4AQYM

Structure of ribosome-apramycin complexes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4aqyM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4aqyM02
3U6SA 1EE8A 3U6MA 5ITYA 3J81S 4G4NA 2OQ4A 3U6LA 2UUAM 1MX0A 3SAVA 2VQFM 4DV4M 3GPUA 5ITRA 2F5PA 3C58A 1PM5A 1KFVA 5ITUA 3TWMA 5IWAM 3J7AS 1Q39A 1XNQM 4JI5M 1L2BA 3GQ4A 4NXNM 3U6PA 3OTOM 4OX9M 3SAUA 1N36M 4DR4M 4B3SM 2F4VM 4YHHM 4JI8M 4JI2M 4B3RM 5ITXA 4YY3M 1IBMM 2UU9M 3VK8A 2OPFA 3JR4A 3SARA 1IBLM 3T1YM 5IT9S 5ITQA 1TDHA 4DR1M 3SASA 4DV5M 3U6QA 2EA0A 3TWLA 4JI4M 1Z5AA 3VK7A 2UUCM 3GPXA 1FJGM 1HNZM 4CISA 3SATA 3J80S 1HNXM 4G4QA 2HHHM 4DV1M 4LFAM 3GQ5A 4DR3M 1XMOM 1N34M 2F5NA 2UXCM 2XZUA 3SBJA 3U6EA 4B3MM 4DR2M 2ZBKB 1PJIA 1R2ZA 1PJJA 2XZFA 5BR8M 3A45A 3W0FA 1NNJA 4G4RA 3T1HM 4DV3M 3JAMS 4DUYM 4DV0M 2VQEM 4DV7M 1Z5BA 3GPPA 4JYAM 4JI1M 2F5QA 4K0KM 1R2YA 4JI0M 3A42A 3U6DA 4GKJM 1K82A 1Z59A 4LFCM 4LFBM 4X65M 1L1TA 3TWKA 1Q3CA 3DOAA 4X64M 1L1ZA 1I94M 1MU5A 3A46A 3GP1A 2E5LM 4DV2M 5A2QS 4PCZA 4JI3M 4X62M 4G4OA 4LF5M 3JR5A 4B3TM 4PDGA 5FLXS 3U6CA 2UXBM 5ITTA 2HKJA 5LMUM 3U6OA 2ZM6M 1N33M 4JI7M 4LF4M 4LF8M 4KHPM 4X66M 4GKKM 3GQ3A 5LMNM 1XNRM 2F5SA 1Q3BA 2Q2EB 1HR0M 4NXMM 1L2DA 3SAWA 1IBKM 4DR6M 4DR7M 4LF7M 4LF9M 4JV5M 1XC8A 4AQYM 1TDZA 4DR5M 2F5OA 2UUBM 4PDIA 1J5EM 3GPYA 1N32M 4LF6M 1Z5CA 4NRWA 5ITXE 4NRVA 3GO8A 4PD2A 4ITQA 1K3WA 1XMQM 4MB7A 1K3XA 4JI6M 1HNWM 2UXDM 4DV6M 1L2CA 4DUZM
chains in the Genus database with same CATH superfamily
3U6SA 1DGHB 3C9PA 3SMSA 1N78A 2DWZB 4M9XA 2CUZA 3KOYE 4QNMA 2RGHA 1DV0A 4DV4M 1QANA 3GPUA 2LNHC 3B74A 2LVQD 2QBYB 3VDUA 2JA2A 1Y8GA 2MROB 2P5TA 3TPZA 3TWMA 3FE3A 1IY2A 1PJSA 4FCTA 4IJEA 4Q7JA 4GHAA 4D81A 5E26A 2CRUA 2AHMA 4LG2A 2V6ZM 1ZMWA 4AG5A 1G4AE 1MJGM 4F2LA 3TE6A 4G6ZA 1OIZA 2CV1A 1SXJD 4B3RM 1EIJA 2DAMA 2UU9M 3KS4A 4B08A 4FWGA 3VK8A 1TH3A 1DGHA 1DO0A 2HCBA 2JP7A 3Q8GA 2MJ5B 1TDHA 3T38A 1XXHB 1QZEA 2EA0A 2WZJA 1LTMA 4FWHA 2UUCM 3IG8A 1DGBA 4M0DA 4R3DA 1I4WA 2C9CA 3ILKA 1TGUA 3GLGA 1LV7A 4NSOB 3U60B 3TQSA 1KSFX 4DV1M 4FCWA 7CATA 2F5NA 4KLNA 2UXCM 2ERCA 3SBJA 2BJWA 3HHZA 3U6EA 2ZBKB 4B3MM 3KFUG 1G71A 1PGYA 3L29A 4WW0A 2HAKA 4AKHA 2QPAA 4RF1A 2DNAA 1PJQA 4HL4A 1T3TA 2CFOA 5KQ8A 5GKNA 4Z8XA 2C9OA 3W0LB 4LZJA 4IBDA 2DKLA 4DBGB 4CGYB 3GPPA 2K6BA 4JI1M 2LH0A 2F5QA 3AOGA 3CF2A 3GLHE 3NBIA 4JI0M 3AL0C 1Z59A 3LCUA 2BNKA 2CHGA 3E46A 3GLIE 4PT5A 1L1TA 3TWKA 1Q3CA 3HJ8A 2LVAA 4X64M 1L1ZA 2C98A 1MU5A 5F3WA 2DAIA 2O01F 1QYRA 2JUJA 3B89A 4MGHA 3HHYA 3FKEA 1OTRA 1GJTA 2H1RA 3HWSA 3HKPA 5EP2A 4LF5M 3JR5A 1NY6A 1SG9A 2KDLA 1N77A 2X4AA 1QAQA 2EJSA 3I04M 5LMUM 2DAEA 2G5GX 3QAUA 1TH4A 3WHLA 5KPTA 5LMNM 4HEOA 1XB2B 4P16A 2ZTDA 3B7ZA 4FVMA 4L78A 3UMMA 1NVMA 4Z6YA 1L2DA 4ZPXA 3SAWA 5EXTA 4DR6M 4LF7M 4XBOA 3I4VA 5C1BA 4WURA 4IIWA 2MH8A 2DHYA 4L8RC 2B3TA 2XFSA 2F5OA 4PDIA 3U5ZB 3QYBA 5BPVA 1N32M 4GEWA 4LF6M 1IQPA 3LW5F 4IBKA 4AKIA 3QWLA 2LBCA 5EXPA 4NRVA 1ZMVA 4LJ7A 4GIPA 2QENA 3E21A 3B7QA 3VKHA 1XWIA 1K3XA 1TF0B 4JI6M 1IN7A 5EXXA 1HNWM 2KXEA 5EJCA 2G8LA 1JQJC 1TH2A 2L2DA 2VF8A 1OJLA 3MK6A 2UUAM 4KO8A 4L16A 3GLGE 1IY1A 1E32A 1YE9A 2JXNA 3GRYA 3J27B 3HZJA 2D7HA 1UM8A 2HWJA 3C58A 3U5ZA 2F5PA 2NQ8C 4G3OA 5ITUA 1V33A 3K92A 5IWAM 3HHXA 3F92A 3J7AS 1Q39A 2APLA 4I8OA 2RRUA 2FE8A 4JI5M 1L2BA 1ZQ9A 3GQ4A 3U6PA 1G41A 1NNUC 1V34A 4KODA 3OTOM 3SAUA 1H6UA 1RU3A 1GL6A 1E9SA 3W68A 3SHFA 2LWXA 2XFTA 1NJFA 1HQCA 1OAOC 2J7NA 3JR4A 4AZFA 1IM2A 4D82A 5IT9S 2KNVA 3GLFA 4MGZE 4DV5M 1D2NA 4JI4M 3TWLA 2ZAOA 1NHWC 1WIVA 3VK7A 3C3EA 3HX3A 2QHOB 4IBJA 1HNXM 2LHCA 4GH9A 4G4QA 1TR8A 3PXGA 4AG6A 2KRKA 3LVWA 2R46A 2DXIA 4TUWA 2XZUA 3GLGB 1UFZA 1WXQA 2K47A 4OVZA 4DR2M 2MR9A 5IZ7D 2FH0A 1R2ZA 1PJJA 5BR8M 3A45A 3K2LA 4B7FA 3FTEA 1NNJA 3KP0E 4DV3M 1GLNA 1ORYB 4FW9A 3JAMS 1NV9A 3LQRA 1GKIA 2A5YB 5FSWA 2VQEM 3HU2A 1Z5BA 4ANRA 1OQYA 1E94E 2R4JA 4JYAM 1VQ1A 1MN3A 3A42A 3D8LA 3U6DA 1K82A 3R9XB 4GKJM 1WHCA 4S12A 4LFCM 1S3SA 4LFBM 3K1JA 4X65M 3CGWA 3H4MA 1KYIA 3L27A 2CV2A 2EKFA 2KA6B 2V1CA 2WSFF 3L28A 3RGSA 3M6AA 4MH0E 4DV2M 2YQZA 3VKGA 3MMPA 2EO2A 3D8BA 2Z4SA 5FLXS 1QDRA 1QVRA 1TTEA 5ITTA 2O5RA 1JR3E 2JWSA 3U6OA 1N33M 4JI7M 1NO1A 2X49A 2CE7A 4LF8M 1DGGA 3GRRA 3SFZA 4X66M 4CJ6A 4KHPM 2R6FA 3H4JA 1XNRM 2R4EA 2F5SA 4QOZC 1PJTA 1Q3BA 2KEBA 2YR0A 1HR0M 1NHGC 2FOIC 4LRTA 5FTJA 5JI3E 3QYEA 2KZSA 2MGWA 4IBGA 4DR7M 3KSXA 2QCUA 2K0BX 4LJ4A 2DVWB 3J7BA 4AQYM 3Q8XA 4DR5M 2UUBM 1G3IA 3U61A 3GPYA 4RF0A 3L25A 3B9PA 3BBZA 3CTWB 3SMPA 1SXJC 5JI2E 1IXZA 3FUUA 2L09A 3DZDA 5EP1A 1HQYE 4QNRA 2DENA 2BWBA 3EIEA 4R71A 3HU3A 4CIZA 3GLFE 2ZAMA 2DHRA 2UXDM 1VEJA 2R65A 1L2CA 1D0KA 1EE8A 3CF6E 3RE8A 3J81S 3U6LA 2O25A 4M9ZA 3U6MA 2LVOC 2JNHA 4MGIE 2DWLA 4IBFA 1GO5A 1CUKA 2VQFM 3SAVA 2JY7A 2XH9A 5ITRA 4BLCA 2JY5A 3GRUA 1XHBA 2Z3XA 1KFVA 4LJ5A 3AOEC 1VEKA 2Y20A 3HGIA 2KNZA 1QDTA 1XNQM 3T6PA 4JN6A 1VEGA 3FRHA 4NXNM 4OX9M 1N36M 5E6JA 4B3SM 4M0WA 8CATA 1ZAEA 3M7GA 3UJNA 3LCVB 5ITXA 1IBMM 1YSYA 1C7YA 4IBIA 2OPFA 3SARA 2V1UA 1W5TA 1R6BX 2H5XA 1JR3D 4LGMA 1IN4A 4DR1M 3IG5A 3FTFA 3U6QA 3KDSE 4UN2B 1FJGM 3GPXA 3IHPA 3PFIA 1R7RA 2R0IA 1HNZM 3GLFB 4CISA 1OFHA 3FTDA 3MHVC 3SATA 2VF7A 4B7HA 4IBCA 4NSRA 2R45A 2HHHM 1IXSA 4LFAM 2XSZA 1JB0F 2FNAA 2C96A 3GQ5A 1XMOM 2DWMA 3DA1A 1J7KA 3ZCBB 5KQDA 1WGLA 4XGIA 1VDLA 2XZFA 5DYGA 3W0FA 3FRIA 3KOWE 4OVZB 3HY5A 3T1HM 2K9DA 1P3QQ 1YLAA 2X8AA 3CF0A 4MGYE 4DV0M 4NOOB 2QNJA 4GHLA 3KP1E 1NJGA 3DFZA 2BJVA 4K0KM 2VDBB 2D7GA 3T15A 3UZUA 2QP9X 3GLHA 2GNOA 1I94M 2KW0A 3DOAA 1HT2E 1G8PA 3GLIA 1QZMA 4BBAA 3AFHA 3E9SA 3HJQA 3GP1A 2E5LM 3LVVA 4JXJA 4B7GA 3TL4X 4G4OA 3VLFB 4PDGA 4CHTB 1F4IA 2XGNA 3U6CA 4OW0A 4QOSA 2UXBM 2I7NA 2Z4RA 2C99A 4F1IA 1OFIA 3MJ5A 2J5YA 4Y28F 3GQ3A 5KO3A 1YUBA 2KZUA 2Q2EB 3GRVA 4QHTA 1T43A 2WSEF 2LTUA 5C18A 3L26A 1BVSA 2YFQA 4WP2A 1IBKM 1ZMUA 4GRIA 5EP3A 4LF9M 2CP8A 4RNAA 1XC8A 3ZC7B 1D0LA 4L6V6 1C1KA 4LJ8A 1TDZA 4FWDA 4LGYA 4I81A 3I4YA 3K9OA 5FTMA 1Q02A 4II7A 3SC3A 2OOAA 1N75A 1Z5CA 2QSFX 2R44A 4NRWA 2LHGA 2DZLA 2LXEA 1QUSA 1SXJA 5FTKA 5ITXE 1HJPA 5EXSA 3U61B 1AIPC 4ITQA 1Z6TA 3RFWA 4IJFA 1GL7A 3K8ZA 1WR1B 2EUCA 1OKSA 2I7PA 3B7NA 3KW6A 4IBEA 4W5WA 5ITYA 2OQ4A 4G4NA 2QBYA 2JZ1A 4OU7A 2XF3A 1MX0A 2Y0TA 3FUXA 1ZV1A 2M5ZA 3KS8A 3FYDA 2HL7A 2R18A 1PRBA 3L2AA 3KVWA 1PM5A 3I01M 3K9PA 4GC9A 4XK8F 3FUTA 3VDPA 4I5SA 3ZQJA 2Y21A 3AOEA 1VG5A 5H37D 2FS1A 4A3VB 1GABA 5KPRA 1IN5A 1D0MA 1WJ7A 3LQQA 4DR4M 4MM3B 2F4VM 5KPZA 3W67A 3NWLA 4YHHM 2L7IA 4JI8M 3IECA 1HT1E 4RKUF 1G59A 4JI2M 1XXHA 4HLQA 2YNMD 2DAGA 4YY3M 1X37A 4AI6A 1OIPA 1IBLM 2KHHA 1NSFA 3T1YM 2CHVA 5ITQA 3SASA 1OAIA 1DGFA 2Y0QA 5EP4A 1NV8A 3FD9A 2KRUA 3U60A 4FCVA 1T6OA 1VDDA 1Z5AA 3R8FA 1GJSA 2L4FA 3HU1A 2VIIA 1IXRC 2L4EA 3J80S 3THGA 3KXEC 3LMMA 1N34M 4DR3M 1E9RA 5DFLA 4L4UA 1EFUB 4EIWA 4QHSA 4LY6A 2LVPC 1PJIA 1IXSB 3KOXE 1L8QA 2DZNB 3C3DA 2M60A 4M9SA 3PNYA 4NL4H 2D7EA 3A98B 4L15A 1WGNA 4LJAA 2DZOB 4LJ9A 3VFDA 4G4RA 4DUYM 4GC5A 2DI0A 2L6OA 3NBXX 4I4LA 3KOZE 2W82A 2LVNC 4GITA 4DV7M 3SYKA 4AKGA 1QUTA 2DWNA 1R2YA 1NY5A 1R5LA 3SHGB 2QZ4A 1IY0A 3J2PB 3I51A 5DYIA 4D80A 3AJIB 2CHQA 3A46A 2BWEA 3AKZA 3GLHB 2GQFA 3BOSA 3AV0A 4JI3M 1IN6A 4PCZA 4X62M 5A2QS 2CV0A 1SXJE 2XSZD 3GLIB 2J7OA 1GVNA 2OO9A 4B3TM 1V92A 5FTNA 3M0EA 2RGOA 4P17A 4MGKE 2G3QA 3BXWA 1QAOA 2OOBA 2XEPA 3PVSA 4IBBA 1A5TA 2HKJA 4AW4A 3KSJA 3V76A 1QQWA 2JY6B 2ZM6M 2FFJA 1JR3A 2JY8A 1R4GA 4GMQA 2CEAA 1J09A 1DO2A 2N35A 3E4RA 4R7GA 5IREB 2EKKA 4LF4M 4GKKM 2RKOA 4LJ6A 4LRSA 2C5RA 2Z8YM 2ZANA 3UGJA 2CWBA 4NXMM 3UK6A 4REZA 2L7HA 2DAKA 3SYLA 3FYCA 4LCBA 4JV5M 2JZ0A 4FD2A 1W5SA 3ZH9B 1QAMA 5L8RF 2QQ8A 1IFYA 3PNVA 2WSCF 3HHWA 4LZZA 3FUVA 1J5EM 5FTLA 4BB9A 1IN8A 1FNNA 2ZTCA 2Z7JA 1XXHE 4NC6A 5EQTA 3GO8A 4PD2A 3WHKA 2KNAA 1K3WA 4KT0F 2R62A 3FUWA 4MB7A 1XMQM 3FTCA 1AUAA 2XLJA 3RGPA 1SXJB 5DNYA 4DV6M 3EIHA 3HJSA 4DUZM
chains in the Genus database with same CATH topology
3U6SA 1DGHB 3SMSA 1N78A 2DWZB 4M9XA 2CUZA 3KOYE 4QNMA 2RGHA 4DV4M 1QANA 3GPUA 2LNHC 2QBYB 3VDUA 2JA2A 2P5TA 3TPZA 3TWMA 4FCTA 1IY2A 4IJEA 4GHAA 4D81A 5E26A 2AHMA 4LG2A 2V6ZM 4AG5A 1G4AE 3TE6A 4G6ZA 2CV1A 1SXJD 4B3RM 2UU9M 3KS4A 4B08A 4FWGA 3VK8A 1TH3A 1DGHA 1DO0A 2HCBA 1TDHA 3T38A 1XXHB 2EA0A 4FWHA 2UUCM 3IG8A 1DGBA 4M0DA 4R3DA 1I4WA 2C9CA 3ILKA 1TGUA 3GLGA 1LV7A 4NSOB 3U60B 3TQSA 1KSFX 4DV1M 4FCWA 7CATA 2F5NA 4KLNA 2UXCM 2ERCA 3SBJA 2BJWA 3HHZA 3U6EA 2ZBKB 4B3MM 3KFUG 3L29A 4WW0A 4AKHA 2QPAA 4RF1A 4HL4A 1T3TA 2CFOA 5KQ8A 5GKNA 4Z8XA 2C9OA 3W0LB 4LZJA 4IBDA 4CGYB 3GPPA 4JI1M 2LH0A 2F5QA 3AOGA 3CF2A 3AL0C 3NBIA 4JI0M 1Z59A 2BNKA 2CHGA 4PT5A 1L1TA 3TWKA 3HJ8A 1Q3CA 4X64M 1L1ZA 2C98A 1MU5A 5F3WA 4MGHA 1QYRA 3HHYA 3FKEA 2H1RA 3HWSA 3HKPA 5EP2A 4LF5M 3JR5A 1NY6A 1N77A 2X4AA 1QAQA 5LMUM 2G5GX 3QAUA 1TH4A 3WHLA 5KPTA 5LMNM 4P16A 4FVMA 4L78A 3UMMA 1NVMA 4Z6YA 1L2DA 4ZPXA 3SAWA 5EXTA 4DR6M 4LF7M 4XBOA 3I4VA 5C1BA 4WURA 4IIWA 4L8RC 2XFSA 2F5OA 4PDIA 3U5ZB 5BPVA 1N32M 4LF6M 1IQPA 4IBKA 4AKIA 3QWLA 5EXPA 4NRVA 4LJ7A 4GIPA 2QENA 3VKHA 1XWIA 1K3XA 4JI6M 1HNWM 1IN7A 5EXXA 2KXEA 5EJCA 2G8LA 1JQJC 1TH2A 3MK6A 1OJLA 2UUAM 4KO8A 4L16A 1IY1A 1E32A 1YE9A 3GRYA 3J27B 2D7HA 1UM8A 2F5PA 3C58A 3U5ZA 2NQ8C 5ITUA 3K92A 5IWAM 3HHXA 3J7AS 1Q39A 4I8OA 2FE8A 4JI5M 1L2BA 1ZQ9A 3GQ4A 3U6PA 1G41A 1NNUC 4KODA 3OTOM 3SAUA 1H6UA 1GL6A 1E9SA 3SHFA 2LWXA 2XFTA 1NJFA 1HQCA 2J7NA 3JR4A 4AZFA 1IM2A 4D82A 5IT9S 3GLFA 4MGZE 4DV5M 1D2NA 4JI4M 3TWLA 2ZAOA 1NHWC 3VK7A 4IBJA 1HNXM 4GH9A 4G4QA 3PXGA 4AG6A 2KRKA 3LVWA 2R46A 2DXIA 4TUWA 2XZUA 3GLGB 1WXQA 2K47A 4OVZA 4DR2M 5IZ7D 1R2ZA 1PJJA 5BR8M 3A45A 3K2LA 4B7FA 3FTEA 1NNJA 3KP0E 4DV3M 1GLNA 1ORYB 4FW9A 3JAMS 3LQRA 1GKIA 2A5YB 5FSWA 2VQEM 3HU2A 1Z5BA 1E94E 2R4JA 4JYAM 3A42A 3D8LA 3U6DA 1K82A 3R9XB 4GKJM 4LFCM 4S12A 4LFBM 1S3SA 3K1JA 4X65M 3H4MA 1KYIA 3L27A 2CV2A 2KA6B 2V1CA 3L28A 3RGSA 3M6AA 4MH0E 4DV2M 2YQZA 3VKGA 2EO2A 3D8BA 2Z4SA 5FLXS 1QVRA 5ITTA 2O5RA 3U6OA 1N33M 4JI7M 2X49A 2CE7A 4LF8M 1DGGA 3GRRA 3SFZA 4X66M 4KHPM 1XNRM 4QOZC 2R4EA 2F5SA 1Q3BA 2KEBA 2YR0A 1HR0M 1NHGC 2FOIC 4LRTA 5FTJA 5JI3E 2KZSA 4IBGA 4DR7M 3KSXA 2QCUA 4LJ4A 2DVWB 3J7BA 4AQYM 3Q8XA 4DR5M 2UUBM 1G3IA 3U61A 3GPYA 4RF0A 3L25A 3B9PA 3CTWB 3SMPA 1SXJC 5JI2E 1IXZA 3FUUA 2L09A 3DZDA 5EP1A 1HQYE 4QNRA 3EIEA 3HU3A 2ZAMA 2DHRA 2UXDM 2R65A 1L2CA 1EE8A 3CF6E 3RE8A 3J81S 3U6LA 3U6MA 4M9ZA 4MGIE 2DWLA 4IBFA 3SAVA 2VQFM 2XH9A 5ITRA 4BLCA 3GRUA 1XHBA 2Z3XA 1KFVA 4LJ5A 3AOEC 2Y20A 3HGIA 1XNQM 4JN6A 4NXNM 4OX9M 1N36M 5E6JA 4B3SM 4M0WA 8CATA 1ZAEA 3M7GA 3UJNA 5ITXA 1IBMM 1YSYA 4IBIA 2OPFA 3SARA 2V1UA 1W5TA 1R6BX 1JR3D 4LGMA 1IN4A 4DR1M 3IG5A 3FTFA 3U6QA 3KDSE 1FJGM 3GPXA 3PFIA 1R7RA 1HNZM 4CISA 3GLFB 1OFHA 3FTDA 3MHVC 3SATA 4B7HA 4IBCA 4NSRA 2R45A 2HHHM 4LFAM 2XSZA 2FNAA 2C96A 3GQ5A 1XMOM 2DWMA 3DA1A 1J7KA 3ZCBB 5KQDA 4XGIA 2XZFA 5DYGA 3W0FA 3KOWE 4OVZB 3T1HM 2X8AA 3CF0A 4MGYE 4DV0M 4NOOB 4GHLA 3KP1E 1NJGA 3DFZA 2BJVA 4K0KM 2D7GA 3T15A 3UZUA 2QP9X 3GLHA 1I94M 2KW0A 3DOAA 1HT2E 1G8PA 3GLIA 1QZMA 4BBAA 3AFHA 3E9SA 3HJQA 3GP1A 2E5LM 3LVVA 4JXJA 4B7GA 3TL4X 4G4OA 3VLFB 4PDGA 4CHTB 2XGNA 3U6CA 4OW0A 4QOSA 2UXBM 2I7NA 2Z4RA 2C99A 1OFIA 3MJ5A 3GQ3A 5KO3A 1YUBA 2KZUA 2Q2EB 3GRVA 4QHTA 5C18A 3L26A 2YFQA 1IBKM 4GRIA 5EP3A 4LF9M 4RNAA 1XC8A 3ZC7B 1C1KA 4LJ8A 1TDZA 4FWDA 4LGYA 4I81A 3I4YA 5FTMA 4II7A 3SC3A 1N75A 1Z5CA 4NRWA 2LXEA 1SXJA 5FTKA 5ITXE 5EXSA 3U61B 4ITQA 1Z6TA 3RFWA 4IJFA 1GL7A 3K8ZA 2EUCA 2I7PA 3KW6A 4IBEA 4W5WA 5ITYA 2OQ4A 4G4NA 2QBYA 4OU7A 2XF3A 1MX0A 2Y0TA 3FUXA 2M5ZA 3KS8A 3FYDA 2HL7A 2R18A 3L2AA 3KVWA 1PM5A 4GC9A 3FUTA 3VDPA 4I5SA 2Y21A 3AOEA 5H37D 4A3VB 5KPRA 1IN5A 3LQQA 4DR4M 4MM3B 2F4VM 5KPZA 3NWLA 4YHHM 2L7IA 4JI8M 1HT1E 4JI2M 1G59A 1XXHA 4HLQA 2YNMD 4YY3M 1X37A 4AI6A 1IBLM 1NSFA 3T1YM 2CHVA 5ITQA 3SASA 2Y0QA 1DGFA 5EP4A 3FD9A 2KRUA 3U60A 4FCVA 1VDDA 1Z5AA 3R8FA 3HU1A 2VIIA 1IXRC 3J80S 3THGA 3KXEC 3LMMA 1N34M 4DR3M 1E9RA 4L4UA 4EIWA 4QHSA 4LY6A 1PJIA 1IXSB 3KOXE 1L8QA 2DZNB 4M9SA 2M60A 3PNYA 4NL4H 2D7EA 3A98B 4L15A 3VFDA 4LJAA 2DZOB 4LJ9A 4G4RA 4DUYM 4GC5A 2L6OA 4I4LA 3KOZE 2W82A 4DV7M 4GITA 3SYKA 4AKGA 2DWNA 1R2YA 1NY5A 3SHGB 2QZ4A 1IY0A 3J2PB 3I51A 5DYIA 4D80A 3AJIB 2CHQA 3A46A 3AKZA 3GLHB 3BOSA 4PCZA 3AV0A 4JI3M 1IN6A 4X62M 5A2QS 2CV0A 1SXJE 2XSZD 3GLIB 2J7OA 1GVNA 4B3TM 5FTNA 3M0EA 2RGOA 4MGKE 1QAOA 2XEPA 3PVSA 4IBBA 4AW4A 2HKJA 3KSJA 2ZM6M 1QQWA 2FFJA 1JR3A 4GMQA 2CEAA 1J09A 1DO2A 4R7GA 3E4RA 5IREB 4LF4M 4GKKM 2RKOA 4LJ6A 4LRSA 2C5RA 2ZANA 3UGJA 4NXMM 3UK6A 4REZA 2L7HA 3SYLA 3FYCA 4LCBA 4JV5M 4FD2A 1W5SA 3ZH9B 1QAMA 3PNVA 3HHWA 4LZZA 3FUVA 1J5EM 5FTLA 4BB9A 1IN8A 1FNNA 2Z7JA 5EQTA 3GO8A 4PD2A 3WHKA 1K3WA 2R62A 3FUWA 4MB7A 1XMQM 3FTCA 2XLJA 3RGPA 1SXJB 5DNYA 4DV6M 3EIHA 3HJSA 4DUZM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6S A;  1EE8 A;  3U6M A;  5ITY A;  3J81 S;  4G4N A;  2OQ4 A;  3U6L A;  2UUA M;  1MX0 A;  3SAV A;  2VQF M;  4DV4 M;  3GPU A;  5ITR A;  2F5P A;  3C58 A;  1PM5 A;  1KFV A;  5ITU A;  3TWM A;  5IWA M;  3J7A S;  1Q39 A;  1XNQ M;  4JI5 M;  1L2B A;  3GQ4 A;  4NXN M;  3U6P A;  3OTO M;  4OX9 M;  3SAU A;  1N36 M;  4DR4 M;  4B3S M;  2F4V M;  4YHH M;  4JI8 M;  4JI2 M;  4B3R M;  5ITX A;  4YY3 M;  1IBM M;  2UU9 M;  3VK8 A;  2OPF A;  3JR4 A;  3SAR A;  1IBL M;  3T1Y M;  5IT9 S;  5ITQ A;  1TDH A;  4DR1 M;  3SAS A;  4DV5 M;  3U6Q A;  2EA0 A;  3TWL A;  4JI4 M;  1Z5A A;  3VK7 A;  2UUC M;  3GPX A;  1FJG M;  1HNZ M;  4CIS A;  3SAT A;  3J80 S;  1HNX M;  4G4Q A;  2HHH M;  4DV1 M;  4LFA M;  3GQ5 A;  4DR3 M;  1XMO M;  1N34 M;  2F5N A;  2UXC M;  2XZU A;  3SBJ A;  3U6E A;  4B3M M;  4DR2 M;  2ZBK B;  1PJI A;  1R2Z A;  1PJJ A;  2XZF A;  5BR8 M;  3A45 A;  3W0F A;  1NNJ A;  4G4R A;  3T1H M;  4DV3 M;  3JAM S;  4DUY M;  4DV0 M;  2VQE M;  4DV7 M;  1Z5B A;  3GPP A;  4JYA M;  4JI1 M;  2F5Q A;  4K0K M;  1R2Y A;  4JI0 M;  3A42 A;  3U6D A;  4GKJ M;  1K82 A;  1Z59 A;  4LFC M;  4LFB M;  4X65 M;  1L1T A;  3TWK A;  1Q3C A;  3DOA A;  4X64 M;  1L1Z A;  1I94 M;  1MU5 A;  3A46 A;  3GP1 A;  2E5L M;  4DV2 M;  5A2Q S;  4PCZ A;  4JI3 M;  4X62 M;  4G4O A;  4LF5 M;  3JR5 A;  4B3T M;  4PDG A;  5FLX S;  3U6C A;  2UXB M;  5ITT A;  2HKJ A;  5LMU M;  3U6O A;  2ZM6 M;  1N33 M;  4JI7 M;  4LF4 M;  4LF8 M;  4KHP M;  4X66 M;  4GKK M;  3GQ3 A;  5LMN M;  1XNR M;  2F5S A;  1Q3B A;  2Q2E B;  1HR0 M;  4NXM M;  1L2D A;  3SAW A;  1IBK M;  4DR6 M;  4DR7 M;  4LF7 M;  4LF9 M;  4JV5 M;  1XC8 A;  4AQY M;  1TDZ A;  4DR5 M;  2F5O A;  2UUB M;  4PDI A;  1J5E M;  3GPY A;  1N32 M;  4LF6 M;  1Z5C A;  4NRW A;  5ITX E;  4NRV A;  3GO8 A;  4PD2 A;  4ITQ A;  1K3W A;  1XMQ M;  4MB7 A;  1K3X A;  4JI6 M;  1HNW M;  2UXD M;  4DV6 M;  1L2C A;  4DUZ M; 
#chains in the Genus database with same CATH topology
 3U6S A;  1DGH B;  3C9P A;  3SMS A;  1N78 A;  2DWZ B;  4M9X A;  2CUZ A;  3KOY E;  4QNM A;  2RGH A;  1DV0 A;  4DV4 M;  1QAN A;  3GPU A;  2LNH C;  3B74 A;  2LVQ D;  2QBY B;  3VDU A;  2JA2 A;  1Y8G A;  2MRO B;  2P5T A;  3TPZ A;  3TWM A;  3FE3 A;  1IY2 A;  1PJS A;  4FCT A;  4IJE A;  4Q7J A;  4GHA A;  4D81 A;  5E26 A;  2CRU A;  2AHM A;  4LG2 A;  2V6Z M;  1ZMW A;  4AG5 A;  1G4A E;  1MJG M;  4F2L A;  3TE6 A;  4G6Z A;  1OIZ A;  2CV1 A;  1SXJ D;  4B3R M;  1EIJ A;  2DAM A;  2UU9 M;  3KS4 A;  4B08 A;  4FWG A;  3VK8 A;  1TH3 A;  1DGH A;  1DO0 A;  2HCB A;  2JP7 A;  3Q8G A;  2MJ5 B;  1TDH A;  3T38 A;  1XXH B;  1QZE A;  2EA0 A;  2WZJ A;  1LTM A;  4FWH A;  2UUC M;  3IG8 A;  1DGB A;  4M0D A;  4R3D A;  1I4W A;  2C9C A;  3ILK A;  1TGU A;  3GLG A;  1LV7 A;  4NSO B;  3U60 B;  3TQS A;  1KSF X;  4DV1 M;  4FCW A;  7CAT A;  2F5N A;  4KLN A;  2UXC M;  2ERC A;  3SBJ A;  2BJW A;  3HHZ A;  3U6E A;  2ZBK B;  4B3M M;  3KFU G;  1G71 A;  1PGY A;  3L29 A;  4WW0 A;  2HAK A;  4AKH A;  2QPA A;  4RF1 A;  2DNA A;  1PJQ A;  4HL4 A;  1T3T A;  2CFO A;  5KQ8 A;  5GKN A;  4Z8X A;  2C9O A;  3W0L B;  4LZJ A;  4IBD A;  2DKL A;  4DBG B;  4CGY B;  3GPP A;  2K6B A;  4JI1 M;  2LH0 A;  2F5Q A;  3AOG A;  3CF2 A;  3GLH E;  3NBI A;  4JI0 M;  3AL0 C;  1Z59 A;  3LCU A;  2BNK A;  2CHG A;  3E46 A;  3GLI E;  4PT5 A;  1L1T A;  3TWK A;  1Q3C A;  3HJ8 A;  2LVA A;  4X64 M;  1L1Z A;  2C98 A;  1MU5 A;  5F3W A;  2DAI A;  2O01 F;  1QYR A;  2JUJ A;  3B89 A;  4MGH A;  3HHY A;  3FKE A;  1OTR A;  1GJT A;  2H1R A;  3HWS A;  3HKP A;  5EP2 A;  4LF5 M;  3JR5 A;  1NY6 A;  1SG9 A;  2KDL A;  1N77 A;  2X4A A;  1QAQ A;  2EJS A;  3I04 M;  5LMU M;  2DAE A;  2G5G X;  3QAU A;  1TH4 A;  3WHL A;  5KPT A;  5LMN M;  4HEO A;  1XB2 B;  4P16 A;  2ZTD A;  3B7Z A;  4FVM A;  4L78 A;  3UMM A;  1NVM A;  4Z6Y A;  1L2D A;  4ZPX A;  3SAW A;  5EXT A;  4DR6 M;  4LF7 M;  4XBO A;  3I4V A;  5C1B A;  4WUR A;  4IIW A;  2MH8 A;  2DHY A;  4L8R C;  2B3T A;  2XFS A;  2F5O A;  4PDI A;  3U5Z B;  3QYB A;  5BPV A;  1N32 M;  4GEW A;  4LF6 M;  1IQP A;  3LW5 F;  4IBK A;  4AKI A;  3QWL A;  2LBC A;  5EXP A;  4NRV A;  1ZMV A;  4LJ7 A;  4GIP A;  2QEN A;  3E21 A;  3B7Q A;  3VKH A;  1XWI A;  1K3X A;  1TF0 B;  4JI6 M;  1IN7 A;  5EXX A;  1HNW M;  2KXE A;  5EJC A;  2G8L A;  1JQJ C;  1TH2 A;  2L2D A;  2VF8 A;  1OJL A;  3MK6 A;  2UUA M;  4KO8 A;  4L16 A;  3GLG E;  1IY1 A;  1E32 A;  1YE9 A;  2JXN A;  3GRY A;  3J27 B;  3HZJ A;  2D7H A;  1UM8 A;  2HWJ A;  3C58 A;  3U5Z A;  2F5P A;  2NQ8 C;  4G3O A;  5ITU A;  1V33 A;  3K92 A;  5IWA M;  3HHX A;  3F92 A;  3J7A S;  1Q39 A;  2APL A;  4I8O A;  2RRU A;  2FE8 A;  4JI5 M;  1L2B A;  1ZQ9 A;  3GQ4 A;  3U6P A;  1G41 A;  1NNU C;  1V34 A;  4KOD A;  3OTO M;  3SAU A;  1H6U A;  1RU3 A;  1GL6 A;  1E9S A;  3W68 A;  3SHF A;  2LWX A;  2XFT A;  1NJF A;  1HQC A;  1OAO C;  2J7N A;  3JR4 A;  4AZF A;  1IM2 A;  4D82 A;  5IT9 S;  2KNV A;  3GLF A;  4MGZ E;  4DV5 M;  1D2N A;  4JI4 M;  3TWL A;  2ZAO A;  1NHW C;  1WIV A;  3VK7 A;  3C3E A;  3HX3 A;  2QHO B;  4IBJ A;  1HNX M;  2LHC A;  4GH9 A;  4G4Q A;  1TR8 A;  3PXG A;  4AG6 A;  2KRK A;  3LVW A;  2R46 A;  2DXI A;  4TUW A;  2XZU A;  3GLG B;  1UFZ A;  1WXQ A;  2K47 A;  4OVZ A;  4DR2 M;  2MR9 A;  5IZ7 D;  2FH0 A;  1R2Z A;  1PJJ A;  5BR8 M;  3A45 A;  3K2L A;  4B7F A;  3FTE A;  1NNJ A;  3KP0 E;  4DV3 M;  1GLN A;  1ORY B;  4FW9 A;  3JAM S;  1NV9 A;  3LQR A;  1GKI A;  2A5Y B;  5FSW A;  2VQE M;  3HU2 A;  1Z5B A;  4ANR A;  1OQY A;  1E94 E;  2R4J A;  4JYA M;  1VQ1 A;  1MN3 A;  3A42 A;  3D8L A;  3U6D A;  1K82 A;  3R9X B;  4GKJ M;  1WHC A;  4S12 A;  4LFC M;  1S3S A;  4LFB M;  3K1J A;  4X65 M;  3CGW A;  3H4M A;  1KYI A;  3L27 A;  2CV2 A;  2EKF A;  2KA6 B;  2V1C A;  2WSF F;  3L28 A;  3RGS A;  3M6A A;  4MH0 E;  4DV2 M;  2YQZ A;  3VKG A;  3MMP A;  2EO2 A;  3D8B A;  2Z4S A;  5FLX S;  1QDR A;  1QVR A;  1TTE A;  5ITT A;  2O5R A;  1JR3 E;  2JWS A;  3U6O A;  1N33 M;  4JI7 M;  1NO1 A;  2X49 A;  2CE7 A;  4LF8 M;  1DGG A;  3GRR A;  3SFZ A;  4X66 M;  4CJ6 A;  4KHP M;  2R6F A;  3H4J A;  1XNR M;  2R4E A;  2F5S A;  4QOZ C;  1PJT A;  1Q3B A;  2KEB A;  2YR0 A;  1HR0 M;  1NHG C;  2FOI C;  4LRT A;  5FTJ A;  5JI3 E;  3QYE A;  2KZS A;  2MGW A;  4IBG A;  4DR7 M;  3KSX A;  2QCU A;  2K0B X;  4LJ4 A;  2DVW B;  3J7B A;  4AQY M;  3Q8X A;  4DR5 M;  2UUB M;  1G3I A;  3U61 A;  3GPY A;  4RF0 A;  3L25 A;  3B9P A;  3BBZ A;  3CTW B;  3SMP A;  1SXJ C;  5JI2 E;  1IXZ A;  3FUU A;  2L09 A;  3DZD A;  5EP1 A;  1HQY E;  4QNR A;  2DEN A;  2BWB A;  3EIE A;  4R71 A;  3HU3 A;  4CIZ A;  3GLF E;  2ZAM A;  2DHR A;  2UXD M;  1VEJ A;  2R65 A;  1L2C A;  1D0K A;  1EE8 A;  3CF6 E;  3RE8 A;  3J81 S;  3U6L A;  2O25 A;  4M9Z A;  3U6M A;  2LVO C;  2JNH A;  4MGI E;  2DWL A;  4IBF A;  1GO5 A;  1CUK A;  2VQF M;  3SAV A;  2JY7 A;  2XH9 A;  5ITR A;  4BLC A;  2JY5 A;  3GRU A;  1XHB A;  2Z3X A;  1KFV A;  4LJ5 A;  3AOE C;  1VEK A;  2Y20 A;  3HGI A;  2KNZ A;  1QDT A;  1XNQ M;  3T6P A;  4JN6 A;  1VEG A;  3FRH A;  4NXN M;  4OX9 M;  1N36 M;  5E6J A;  4B3S M;  4M0W A;  8CAT A;  1ZAE A;  3M7G A;  3UJN A;  3LCV B;  5ITX A;  1IBM M;  1YSY A;  1C7Y A;  4IBI A;  2OPF A;  3SAR A;  2V1U A;  1W5T A;  1R6B X;  2H5X A;  1JR3 D;  4LGM A;  1IN4 A;  4DR1 M;  3IG5 A;  3FTF A;  3U6Q A;  3KDS E;  4UN2 B;  1FJG M;  3GPX A;  3IHP A;  3PFI A;  1R7R A;  2R0I A;  1HNZ M;  3GLF B;  4CIS A;  1OFH A;  3FTD A;  3MHV C;  3SAT A;  2VF7 A;  4B7H A;  4IBC A;  4NSR A;  2R45 A;  2HHH M;  1IXS A;  4LFA M;  2XSZ A;  1JB0 F;  2FNA A;  2C96 A;  3GQ5 A;  1XMO M;  2DWM A;  3DA1 A;  1J7K A;  3ZCB B;  5KQD A;  1WGL A;  4XGI A;  1VDL A;  2XZF A;  5DYG A;  3W0F A;  3FRI A;  3KOW E;  4OVZ B;  3HY5 A;  3T1H M;  2K9D A;  1P3Q Q;  1YLA A;  2X8A A;  3CF0 A;  4MGY E;  4DV0 M;  4NOO B;  2QNJ A;  4GHL A;  3KP1 E;  1NJG A;  3DFZ A;  2BJV A;  4K0K M;  2VDB B;  2D7G A;  3T15 A;  3UZU A;  2QP9 X;  3GLH A;  2GNO A;  1I94 M;  2KW0 A;  3DOA A;  1HT2 E;  1G8P A;  3GLI A;  1QZM A;  4BBA A;  3AFH A;  3E9S A;  3HJQ A;  3GP1 A;  2E5L M;  3LVV A;  4JXJ A;  4B7G A;  3TL4 X;  4G4O A;  3VLF B;  4PDG A;  4CHT B;  1F4I A;  2XGN A;  3U6C A;  4OW0 A;  4QOS A;  2UXB M;  2I7N A;  2Z4R A;  2C99 A;  4F1I A;  1OFI A;  3MJ5 A;  2J5Y A;  4Y28 F;  3GQ3 A;  5KO3 A;  1YUB A;  2KZU A;  2Q2E B;  3GRV A;  4QHT A;  1T43 A;  2WSE F;  2LTU A;  5C18 A;  3L26 A;  1BVS A;  2YFQ A;  4WP2 A;  1IBK M;  1ZMU A;  4GRI A;  5EP3 A;  4LF9 M;  2CP8 A;  4RNA A;  1XC8 A;  3ZC7 B;  1D0L A;  4L6V 6;  1C1K A;  4LJ8 A;  1TDZ A;  4FWD A;  4LGY A;  4I81 A;  3I4Y A;  3K9O A;  5FTM A;  1Q02 A;  4II7 A;  3SC3 A;  2OOA A;  1N75 A;  1Z5C A;  2QSF X;  2R44 A;  4NRW A;  2LHG A;  2DZL A;  2LXE A;  1QUS A;  1SXJ A;  5FTK A;  5ITX E;  1HJP A;  5EXS A;  3U61 B;  1AIP C;  4ITQ A;  1Z6T A;  3RFW A;  4IJF A;  1GL7 A;  3K8Z A;  1WR1 B;  2EUC A;  1OKS A;  2I7P A;  3B7N A;  3KW6 A;  4IBE A;  4W5W A;  5ITY A;  2OQ4 A;  4G4N A;  2QBY A;  2JZ1 A;  4OU7 A;  2XF3 A;  1MX0 A;  2Y0T A;  3FUX A;  1ZV1 A;  2M5Z A;  3KS8 A;  3FYD A;  2HL7 A;  2R18 A;  1PRB A;  3L2A A;  3KVW A;  1PM5 A;  3I01 M;  3K9P A;  4GC9 A;  4XK8 F;  3FUT A;  3VDP A;  4I5S A;  3ZQJ A;  2Y21 A;  3AOE A;  1VG5 A;  5H37 D;  2FS1 A;  4A3V B;  1GAB A;  5KPR A;  1IN5 A;  1D0M A;  1WJ7 A;  3LQQ A;  4DR4 M;  4MM3 B;  2F4V M;  5KPZ A;  3W67 A;  3NWL A;  4YHH M;  2L7I A;  4JI8 M;  3IEC A;  1HT1 E;  4RKU F;  1G59 A;  4JI2 M;  1XXH A;  4HLQ A;  2YNM D;  2DAG A;  4YY3 M;  1X37 A;  4AI6 A;  1OIP A;  1IBL M;  2KHH A;  1NSF A;  3T1Y M;  2CHV A;  5ITQ A;  3SAS A;  1OAI A;  1DGF A;  2Y0Q A;  5EP4 A;  1NV8 A;  3FD9 A;  2KRU A;  3U60 A;  4FCV A;  1T6O A;  1VDD A;  1Z5A A;  3R8F A;  1GJS A;  2L4F A;  3HU1 A;  2VII A;  1IXR C;  2L4E A;  3J80 S;  3THG A;  3KXE C;  3LMM A;  1N34 M;  4DR3 M;  1E9R A;  5DFL A;  4L4U A;  1EFU B;  4EIW A;  4QHS A;  4LY6 A;  2LVP C;  1PJI A;  1IXS B;  3KOX E;  1L8Q A;  2DZN B;  3C3D A;  2M60 A;  4M9S A;  3PNY A;  4NL4 H;  2D7E A;  3A98 B;  4L15 A;  1WGN A;  4LJA A;  2DZO B;  4LJ9 A;  3VFD A;  4G4R A;  4DUY M;  4GC5 A;  2DI0 A;  2L6O A;  3NBX X;  4I4L A;  3KOZ E;  2W82 A;  2LVN C;  4GIT A;  4DV7 M;  3SYK A;  4AKG A;  1QUT A;  2DWN A;  1R2Y A;  1NY5 A;  1R5L A;  3SHG B;  2QZ4 A;  1IY0 A;  3J2P B;  3I51 A;  5DYI A;  4D80 A;  3AJI B;  2CHQ A;  3A46 A;  2BWE A;  3AKZ A;  3GLH B;  2GQF A;  3BOS A;  3AV0 A;  4JI3 M;  1IN6 A;  4PCZ A;  4X62 M;  5A2Q S;  2CV0 A;  1SXJ E;  2XSZ D;  3GLI B;  2J7O A;  1GVN A;  2OO9 A;  4B3T M;  1V92 A;  5FTN A;  3M0E A;  2RGO A;  4P17 A;  4MGK E;  2G3Q A;  3BXW A;  1QAO A;  2OOB A;  2XEP A;  3PVS A;  4IBB A;  1A5T A;  2HKJ A;  4AW4 A;  3KSJ A;  3V76 A;  1QQW A;  2JY6 B;  2ZM6 M;  2FFJ A;  1JR3 A;  2JY8 A;  1R4G A;  4GMQ A;  2CEA A;  1J09 A;  1DO2 A;  2N35 A;  3E4R A;  4R7G A;  5IRE B;  2EKK A;  4LF4 M;  4GKK M;  2RKO A;  4LJ6 A;  4LRS A;  2C5R A;  2Z8Y M;  2ZAN A;  3UGJ A;  2CWB A;  4NXM M;  3UK6 A;  4REZ A;  2L7H A;  2DAK A;  3SYL A;  3FYC A;  4LCB A;  4JV5 M;  2JZ0 A;  4FD2 A;  1W5S A;  3ZH9 B;  1QAM A;  5L8R F;  2QQ8 A;  1IFY A;  3PNV A;  2WSC F;  3HHW A;  4LZZ A;  3FUV A;  1J5E M;  5FTL A;  4BB9 A;  1IN8 A;  1FNN A;  2ZTC A;  2Z7J A;  1XXH E;  4NC6 A;  5EQT A;  3GO8 A;  4PD2 A;  3WHK A;  2KNA A;  1K3W A;  4KT0 F;  2R62 A;  3FUW A;  4MB7 A;  1XMQ M;  3FTC A;  1AUA A;  2XLJ A;  3RGP A;  1SXJ B;  5DNY A;  4DV6 M;  3EIH A;  3HJS A;  4DUZ M; 
#chains in the Genus database with same CATH homology
 3U6S A;  1DGH B;  3SMS A;  1N78 A;  2DWZ B;  4M9X A;  2CUZ A;  3KOY E;  4QNM A;  2RGH A;  4DV4 M;  1QAN A;  3GPU A;  2LNH C;  2QBY B;  3VDU A;  2JA2 A;  2P5T A;  3TPZ A;  3TWM A;  4FCT A;  1IY2 A;  4IJE A;  4GHA A;  4D81 A;  5E26 A;  2AHM A;  4LG2 A;  2V6Z M;  4AG5 A;  1G4A E;  3TE6 A;  4G6Z A;  2CV1 A;  1SXJ D;  4B3R M;  2UU9 M;  3KS4 A;  4B08 A;  4FWG A;  3VK8 A;  1TH3 A;  1DGH A;  1DO0 A;  2HCB A;  1TDH A;  3T38 A;  1XXH B;  2EA0 A;  4FWH A;  2UUC M;  3IG8 A;  1DGB A;  4M0D A;  4R3D A;  1I4W A;  2C9C A;  3ILK A;  1TGU A;  3GLG A;  1LV7 A;  4NSO B;  3U60 B;  3TQS A;  1KSF X;  4DV1 M;  4FCW A;  7CAT A;  2F5N A;  4KLN A;  2UXC M;  2ERC A;  3SBJ A;  2BJW A;  3HHZ A;  3U6E A;  2ZBK B;  4B3M M;  3KFU G;  3L29 A;  4WW0 A;  4AKH A;  2QPA A;  4RF1 A;  4HL4 A;  1T3T A;  2CFO A;  5KQ8 A;  5GKN A;  4Z8X A;  2C9O A;  3W0L B;  4LZJ A;  4IBD A;  4CGY B;  3GPP A;  4JI1 M;  2LH0 A;  2F5Q A;  3AOG A;  3CF2 A;  3AL0 C;  3NBI A;  4JI0 M;  1Z59 A;  2BNK A;  2CHG A;  4PT5 A;  1L1T A;  3TWK A;  3HJ8 A;  1Q3C A;  4X64 M;  1L1Z A;  2C98 A;  1MU5 A;  5F3W A;  4MGH A;  1QYR A;  3HHY A;  3FKE A;  2H1R A;  3HWS A;  3HKP A;  5EP2 A;  4LF5 M;  3JR5 A;  1NY6 A;  1N77 A;  2X4A A;  1QAQ A;  5LMU M;  2G5G X;  3QAU A;  1TH4 A;  3WHL A;  5KPT A;  5LMN M;  4P16 A;  4FVM A;  4L78 A;  3UMM A;  1NVM A;  4Z6Y A;  1L2D A;  4ZPX A;  3SAW A;  5EXT A;  4DR6 M;  4LF7 M;  4XBO A;  3I4V A;  5C1B A;  4WUR A;  4IIW A;  4L8R C;  2XFS A;  2F5O A;  4PDI A;  3U5Z B;  5BPV A;  1N32 M;  4LF6 M;  1IQP A;  4IBK A;  4AKI A;  3QWL A;  5EXP A;  4NRV A;  4LJ7 A;  4GIP A;  2QEN A;  3VKH A;  1XWI A;  1K3X A;  4JI6 M;  1HNW M;  1IN7 A;  5EXX A;  2KXE A;  5EJC A;  2G8L A;  1JQJ C;  1TH2 A;  3MK6 A;  1OJL A;  2UUA M;  4KO8 A;  4L16 A;  1IY1 A;  1E32 A;  1YE9 A;  3GRY A;  3J27 B;  2D7H A;  1UM8 A;  2F5P A;  3C58 A;  3U5Z A;  2NQ8 C;  5ITU A;  3K92 A;  5IWA M;  3HHX A;  3J7A S;  1Q39 A;  4I8O A;  2FE8 A;  4JI5 M;  1L2B A;  1ZQ9 A;  3GQ4 A;  3U6P A;  1G41 A;  1NNU C;  4KOD A;  3OTO M;  3SAU A;  1H6U A;  1GL6 A;  1E9S A;  3SHF A;  2LWX A;  2XFT A;  1NJF A;  1HQC A;  2J7N A;  3JR4 A;  4AZF A;  1IM2 A;  4D82 A;  5IT9 S;  3GLF A;  4MGZ E;  4DV5 M;  1D2N A;  4JI4 M;  3TWL A;  2ZAO A;  1NHW C;  3VK7 A;  4IBJ A;  1HNX M;  4GH9 A;  4G4Q A;  3PXG A;  4AG6 A;  2KRK A;  3LVW A;  2R46 A;  2DXI A;  4TUW A;  2XZU A;  3GLG B;  1WXQ A;  2K47 A;  4OVZ A;  4DR2 M;  5IZ7 D;  1R2Z A;  1PJJ A;  5BR8 M;  3A45 A;  3K2L A;  4B7F A;  3FTE A;  1NNJ A;  3KP0 E;  4DV3 M;  1GLN A;  1ORY B;  4FW9 A;  3JAM S;  3LQR A;  1GKI A;  2A5Y B;  5FSW A;  2VQE M;  3HU2 A;  1Z5B A;  1E94 E;  2R4J A;  4JYA M;  3A42 A;  3D8L A;  3U6D A;  1K82 A;  3R9X B;  4GKJ M;  4LFC M;  4S12 A;  4LFB M;  1S3S A;  3K1J A;  4X65 M;  3H4M A;  1KYI A;  3L27 A;  2CV2 A;  2KA6 B;  2V1C A;  3L28 A;  3RGS A;  3M6A A;  4MH0 E;  4DV2 M;  2YQZ A;  3VKG A;  2EO2 A;  3D8B A;  2Z4S A;  5FLX S;  1QVR A;  5ITT A;  2O5R A;  3U6O A;  1N33 M;  4JI7 M;  2X49 A;  2CE7 A;  4LF8 M;  1DGG A;  3GRR A;  3SFZ A;  4X66 M;  4KHP M;  1XNR M;  4QOZ C;  2R4E A;  2F5S A;  1Q3B A;  2KEB A;  2YR0 A;  1HR0 M;  1NHG C;  2FOI C;  4LRT A;  5FTJ A;  5JI3 E;  2KZS A;  4IBG A;  4DR7 M;  3KSX A;  2QCU A;  4LJ4 A;  2DVW B;  3J7B A;  4AQY M;  3Q8X A;  4DR5 M;  2UUB M;  1G3I A;  3U61 A;  3GPY A;  4RF0 A;  3L25 A;  3B9P A;  3CTW B;  3SMP A;  1SXJ C;  5JI2 E;  1IXZ A;  3FUU A;  2L09 A;  3DZD A;  5EP1 A;  1HQY E;  4QNR A;  3EIE A;  3HU3 A;  2ZAM A;  2DHR A;  2UXD M;  2R65 A;  1L2C A;  1EE8 A;  3CF6 E;  3RE8 A;  3J81 S;  3U6L A;  3U6M A;  4M9Z A;  4MGI E;  2DWL A;  4IBF A;  3SAV A;  2VQF M;  2XH9 A;  5ITR A;  4BLC A;  3GRU A;  1XHB A;  2Z3X A;  1KFV A;  4LJ5 A;  3AOE C;  2Y20 A;  3HGI A;  1XNQ M;  4JN6 A;  4NXN M;  4OX9 M;  1N36 M;  5E6J A;  4B3S M;  4M0W A;  8CAT A;  1ZAE A;  3M7G A;  3UJN A;  5ITX A;  1IBM M;  1YSY A;  4IBI A;  2OPF A;  3SAR A;  2V1U A;  1W5T A;  1R6B X;  1JR3 D;  4LGM A;  1IN4 A;  4DR1 M;  3IG5 A;  3FTF A;  3U6Q A;  3KDS E;  1FJG M;  3GPX A;  3PFI A;  1R7R A;  1HNZ M;  4CIS A;  3GLF B;  1OFH A;  3FTD A;  3MHV C;  3SAT A;  4B7H A;  4IBC A;  4NSR A;  2R45 A;  2HHH M;  4LFA M;  2XSZ A;  2FNA A;  2C96 A;  3GQ5 A;  1XMO M;  2DWM A;  3DA1 A;  1J7K A;  3ZCB B;  5KQD A;  4XGI A;  2XZF A;  5DYG A;  3W0F A;  3KOW E;  4OVZ B;  3T1H M;  2X8A A;  3CF0 A;  4MGY E;  4DV0 M;  4NOO B;  4GHL A;  3KP1 E;  1NJG A;  3DFZ A;  2BJV A;  4K0K M;  2D7G A;  3T15 A;  3UZU A;  2QP9 X;  3GLH A;  1I94 M;  2KW0 A;  3DOA A;  1HT2 E;  1G8P A;  3GLI A;  1QZM A;  4BBA A;  3AFH A;  3E9S A;  3HJQ A;  3GP1 A;  2E5L M;  3LVV A;  4JXJ A;  4B7G A;  3TL4 X;  4G4O A;  3VLF B;  4PDG A;  4CHT B;  2XGN A;  3U6C A;  4OW0 A;  4QOS A;  2UXB M;  2I7N A;  2Z4R A;  2C99 A;  1OFI A;  3MJ5 A;  3GQ3 A;  5KO3 A;  1YUB A;  2KZU A;  2Q2E B;  3GRV A;  4QHT A;  5C18 A;  3L26 A;  2YFQ A;  1IBK M;  4GRI A;  5EP3 A;  4LF9 M;  4RNA A;  1XC8 A;  3ZC7 B;  1C1K A;  4LJ8 A;  1TDZ A;  4FWD A;  4LGY A;  4I81 A;  3I4Y A;  5FTM A;  4II7 A;  3SC3 A;  1N75 A;  1Z5C A;  4NRW A;  2LXE A;  1SXJ A;  5FTK A;  5ITX E;  5EXS A;  3U61 B;  4ITQ A;  1Z6T A;  3RFW A;  4IJF A;  1GL7 A;  3K8Z A;  2EUC A;  2I7P A;  3KW6 A;  4IBE A;  4W5W A;  5ITY A;  2OQ4 A;  4G4N A;  2QBY A;  4OU7 A;  2XF3 A;  1MX0 A;  2Y0T A;  3FUX A;  2M5Z A;  3KS8 A;  3FYD A;  2HL7 A;  2R18 A;  3L2A A;  3KVW A;  1PM5 A;  4GC9 A;  3FUT A;  3VDP A;  4I5S A;  2Y21 A;  3AOE A;  5H37 D;  4A3V B;  5KPR A;  1IN5 A;  3LQQ A;  4DR4 M;  4MM3 B;  2F4V M;  5KPZ A;  3NWL A;  4YHH M;  2L7I A;  4JI8 M;  1HT1 E;  4JI2 M;  1G59 A;  1XXH A;  4HLQ A;  2YNM D;  4YY3 M;  1X37 A;  4AI6 A;  1IBL M;  1NSF A;  3T1Y M;  2CHV A;  5ITQ A;  3SAS A;  2Y0Q A;  1DGF A;  5EP4 A;  3FD9 A;  2KRU A;  3U60 A;  4FCV A;  1VDD A;  1Z5A A;  3R8F A;  3HU1 A;  2VII A;  1IXR C;  3J80 S;  3THG A;  3KXE C;  3LMM A;  1N34 M;  4DR3 M;  1E9R A;  4L4U A;  4EIW A;  4QHS A;  4LY6 A;  1PJI A;  1IXS B;  3KOX E;  1L8Q A;  2DZN B;  4M9S A;  2M60 A;  3PNY A;  4NL4 H;  2D7E A;  3A98 B;  4L15 A;  3VFD A;  4LJA A;  2DZO B;  4LJ9 A;  4G4R A;  4DUY M;  4GC5 A;  2L6O A;  4I4L A;  3KOZ E;  2W82 A;  4DV7 M;  4GIT A;  3SYK A;  4AKG A;  2DWN A;  1R2Y A;  1NY5 A;  3SHG B;  2QZ4 A;  1IY0 A;  3J2P B;  3I51 A;  5DYI A;  4D80 A;  3AJI B;  2CHQ A;  3A46 A;  3AKZ A;  3GLH B;  3BOS A;  4PCZ A;  3AV0 A;  4JI3 M;  1IN6 A;  4X62 M;  5A2Q S;  2CV0 A;  1SXJ E;  2XSZ D;  3GLI B;  2J7O A;  1GVN A;  4B3T M;  5FTN A;  3M0E A;  2RGO A;  4MGK E;  1QAO A;  2XEP A;  3PVS A;  4IBB A;  4AW4 A;  2HKJ A;  3KSJ A;  2ZM6 M;  1QQW A;  2FFJ A;  1JR3 A;  4GMQ A;  2CEA A;  1J09 A;  1DO2 A;  4R7G A;  3E4R A;  5IRE B;  4LF4 M;  4GKK M;  2RKO A;  4LJ6 A;  4LRS A;  2C5R A;  2ZAN A;  3UGJ A;  4NXM M;  3UK6 A;  4REZ A;  2L7H A;  3SYL A;  3FYC A;  4LCB A;  4JV5 M;  4FD2 A;  1W5S A;  3ZH9 B;  1QAM A;  3PNV A;  3HHW A;  4LZZ A;  3FUV A;  1J5E M;  5FTL A;  4BB9 A;  1IN8 A;  1FNN A;  2Z7J A;  5EQT A;  3GO8 A;  4PD2 A;  3WHK A;  1K3W A;  2R62 A;  3FUW A;  4MB7 A;  1XMQ M;  3FTC A;  2XLJ A;  3RGP A;  1SXJ B;  5DNY A;  4DV6 M;  3EIH A;  3HJS A;  4DUZ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...