4AQYM

Structure of ribosome-apramycin complexes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 25
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4aqyM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4aqyM02
4JI1M 1J5EM 2OPFA 5ITRA 1MU5A 3A45A 3U6QA 4LFCM 4X64M 3SARA 1L1TA 4CISA 1PM5A 2E5LM 4B3RM 4JI6M 1Z5CA 5FLXS 5LMNM 4K0KM 4DR5M 5BR8M 3W0FA 3GQ4A 5ITYA 4NRVA 4DR2M 3VK7A 2F4VM 4NXNM 4YY3M 3GPYA 4DV1M 4DR1M 4KHPM 3DOAA 3OTOM 4JYAM 4LF9M 4PCZA 5IWAM 2UU9M 5ITTA 4G4NA 1L2BA 4PDIA 3U6DA 4LF5M 2UUCM 1IBLM 2HHHM 1KFVA 1XNQM 4NRWA 4LFBM 2ZM6M 2OQ4A 3U6PA 2F5NA 5ITXA 3GPXA 3U6EA 3VK8A 1XMQM 1PJIA 1XNRM 2UUAM 1I94M 4DR6M 4JV5M 1L2DA 3T1HM 4DV5M 3U6OA 1K3WA 1Z5BA 3GP1A 3C58A 2VQFM 4DR4M 4GKJM 4YHHM 3GO8A 4LF6M 4GKKM 1L1ZA 1N34M 4JI2M 3SAUA 4LF7M 1Q3CA 4DV6M 4G4QA 2F5OA 1Z59A 3U6CA 2XZUA 1MX0A 4NXMM 3SAWA 1Q39A 2UXCM 4JI8M 3TWMA 5ITXE 2F5PA 2UXBM 4X62M 2F5SA 4JI4M 4JI5M 4MB7A 4LFAM 4B3SM 1HNZM 4G4OA 4PDGA 2UUBM 1N32M 3A42A 4DR7M 5ITQA 4JI7M 3GQ3A 1N33M 5ITUA 1R2ZA 4LF4M 4DV3M 4B3MM 4DUYM 1Q3BA 2ZBKB 3J80S 4X66M 3JAMS 3JR5A 1TDZA 3GPPA 1PJJA 1N36M 3SBJA 4G4RA 3A46A 5A2QS 1NNJA 3SATA 3GPUA 4DUZM 4DV0M 2Q2EB 3J7AS 4OX9M 4DV4M 3U6MA 4ITQA 3GQ5A 4JI0M 3T1YM 1IBMM 1K3XA 2HKJA 1IBKM 3J81S 2F5QA 1K82A 1FJGM 4DR3M 4PD2A 3SASA 1XMOM 3SAVA 1HNXM 1HNWM 1R2YA 3JR4A 3U6SA 4LF8M 2UXDM 1XC8A 4AQYM 3TWKA 2VQEM 4B3TM 1EE8A 1HR0M 5LMUM 5IT9S 1L2CA 4X65M 2XZFA 3U6LA 4DV2M 1Z5AA 2EA0A 3TWLA 1TDHA 4JI3M 4DV7M
chains in the Genus database with same CATH superfamily
3LCVB 5EP1A 1TF0B 4JXJA 4RKUF 1J5EM 5ITRA 1Q02A 2L6OA 3FYCA 3B7QA 5BPVA 3U6QA 3HU1A 1SG9A 5F3WA 3K92A 1ZV1A 1L1TA 1PM5A 1W5TA 1WXQA 3PNYA 2E5LM 2C9CA 3SHGB 4AI6A 2D7HA 1EFUB 1G41A 4GHAA 2QBYA 3B9PA 4K0KM 4NOOB 2LVNC 3W0FA 1IXSB 2DWZB 3UJNA 1VEJA 4LRSA 1IQPA 1D0LA 1LV7A 1HQYE 4NRVA 2KXEA 3ZQJA 4YY3M 4D80A 3GPYA 4R3DA 3U61A 1E9RA 3FTCA 2DXIA 4HEOA 2L4EA 3SHFA 1BVSA 2VF7A 3FUUA 3PVSA 1D0KA 2LH0A 1VQ1A 1L2BA 3AV0A 4PDIA 1IN5A 2RKOA 3LCUA 4GH9A 4Y28F 3U6DA 1HT1E 1QUTA 4LF5M 1RU3A 3HJSA 4LFBM 3U6PA 2OQ4A 1GVNA 4LRTA 3FRHA 3C3DA 2CWBA 4LJ6A 2BJWA 1HT2E 4D82A 4LJ5A 4L4UA 1L2DA 3KXEC 4KT0F 3U6OA 2WSEF 4FD2A 4EIWA 3GLFB 2HWJA 3K1JA 3GP1A 3C58A 4QOZC 2KHHA 4FWDA 4QNRA 2JY6B 1DGBA 3LVWA 1W5SA 2MH8A 1XHBA 3RGSA 5KPZA 1G4AE 1CUKA 4JI2M 2FNAA 1QAOA 4G4QA 2W82A 1Z59A 3U6CA 1SXJB 3U60A 1MX0A 2EJSA 1OJLA 2QP9X 4QOSA 3FUVA 3M7GA 4OVZB 1YE9A 3B7NA 3KDSE 4JN6A 2CP8A 3ZCBB 5ITXE 2HL7A 3W68A 1IFYA 3HU3A 4MH0E 1WIVA 4JI4M 2ZTDA 2DWNA 3UGJA 3PXGA 1G71A 4LJ4A 2DKLA 4KLNA 1UM8A 4PT5A 4LFAM 2R46A 2GNOA 2KA6B 3GRVA 4B3SM 3VKHA 5EJCA 5KPRA 1PJTA 2R45A 3BBZA 2UUBM 2P5TA 3L25A 4GHLA 3VDPA 1R5LA 1N33M 1XXHA 3HY5A 5EXTA 5FSWA 1EIJA 1DGFA 3AFHA 4DUYM 1IM2A 3JAMS 4X66M 3JR5A 1N36M 1G8PA 3B74A 4G4RA 2XSZA 2ZTCA 3SYLA 1OIPA 2QBYB 3FE3A 3NWLA 5L8RF 1R6BX 2GQFA 4OX9M 3LW5F 2DZLA 4DV4M 3GQ5A 2R4EA 1IY0A 4KODA 2QSFX 3AOEC 2C96A 2HKJA 2C99A 4IBGA 1JR3A 2F5QA 1DGGA 1QUSA 3FTEA 3HWSA 1QAMA 3SYKA 1XMOM 2JZ1A 2CV2A 1TGUA 3JR4A 2LNHC 2ZAMA 4Z6YA 2FOIC 3AKZA 5GKNA 4TUWA 5FTNA 2MR9A 2CHVA 2DZOB 1G3IA 3FTDA 5LMUM 2HAKA 3QAUA 4F1IA 4B08A 4X65M 3U6LA 3L29A 2JXNA 1TH4A 3DZDA 4L6V6 4QNMA 2O25A 1TDHA 5FTKA 2OO9A 4B7GA 2XF3A 4JI1M 3K9OA 2OPFA 4CJ6A 1ZMWA 1MU5A 1E32A 4LFCM 4X64M 3AL0C 4IJEA 3L27A 4IBDA 3GLHE 1NV8A 2LTUA 2Z4RA 2R6FA 1OTRA 3FKEA 3MMPA 4B3RM 5EXSA 4JI6M 1PJSA 5FLXS 2C5RA 1LTMA 2KW0A 7CATA 4DR5M 3J2PB 1NO1A 5BR8M 4D81A 5ITYA 2K47A 3EIHA 3LQRA 3GRUA 1UFZA 1VEGA 3QWLA 4DR1M 2OOAA 3U5ZB 3MHVC 4HL4A 1YLAA 3U5ZA 3OTOM 3TL4X 2XFSA 2EKKA 3A98B 1JR3D 1XXHB 2HCBA 4CIZA 4LF9M 3F92A 2CUZA 1GABA 3CGWA 5ITTA 1NY6A 1IY2A 1OFHA 2K0BX 2MROB 3W0LB 2OOBA 4MGHA 4UN2B 3GLIB 1XMQM 1PJIA 2UUAM 4WURA 1I94M 1WHCA 3IG8A 4RNAA 5C18A 2QHOB 2MJ5B 2K6BA 1IN6A 1D0MA 2KNAA 3B89A 4DV5M 2MGWA 3AJIB 3T1HM 1K3WA 2RGOA 2Z4SA 3TE6A 2VQFM 2WSCF 3U60B 3T38A 1NY5A 4YHHM 3GO8A 3LVVA 4NSRA 4LF6M 2DAMA 3I4VA 2X49A 1L1ZA 3HJQA 3ILKA 1WGLA 1C1KA 3HKPA 1Q3CA 4DV6M 2I7PA 3I01M 2F5OA 2VDBB 3C9PA 4I8OA 4CHTB 3RE8A 2NQ8C 3K8ZA 2XFTA 2DWMA 4MM3B 2F5PA 3J27B 3E21A 4DBGB 3C3EA 2F5SA 2RGHA 1JR3E 2R18A 1OAOC 4G3OA 4L16A 2XGNA 3D8LA 4FCTA 4Q7JA 4AZFA 4XGIA 2O5RA 4AW4A 1SXJD 1NJGA 1R7RA 4IBBA 2L7HA 4AG6A 4NSOB 3WHLA 4MGIE 5ITQA 4AKGA 4JI7M 1E94E 3W67A 1GKIA 2DAEA 3VFDA 4LF4M 1KSFX 5H37D 4B3MM 3IHPA 4B7HA 1NV9A 4IIWA 4LZZA 5A2QS 1NNJA 3SATA 1SXJC 2DENA 2LWXA 2DNAA 2O01F 4M0DA 5FTMA 4BLCA 4ITQA 2J5YA 2KRUA 3HX3A 3KOWE 2KRKA 3CF6E 1JB0F 1PRBA 1TH2A 4Z8XA 1DO0A 2BJVA 3SMSA 1DGHA 4GEWA 4ZPXA 1K82A 1IBKM 1S3SA 3SASA 3CTWB 2R62A 1IXZA 1NHGC 1XWIA 2QENA 1OIZA 3LMMA 1YUBA 3K2LA 3KOZE 1R2YA 4REZA 4BBAA 4AQYM 2H1RA 3MJ5A 2L4FA 2JWSA 1QVRA 1ZMUA 3BXWA 1GJTA 4L15A 1ZQ9A 3HHYA 3TQSA 1L2CA 2XZFA 5IT9S 1GJSA 1Z5AA 4DV2M 1SXJE 2B3TA 2UUCM 4JI3M 2ZAOA 4DV7M 2L2DA 2JY5A 2D7GA 1VDLA 3A45A 1T6OA 3SARA 4CISA 2M60A 2Z3XA 2V1UA 3R8FA 1NNUC 4FCVA 3E46A 4IJFA 1Z5CA 2LVPC 5E6JA 3KSXA 1X37A 1N75A 2JZ0A 2KNZA 2CRUA 4GRIA 3GQ4A 2H5XA 2KEBA 2F4VM 4WP2A 2YR0A 2L09A 1HJPA 3DOAA 4QHSA 5EQTA 2R65A 2XH9A 4JYAM 1AIPC 4R7GA 3KS8A 2DAGA 4QHTA 4LY6A 4PCZA 1ZMVA 3BOSA 2KZUA 1FNNA 1QZEA 5EXPA 4M0WA 4G4NA 1PJQA 2BWEA 2R4JA 1OAIA 2YQZA 3UK6A 4IBKA 1KFVA 1XNQM 4NRWA 2LVOC 1QAQA 2ZM6M 2KNVA 3GLGE 2F5NA 5JI2E 3GPXA 5C1BA 1P3QQ 3VK8A 1GO5A 3HZJA 4RF1A 3ZC7B 2VIIA 4GC9A 5JI3E 2BWBA 4AG5A 4B7FA 4AKHA 2G8LA 4R71A 4GITA 1Z5BA 1MN3A 3SC3A 3T6PA 4P16A 2JY7A 3FUXA 4KO8A 3M0EA 2CHQA 4ANRA 4OW0A 2Z8YM 2V6ZM 2AHMA 3B7ZA 3SAUA 3KFUG 1F4IA 1A5TA 2D7EA 4IBJA 1H6UA 4I81A 4OU7A 2X4AA 4NXMM 5EXXA 1Q39A 4NL4H 3SAWA 4IBCA 4JI8M 3TWMA 3FYDA 3GLHB 1AUAA 2CV1A 3FD9A 1WGNA 4IBIA 3FTFA 3DFZA 1QDTA 2FFJA 1TH3A 4NC6A 3GLIA 4FVMA 3KOYE 4A3VB 4OVZA 5FTLA 2JP7A 3HHZA 4I4LA 4LJ8A 2XLJA 1WR1B 4FW9A 4PDGA 1YSYA 3A42A 4FWHA 4LGMA 2Y20A 3KOXE 5ITUA 2DAKA 3HGIA 1R2ZA 1G59A 2APLA 2FE8A 1JQJC 2X8AA 2ZANA 4I5SA 4CGYB 4F2LA 1TDZA 1PJJA 1V34A 1QANA 2XEPA 5IZ7D 5FTJA 3UMMA 1IN7A 1R4GA 3A46A 1I4WA 4DUZM 3IG5A 4DV0M 2G3QA 4MGYE 1ZAEA 4M9XA 1V92A 3J7AS 3I04M 3U6MA 2DVWB 4P17A 1IBMM 3L2AA 4IBEA 3GLGB 1V33A 1QYRA 2R0IA 3SFZA 3J81S 1FJGM 3UZUA 1OQYA 3FUWA 4M9ZA 1OKSA 5DNYA 4RF0A 4IBFA 3H4MA 1HNXM 1HNWM 1E9SA 2J7NA 3U6SA 4LF8M 3CF2A 3KP0E 4XBOA 3GLGA 2UXDM 3HHXA 3ZH9B 3QYBA 4B3TM 1EE8A 3NBXX 4LZJA 2CHGA 2KDLA 5DFLA 3H4JA 1NJFA 2ERCA 1N34M 3FRIA 2G5GX 4FWGA 1IN8A 2A5YB 2JNHA 2L7IA 2CE7A 3SMPA 3TPZA 1PGYA 5KO3A 4G6ZA 4FCWA 1WJ7A 4GMQA 1VG5A 3GLHA 5IREB 3GLFA 1GL6A 2C9OA 2K9DA 2QCUA 5LMNM 2XSZD 3D8BA 5KQ8A 1DO2A 3I4YA 4W5WA 5EP4A 3LQQA 1NVMA 2VF8A 4DR2M 3GRYA 3VK7A 4NXNM 4KHPM 4DV1M 3HU2A 2DHRA 2BNKA 5EP2A 1N77A 1HQCA 8CATA 1SXJA 5IWAM 3VDUA 2UU9M 5KPTA 1Y8GA 3MK6A 1IBLM 3KSJA 2HHHM 4GC5A 2LBCA 3AOGA 2WZJA 3U61B 2LVQD 5ITXA 3PNVA 2YFQA 2QNJA 1L8QA 3PFIA 3U6EA 4LJAA 2FH0A 1XNRM 2Y0TA 3AOEA 4DR6M 5DYIA 4JV5M 2JY8A 5KQDA 4S12A 1GLNA 2LHCA 3E4RA 3EIEA 2M5ZA 4DR4M 4LG2A 1VEKA 1D2NA 4GKJM 4LJ9A 1DV0A 1KYIA 4MGZE 3NBIA 4LCBA 4MGKE 4GKKM 1N78A 3HHWA 3HJ8A 1IN4A 4GIPA 1NSFA 1TR8A 3QYEA 2DAIA 4LF7M 1J09A 2N35A 4LGYA 3RFWA 2QZ4A 4XK8F 2CV0A 2CFOA 2XZUA 2EKFA 2DI0A 2C98A 2WSFF 3CF0A 2QPAA 2UXCM 2UXBM 5DYGA 1T3TA 1QDRA 1IY1A 2FS1A 1QZMA 4X62M 3M6AA 4JI5M 4MB7A 3E9SA 1IXSA 3V76A 3K9PA 3KS4A 1HNZM 2KZSA 2I7NA 4G4OA 1DGHB 5EP3A 1N32M 4DR7M 2Y0QA 3KVWA 3GQ3A 3THGA 2V1CA 4DV3M 2Y21A 2LXEA 1Q3BA 2ZBKB 2LHGA 3J80S 2EUCA 3GPPA 3I51A 2RRUA 3SBJA 3RGPA 3L26A 2DHYA 3VKGA 3GPUA 3DA1A 3J7BA 2YNMD 1J7KA 4AKIA 1TTEA 1MJGM 2Q2EB 2QQ8A 3IECA 3T15A 3R9XB 4JI0M 3T1YM 2DWLA 4LJ7A 1K3XA 3Q8XA 1GL7A 3GLIE 4L78A 2Z7JA 2CEAA 4DR3M 4PD2A 2DZNB 2JA2A 3GLFE 4WW0A 2J7OA 1ORYB 2EO2A 3GRRA 5E26A 2R44A 3SAVA 1VDDA 4L8RC 3KP1E 4II7A 1NHWC 1C7YA 1IXRC 1XC8A 1XXHE 4M9SA 4HLQA 3TWKA 1Z6TA 4BB9A 1XB2B 3WHKA 2VQEM 3L28A 1HR0M 1OFIA 1T43A 2LVAA 3Q8GA 3VLFB 2EA0A 2JUJA 3KW6A 1QQWA 3TWLA 3FUTA
chains in the Genus database with same CATH topology
5EP1A 4JXJA 1J5EM 5ITRA 2L6OA 3FYCA 5BPVA 3U6QA 3HU1A 5F3WA 1L1TA 3K92A 1PM5A 1W5TA 1WXQA 3PNYA 2E5LM 2C9CA 3SHGB 4AI6A 2D7HA 1G41A 4GHAA 2QBYA 3B9PA 4K0KM 4NOOB 3W0FA 1IXSB 2DWZB 3UJNA 4LRSA 1IQPA 1LV7A 4NRVA 1HQYE 2KXEA 4YY3M 3GPYA 4D80A 4R3DA 3U61A 1E9RA 3FTCA 2DXIA 3SHFA 3FUUA 3PVSA 2LH0A 1L2BA 3AV0A 4PDIA 1IN5A 2RKOA 4GH9A 3U6DA 4LF5M 3VKHA 1HT1E 3HJSA 4LFBM 3U6PA 2OQ4A 1GVNA 4LRTA 4LJ6A 2BJWA 1HT2E 4D82A 4LJ5A 4L4UA 1L2DA 3KXEC 3U6OA 4FD2A 4EIWA 3GLFB 3K1JA 3GP1A 3C58A 4QOZC 4FWDA 4QNRA 1DGBA 3LVWA 1W5SA 1XHBA 3RGSA 5KPZA 1G4AE 4JI2M 2FNAA 1QAOA 4G4QA 2W82A 1Z59A 3U6CA 1SXJB 3U60A 1MX0A 4QOSA 1OJLA 2QP9X 3FUVA 3M7GA 4OVZB 1YE9A 3KDSE 4JN6A 3ZCBB 5ITXE 2HL7A 3HU3A 4MH0E 4JI4M 2DWNA 3UGJA 3PXGA 4LJ4A 4KLNA 1UM8A 4PT5A 4LFAM 2R46A 4B3SM 2KA6B 3GRVA 5EJCA 5KPRA 2R45A 2UUBM 3L25A 2P5TA 4GHLA 3VDPA 1N33M 1XXHA 5EXTA 5FSWA 1DGFA 3AFHA 4DUYM 1IM2A 3JAMS 4X66M 3JR5A 1N36M 1G8PA 4G4RA 2XSZA 3SYLA 2QBYB 3NWLA 1R6BX 4OX9M 4DV4M 3GQ5A 2R4EA 1IY0A 4KODA 3AOEC 2C96A 2HKJA 2C99A 4IBGA 1JR3A 2F5QA 1DGGA 3FTEA 3HWSA 1QAMA 3SYKA 1XMOM 2CV2A 1TGUA 3JR4A 2LNHC 2ZAMA 4Z6YA 2FOIC 3AKZA 5GKNA 4TUWA 5FTNA 2CHVA 2DZOB 1G3IA 3FTDA 5LMUM 3QAUA 4B08A 4X65M 3U6LA 3L29A 1TH4A 3DZDA 4QNMA 1TDHA 5FTKA 4B7GA 2XF3A 4JI1M 2OPFA 1MU5A 1E32A 4LFCM 4X64M 3AL0C 4IJEA 3L27A 4IBDA 2Z4RA 3FKEA 4B3RM 5EXSA 4JI6M 5FLXS 2C5RA 2KW0A 7CATA 4DR5M 3J2PB 5BR8M 4D81A 5ITYA 2K47A 3EIHA 3LQRA 3GRUA 3QWLA 4DR1M 3U5ZB 3MHVC 4HL4A 3U5ZA 3OTOM 3TL4X 2XFSA 3A98B 1JR3D 1XXHB 2HCBA 4LF9M 2CUZA 5ITTA 1NY6A 1IY2A 1OFHA 3W0LB 4MGHA 3GLIB 1XMQM 1PJIA 2UUAM 4WURA 1I94M 3IG8A 4RNAA 5C18A 1IN6A 3T1HM 4DV5M 3AJIB 1K3WA 2RGOA 2Z4SA 3TE6A 2VQFM 3U60B 3T38A 1NY5A 4YHHM 3GO8A 3LVVA 4NSRA 4LF6M 3I4VA 2X49A 1L1ZA 3HJQA 3ILKA 1C1KA 3HKPA 1Q3CA 4DV6M 2I7PA 2F5OA 4I8OA 4CHTB 3RE8A 2NQ8C 3K8ZA 2XFTA 2DWMA 4MM3B 2F5PA 3J27B 2F5SA 2RGHA 2R18A 2V1UA 4L16A 4AZFA 2XGNA 3D8LA 4FCTA 4XGIA 2O5RA 4AW4A 1SXJD 1NJGA 1R7RA 4IBBA 2L7HA 4AG6A 4NSOB 3WHLA 4MGIE 5ITQA 4AKGA 4JI7M 1E94E 1GKIA 3VFDA 4LF4M 1KSFX 5H37D 4B3MM 4B7HA 4IIWA 4LZZA 5A2QS 1NNJA 3SATA 1SXJC 2LWXA 4M0DA 5FTMA 4BLCA 4ITQA 2KRUA 3KOWE 2KRKA 3CF6E 1TH2A 4Z8XA 1DO0A 2BJVA 3SMSA 1DGHA 4ZPXA 1K82A 1IBKM 1S3SA 3SASA 3CTWB 2R62A 1IXZA 1NHGC 1XWIA 2QENA 3LMMA 1YUBA 3K2LA 3KOZE 1R2YA 4REZA 4BBAA 4AQYM 2H1RA 3MJ5A 1QVRA 3HHYA 4L15A 1ZQ9A 3TQSA 1L2CA 5IT9S 2XZFA 1Z5AA 4DV2M 1SXJE 2UUCM 4JI3M 2ZAOA 4DV7M 2D7GA 3A45A 3SARA 4CISA 2M60A 2Z3XA 3R8FA 1NNUC 4FCVA 4IJFA 1Z5CA 5E6JA 3KSXA 1X37A 1N75A 4GRIA 3GQ4A 2KEBA 2F4VM 2YR0A 2L09A 4QHSA 3DOAA 5EQTA 2R65A 2XH9A 4JYAM 4R7GA 3KS8A 4QHTA 4LY6A 4PCZA 3BOSA 2KZUA 1FNNA 5EXPA 4G4NA 4M0WA 2R4JA 2YQZA 3UK6A 4IBKA 1KFVA 1XNQM 4NRWA 1QAQA 2ZM6M 2F5NA 5JI2E 3GPXA 5C1BA 3VK8A 4RF1A 3ZC7B 2VIIA 4GC9A 5JI3E 4AG5A 4B7FA 4AKHA 2G8LA 4GITA 1Z5BA 3SC3A 4P16A 3FUXA 4KO8A 3M0EA 2CHQA 4OW0A 2V6ZM 2AHMA 3SAUA 3KFUG 2D7EA 4IBJA 1H6UA 4I81A 4OU7A 2X4AA 4NXMM 5EXXA 1Q39A 4NL4H 3SAWA 4IBCA 4JI8M 3TWMA 3FYDA 3GLHB 2CV1A 3FD9A 3FTFA 4IBIA 3DFZA 2FFJA 1TH3A 3GLIA 4FVMA 3KOYE 4A3VB 4OVZA 5FTLA 3HHZA 4I4LA 4LJ8A 2XLJA 4FW9A 4PDGA 1YSYA 3A42A 4FWHA 4LGMA 2Y20A 3KOXE 5ITUA 3HGIA 1R2ZA 1G59A 2FE8A 2X8AA 1JQJC 1PJJA 2ZANA 4I5SA 4CGYB 1TDZA 1QANA 2XEPA 5IZ7D 5FTJA 3UMMA 1IN7A 3A46A 1I4WA 4DUZM 3IG5A 4DV0M 3J7AS 4MGYE 1ZAEA 4M9XA 3U6MA 2DVWB 1IBMM 3L2AA 4IBEA 3GLGB 1QYRA 3SFZA 3J81S 1FJGM 3UZUA 3FUWA 4M9ZA 5DNYA 4RF0A 4IBFA 3H4MA 1HNXM 1HNWM 1E9SA 2J7NA 3U6SA 4LF8M 3CF2A 3KP0E 4XBOA 3GLGA 2UXDM 3HHXA 3ZH9B 4B3TM 1EE8A 4LZJA 2CHGA 1NJFA 2ERCA 1N34M 2G5GX 4FWGA 1IN8A 2A5YB 2L7IA 2CE7A 3SMPA 3TPZA 5KO3A 4G6ZA 4FCWA 4GMQA 3GLHA 5IREB 3GLFA 1GL6A 2C9OA 2QCUA 5LMNM 2XSZD 3D8BA 5KQ8A 1DO2A 3I4YA 4W5WA 5EP4A 3LQQA 1NVMA 4DR2M 3GRYA 3VK7A 4NXNM 4KHPM 4DV1M 3HU2A 2DHRA 2BNKA 5EP2A 1N77A 1HQCA 8CATA 1SXJA 5IWAM 3VDUA 2UU9M 5KPTA 3MK6A 1IBLM 3KSJA 2HHHM 4GC5A 3AOGA 3U61B 5ITXA 3PNVA 2YFQA 1L8QA 3PFIA 3U6EA 4LJAA 1XNRM 2Y0TA 3AOEA 4DR6M 5DYIA 4JV5M 5KQDA 4S12A 1GLNA 3E4RA 3EIEA 2M5ZA 4DR4M 4LG2A 4GKJM 1D2NA 4LJ9A 1KYIA 4MGZE 3NBIA 4LCBA 4MGKE 4GKKM 1N78A 3HHWA 3HJ8A 1IN4A 4GIPA 1NSFA 4LF7M 1J09A 4LGYA 3RFWA 2QZ4A 2CV0A 2CFOA 2XZUA 2C98A 3CF0A 2QPAA 2UXCM 2UXBM 5DYGA 1T3TA 1IY1A 4X62M 1QZMA 3M6AA 4JI5M 4MB7A 3E9SA 3KS4A 1HNZM 2KZSA 2I7NA 4G4OA 1DGHB 5EP3A 1N32M 4DR7M 2Y0QA 3KVWA 3GQ3A 3THGA 2V1CA 4DV3M 2Y21A 2LXEA 1Q3BA 2ZBKB 3J80S 2EUCA 3GPPA 3I51A 3SBJA 3RGPA 3L26A 3VKGA 3GPUA 3DA1A 3J7BA 2YNMD 1J7KA 4AKIA 2Q2EB 3R9XB 3T15A 4JI0M 3T1YM 2DWLA 4LJ7A 1K3XA 3Q8XA 1GL7A 4L78A 2Z7JA 2CEAA 4DR3M 4PD2A 2DZNB 2JA2A 4WW0A 2J7OA 1ORYB 2EO2A 3GRRA 5E26A 3SAVA 1VDDA 4L8RC 3KP1E 4II7A 1NHWC 1IXRC 1XC8A 4M9SA 4HLQA 3TWKA 1Z6TA 4BB9A 2VQEM 3WHKA 3L28A 1HR0M 1OFIA 3VLFB 2EA0A 3KW6A 1QQWA 3TWLA 3FUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 M;  1J5E M;  2OPF A;  5ITR A;  1MU5 A;  3A45 A;  3U6Q A;  4LFC M;  4X64 M;  3SAR A;  1L1T A;  4CIS A;  1PM5 A;  2E5L M;  4B3R M;  4JI6 M;  1Z5C A;  5FLX S;  5LMN M;  4K0K M;  4DR5 M;  5BR8 M;  3W0F A;  3GQ4 A;  5ITY A;  4NRV A;  4DR2 M;  3VK7 A;  2F4V M;  4NXN M;  4YY3 M;  3GPY A;  4DV1 M;  4DR1 M;  4KHP M;  3DOA A;  3OTO M;  4JYA M;  4LF9 M;  4PCZ A;  5IWA M;  2UU9 M;  5ITT A;  4G4N A;  1L2B A;  4PDI A;  3U6D A;  4LF5 M;  2UUC M;  1IBL M;  2HHH M;  1KFV A;  1XNQ M;  4NRW A;  4LFB M;  2ZM6 M;  2OQ4 A;  3U6P A;  2F5N A;  5ITX A;  3GPX A;  3U6E A;  3VK8 A;  1XMQ M;  1PJI A;  1XNR M;  2UUA M;  1I94 M;  4DR6 M;  4JV5 M;  1L2D A;  3T1H M;  4DV5 M;  3U6O A;  1K3W A;  1Z5B A;  3GP1 A;  3C58 A;  2VQF M;  4DR4 M;  4GKJ M;  4YHH M;  3GO8 A;  4LF6 M;  4GKK M;  1L1Z A;  1N34 M;  4JI2 M;  3SAU A;  4LF7 M;  1Q3C A;  4DV6 M;  4G4Q A;  2F5O A;  1Z59 A;  3U6C A;  2XZU A;  1MX0 A;  4NXM M;  3SAW A;  1Q39 A;  2UXC M;  4JI8 M;  3TWM A;  5ITX E;  2F5P A;  2UXB M;  4X62 M;  2F5S A;  4JI4 M;  4JI5 M;  4MB7 A;  4LFA M;  4B3S M;  1HNZ M;  4G4O A;  4PDG A;  2UUB M;  1N32 M;  3A42 A;  4DR7 M;  5ITQ A;  4JI7 M;  3GQ3 A;  1N33 M;  5ITU A;  1R2Z A;  4LF4 M;  4DV3 M;  4B3M M;  4DUY M;  1Q3B A;  2ZBK B;  3J80 S;  4X66 M;  3JAM S;  3JR5 A;  1TDZ A;  3GPP A;  1PJJ A;  1N36 M;  3SBJ A;  4G4R A;  3A46 A;  5A2Q S;  1NNJ A;  3SAT A;  3GPU A;  4DUZ M;  4DV0 M;  2Q2E B;  3J7A S;  4OX9 M;  4DV4 M;  3U6M A;  4ITQ A;  3GQ5 A;  4JI0 M;  3T1Y M;  1IBM M;  1K3X A;  2HKJ A;  1IBK M;  3J81 S;  2F5Q A;  1K82 A;  1FJG M;  4DR3 M;  4PD2 A;  3SAS A;  1XMO M;  3SAV A;  1HNX M;  1HNW M;  1R2Y A;  3JR4 A;  3U6S A;  4LF8 M;  2UXD M;  1XC8 A;  4AQY M;  3TWK A;  2VQE M;  4B3T M;  1EE8 A;  1HR0 M;  5LMU M;  5IT9 S;  1L2C A;  4X65 M;  2XZF A;  3U6L A;  4DV2 M;  1Z5A A;  2EA0 A;  3TWL A;  1TDH A;  4JI3 M;  4DV7 M; 
#chains in the Genus database with same CATH topology
 3LCV B;  5EP1 A;  1TF0 B;  4JXJ A;  4RKU F;  1J5E M;  5ITR A;  1Q02 A;  2L6O A;  3FYC A;  3B7Q A;  5BPV A;  3U6Q A;  3HU1 A;  1SG9 A;  5F3W A;  3K92 A;  1ZV1 A;  1L1T A;  1PM5 A;  1W5T A;  1WXQ A;  3PNY A;  2E5L M;  2C9C A;  3SHG B;  4AI6 A;  2D7H A;  1EFU B;  1G41 A;  4GHA A;  2QBY A;  3B9P A;  4K0K M;  4NOO B;  2LVN C;  3W0F A;  1IXS B;  2DWZ B;  3UJN A;  1VEJ A;  4LRS A;  1IQP A;  1D0L A;  1LV7 A;  1HQY E;  4NRV A;  2KXE A;  3ZQJ A;  4YY3 M;  4D80 A;  3GPY A;  4R3D A;  3U61 A;  1E9R A;  3FTC A;  2DXI A;  4HEO A;  2L4E A;  3SHF A;  1BVS A;  2VF7 A;  3FUU A;  3PVS A;  1D0K A;  2LH0 A;  1VQ1 A;  1L2B A;  3AV0 A;  4PDI A;  1IN5 A;  2RKO A;  3LCU A;  4GH9 A;  4Y28 F;  3U6D A;  1HT1 E;  1QUT A;  4LF5 M;  1RU3 A;  3HJS A;  4LFB M;  3U6P A;  2OQ4 A;  1GVN A;  4LRT A;  3FRH A;  3C3D A;  2CWB A;  4LJ6 A;  2BJW A;  1HT2 E;  4D82 A;  4LJ5 A;  4L4U A;  1L2D A;  3KXE C;  4KT0 F;  3U6O A;  2WSE F;  4FD2 A;  4EIW A;  3GLF B;  2HWJ A;  3K1J A;  3GP1 A;  3C58 A;  4QOZ C;  2KHH A;  4FWD A;  4QNR A;  2JY6 B;  1DGB A;  3LVW A;  1W5S A;  2MH8 A;  1XHB A;  3RGS A;  5KPZ A;  1G4A E;  1CUK A;  4JI2 M;  2FNA A;  1QAO A;  4G4Q A;  2W82 A;  1Z59 A;  3U6C A;  1SXJ B;  3U60 A;  1MX0 A;  2EJS A;  1OJL A;  2QP9 X;  4QOS A;  3FUV A;  3M7G A;  4OVZ B;  1YE9 A;  3B7N A;  3KDS E;  4JN6 A;  2CP8 A;  3ZCB B;  5ITX E;  2HL7 A;  3W68 A;  1IFY A;  3HU3 A;  4MH0 E;  1WIV A;  4JI4 M;  2ZTD A;  2DWN A;  3UGJ A;  3PXG A;  1G71 A;  4LJ4 A;  2DKL A;  4KLN A;  1UM8 A;  4PT5 A;  4LFA M;  2R46 A;  2GNO A;  2KA6 B;  3GRV A;  4B3S M;  3VKH A;  5EJC A;  5KPR A;  1PJT A;  2R45 A;  3BBZ A;  2UUB M;  2P5T A;  3L25 A;  4GHL A;  3VDP A;  1R5L A;  1N33 M;  1XXH A;  3HY5 A;  5EXT A;  5FSW A;  1EIJ A;  1DGF A;  3AFH A;  4DUY M;  1IM2 A;  3JAM S;  4X66 M;  3JR5 A;  1N36 M;  1G8P A;  3B74 A;  4G4R A;  2XSZ A;  2ZTC A;  3SYL A;  1OIP A;  2QBY B;  3FE3 A;  3NWL A;  5L8R F;  1R6B X;  2GQF A;  4OX9 M;  3LW5 F;  2DZL A;  4DV4 M;  3GQ5 A;  2R4E A;  1IY0 A;  4KOD A;  2QSF X;  3AOE C;  2C96 A;  2HKJ A;  2C99 A;  4IBG A;  1JR3 A;  2F5Q A;  1DGG A;  1QUS A;  3FTE A;  3HWS A;  1QAM A;  3SYK A;  1XMO M;  2JZ1 A;  2CV2 A;  1TGU A;  3JR4 A;  2LNH C;  2ZAM A;  4Z6Y A;  2FOI C;  3AKZ A;  5GKN A;  4TUW A;  5FTN A;  2MR9 A;  2CHV A;  2DZO B;  1G3I A;  3FTD A;  5LMU M;  2HAK A;  3QAU A;  4F1I A;  4B08 A;  4X65 M;  3U6L A;  3L29 A;  2JXN A;  1TH4 A;  3DZD A;  4L6V 6;  4QNM A;  2O25 A;  1TDH A;  5FTK A;  2OO9 A;  4B7G A;  2XF3 A;  4JI1 M;  3K9O A;  2OPF A;  4CJ6 A;  1ZMW A;  1MU5 A;  1E32 A;  4LFC M;  4X64 M;  3AL0 C;  4IJE A;  3L27 A;  4IBD A;  3GLH E;  1NV8 A;  2LTU A;  2Z4R A;  2R6F A;  1OTR A;  3FKE A;  3MMP A;  4B3R M;  5EXS A;  4JI6 M;  1PJS A;  5FLX S;  2C5R A;  1LTM A;  2KW0 A;  7CAT A;  4DR5 M;  3J2P B;  1NO1 A;  5BR8 M;  4D81 A;  5ITY A;  2K47 A;  3EIH A;  3LQR A;  3GRU A;  1UFZ A;  1VEG A;  3QWL A;  4DR1 M;  2OOA A;  3U5Z B;  3MHV C;  4HL4 A;  1YLA A;  3U5Z A;  3OTO M;  3TL4 X;  2XFS A;  2EKK A;  3A98 B;  1JR3 D;  1XXH B;  2HCB A;  4CIZ A;  4LF9 M;  3F92 A;  2CUZ A;  1GAB A;  3CGW A;  5ITT A;  1NY6 A;  1IY2 A;  1OFH A;  2K0B X;  2MRO B;  3W0L B;  2OOB A;  4MGH A;  4UN2 B;  3GLI B;  1XMQ M;  1PJI A;  2UUA M;  4WUR A;  1I94 M;  1WHC A;  3IG8 A;  4RNA A;  5C18 A;  2QHO B;  2MJ5 B;  2K6B A;  1IN6 A;  1D0M A;  2KNA A;  3B89 A;  4DV5 M;  2MGW A;  3AJI B;  3T1H M;  1K3W A;  2RGO A;  2Z4S A;  3TE6 A;  2VQF M;  2WSC F;  3U60 B;  3T38 A;  1NY5 A;  4YHH M;  3GO8 A;  3LVV A;  4NSR A;  4LF6 M;  2DAM A;  3I4V A;  2X49 A;  1L1Z A;  3HJQ A;  3ILK A;  1WGL A;  1C1K A;  3HKP A;  1Q3C A;  4DV6 M;  2I7P A;  3I01 M;  2F5O A;  2VDB B;  3C9P A;  4I8O A;  4CHT B;  3RE8 A;  2NQ8 C;  3K8Z A;  2XFT A;  2DWM A;  4MM3 B;  2F5P A;  3J27 B;  3E21 A;  4DBG B;  3C3E A;  2F5S A;  2RGH A;  1JR3 E;  2R18 A;  1OAO C;  4G3O A;  4L16 A;  2XGN A;  3D8L A;  4FCT A;  4Q7J A;  4AZF A;  4XGI A;  2O5R A;  4AW4 A;  1SXJ D;  1NJG A;  1R7R A;  4IBB A;  2L7H A;  4AG6 A;  4NSO B;  3WHL A;  4MGI E;  5ITQ A;  4AKG A;  4JI7 M;  1E94 E;  3W67 A;  1GKI A;  2DAE A;  3VFD A;  4LF4 M;  1KSF X;  5H37 D;  4B3M M;  3IHP A;  4B7H A;  1NV9 A;  4IIW A;  4LZZ A;  5A2Q S;  1NNJ A;  3SAT A;  1SXJ C;  2DEN A;  2LWX A;  2DNA A;  2O01 F;  4M0D A;  5FTM A;  4BLC A;  4ITQ A;  2J5Y A;  2KRU A;  3HX3 A;  3KOW E;  2KRK A;  3CF6 E;  1JB0 F;  1PRB A;  1TH2 A;  4Z8X A;  1DO0 A;  2BJV A;  3SMS A;  1DGH A;  4GEW A;  4ZPX A;  1K82 A;  1IBK M;  1S3S A;  3SAS A;  3CTW B;  2R62 A;  1IXZ A;  1NHG C;  1XWI A;  2QEN A;  1OIZ A;  3LMM A;  1YUB A;  3K2L A;  3KOZ E;  1R2Y A;  4REZ A;  4BBA A;  4AQY M;  2H1R A;  3MJ5 A;  2L4F A;  2JWS A;  1QVR A;  1ZMU A;  3BXW A;  1GJT A;  4L15 A;  1ZQ9 A;  3HHY A;  3TQS A;  1L2C A;  2XZF A;  5IT9 S;  1GJS A;  1Z5A A;  4DV2 M;  1SXJ E;  2B3T A;  2UUC M;  4JI3 M;  2ZAO A;  4DV7 M;  2L2D A;  2JY5 A;  2D7G A;  1VDL A;  3A45 A;  1T6O A;  3SAR A;  4CIS A;  2M60 A;  2Z3X A;  2V1U A;  3R8F A;  1NNU C;  4FCV A;  3E46 A;  4IJF A;  1Z5C A;  2LVP C;  5E6J A;  3KSX A;  1X37 A;  1N75 A;  2JZ0 A;  2KNZ A;  2CRU A;  4GRI A;  3GQ4 A;  2H5X A;  2KEB A;  2F4V M;  4WP2 A;  2YR0 A;  2L09 A;  1HJP A;  3DOA A;  4QHS A;  5EQT A;  2R65 A;  2XH9 A;  4JYA M;  1AIP C;  4R7G A;  3KS8 A;  2DAG A;  4QHT A;  4LY6 A;  4PCZ A;  1ZMV A;  3BOS A;  2KZU A;  1FNN A;  1QZE A;  5EXP A;  4M0W A;  4G4N A;  1PJQ A;  2BWE A;  2R4J A;  1OAI A;  2YQZ A;  3UK6 A;  4IBK A;  1KFV A;  1XNQ M;  4NRW A;  2LVO C;  1QAQ A;  2ZM6 M;  2KNV A;  3GLG E;  2F5N A;  5JI2 E;  3GPX A;  5C1B A;  1P3Q Q;  3VK8 A;  1GO5 A;  3HZJ A;  4RF1 A;  3ZC7 B;  2VII A;  4GC9 A;  5JI3 E;  2BWB A;  4AG5 A;  4B7F A;  4AKH A;  2G8L A;  4R71 A;  4GIT A;  1Z5B A;  1MN3 A;  3SC3 A;  3T6P A;  4P16 A;  2JY7 A;  3FUX A;  4KO8 A;  3M0E A;  2CHQ A;  4ANR A;  4OW0 A;  2Z8Y M;  2V6Z M;  2AHM A;  3B7Z A;  3SAU A;  3KFU G;  1F4I A;  1A5T A;  2D7E A;  4IBJ A;  1H6U A;  4I81 A;  4OU7 A;  2X4A A;  4NXM M;  5EXX A;  1Q39 A;  4NL4 H;  3SAW A;  4IBC A;  4JI8 M;  3TWM A;  3FYD A;  3GLH B;  1AUA A;  2CV1 A;  3FD9 A;  1WGN A;  4IBI A;  3FTF A;  3DFZ A;  1QDT A;  2FFJ A;  1TH3 A;  4NC6 A;  3GLI A;  4FVM A;  3KOY E;  4A3V B;  4OVZ A;  5FTL A;  2JP7 A;  3HHZ A;  4I4L A;  4LJ8 A;  2XLJ A;  1WR1 B;  4FW9 A;  4PDG A;  1YSY A;  3A42 A;  4FWH A;  4LGM A;  2Y20 A;  3KOX E;  5ITU A;  2DAK A;  3HGI A;  1R2Z A;  1G59 A;  2APL A;  2FE8 A;  1JQJ C;  2X8A A;  2ZAN A;  4I5S A;  4CGY B;  4F2L A;  1TDZ A;  1PJJ A;  1V34 A;  1QAN A;  2XEP A;  5IZ7 D;  5FTJ A;  3UMM A;  1IN7 A;  1R4G A;  3A46 A;  1I4W A;  4DUZ M;  3IG5 A;  4DV0 M;  2G3Q A;  4MGY E;  1ZAE A;  4M9X A;  1V92 A;  3J7A S;  3I04 M;  3U6M A;  2DVW B;  4P17 A;  1IBM M;  3L2A A;  4IBE A;  3GLG B;  1V33 A;  1QYR A;  2R0I A;  3SFZ A;  3J81 S;  1FJG M;  3UZU A;  1OQY A;  3FUW A;  4M9Z A;  1OKS A;  5DNY A;  4RF0 A;  4IBF A;  3H4M A;  1HNX M;  1HNW M;  1E9S A;  2J7N A;  3U6S A;  4LF8 M;  3CF2 A;  3KP0 E;  4XBO A;  3GLG A;  2UXD M;  3HHX A;  3ZH9 B;  3QYB A;  4B3T M;  1EE8 A;  3NBX X;  4LZJ A;  2CHG A;  2KDL A;  5DFL A;  3H4J A;  1NJF A;  2ERC A;  1N34 M;  3FRI A;  2G5G X;  4FWG A;  1IN8 A;  2A5Y B;  2JNH A;  2L7I A;  2CE7 A;  3SMP A;  3TPZ A;  1PGY A;  5KO3 A;  4G6Z A;  4FCW A;  1WJ7 A;  4GMQ A;  1VG5 A;  3GLH A;  5IRE B;  3GLF A;  1GL6 A;  2C9O A;  2K9D A;  2QCU A;  5LMN M;  2XSZ D;  3D8B A;  5KQ8 A;  1DO2 A;  3I4Y A;  4W5W A;  5EP4 A;  3LQQ A;  1NVM A;  2VF8 A;  4DR2 M;  3GRY A;  3VK7 A;  4NXN M;  4KHP M;  4DV1 M;  3HU2 A;  2DHR A;  2BNK A;  5EP2 A;  1N77 A;  1HQC A;  8CAT A;  1SXJ A;  5IWA M;  3VDU A;  2UU9 M;  5KPT A;  1Y8G A;  3MK6 A;  1IBL M;  3KSJ A;  2HHH M;  4GC5 A;  2LBC A;  3AOG A;  2WZJ A;  3U61 B;  2LVQ D;  5ITX A;  3PNV A;  2YFQ A;  2QNJ A;  1L8Q A;  3PFI A;  3U6E A;  4LJA A;  2FH0 A;  1XNR M;  2Y0T A;  3AOE A;  4DR6 M;  5DYI A;  4JV5 M;  2JY8 A;  5KQD A;  4S12 A;  1GLN A;  2LHC A;  3E4R A;  3EIE A;  2M5Z A;  4DR4 M;  4LG2 A;  1VEK A;  1D2N A;  4GKJ M;  4LJ9 A;  1DV0 A;  1KYI A;  4MGZ E;  3NBI A;  4LCB A;  4MGK E;  4GKK M;  1N78 A;  3HHW A;  3HJ8 A;  1IN4 A;  4GIP A;  1NSF A;  1TR8 A;  3QYE A;  2DAI A;  4LF7 M;  1J09 A;  2N35 A;  4LGY A;  3RFW A;  2QZ4 A;  4XK8 F;  2CV0 A;  2CFO A;  2XZU A;  2EKF A;  2DI0 A;  2C98 A;  2WSF F;  3CF0 A;  2QPA A;  2UXC M;  2UXB M;  5DYG A;  1T3T A;  1QDR A;  1IY1 A;  2FS1 A;  1QZM A;  4X62 M;  3M6A A;  4JI5 M;  4MB7 A;  3E9S A;  1IXS A;  3V76 A;  3K9P A;  3KS4 A;  1HNZ M;  2KZS A;  2I7N A;  4G4O A;  1DGH B;  5EP3 A;  1N32 M;  4DR7 M;  2Y0Q A;  3KVW A;  3GQ3 A;  3THG A;  2V1C A;  4DV3 M;  2Y21 A;  2LXE A;  1Q3B A;  2ZBK B;  2LHG A;  3J80 S;  2EUC A;  3GPP A;  3I51 A;  2RRU A;  3SBJ A;  3RGP A;  3L26 A;  2DHY A;  3VKG A;  3GPU A;  3DA1 A;  3J7B A;  2YNM D;  1J7K A;  4AKI A;  1TTE A;  1MJG M;  2Q2E B;  2QQ8 A;  3IEC A;  3T15 A;  3R9X B;  4JI0 M;  3T1Y M;  2DWL A;  4LJ7 A;  1K3X A;  3Q8X A;  1GL7 A;  3GLI E;  4L78 A;  2Z7J A;  2CEA A;  4DR3 M;  4PD2 A;  2DZN B;  2JA2 A;  3GLF E;  4WW0 A;  2J7O A;  1ORY B;  2EO2 A;  3GRR A;  5E26 A;  2R44 A;  3SAV A;  1VDD A;  4L8R C;  3KP1 E;  4II7 A;  1NHW C;  1C7Y A;  1IXR C;  1XC8 A;  1XXH E;  4M9S A;  4HLQ A;  3TWK A;  1Z6T A;  4BB9 A;  1XB2 B;  3WHK A;  2VQE M;  3L28 A;  1HR0 M;  1OFI A;  1T43 A;  2LVA A;  3Q8G A;  3VLF B;  2EA0 A;  2JUJ A;  3KW6 A;  1QQW A;  3TWL A;  3FUT A; 
#chains in the Genus database with same CATH homology
 5EP1 A;  4JXJ A;  1J5E M;  5ITR A;  2L6O A;  3FYC A;  5BPV A;  3U6Q A;  3HU1 A;  5F3W A;  1L1T A;  3K92 A;  1PM5 A;  1W5T A;  1WXQ A;  3PNY A;  2E5L M;  2C9C A;  3SHG B;  4AI6 A;  2D7H A;  1G41 A;  4GHA A;  2QBY A;  3B9P A;  4K0K M;  4NOO B;  3W0F A;  1IXS B;  2DWZ B;  3UJN A;  4LRS A;  1IQP A;  1LV7 A;  4NRV A;  1HQY E;  2KXE A;  4YY3 M;  3GPY A;  4D80 A;  4R3D A;  3U61 A;  1E9R A;  3FTC A;  2DXI A;  3SHF A;  3FUU A;  3PVS A;  2LH0 A;  1L2B A;  3AV0 A;  4PDI A;  1IN5 A;  2RKO A;  4GH9 A;  3U6D A;  4LF5 M;  3VKH A;  1HT1 E;  3HJS A;  4LFB M;  3U6P A;  2OQ4 A;  1GVN A;  4LRT A;  4LJ6 A;  2BJW A;  1HT2 E;  4D82 A;  4LJ5 A;  4L4U A;  1L2D A;  3KXE C;  3U6O A;  4FD2 A;  4EIW A;  3GLF B;  3K1J A;  3GP1 A;  3C58 A;  4QOZ C;  4FWD A;  4QNR A;  1DGB A;  3LVW A;  1W5S A;  1XHB A;  3RGS A;  5KPZ A;  1G4A E;  4JI2 M;  2FNA A;  1QAO A;  4G4Q A;  2W82 A;  1Z59 A;  3U6C A;  1SXJ B;  3U60 A;  1MX0 A;  4QOS A;  1OJL A;  2QP9 X;  3FUV A;  3M7G A;  4OVZ B;  1YE9 A;  3KDS E;  4JN6 A;  3ZCB B;  5ITX E;  2HL7 A;  3HU3 A;  4MH0 E;  4JI4 M;  2DWN A;  3UGJ A;  3PXG A;  4LJ4 A;  4KLN A;  1UM8 A;  4PT5 A;  4LFA M;  2R46 A;  4B3S M;  2KA6 B;  3GRV A;  5EJC A;  5KPR A;  2R45 A;  2UUB M;  3L25 A;  2P5T A;  4GHL A;  3VDP A;  1N33 M;  1XXH A;  5EXT A;  5FSW A;  1DGF A;  3AFH A;  4DUY M;  1IM2 A;  3JAM S;  4X66 M;  3JR5 A;  1N36 M;  1G8P A;  4G4R A;  2XSZ A;  3SYL A;  2QBY B;  3NWL A;  1R6B X;  4OX9 M;  4DV4 M;  3GQ5 A;  2R4E A;  1IY0 A;  4KOD A;  3AOE C;  2C96 A;  2HKJ A;  2C99 A;  4IBG A;  1JR3 A;  2F5Q A;  1DGG A;  3FTE A;  3HWS A;  1QAM A;  3SYK A;  1XMO M;  2CV2 A;  1TGU A;  3JR4 A;  2LNH C;  2ZAM A;  4Z6Y A;  2FOI C;  3AKZ A;  5GKN A;  4TUW A;  5FTN A;  2CHV A;  2DZO B;  1G3I A;  3FTD A;  5LMU M;  3QAU A;  4B08 A;  4X65 M;  3U6L A;  3L29 A;  1TH4 A;  3DZD A;  4QNM A;  1TDH A;  5FTK A;  4B7G A;  2XF3 A;  4JI1 M;  2OPF A;  1MU5 A;  1E32 A;  4LFC M;  4X64 M;  3AL0 C;  4IJE A;  3L27 A;  4IBD A;  2Z4R A;  3FKE A;  4B3R M;  5EXS A;  4JI6 M;  5FLX S;  2C5R A;  2KW0 A;  7CAT A;  4DR5 M;  3J2P B;  5BR8 M;  4D81 A;  5ITY A;  2K47 A;  3EIH A;  3LQR A;  3GRU A;  3QWL A;  4DR1 M;  3U5Z B;  3MHV C;  4HL4 A;  3U5Z A;  3OTO M;  3TL4 X;  2XFS A;  3A98 B;  1JR3 D;  1XXH B;  2HCB A;  4LF9 M;  2CUZ A;  5ITT A;  1NY6 A;  1IY2 A;  1OFH A;  3W0L B;  4MGH A;  3GLI B;  1XMQ M;  1PJI A;  2UUA M;  4WUR A;  1I94 M;  3IG8 A;  4RNA A;  5C18 A;  1IN6 A;  3T1H M;  4DV5 M;  3AJI B;  1K3W A;  2RGO A;  2Z4S A;  3TE6 A;  2VQF M;  3U60 B;  3T38 A;  1NY5 A;  4YHH M;  3GO8 A;  3LVV A;  4NSR A;  4LF6 M;  3I4V A;  2X49 A;  1L1Z A;  3HJQ A;  3ILK A;  1C1K A;  3HKP A;  1Q3C A;  4DV6 M;  2I7P A;  2F5O A;  4I8O A;  4CHT B;  3RE8 A;  2NQ8 C;  3K8Z A;  2XFT A;  2DWM A;  4MM3 B;  2F5P A;  3J27 B;  2F5S A;  2RGH A;  2R18 A;  2V1U A;  4L16 A;  4AZF A;  2XGN A;  3D8L A;  4FCT A;  4XGI A;  2O5R A;  4AW4 A;  1SXJ D;  1NJG A;  1R7R A;  4IBB A;  2L7H A;  4AG6 A;  4NSO B;  3WHL A;  4MGI E;  5ITQ A;  4AKG A;  4JI7 M;  1E94 E;  1GKI A;  3VFD A;  4LF4 M;  1KSF X;  5H37 D;  4B3M M;  4B7H A;  4IIW A;  4LZZ A;  5A2Q S;  1NNJ A;  3SAT A;  1SXJ C;  2LWX A;  4M0D A;  5FTM A;  4BLC A;  4ITQ A;  2KRU A;  3KOW E;  2KRK A;  3CF6 E;  1TH2 A;  4Z8X A;  1DO0 A;  2BJV A;  3SMS A;  1DGH A;  4ZPX A;  1K82 A;  1IBK M;  1S3S A;  3SAS A;  3CTW B;  2R62 A;  1IXZ A;  1NHG C;  1XWI A;  2QEN A;  3LMM A;  1YUB A;  3K2L A;  3KOZ E;  1R2Y A;  4REZ A;  4BBA A;  4AQY M;  2H1R A;  3MJ5 A;  1QVR A;  3HHY A;  4L15 A;  1ZQ9 A;  3TQS A;  1L2C A;  5IT9 S;  2XZF A;  1Z5A A;  4DV2 M;  1SXJ E;  2UUC M;  4JI3 M;  2ZAO A;  4DV7 M;  2D7G A;  3A45 A;  3SAR A;  4CIS A;  2M60 A;  2Z3X A;  3R8F A;  1NNU C;  4FCV A;  4IJF A;  1Z5C A;  5E6J A;  3KSX A;  1X37 A;  1N75 A;  4GRI A;  3GQ4 A;  2KEB A;  2F4V M;  2YR0 A;  2L09 A;  4QHS A;  3DOA A;  5EQT A;  2R65 A;  2XH9 A;  4JYA M;  4R7G A;  3KS8 A;  4QHT A;  4LY6 A;  4PCZ A;  3BOS A;  2KZU A;  1FNN A;  5EXP A;  4G4N A;  4M0W A;  2R4J A;  2YQZ A;  3UK6 A;  4IBK A;  1KFV A;  1XNQ M;  4NRW A;  1QAQ A;  2ZM6 M;  2F5N A;  5JI2 E;  3GPX A;  5C1B A;  3VK8 A;  4RF1 A;  3ZC7 B;  2VII A;  4GC9 A;  5JI3 E;  4AG5 A;  4B7F A;  4AKH A;  2G8L A;  4GIT A;  1Z5B A;  3SC3 A;  4P16 A;  3FUX A;  4KO8 A;  3M0E A;  2CHQ A;  4OW0 A;  2V6Z M;  2AHM A;  3SAU A;  3KFU G;  2D7E A;  4IBJ A;  1H6U A;  4I81 A;  4OU7 A;  2X4A A;  4NXM M;  5EXX A;  1Q39 A;  4NL4 H;  3SAW A;  4IBC A;  4JI8 M;  3TWM A;  3FYD A;  3GLH B;  2CV1 A;  3FD9 A;  3FTF A;  4IBI A;  3DFZ A;  2FFJ A;  1TH3 A;  3GLI A;  4FVM A;  3KOY E;  4A3V B;  4OVZ A;  5FTL A;  3HHZ A;  4I4L A;  4LJ8 A;  2XLJ A;  4FW9 A;  4PDG A;  1YSY A;  3A42 A;  4FWH A;  4LGM A;  2Y20 A;  3KOX E;  5ITU A;  3HGI A;  1R2Z A;  1G59 A;  2FE8 A;  2X8A A;  1JQJ C;  1PJJ A;  2ZAN A;  4I5S A;  4CGY B;  1TDZ A;  1QAN A;  2XEP A;  5IZ7 D;  5FTJ A;  3UMM A;  1IN7 A;  3A46 A;  1I4W A;  4DUZ M;  3IG5 A;  4DV0 M;  3J7A S;  4MGY E;  1ZAE A;  4M9X A;  3U6M A;  2DVW B;  1IBM M;  3L2A A;  4IBE A;  3GLG B;  1QYR A;  3SFZ A;  3J81 S;  1FJG M;  3UZU A;  3FUW A;  4M9Z A;  5DNY A;  4RF0 A;  4IBF A;  3H4M A;  1HNX M;  1HNW M;  1E9S A;  2J7N A;  3U6S A;  4LF8 M;  3CF2 A;  3KP0 E;  4XBO A;  3GLG A;  2UXD M;  3HHX A;  3ZH9 B;  4B3T M;  1EE8 A;  4LZJ A;  2CHG A;  1NJF A;  2ERC A;  1N34 M;  2G5G X;  4FWG A;  1IN8 A;  2A5Y B;  2L7I A;  2CE7 A;  3SMP A;  3TPZ A;  5KO3 A;  4G6Z A;  4FCW A;  4GMQ A;  3GLH A;  5IRE B;  3GLF A;  1GL6 A;  2C9O A;  2QCU A;  5LMN M;  2XSZ D;  3D8B A;  5KQ8 A;  1DO2 A;  3I4Y A;  4W5W A;  5EP4 A;  3LQQ A;  1NVM A;  4DR2 M;  3GRY A;  3VK7 A;  4NXN M;  4KHP M;  4DV1 M;  3HU2 A;  2DHR A;  2BNK A;  5EP2 A;  1N77 A;  1HQC A;  8CAT A;  1SXJ A;  5IWA M;  3VDU A;  2UU9 M;  5KPT A;  3MK6 A;  1IBL M;  3KSJ A;  2HHH M;  4GC5 A;  3AOG A;  3U61 B;  5ITX A;  3PNV A;  2YFQ A;  1L8Q A;  3PFI A;  3U6E A;  4LJA A;  1XNR M;  2Y0T A;  3AOE A;  4DR6 M;  5DYI A;  4JV5 M;  5KQD A;  4S12 A;  1GLN A;  3E4R A;  3EIE A;  2M5Z A;  4DR4 M;  4LG2 A;  4GKJ M;  1D2N A;  4LJ9 A;  1KYI A;  4MGZ E;  3NBI A;  4LCB A;  4MGK E;  4GKK M;  1N78 A;  3HHW A;  3HJ8 A;  1IN4 A;  4GIP A;  1NSF A;  4LF7 M;  1J09 A;  4LGY A;  3RFW A;  2QZ4 A;  2CV0 A;  2CFO A;  2XZU A;  2C98 A;  3CF0 A;  2QPA A;  2UXC M;  2UXB M;  5DYG A;  1T3T A;  1IY1 A;  4X62 M;  1QZM A;  3M6A A;  4JI5 M;  4MB7 A;  3E9S A;  3KS4 A;  1HNZ M;  2KZS A;  2I7N A;  4G4O A;  1DGH B;  5EP3 A;  1N32 M;  4DR7 M;  2Y0Q A;  3KVW A;  3GQ3 A;  3THG A;  2V1C A;  4DV3 M;  2Y21 A;  2LXE A;  1Q3B A;  2ZBK B;  3J80 S;  2EUC A;  3GPP A;  3I51 A;  3SBJ A;  3RGP A;  3L26 A;  3VKG A;  3GPU A;  3DA1 A;  3J7B A;  2YNM D;  1J7K A;  4AKI A;  2Q2E B;  3R9X B;  3T15 A;  4JI0 M;  3T1Y M;  2DWL A;  4LJ7 A;  1K3X A;  3Q8X A;  1GL7 A;  4L78 A;  2Z7J A;  2CEA A;  4DR3 M;  4PD2 A;  2DZN B;  2JA2 A;  4WW0 A;  2J7O A;  1ORY B;  2EO2 A;  3GRR A;  5E26 A;  3SAV A;  1VDD A;  4L8R C;  3KP1 E;  4II7 A;  1NHW C;  1IXR C;  1XC8 A;  4M9S A;  4HLQ A;  3TWK A;  1Z6T A;  4BB9 A;  2VQE M;  3WHK A;  3L28 A;  1HR0 M;  1OFI A;  3VLF B;  2EA0 A;  3KW6 A;  1QQW A;  3TWL A;  3FUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...