;  1IBL Q;  4JYA L;  3ZJY C;  4R4Q A;  1Z9F A;  1OXU A;  2UUC L;  3RLF A;  1J6Q A;  3HOX H;  4A3G G;  1SE8 A;  2AKW B;  4GNX C;  2JQO A;  1X3F A;  1VCI A;  1P16 A;  1VQB A;  2WB1 G;  1CKM A;  4BBR G;  3D31 A;  1EWI A;  2F3I A;  3FP9 A;  1V43 A;  1W3S A;  1W2B A;  3PUZ A;  4DAM A;  4ME3 A;  4C2M H;  3I56 A;  1KIX A;  4LFC Q;  3ULJ A;  4UPA A;  4IFD I;  4DV4 L;  4AQY Q;  2D0O A;  2HQL A;  2LSS A;  4O0A A;  4MNO A;  1Q7Y C;  1P8L A;  4GLV B;  4DR6 L;  2KEN A;  1A62 A;  1HNX Q;  4RMF A;  3RNU A;  4O2D A;  1FGU A;  1SMX A;  2Q2H A;  2HIX A;  2BH8 A;  1TWC H;  1IYJ B;  1XNQ Q;  2GVB A;  3PUV A;  3CCV A;  1QZG A;  4B3T L;  1VS0 A;  4KLK A;  4TQU S;  4X65 Q;  5C0X G;  1X55 A;  3PIO A;  1VQ5 A;  3I4N H;  4A75 A;  1EFW A;  3DLL A;  1BBU A;  3EBE A;  3KJO A;  4HJ7 A;  4GS3 A;  3HOW H;  4JI2 Q;  4DR2 L;  4GN5 A;  2UUA L;  2I5M X;  4BY1 G;  4GKJ L;  3GTJ H;  1N33 L;  3T1H Q;  3FKI G;  1YBY A;  5FLX c;  2N49 A;  3HKS A;  1WCM H;  2N8N A;  1O7I A;  4L5T A;  4QIW E;  3RN5 A;  1QZH A;  3HOY G;  1PH3 A;  3S16 H;  4DR6 Q;  2BA0 A;  1R9T H;  2K50 A;  3CC4 A;  1PH6 A;  1C0A A;  1OXV A;  3CCU A;  1UEB A;  5IYC G;  1ASY A;  3GTK H;  3H0G G;  2I0Q A;  1GVP A;  4X64 L;  1LYL A;  1NY4 A;  1HH2 P;  3H3V I;  1PHJ A;  1Y1W G;  5JJI A;  4OON A;  3BJU A;  1Q82 C;  4OWX B;  1N34 L;  2B63 G;  5JJL A;  1E7Z A;  3G4S A;  4DV5 Q;  4DV6 Q;  2ATW A;  1G29 1;  4A3B H;  4GNX B;  5HGQ A;  4LF5 L;  1E24 A;  1YEZ A;  3K7U C;  4GN4 B;  4IOA A;  1XMO Q;  1L1O C;  3OTO Q;  3TS0 A;  3PCO B;  2JA5 G;  4HIO A;  3M85 A;  1Q46 A;  5C3E H;  1VQP A;  2VNU D;  3WWV A;  3S15 H;  2QGQ A;  1VQE A;  1J5E L;  1JJG A;  1K73 C;  4A3C H;  1MKH A;  2B3G A;  4BA2 I;  1VQ9 A;  4JBW A;  4HJ9 A;  1PYS B;  1FVI A;  1PH8 A;  4JI7 L;  3U58 A;  3PO3 H;  1EIF A;  1WFQ A;  4MTN A;  1FJG Q;  2WFW A;  1SRU A;  4JBM A;  4C3J H;  4A3K H;  5C4X G;  2WAQ E;  1WOC A;  1L1O B;  1KRS A;  4X66 Q;  3KDF A;  1KL9 A;  2AWO A;  2EQS A;  1VQ7 A;  1S72 A;  2ZJP A;  4HIM A;  4AYB G;  3CXC A;  4JV5 Q;  1HZC A;  2PI2 E;  4IPG A;  5C0X J;  1PV4 A;  2UXB L;  2E2J H;  4A3M H;  2VL6 A;  3M4Q A;  1SLJ A;  2RF4 A;  1CKN A;  2D62 A;  4DR3 L;  4A93 G;  1JT8 A;  4JI6 Q;  1JE5 A;  3U50 C;  3CMA A;  1QUQ A;  4BXX G;  1JB7 A;  3UE1 A;  4JI0 Q;  4BXX H;  1J5E Q;  1IBK L;  2MO0 A;  3HOW G;  1QVF A;  4K0K Q;  3S24 A;  3PUX A;  3S14 H;  2R7F A;  2YTX A;  4OX9 L;  3GDE A;  3I55 A;  1G51 A;  1VQG A;  3FKI H;  4JI1 L;  3I2Z A;  4PMW A;  4DV3 Q;  4DV2 L;  1SN8 A;  4JBK A;  3PSI A;  2ZJR A;  1RL2 A;  2KCM A;  4R1J A;  4IPD A;  4BBR H;  5LMN W;  4A3C G;  4DUZ Q;  2OTL A;  5IYC H;  2I5L X;  4P72 A;  3T1Y Q;  2YU9 H;  4EQ5 A;  2NVQ H;  4LUO A;  1HR0 L;  4DR2 Q;  4JI2 L;  1Y1W H;  3I4M G;  3CCM A;  4FDB A;  1HNZ L;  1GM5 A;  1K3R A;  1EUJ A;  2HIV A;  4PZ6 A;  2BH2 A;  5M3M G;  3PUY A;  4LFB L;  4LF7 Q;  4YCU A;  2YV5 A;  4GLX A;  1K8A C;  1YJ9 A;  4A3M G;  1VQD A;  1A8V A;  4JOI C;  1Z47 A;  2GN5 A;  2JA9 A;  3KF6 B;  4X64 Q;  4DV1 Q;  5LMN L;  1PH9 A;  3HOZ G;  2UXD L;  4LF4 L;  4JBJ A;  4NB3 A;  5IP9 H;  3BU2 A;  2UXC Q;  5M3F H;  3NEL A;  2IX1 A;  1QVC A;  5M3F G;  2YTV A;  2FXQ A;  4B3M L;  3PGZ A;  5GAE C;  1PH4 A;  1N36 Q;  4A3L G;  3I4O A;  2MNA A;  5C4X H;  4DV0 L;  4A3K G;  1HZB A;  2MQH A;  2VQF Q;  4BBS G;  3KF8 B;  3TRE A;  1B7Y B;  4NXN L;  5E7N A;  2K75 A;  5GRO A;  1WJJ A;  1HR0 W;  3TEH B;  1X9N A;  1KC8 C;  2RHS B;  2RCN A;  4AYB E;  3S1M H;  2NZH A;  1CSQ A;  1YHQ A;  1PH7 A;  1VQL A;  4A76 A;  3U4V A;  1HZ9 A;  1XPO A;  1VQN A;  4UP7 A;  1YHA A;  4A3E H;  1FJG L;  4BY7 H;  3CCJ A;  1YVC A;  4B3R L;  4KHP L;  5IYB G;  4L5R C;  1N9W A;  2IHF A;  1M90 C;  4QQB X;  3JAM c;  3J81 j;  4MZ9 A;  3A74 A;  3AYH B;  4EX5 A;  1UWV A;  3H3V H;  2NN6 G;  4DK3 C;  4P74 A;  5M5W H;  4R4O A;  1N36 L;  3GTP H;  1KXL A;  3CME A;  4J15 A;  4LF9 Q;  2JA7 G;  1T9H A;  1K9M C;  4PZ8 A;  4R4T A;  3HKZ G;  4KI0 A;  1WCM G;  4DR3 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...