4AQYM

Structure of ribosome-apramycin complexes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4aqyM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4aqyM02
2F4VM 1HR0M 3U6DA 4X64M 2F5PA 5ITXE 4G4QA 3GPUA 2ZM6M 1J5EM 1IBLM 5ITQA 4JYAM 4X62M 2UUAM 5ITUA 1PJJA 1KFVA 4DV7M 3A45A 2E5LM 4LFCM 1IBMM 1Z5AA 4LF8M 4JI2M 2XZUA 4G4NA 4GKJM 2EA0A 4DR2M 4PCZA 1IBKM 3SATA 2OPFA 4JI7M 4DV5M 3T1HM 5FLXS 4PD2A 3U6QA 1Q3CA 1K3XA 4JI4M 1L2BA 2UXDM 4JI8M 5ITYA 4JV5M 3J81S 4DUZM 3TWMA 5BR8M 4LF5M 4NXNM 4DV3M 1N36M 3SARA 1PM5A 1L1TA 2HHHM 1L2DA 4B3MM 2HKJA 3GQ5A 3JR5A 1HNWM 3C58A 3A42A 2F5SA 2ZBKB 1Z5CA 5ITTA 5A2QS 3U6EA 1R2YA 1XNQM 4G4OA 3GPXA 4B3SM 2F5NA 3GP1A 4KHPM 2UUCM 4DV0M 1Z59A 2Q2EB 4PDGA 1HNXM 1XMOM 3GPPA 4MB7A 2F5QA 3A46A 4G4RA 3JAMS 5ITRA 4DR3M 4DV4M 2UXBM 4DV6M 1PJIA 1N34M 1L2CA 4JI5M 4DV2M 3TWLA 3TWKA 2F5OA 4X65M 3U6OA 4CISA 4LF9M 4B3RM 3J80S 3W0FA 4GKKM 3GO8A 2UUBM 4JI3M 1FJGM 4NRVA 3DOAA 4YHHM 4OX9M 1XMQM 4DUYM 3VK7A 3GQ4A 3SBJA 1TDZA 4NRWA 3U6PA 5IWAM 3SAVA 2VQFM 4JI1M 4LF7M 3J7AS 4JI0M 4X66M 4DV1M 1NNJA 4PDIA 4DR1M 3T1YM 1N32M 4DR7M 1HNZM 4YY3M 1K82A 3U6CA 3GQ3A 4LFAM 4ITQA 1Z5BA 1Q3BA 1L1ZA 4LFBM 4DR5M 1MU5A 3SAWA 4K0KM 1K3WA 3VK8A 4B3TM 4AQYM 3U6LA 4DR4M 2UXCM 4LF6M 1TDHA 1I94M 5IT9S 4JI6M 4DR6M 3OTOM 5LMUM 2XZFA 3SAUA 1R2ZA 3U6SA 3GPYA 3U6MA 1N33M 1Q39A 4NXMM 1XNRM 2UU9M 2OQ4A 1EE8A 2VQEM 3JR4A 1MX0A 1XC8A 5ITXA 3SASA 4LF4M 5LMNM
chains in the Genus database with same CATH superfamily
3NBXX 2JY6B 4X64M 3U6DA 1NNUC 4LJ9A 2H1RA 4MGZE 5ITQA 2JZ0A 2EJSA 3VDPA 1IN7A 4AG5A 2JZ1A 3W68A 2HCBA 1J7KA 2M60A 2D7HA 3GRYA 3MHVC 4Q7JA 4DV7M 1YSYA 2DAEA 2DWZB 2QHOB 3A45A 3FRHA 2I7NA 4IJFA 1Z5AA 4LFCM 4G3OA 4LF8M 5KO3A 4PCZA 1UM8A 2FE8A 1IY2A 4DV5M 2DVWB 2RKOA 1TH3A 4OVZB 4R3DA 4DBGB 3QAUA 1Q3CA 2O5RA 1XXHB 3PFIA 1IXRC 4RF1A 4RKUF 3QWLA 4CJ6A 4IBGA 3SMSA 4JI4M 3PVSA 2YNMD 4MGIE 2UXDM 4JI8M 3ZQJA 2C96A 3K2LA 2BNKA 3K9OA 3SYLA 3J81S 1DV0A 2JY5A 2LVNC 4HL4A 5BR8M 3BBZA 1F4IA 2KRUA 3GLIE 4FVMA 1L2DA 1GL6A 2DXIA 3A42A 4JXJA 2ZBKB 1IM2A 2MGWA 3AJIB 4NSOB 4GMQA 3M7GA 3U6EA 2MH8A 4M9SA 1GLNA 1TR8A 4G4OA 1XNQM 4FW9A 1G4AE 5FSWA 2JWSA 3GP1A 2UUCM 3CGWA 3M6AA 4AG6A 2R62A 1HNXM 1NO1A 5E26A 2LNHC 3K1JA 1DGHA 3C3DA 3H4MA 3HWSA 1TH2A 2V1UA 1G59A 4LZJA 2QNJA 3MMPA 2JY8A 4GITA 3KXEC 1NV9A 2JNHA 3L25A 1NJGA 2UXBM 4DV6M 3VKHA 2KNZA 3VKGA 1L2CA 2LWXA 3GRVA 2LVQD 3PNYA 2QSFX 3TWLA 7CATA 1GKIA 4DV2M 4JI5M 1D0LA 4WP2A 4X65M 2XGNA 2KNAA 3KP1E 5F3WA 4LF9M 1OAOC 1E9SA 2VDBB 3J80S 4GC9A 2K6BA 3HKPA 1OQYA 5EJCA 2ZAMA 1S3SA 4MGHA 4JI3M 2B3TA 2CFOA 2VF8A 1XHBA 3KDSE 3DOAA 2EO2A 1GJTA 2R65A 4NRVA 1XMQM 4LZZA 4OX9M 1ZMWA 1XWIA 4DUYM 1ZV1A 2CV1A 3GQ4A 2AHMA 1TDZA 1HT2E 3SAVA 3J7AS 4JI0M 4X66M 2G5GX 4DR1M 3RGSA 2P5TA 3DA1A 1K82A 3U6CA 1XXHA 1OKSA 4ITQA 2C99A 4ANRA 2JA2A 1X37A 4MH0E 2V1CA 1IXZA 4DR5M 1VDLA 3SAWA 4QOSA 2KA6B 1VQ1A 4IBCA 2O01F 3VK8A 4DR4M 2YFQA 2M5ZA 4HEOA 1I94M 1MJGM 1E9RA 2J7OA 1AUAA 1PJQA 2X4AA 4WW0A 3FYDA 2XZFA 5E6JA 3U60B 2VF7A 3E4RA 3KSXA 3LQRA 4PT5A 2CHQA 2KHHA 2XSZD 2ZAOA 3VFDA 4EIWA 1N33M 5EXTA 4NXMM 1XNRM 4FCTA 4D81A 3HHZA 1GABA 1EE8A 3WHLA 5ITXA 1WIVA 4LJ8A 4XGIA 3T38A 1RU3A 4LF4M 2F4VM 2L6OA 1MN3A 4NSRA 3GPUA 1J5EM 2L7HA 2LVPC 1Z6TA 3J2PB 5FTKA 4BLCA 2UUAM 1VDDA 3HJQA 3I51A 4QHSA 1PJJA 2JUJA 1DO2A 2VIIA 4FWGA 1QQWA 3FD9A 4Z8XA 1NHGC 1WGNA 2E5LM 4IJEA 2QQ8A 4XK8F 1QVRA 3R9XB 1DGBA 4DR2M 4I5SA 3B89A 2OPFA 4JI7M 1NVMA 1DO0A 2CHGA 2BWEA 2FFJA 3T1HM 3FUXA 4FCWA 4GH9A 4QNRA 3CTWB 3GLFA 2EUCA 4NC6A 1L2BA 1WHCA 2YR0A 4QNMA 3GLGE 5EP1A 3K9PA 4L16A 2GNOA 3GRRA 3IG5A 1OFHA 3Q8XA 3NWLA 3IHPA 3KSJA 1SXJE 4B3MM 4QOZC 4LJ6A 1QUTA 2R4EA 3SYKA 3C58A 5KPZA 1ORYB 4AKHA 3GLHE 1PJTA 2Z4SA 4AKGA 3ZH9B 3GPXA 3M0EA 4IBDA 2RRUA 1Z59A 1OTRA 4AKIA 4MB7A 1NV8A 2A5YB 3T6PA 1OFIA 4WURA 3V76A 2ZTCA 3AFHA 4NL4H 5FTLA 4LJ4A 3U60A 4CGYB 2KEBA 1VG5A 3K8ZA 4A3VB 4AZFA 3AOGA 5EXXA 3A46A 2RGOA 1WGLA 1TH4A 2LTUA 3LW5F 3SFZA 5EQTA 5ITRA 2J7NA 2JP7A 3VLFB 1PJIA 3FUUA 2FOIC 3TWKA 3U6OA 3AL0C 2KRKA 1SXJD 1WR1B 2DAKA 3AOEA 4XBOA 2EKFA 2WSEF 3D8LA 3W0FA 3U5ZB 4GKKM 1FJGM 5IREB 2YQZA 3FKEA 4YHHM 1GL7A 4RF0A 1QYRA 3GRUA 1SG9A 3B9PA 1JB0F 3VK7A 1IXSB 3PXGA 4NRWA 1IQPA 1NJFA 2WZJA 3B74A 4KO8A 5DFLA 3RE8A 4CIZA 4JI1M 1ZMVA 4LF7M 2OOAA 1NNJA 4L6V6 3RFWA 4B7GA 3B7QA 4LGMA 4DR7M 2XF3A 1IN5A 3CF0A 1ZAEA 1CUKA 2OOBA 1JR3E 1ZQ9A 3FE3A 1MU5A 2QENA 4LJ5A 1K3WA 2C5RA 4AQYM 1G3IA 2JY7A 3ZC7B 1T43A 3L29A 5EP3A 3OTOM 5LMUM 4NOOB 3SAUA 1R2ZA 3U6SA 1R5LA 3GLFB 3HGIA 3U6MA 4LJAA 1V33A 2CV2A 4LCBA 2WSCF 4B08A 2OQ4A 4HLQA 3SASA 1R7RA 3UK6A 4R7GA 3GLIA 4GHAA 3FTFA 2JXNA 1TTEA 2CRUA 8CATA 3RGPA 1IFYA 1HQCA 5DYIA 3E9SA 4D80A 3KOXE 5ITXE 3BOSA 1QAQA 1D2NA 4L15A 2J5YA 4X62M 2Y21A 2R4JA 5ITUA 1BVSA 1JR3D 1KFVA 4FWHA 4UN2B 3HHXA 3L27A 1N77A 4IBBA 1IBMM 2HL7A 2DAMA 2XZUA 4JI2M 2DKLA 4IBFA 1D0MA 1IBKM 3SATA 3U5ZA 1IN6A 2H5XA 2DHRA 1YE9A 1VEGA 3U6QA 1HJPA 1QUSA 2Y0QA 1OJLA 2L2DA 4RNAA 3IG8A 1KSFX 2KDLA 4M9XA 3UZUA 4F1IA 1K3XA 1H6UA 2FNAA 3THGA 2RGHA 1IXSA 2DENA 3EIEA 3UJNA 1E94E 5ITYA 2KZUA 4DUZM 1C1KA 2EKKA 4IBJA 1N78A 4NXNM 4DV3M 3TE6A 4M0WA 5FTMA 1N36M 1IN8A 3KP0E 1SXJC 4II7A 2Y20A 1PM5A 2D7EA 2HHHM 1AIPC 2HKJA 3LVVA 3FUWA 3FUTA 3GQ5A 4LRTA 1P3QQ 2XSZA 2F5SA 1QDRA 1XB2B 1Z5CA 5ITTA 5A2QS 2Z3XA 3GLGB 4OU7A 4KHPM 4B3SM 3LCUA 4DV0M 3TL4X 1Q02A 4ZPXA 3HJ8A 5JI3E 4S12A 1SXJB 3FTCA 5DNYA 2FH0A 1VEKA 3H4JA 2BWBA 2MROB 1W5TA 3GLHB 3TPZA 4P17A 2OO9A 1V34A 4IBKA 5EP2A 5GKNA 5H37D 4DV4M 4DR3M 2O25A 2LVAA 3BXWA 3VDUA 3I4VA 3L26A 4GHLA 4M0DA 2QZ4A 2K9DA 3MK6A 2QP9X 4B3RM 3T15A 3HU1A 1HT1E 4REZA 2BJWA 2DHYA 2DZLA 3GO8A 2X49A 1NSFA 2C9CA 3QYEA 3NBIA 3SHGB 2D7GA 3KOYE 1GO5A 1NY5A 1YUBA 4OW0A 4L78A 2XH9A 3GLIB 1NY6A 2LVOC 4QHTA 1PGYA 5IWAM 3HHYA 5EP4A 3TQSA 3R8FA 3SC3A 2DZOB 4PDIA 3HX3A 3T1YM 2L4EA 1HNZM 4YY3M 3GQ3A 4LFAM 1Z5BA 1TGUA 1Q3BA 3SMPA 4L8RC 3SHFA 4LFBM 4FD2A 3QYBA 5KQDA 4KODA 2HWJA 2N35A 1FNNA 2LHGA 2XEPA 1GVNA 4IIWA 3I4YA 3FTEA 4K0KM 5KPTA 3U6LA 2UXCM 4LF6M 3L28A 2KW0A 2R46A 3HU3A 1C7YA 1N75A 1R6BX 1UFZA 1ZMUA 2R0IA 2KNVA 4I8OA 1A5TA 3F92A 2WSFF 3B7ZA 2DWLA 2LBCA 1Q39A 2Z4RA 2DAGA 4MGYE 3ZCBB 3GLGA 4LG2A 3KS8A 1PJSA 1QZMA 1IN4A 4B7HA 1XC8A 2BJVA 4GEWA 3MJ5A 1WXQA 3U61A 2CV0A 5LMNM 1HR0M 1SXJA 1R4GA 1YLAA 2DAIA 2F5PA 1VEJA 1QZEA 4G4QA 2ZM6M 1IBLM 3KOZE 3GLHA 3LQQA 1G8PA 4JYAM 2NQ8C 4TUWA 1KYIA 1WJ7A 1XXHE 2KZSA 3HHWA 4FWDA 1PRBA 3PNVA 1G41A 5EXSA 5L8RF 2DI0A 1T6OA 5FTNA 3E46A 5KQ8A 1Y8GA 2Z7JA 4LRSA 2Y0TA 4W5WA 2EA0A 1OIZA 3FTDA 4G4NA 4GKJM 3HY5A 4BB9A 4KT0F 5FLXS 3A98B 4PD2A 2MJ5B 3KFUG 4Y28F 3KS4A 2I7PA 4LGYA 3W67A 2K0BX 2QBYB 4JV5M 3CF6E 3AKZA 4D82A 3W0LB 2MR9A 3I01M 2Z8YM 4JN6A 3TWMA 4LF5M 4CHTB 1GJSA 3AV0A 2CE7A 3SARA 1L1TA 3JR5A 1HNWM 4LJ7A 3HJSA 1TF0B 3J27B 1R2YA 3WHKA 1EFUB 2F5NA 2FS1A 4MGKE 1T3TA 2R18A 4GRIA 4MM3B 4B7FA 3L2AA 2Q2EB 3FRIA 1V92A 4IBIA 5FTJA 4PDGA 5KPRA 1XMOM 1LTMA 2CP8A 2ERCA 3GPPA 1IY0A 1LV7A 3J7BA 2F5QA 3FUVA 1IY1A 4AW4A 3JAMS 2C98A 4OVZA 4G4RA 1JR3A 1DGGA 2X8AA 1QAOA 4BBAA 4LY6A 1DGFA 4Z6YA 4P16A 3LVWA 3UMMA 3UGJA 3GLFE 2R45A 1QAMA 1N34M 2V6ZM 2XFTA 2F5OA 4CISA 2C9OA 2LHCA 2LXEA 3KOWE 3K92A 5C1BA 3FYCA 3LMMA 2KXEA 2LH0A 3B7NA 2HAKA 2UUBM 1NHWC 3C3EA 2ZANA 3AOEC 2DWMA 2CUZA 2K47A 5EXPA 3SBJA 2QCUA 3U6PA 4L4UA 3U61B 2L7IA 5IZ7D 3KVWA 1D0KA 1QANA 2R6FA 2VQFM 2DWNA 4DV1M 3DFZA 3DZDA 5JI2E 2ZTDA 3KW6A 2APLA 2GQFA 4FCVA 4R71A 1OAIA 3D8BA 2XLJA 1N32M 4M9ZA 3C9PA 1OIPA 2W82A 4AI6A 3HU2A 5DYGA 1L1ZA 2DNAA 4I81A 1W5SA 4G6ZA 3CF2A 4GIPA 2XFSA 3ILKA 2QBYA 1JQJC 3HZJA 5BPVA 4B3TM 1J09A 1QDTA 2CWBA 4KLNA 2QPAA 1L8QA 1TDHA 5IT9S 4I4LA 1E32A 2CHVA 2L09A 4IBEA 1I4WA 4JI6M 3I04M 4GC5A 1DGHB 3IECA 4DR6M 2G8LA 3Q8GA 2L4FA 2CEAA 3GPYA 1EIJA 4F2LA 1HQYE 2UU9M 2G3QA 2VQEM 2R44A 1MX0A 5C18A 3JR4A 3E21A 3LCVB 2DZNB 1G71A 3EIHA
chains in the Genus database with same CATH topology
3U6DA 4X64M 1NNUC 4LJ9A 2H1RA 4MGZE 5ITQA 3VDPA 1IN7A 4AG5A 2HCBA 1J7KA 2M60A 2D7HA 3GRYA 3MHVC 4DV7M 1YSYA 3A45A 2DWZB 4LFCM 2I7NA 4IJFA 1Z5AA 4LF8M 5KO3A 4PCZA 1UM8A 2FE8A 1IY2A 4DV5M 2DVWB 2RKOA 1TH3A 4OVZB 4R3DA 3QAUA 1Q3CA 2O5RA 1XXHB 3PFIA 1IXRC 4RF1A 3QWLA 4IBGA 3SMSA 4JI4M 3PVSA 2YNMD 4MGIE 2UXDM 4JI8M 2C96A 3K2LA 2BNKA 3SYLA 3J81S 5BR8M 4HL4A 2KRUA 4FVMA 1L2DA 1GL6A 2DXIA 3A42A 4JXJA 2ZBKB 1IM2A 3AJIB 4NSOB 4GMQA 3M7GA 3U6EA 4M9SA 1XNQM 1GLNA 4G4OA 4FW9A 1G4AE 5FSWA 3GP1A 2UUCM 3M6AA 4AG6A 2R62A 1HNXM 5E26A 2LNHC 3K1JA 1DGHA 3H4MA 3HWSA 1TH2A 2V1UA 1G59A 4LZJA 4GITA 3KXEC 3L25A 2UXBM 1NJGA 3VKHA 4DV6M 3VKGA 1L2CA 2LWXA 3GRVA 3PNYA 7CATA 3TWLA 4DV2M 1GKIA 4JI5M 4X65M 5F3WA 4LF9M 2XGNA 3KP1E 3J80S 1E9SA 4GC9A 3HKPA 5EJCA 2ZAMA 1S3SA 4MGHA 4JI3M 4NRVA 2CFOA 4WW0A 3KDSE 1XHBA 3DOAA 2EO2A 4OX9M 2R65A 1XMQM 4LZZA 1XWIA 4DUYM 2CV1A 3GQ4A 2AHMA 1TDZA 1HT2E 3SAVA 3J7AS 4JI0M 4X66M 2G5GX 4DR1M 3RGSA 2P5TA 3DA1A 1K82A 3U6CA 1XXHA 4ITQA 2C99A 2JA2A 1X37A 4MH0E 2V1CA 1IXZA 4DR5M 3SAWA 4QOSA 2KA6B 4IBCA 3VK8A 4DR4M 2YFQA 2M5ZA 1I94M 2J7OA 1E9RA 2X4AA 3FYDA 2XZFA 5E6JA 3U60B 3E4RA 3KSXA 3LQRA 4PT5A 2CHQA 2XSZD 2ZAOA 3VFDA 4EIWA 1N33M 5EXTA 4NXMM 1XNRM 4FCTA 4D81A 3HHZA 1EE8A 3WHLA 5ITXA 4XGIA 4LJ8A 3T38A 4LF4M 2F4VM 2L6OA 4NSRA 3GPUA 1J5EM 2L7HA 3J2PB 1Z6TA 5FTKA 4BLCA 2UUAM 1VDDA 3HJQA 3I51A 4QHSA 1PJJA 1DO2A 2VIIA 4FWGA 1QQWA 3FD9A 4Z8XA 1NHGC 2E5LM 4IJEA 1QVRA 3R9XB 1DGBA 4DR2M 4I5SA 2OPFA 4JI7M 1NVMA 1DO0A 2CHGA 2FFJA 3T1HM 3FUXA 4FCWA 4GH9A 4QNRA 3CTWB 3GLFA 2EUCA 1L2BA 2YR0A 4QNMA 5EP1A 4L16A 3GRRA 3IG5A 1OFHA 3Q8XA 3NWLA 3KSJA 1SXJE 4B3MM 4QOZC 4LJ6A 2R4EA 3SYKA 3C58A 5KPZA 1ORYB 4AKHA 4AKGA 2Z4SA 3ZH9B 3GPXA 3M0EA 4IBDA 1Z59A 4AKIA 4MB7A 2A5YB 1OFIA 4WURA 5FTLA 3AFHA 4NL4H 4LJ4A 3U60A 4CGYB 2KEBA 3K8ZA 4A3VB 4AZFA 3A46A 3AOGA 5EXXA 2RGOA 1TH4A 3SFZA 5ITRA 5EQTA 2J7NA 3VLFB 1PJIA 3FUUA 2FOIC 3TWKA 3U6OA 3AL0C 2KRKA 1SXJD 4XBOA 3AOEA 3U5ZB 3D8LA 3W0FA 4GKKM 1FJGM 5IREB 2YQZA 3FKEA 4YHHM 1GL7A 4RF0A 1QYRA 3GRUA 3B9PA 3VK7A 1IXSB 3PXGA 4NRWA 1IQPA 1NJFA 4KO8A 3RE8A 4JI1M 4LF7M 1NNJA 3RFWA 4B7GA 4LGMA 4DR7M 2XF3A 1IN5A 3CF0A 1ZAEA 1ZQ9A 1MU5A 2QENA 4LJ5A 1K3WA 2C5RA 4AQYM 1G3IA 3ZC7B 3L29A 5EP3A 3OTOM 5LMUM 4NOOB 3SAUA 1R2ZA 3U6SA 3GLFB 3HGIA 3U6MA 4LJAA 2CV2A 4LCBA 4B08A 2OQ4A 4HLQA 3SASA 1R7RA 3UK6A 4R7GA 3GLIA 4GHAA 3FTFA 8CATA 3RGPA 1HQCA 5DYIA 3E9SA 4D80A 3KOXE 5ITXE 3BOSA 1QAQA 1D2NA 4L15A 4X62M 2Y21A 2R4JA 5ITUA 1JR3D 1KFVA 4FWHA 3HHXA 3L27A 1N77A 4IBBA 1IBMM 2HL7A 4JI2M 2XZUA 4IBFA 1IBKM 3SATA 3U5ZA 1IN6A 2DHRA 1YE9A 3U6QA 2Y0QA 1OJLA 4RNAA 3IG8A 1KSFX 4M9XA 3UZUA 1K3XA 1H6UA 2FNAA 3THGA 2RGHA 3EIEA 3UJNA 1E94E 5ITYA 2KZUA 4DUZM 1C1KA 4IBJA 1N78A 4NXNM 4DV3M 3TE6A 4M0WA 5FTMA 1N36M 1IN8A 3KP0E 1SXJC 4II7A 2Y20A 1PM5A 2D7EA 2HHHM 2HKJA 3LVVA 3GQ5A 3FUWA 3FUTA 4LRTA 2XSZA 2F5SA 5A2QS 1Z5CA 5ITTA 2Z3XA 3GLGB 4OU7A 4KHPM 4B3SM 4DV0M 3TL4X 4ZPXA 3HJ8A 5JI3E 4S12A 1SXJB 3FTCA 5DNYA 3GLHB 1W5TA 3TPZA 5H37D 5GKNA 4IBKA 5EP2A 4DR3M 4DV4M 3VDUA 3I4VA 3L26A 4GHLA 4M0DA 2QZ4A 3MK6A 2QP9X 4B3RM 3T15A 3HU1A 1HT1E 4REZA 2BJWA 3GO8A 2X49A 1NSFA 2C9CA 3NBIA 3SHGB 2D7GA 3KOYE 1NY5A 1YUBA 4OW0A 4L78A 2XH9A 3GLIB 1NY6A 4QHTA 5IWAM 3HHYA 5EP4A 3TQSA 3R8FA 3SC3A 2DZOB 4PDIA 3T1YM 1HNZM 4YY3M 3GQ3A 4LFAM 1Z5BA 1TGUA 1Q3BA 3SMPA 4L8RC 3SHFA 4LFBM 4FD2A 5KQDA 4KODA 1FNNA 2XEPA 1GVNA 4IIWA 3I4YA 3FTEA 4K0KM 5KPTA 3U6LA 2UXCM 4LF6M 3L28A 2KW0A 2R46A 3HU3A 1N75A 1R6BX 4I8OA 2DWLA 3KS8A 1Q39A 2Z4RA 4MGYE 3ZCBB 3GLGA 4LG2A 1QZMA 1IN4A 4B7HA 1XC8A 2BJVA 3MJ5A 1WXQA 3U61A 2CV0A 5LMNM 1HR0M 1SXJA 2F5PA 4G4QA 2ZM6M 1IBLM 3KOZE 3GLHA 3LQQA 1G8PA 4JYAM 2NQ8C 4TUWA 1KYIA 3HHWA 2KZSA 4FWDA 3PNVA 5EXSA 1G41A 5FTNA 5KQ8A 4LRSA 2Z7JA 2Y0TA 4W5WA 2EA0A 4G4NA 3FTDA 4GKJM 4BB9A 5FLXS 3A98B 4PD2A 3KFUG 3KS4A 2I7PA 4LGYA 2QBYB 4JV5M 3CF6E 3AKZA 4D82A 3W0LB 3TWMA 4JN6A 4LF5M 4CHTB 3AV0A 2CE7A 3SARA 1L1TA 3JR5A 1HNWM 4LJ7A 3HJSA 3J27B 1R2YA 3WHKA 2F5NA 4MGKE 1T3TA 2R18A 4GRIA 4MM3B 4B7FA 3L2AA 2Q2EB 4PDGA 5FTJA 4IBIA 5KPRA 1XMOM 3GPPA 2ERCA 1IY0A 1LV7A 3J7BA 2F5QA 3FUVA 1IY1A 4AW4A 3JAMS 2C98A 4OVZA 4G4RA 1JR3A 1DGGA 2X8AA 1QAOA 4BBAA 4LY6A 1DGFA 4Z6YA 4P16A 3LVWA 3UMMA 3UGJA 2R45A 1QAMA 1N34M 2V6ZM 2XFTA 2F5OA 4CISA 2C9OA 2LXEA 3KOWE 3K92A 5C1BA 3FYCA 3LMMA 2KXEA 2LH0A 2UUBM 1NHWC 2ZANA 3AOEC 2DWMA 2CUZA 2K47A 5EXPA 3SBJA 2QCUA 3U6PA 4L4UA 3U61B 2L7IA 5IZ7D 3KVWA 1QANA 2VQFM 2DWNA 4DV1M 3DFZA 3DZDA 5JI2E 3KW6A 1N32M 4FCVA 2XLJA 3D8BA 4M9ZA 2W82A 4AI6A 3HU2A 5DYGA 1L1ZA 4I81A 1W5SA 4G6ZA 3CF2A 4GIPA 2XFSA 3ILKA 2QBYA 1JQJC 5BPVA 4B3TM 1J09A 4KLNA 2QPAA 1L8QA 1TDHA 5IT9S 4I4LA 1E32A 2CHVA 2L09A 4IBEA 1I4WA 4JI6M 4DR6M 4GC5A 1DGHB 2G8LA 3GPYA 2CEAA 1HQYE 2UU9M 2VQEM 3JR4A 1MX0A 5C18A 2DZNB 3EIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V M;  1HR0 M;  3U6D A;  4X64 M;  2F5P A;  5ITX E;  4G4Q A;  3GPU A;  2ZM6 M;  1J5E M;  1IBL M;  5ITQ A;  4JYA M;  4X62 M;  2UUA M;  5ITU A;  1PJJ A;  1KFV A;  4DV7 M;  3A45 A;  2E5L M;  4LFC M;  1IBM M;  1Z5A A;  4LF8 M;  4JI2 M;  2XZU A;  4G4N A;  4GKJ M;  2EA0 A;  4DR2 M;  4PCZ A;  1IBK M;  3SAT A;  2OPF A;  4JI7 M;  4DV5 M;  3T1H M;  5FLX S;  4PD2 A;  3U6Q A;  1Q3C A;  1K3X A;  4JI4 M;  1L2B A;  2UXD M;  4JI8 M;  5ITY A;  4JV5 M;  3J81 S;  4DUZ M;  3TWM A;  5BR8 M;  4LF5 M;  4NXN M;  4DV3 M;  1N36 M;  3SAR A;  1PM5 A;  1L1T A;  2HHH M;  1L2D A;  4B3M M;  2HKJ A;  3GQ5 A;  3JR5 A;  1HNW M;  3C58 A;  3A42 A;  2F5S A;  2ZBK B;  1Z5C A;  5ITT A;  5A2Q S;  3U6E A;  1R2Y A;  1XNQ M;  4G4O A;  3GPX A;  4B3S M;  2F5N A;  3GP1 A;  4KHP M;  2UUC M;  4DV0 M;  1Z59 A;  2Q2E B;  4PDG A;  1HNX M;  1XMO M;  3GPP A;  4MB7 A;  2F5Q A;  3A46 A;  4G4R A;  3JAM S;  5ITR A;  4DR3 M;  4DV4 M;  2UXB M;  4DV6 M;  1PJI A;  1N34 M;  1L2C A;  4JI5 M;  4DV2 M;  3TWL A;  3TWK A;  2F5O A;  4X65 M;  3U6O A;  4CIS A;  4LF9 M;  4B3R M;  3J80 S;  3W0F A;  4GKK M;  3GO8 A;  2UUB M;  4JI3 M;  1FJG M;  4NRV A;  3DOA A;  4YHH M;  4OX9 M;  1XMQ M;  4DUY M;  3VK7 A;  3GQ4 A;  3SBJ A;  1TDZ A;  4NRW A;  3U6P A;  5IWA M;  3SAV A;  2VQF M;  4JI1 M;  4LF7 M;  3J7A S;  4JI0 M;  4X66 M;  4DV1 M;  1NNJ A;  4PDI A;  4DR1 M;  3T1Y M;  1N32 M;  4DR7 M;  1HNZ M;  4YY3 M;  1K82 A;  3U6C A;  3GQ3 A;  4LFA M;  4ITQ A;  1Z5B A;  1Q3B A;  1L1Z A;  4LFB M;  4DR5 M;  1MU5 A;  3SAW A;  4K0K M;  1K3W A;  3VK8 A;  4B3T M;  4AQY M;  3U6L A;  4DR4 M;  2UXC M;  4LF6 M;  1TDH A;  1I94 M;  5IT9 S;  4JI6 M;  4DR6 M;  3OTO M;  5LMU M;  2XZF A;  3SAU A;  1R2Z A;  3U6S A;  3GPY A;  3U6M A;  1N33 M;  1Q39 A;  4NXM M;  1XNR M;  2UU9 M;  2OQ4 A;  1EE8 A;  2VQE M;  3JR4 A;  1MX0 A;  1XC8 A;  5ITX A;  3SAS A;  4LF4 M;  5LMN M; 
#chains in the Genus database with same CATH topology
 3NBX X;  2JY6 B;  4X64 M;  3U6D A;  1NNU C;  4LJ9 A;  2H1R A;  4MGZ E;  5ITQ A;  2JZ0 A;  2EJS A;  3VDP A;  1IN7 A;  4AG5 A;  2JZ1 A;  3W68 A;  2HCB A;  1J7K A;  2M60 A;  2D7H A;  3GRY A;  3MHV C;  4Q7J A;  4DV7 M;  1YSY A;  2DAE A;  2DWZ B;  2QHO B;  3A45 A;  3FRH A;  2I7N A;  4IJF A;  1Z5A A;  4LFC M;  4G3O A;  4LF8 M;  5KO3 A;  4PCZ A;  1UM8 A;  2FE8 A;  1IY2 A;  4DV5 M;  2DVW B;  2RKO A;  1TH3 A;  4OVZ B;  4R3D A;  4DBG B;  3QAU A;  1Q3C A;  2O5R A;  1XXH B;  3PFI A;  1IXR C;  4RF1 A;  4RKU F;  3QWL A;  4CJ6 A;  4IBG A;  3SMS A;  4JI4 M;  3PVS A;  2YNM D;  4MGI E;  2UXD M;  4JI8 M;  3ZQJ A;  2C96 A;  3K2L A;  2BNK A;  3K9O A;  3SYL A;  3J81 S;  1DV0 A;  2JY5 A;  2LVN C;  4HL4 A;  5BR8 M;  3BBZ A;  1F4I A;  2KRU A;  3GLI E;  4FVM A;  1L2D A;  1GL6 A;  2DXI A;  3A42 A;  4JXJ A;  2ZBK B;  1IM2 A;  2MGW A;  3AJI B;  4NSO B;  4GMQ A;  3M7G A;  3U6E A;  2MH8 A;  4M9S A;  1GLN A;  1TR8 A;  4G4O A;  1XNQ M;  4FW9 A;  1G4A E;  5FSW A;  2JWS A;  3GP1 A;  2UUC M;  3CGW A;  3M6A A;  4AG6 A;  2R62 A;  1HNX M;  1NO1 A;  5E26 A;  2LNH C;  3K1J A;  1DGH A;  3C3D A;  3H4M A;  3HWS A;  1TH2 A;  2V1U A;  1G59 A;  4LZJ A;  2QNJ A;  3MMP A;  2JY8 A;  4GIT A;  3KXE C;  1NV9 A;  2JNH A;  3L25 A;  1NJG A;  2UXB M;  4DV6 M;  3VKH A;  2KNZ A;  3VKG A;  1L2C A;  2LWX A;  3GRV A;  2LVQ D;  3PNY A;  2QSF X;  3TWL A;  7CAT A;  1GKI A;  4DV2 M;  4JI5 M;  1D0L A;  4WP2 A;  4X65 M;  2XGN A;  2KNA A;  3KP1 E;  5F3W A;  4LF9 M;  1OAO C;  1E9S A;  2VDB B;  3J80 S;  4GC9 A;  2K6B A;  3HKP A;  1OQY A;  5EJC A;  2ZAM A;  1S3S A;  4MGH A;  4JI3 M;  2B3T A;  2CFO A;  2VF8 A;  1XHB A;  3KDS E;  3DOA A;  2EO2 A;  1GJT A;  2R65 A;  4NRV A;  1XMQ M;  4LZZ A;  4OX9 M;  1ZMW A;  1XWI A;  4DUY M;  1ZV1 A;  2CV1 A;  3GQ4 A;  2AHM A;  1TDZ A;  1HT2 E;  3SAV A;  3J7A S;  4JI0 M;  4X66 M;  2G5G X;  4DR1 M;  3RGS A;  2P5T A;  3DA1 A;  1K82 A;  3U6C A;  1XXH A;  1OKS A;  4ITQ A;  2C99 A;  4ANR A;  2JA2 A;  1X37 A;  4MH0 E;  2V1C A;  1IXZ A;  4DR5 M;  1VDL A;  3SAW A;  4QOS A;  2KA6 B;  1VQ1 A;  4IBC A;  2O01 F;  3VK8 A;  4DR4 M;  2YFQ A;  2M5Z A;  4HEO A;  1I94 M;  1MJG M;  1E9R A;  2J7O A;  1AUA A;  1PJQ A;  2X4A A;  4WW0 A;  3FYD A;  2XZF A;  5E6J A;  3U60 B;  2VF7 A;  3E4R A;  3KSX A;  3LQR A;  4PT5 A;  2CHQ A;  2KHH A;  2XSZ D;  2ZAO A;  3VFD A;  4EIW A;  1N33 M;  5EXT A;  4NXM M;  1XNR M;  4FCT A;  4D81 A;  3HHZ A;  1GAB A;  1EE8 A;  3WHL A;  5ITX A;  1WIV A;  4LJ8 A;  4XGI A;  3T38 A;  1RU3 A;  4LF4 M;  2F4V M;  2L6O A;  1MN3 A;  4NSR A;  3GPU A;  1J5E M;  2L7H A;  2LVP C;  1Z6T A;  3J2P B;  5FTK A;  4BLC A;  2UUA M;  1VDD A;  3HJQ A;  3I51 A;  4QHS A;  1PJJ A;  2JUJ A;  1DO2 A;  2VII A;  4FWG A;  1QQW A;  3FD9 A;  4Z8X A;  1NHG C;  1WGN A;  2E5L M;  4IJE A;  2QQ8 A;  4XK8 F;  1QVR A;  3R9X B;  1DGB A;  4DR2 M;  4I5S A;  3B89 A;  2OPF A;  4JI7 M;  1NVM A;  1DO0 A;  2CHG A;  2BWE A;  2FFJ A;  3T1H M;  3FUX A;  4FCW A;  4GH9 A;  4QNR A;  3CTW B;  3GLF A;  2EUC A;  4NC6 A;  1L2B A;  1WHC A;  2YR0 A;  4QNM A;  3GLG E;  5EP1 A;  3K9P A;  4L16 A;  2GNO A;  3GRR A;  3IG5 A;  1OFH A;  3Q8X A;  3NWL A;  3IHP A;  3KSJ A;  1SXJ E;  4B3M M;  4QOZ C;  4LJ6 A;  1QUT A;  2R4E A;  3SYK A;  3C58 A;  5KPZ A;  1ORY B;  4AKH A;  3GLH E;  1PJT A;  2Z4S A;  4AKG A;  3ZH9 B;  3GPX A;  3M0E A;  4IBD A;  2RRU A;  1Z59 A;  1OTR A;  4AKI A;  4MB7 A;  1NV8 A;  2A5Y B;  3T6P A;  1OFI A;  4WUR A;  3V76 A;  2ZTC A;  3AFH A;  4NL4 H;  5FTL A;  4LJ4 A;  3U60 A;  4CGY B;  2KEB A;  1VG5 A;  3K8Z A;  4A3V B;  4AZF A;  3AOG A;  5EXX A;  3A46 A;  2RGO A;  1WGL A;  1TH4 A;  2LTU A;  3LW5 F;  3SFZ A;  5EQT A;  5ITR A;  2J7N A;  2JP7 A;  3VLF B;  1PJI A;  3FUU A;  2FOI C;  3TWK A;  3U6O A;  3AL0 C;  2KRK A;  1SXJ D;  1WR1 B;  2DAK A;  3AOE A;  4XBO A;  2EKF A;  2WSE F;  3D8L A;  3W0F A;  3U5Z B;  4GKK M;  1FJG M;  5IRE B;  2YQZ A;  3FKE A;  4YHH M;  1GL7 A;  4RF0 A;  1QYR A;  3GRU A;  1SG9 A;  3B9P A;  1JB0 F;  3VK7 A;  1IXS B;  3PXG A;  4NRW A;  1IQP A;  1NJF A;  2WZJ A;  3B74 A;  4KO8 A;  5DFL A;  3RE8 A;  4CIZ A;  4JI1 M;  1ZMV A;  4LF7 M;  2OOA A;  1NNJ A;  4L6V 6;  3RFW A;  4B7G A;  3B7Q A;  4LGM A;  4DR7 M;  2XF3 A;  1IN5 A;  3CF0 A;  1ZAE A;  1CUK A;  2OOB A;  1JR3 E;  1ZQ9 A;  3FE3 A;  1MU5 A;  2QEN A;  4LJ5 A;  1K3W A;  2C5R A;  4AQY M;  1G3I A;  2JY7 A;  3ZC7 B;  1T43 A;  3L29 A;  5EP3 A;  3OTO M;  5LMU M;  4NOO B;  3SAU A;  1R2Z A;  3U6S A;  1R5L A;  3GLF B;  3HGI A;  3U6M A;  4LJA A;  1V33 A;  2CV2 A;  4LCB A;  2WSC F;  4B08 A;  2OQ4 A;  4HLQ A;  3SAS A;  1R7R A;  3UK6 A;  4R7G A;  3GLI A;  4GHA A;  3FTF A;  2JXN A;  1TTE A;  2CRU A;  8CAT A;  3RGP A;  1IFY A;  1HQC A;  5DYI A;  3E9S A;  4D80 A;  3KOX E;  5ITX E;  3BOS A;  1QAQ A;  1D2N A;  4L15 A;  2J5Y A;  4X62 M;  2Y21 A;  2R4J A;  5ITU A;  1BVS A;  1JR3 D;  1KFV A;  4FWH A;  4UN2 B;  3HHX A;  3L27 A;  1N77 A;  4IBB A;  1IBM M;  2HL7 A;  2DAM A;  2XZU A;  4JI2 M;  2DKL A;  4IBF A;  1D0M A;  1IBK M;  3SAT A;  3U5Z A;  1IN6 A;  2H5X A;  2DHR A;  1YE9 A;  1VEG A;  3U6Q A;  1HJP A;  1QUS A;  2Y0Q A;  1OJL A;  2L2D A;  4RNA A;  3IG8 A;  1KSF X;  2KDL A;  4M9X A;  3UZU A;  4F1I A;  1K3X A;  1H6U A;  2FNA A;  3THG A;  2RGH A;  1IXS A;  2DEN A;  3EIE A;  3UJN A;  1E94 E;  5ITY A;  2KZU A;  4DUZ M;  1C1K A;  2EKK A;  4IBJ A;  1N78 A;  4NXN M;  4DV3 M;  3TE6 A;  4M0W A;  5FTM A;  1N36 M;  1IN8 A;  3KP0 E;  1SXJ C;  4II7 A;  2Y20 A;  1PM5 A;  2D7E A;  2HHH M;  1AIP C;  2HKJ A;  3LVV A;  3FUW A;  3FUT A;  3GQ5 A;  4LRT A;  1P3Q Q;  2XSZ A;  2F5S A;  1QDR A;  1XB2 B;  1Z5C A;  5ITT A;  5A2Q S;  2Z3X A;  3GLG B;  4OU7 A;  4KHP M;  4B3S M;  3LCU A;  4DV0 M;  3TL4 X;  1Q02 A;  4ZPX A;  3HJ8 A;  5JI3 E;  4S12 A;  1SXJ B;  3FTC A;  5DNY A;  2FH0 A;  1VEK A;  3H4J A;  2BWB A;  2MRO B;  1W5T A;  3GLH B;  3TPZ A;  4P17 A;  2OO9 A;  1V34 A;  4IBK A;  5EP2 A;  5GKN A;  5H37 D;  4DV4 M;  4DR3 M;  2O25 A;  2LVA A;  3BXW A;  3VDU A;  3I4V A;  3L26 A;  4GHL A;  4M0D A;  2QZ4 A;  2K9D A;  3MK6 A;  2QP9 X;  4B3R M;  3T15 A;  3HU1 A;  1HT1 E;  4REZ A;  2BJW A;  2DHY A;  2DZL A;  3GO8 A;  2X49 A;  1NSF A;  2C9C A;  3QYE A;  3NBI A;  3SHG B;  2D7G A;  3KOY E;  1GO5 A;  1NY5 A;  1YUB A;  4OW0 A;  4L78 A;  2XH9 A;  3GLI B;  1NY6 A;  2LVO C;  4QHT A;  1PGY A;  5IWA M;  3HHY A;  5EP4 A;  3TQS A;  3R8F A;  3SC3 A;  2DZO B;  4PDI A;  3HX3 A;  3T1Y M;  2L4E A;  1HNZ M;  4YY3 M;  3GQ3 A;  4LFA M;  1Z5B A;  1TGU A;  1Q3B A;  3SMP A;  4L8R C;  3SHF A;  4LFB M;  4FD2 A;  3QYB A;  5KQD A;  4KOD A;  2HWJ A;  2N35 A;  1FNN A;  2LHG A;  2XEP A;  1GVN A;  4IIW A;  3I4Y A;  3FTE A;  4K0K M;  5KPT A;  3U6L A;  2UXC M;  4LF6 M;  3L28 A;  2KW0 A;  2R46 A;  3HU3 A;  1C7Y A;  1N75 A;  1R6B X;  1UFZ A;  1ZMU A;  2R0I A;  2KNV A;  4I8O A;  1A5T A;  3F92 A;  2WSF F;  3B7Z A;  2DWL A;  2LBC A;  1Q39 A;  2Z4R A;  2DAG A;  4MGY E;  3ZCB B;  3GLG A;  4LG2 A;  3KS8 A;  1PJS A;  1QZM A;  1IN4 A;  4B7H A;  1XC8 A;  2BJV A;  4GEW A;  3MJ5 A;  1WXQ A;  3U61 A;  2CV0 A;  5LMN M;  1HR0 M;  1SXJ A;  1R4G A;  1YLA A;  2DAI A;  2F5P A;  1VEJ A;  1QZE A;  4G4Q A;  2ZM6 M;  1IBL M;  3KOZ E;  3GLH A;  3LQQ A;  1G8P A;  4JYA M;  2NQ8 C;  4TUW A;  1KYI A;  1WJ7 A;  1XXH E;  2KZS A;  3HHW A;  4FWD A;  1PRB A;  3PNV A;  1G41 A;  5EXS A;  5L8R F;  2DI0 A;  1T6O A;  5FTN A;  3E46 A;  5KQ8 A;  1Y8G A;  2Z7J A;  4LRS A;  2Y0T A;  4W5W A;  2EA0 A;  1OIZ A;  3FTD A;  4G4N A;  4GKJ M;  3HY5 A;  4BB9 A;  4KT0 F;  5FLX S;  3A98 B;  4PD2 A;  2MJ5 B;  3KFU G;  4Y28 F;  3KS4 A;  2I7P A;  4LGY A;  3W67 A;  2K0B X;  2QBY B;  4JV5 M;  3CF6 E;  3AKZ A;  4D82 A;  3W0L B;  2MR9 A;  3I01 M;  2Z8Y M;  4JN6 A;  3TWM A;  4LF5 M;  4CHT B;  1GJS A;  3AV0 A;  2CE7 A;  3SAR A;  1L1T A;  3JR5 A;  1HNW M;  4LJ7 A;  3HJS A;  1TF0 B;  3J27 B;  1R2Y A;  3WHK A;  1EFU B;  2F5N A;  2FS1 A;  4MGK E;  1T3T A;  2R18 A;  4GRI A;  4MM3 B;  4B7F A;  3L2A A;  2Q2E B;  3FRI A;  1V92 A;  4IBI A;  5FTJ A;  4PDG A;  5KPR A;  1XMO M;  1LTM A;  2CP8 A;  2ERC A;  3GPP A;  1IY0 A;  1LV7 A;  3J7B A;  2F5Q A;  3FUV A;  1IY1 A;  4AW4 A;  3JAM S;  2C98 A;  4OVZ A;  4G4R A;  1JR3 A;  1DGG A;  2X8A A;  1QAO A;  4BBA A;  4LY6 A;  1DGF A;  4Z6Y A;  4P16 A;  3LVW A;  3UMM A;  3UGJ A;  3GLF E;  2R45 A;  1QAM A;  1N34 M;  2V6Z M;  2XFT A;  2F5O A;  4CIS A;  2C9O A;  2LHC A;  2LXE A;  3KOW E;  3K92 A;  5C1B A;  3FYC A;  3LMM A;  2KXE A;  2LH0 A;  3B7N A;  2HAK A;  2UUB M;  1NHW C;  3C3E A;  2ZAN A;  3AOE C;  2DWM A;  2CUZ A;  2K47 A;  5EXP A;  3SBJ A;  2QCU A;  3U6P A;  4L4U A;  3U61 B;  2L7I A;  5IZ7 D;  3KVW A;  1D0K A;  1QAN A;  2R6F A;  2VQF M;  2DWN A;  4DV1 M;  3DFZ A;  3DZD A;  5JI2 E;  2ZTD A;  3KW6 A;  2APL A;  2GQF A;  4FCV A;  4R71 A;  1OAI A;  3D8B A;  2XLJ A;  1N32 M;  4M9Z A;  3C9P A;  1OIP A;  2W82 A;  4AI6 A;  3HU2 A;  5DYG A;  1L1Z A;  2DNA A;  4I81 A;  1W5S A;  4G6Z A;  3CF2 A;  4GIP A;  2XFS A;  3ILK A;  2QBY A;  1JQJ C;  3HZJ A;  5BPV A;  4B3T M;  1J09 A;  1QDT A;  2CWB A;  4KLN A;  2QPA A;  1L8Q A;  1TDH A;  5IT9 S;  4I4L A;  1E32 A;  2CHV A;  2L09 A;  4IBE A;  1I4W A;  4JI6 M;  3I04 M;  4GC5 A;  1DGH B;  3IEC A;  4DR6 M;  2G8L A;  3Q8G A;  2L4F A;  2CEA A;  3GPY A;  1EIJ A;  4F2L A;  1HQY E;  2UU9 M;  2G3Q A;  2VQE M;  2R44 A;  1MX0 A;  5C18 A;  3JR4 A;  3E21 A;  3LCV B;  2DZN B;  1G71 A;  3EIH A; 
#chains in the Genus database with same CATH homology
 3U6D A;  4X64 M;  1NNU C;  4LJ9 A;  2H1R A;  4MGZ E;  5ITQ A;  3VDP A;  1IN7 A;  4AG5 A;  2HCB A;  1J7K A;  2M60 A;  2D7H A;  3GRY A;  3MHV C;  4DV7 M;  1YSY A;  3A45 A;  2DWZ B;  4LFC M;  2I7N A;  4IJF A;  1Z5A A;  4LF8 M;  5KO3 A;  4PCZ A;  1UM8 A;  2FE8 A;  1IY2 A;  4DV5 M;  2DVW B;  2RKO A;  1TH3 A;  4OVZ B;  4R3D A;  3QAU A;  1Q3C A;  2O5R A;  1XXH B;  3PFI A;  1IXR C;  4RF1 A;  3QWL A;  4IBG A;  3SMS A;  4JI4 M;  3PVS A;  2YNM D;  4MGI E;  2UXD M;  4JI8 M;  2C96 A;  3K2L A;  2BNK A;  3SYL A;  3J81 S;  5BR8 M;  4HL4 A;  2KRU A;  4FVM A;  1L2D A;  1GL6 A;  2DXI A;  3A42 A;  4JXJ A;  2ZBK B;  1IM2 A;  3AJI B;  4NSO B;  4GMQ A;  3M7G A;  3U6E A;  4M9S A;  1XNQ M;  1GLN A;  4G4O A;  4FW9 A;  1G4A E;  5FSW A;  3GP1 A;  2UUC M;  3M6A A;  4AG6 A;  2R62 A;  1HNX M;  5E26 A;  2LNH C;  3K1J A;  1DGH A;  3H4M A;  3HWS A;  1TH2 A;  2V1U A;  1G59 A;  4LZJ A;  4GIT A;  3KXE C;  3L25 A;  2UXB M;  1NJG A;  3VKH A;  4DV6 M;  3VKG A;  1L2C A;  2LWX A;  3GRV A;  3PNY A;  7CAT A;  3TWL A;  4DV2 M;  1GKI A;  4JI5 M;  4X65 M;  5F3W A;  4LF9 M;  2XGN A;  3KP1 E;  3J80 S;  1E9S A;  4GC9 A;  3HKP A;  5EJC A;  2ZAM A;  1S3S A;  4MGH A;  4JI3 M;  4NRV A;  2CFO A;  4WW0 A;  3KDS E;  1XHB A;  3DOA A;  2EO2 A;  4OX9 M;  2R65 A;  1XMQ M;  4LZZ A;  1XWI A;  4DUY M;  2CV1 A;  3GQ4 A;  2AHM A;  1TDZ A;  1HT2 E;  3SAV A;  3J7A S;  4JI0 M;  4X66 M;  2G5G X;  4DR1 M;  3RGS A;  2P5T A;  3DA1 A;  1K82 A;  3U6C A;  1XXH A;  4ITQ A;  2C99 A;  2JA2 A;  1X37 A;  4MH0 E;  2V1C A;  1IXZ A;  4DR5 M;  3SAW A;  4QOS A;  2KA6 B;  4IBC A;  3VK8 A;  4DR4 M;  2YFQ A;  2M5Z A;  1I94 M;  2J7O A;  1E9R A;  2X4A A;  3FYD A;  2XZF A;  5E6J A;  3U60 B;  3E4R A;  3KSX A;  3LQR A;  4PT5 A;  2CHQ A;  2XSZ D;  2ZAO A;  3VFD A;  4EIW A;  1N33 M;  5EXT A;  4NXM M;  1XNR M;  4FCT A;  4D81 A;  3HHZ A;  1EE8 A;  3WHL A;  5ITX A;  4XGI A;  4LJ8 A;  3T38 A;  4LF4 M;  2F4V M;  2L6O A;  4NSR A;  3GPU A;  1J5E M;  2L7H A;  3J2P B;  1Z6T A;  5FTK A;  4BLC A;  2UUA M;  1VDD A;  3HJQ A;  3I51 A;  4QHS A;  1PJJ A;  1DO2 A;  2VII A;  4FWG A;  1QQW A;  3FD9 A;  4Z8X A;  1NHG C;  2E5L M;  4IJE A;  1QVR A;  3R9X B;  1DGB A;  4DR2 M;  4I5S A;  2OPF A;  4JI7 M;  1NVM A;  1DO0 A;  2CHG A;  2FFJ A;  3T1H M;  3FUX A;  4FCW A;  4GH9 A;  4QNR A;  3CTW B;  3GLF A;  2EUC A;  1L2B A;  2YR0 A;  4QNM A;  5EP1 A;  4L16 A;  3GRR A;  3IG5 A;  1OFH A;  3Q8X A;  3NWL A;  3KSJ A;  1SXJ E;  4B3M M;  4QOZ C;  4LJ6 A;  2R4E A;  3SYK A;  3C58 A;  5KPZ A;  1ORY B;  4AKH A;  4AKG A;  2Z4S A;  3ZH9 B;  3GPX A;  3M0E A;  4IBD A;  1Z59 A;  4AKI A;  4MB7 A;  2A5Y B;  1OFI A;  4WUR A;  5FTL A;  3AFH A;  4NL4 H;  4LJ4 A;  3U60 A;  4CGY B;  2KEB A;  3K8Z A;  4A3V B;  4AZF A;  3A46 A;  3AOG A;  5EXX A;  2RGO A;  1TH4 A;  3SFZ A;  5ITR A;  5EQT A;  2J7N A;  3VLF B;  1PJI A;  3FUU A;  2FOI C;  3TWK A;  3U6O A;  3AL0 C;  2KRK A;  1SXJ D;  4XBO A;  3AOE A;  3U5Z B;  3D8L A;  3W0F A;  4GKK M;  1FJG M;  5IRE B;  2YQZ A;  3FKE A;  4YHH M;  1GL7 A;  4RF0 A;  1QYR A;  3GRU A;  3B9P A;  3VK7 A;  1IXS B;  3PXG A;  4NRW A;  1IQP A;  1NJF A;  4KO8 A;  3RE8 A;  4JI1 M;  4LF7 M;  1NNJ A;  3RFW A;  4B7G A;  4LGM A;  4DR7 M;  2XF3 A;  1IN5 A;  3CF0 A;  1ZAE A;  1ZQ9 A;  1MU5 A;  2QEN A;  4LJ5 A;  1K3W A;  2C5R A;  4AQY M;  1G3I A;  3ZC7 B;  3L29 A;  5EP3 A;  3OTO M;  5LMU M;  4NOO B;  3SAU A;  1R2Z A;  3U6S A;  3GLF B;  3HGI A;  3U6M A;  4LJA A;  2CV2 A;  4LCB A;  4B08 A;  2OQ4 A;  4HLQ A;  3SAS A;  1R7R A;  3UK6 A;  4R7G A;  3GLI A;  4GHA A;  3FTF A;  8CAT A;  3RGP A;  1HQC A;  5DYI A;  3E9S A;  4D80 A;  3KOX E;  5ITX E;  3BOS A;  1QAQ A;  1D2N A;  4L15 A;  4X62 M;  2Y21 A;  2R4J A;  5ITU A;  1JR3 D;  1KFV A;  4FWH A;  3HHX A;  3L27 A;  1N77 A;  4IBB A;  1IBM M;  2HL7 A;  4JI2 M;  2XZU A;  4IBF A;  1IBK M;  3SAT A;  3U5Z A;  1IN6 A;  2DHR A;  1YE9 A;  3U6Q A;  2Y0Q A;  1OJL A;  4RNA A;  3IG8 A;  1KSF X;  4M9X A;  3UZU A;  1K3X A;  1H6U A;  2FNA A;  3THG A;  2RGH A;  3EIE A;  3UJN A;  1E94 E;  5ITY A;  2KZU A;  4DUZ M;  1C1K A;  4IBJ A;  1N78 A;  4NXN M;  4DV3 M;  3TE6 A;  4M0W A;  5FTM A;  1N36 M;  1IN8 A;  3KP0 E;  1SXJ C;  4II7 A;  2Y20 A;  1PM5 A;  2D7E A;  2HHH M;  2HKJ A;  3LVV A;  3GQ5 A;  3FUW A;  3FUT A;  4LRT A;  2XSZ A;  2F5S A;  5A2Q S;  1Z5C A;  5ITT A;  2Z3X A;  3GLG B;  4OU7 A;  4KHP M;  4B3S M;  4DV0 M;  3TL4 X;  4ZPX A;  3HJ8 A;  5JI3 E;  4S12 A;  1SXJ B;  3FTC A;  5DNY A;  3GLH B;  1W5T A;  3TPZ A;  5H37 D;  5GKN A;  4IBK A;  5EP2 A;  4DR3 M;  4DV4 M;  3VDU A;  3I4V A;  3L26 A;  4GHL A;  4M0D A;  2QZ4 A;  3MK6 A;  2QP9 X;  4B3R M;  3T15 A;  3HU1 A;  1HT1 E;  4REZ A;  2BJW A;  3GO8 A;  2X49 A;  1NSF A;  2C9C A;  3NBI A;  3SHG B;  2D7G A;  3KOY E;  1NY5 A;  1YUB A;  4OW0 A;  4L78 A;  2XH9 A;  3GLI B;  1NY6 A;  4QHT A;  5IWA M;  3HHY A;  5EP4 A;  3TQS A;  3R8F A;  3SC3 A;  2DZO B;  4PDI A;  3T1Y M;  1HNZ M;  4YY3 M;  3GQ3 A;  4LFA M;  1Z5B A;  1TGU A;  1Q3B A;  3SMP A;  4L8R C;  3SHF A;  4LFB M;  4FD2 A;  5KQD A;  4KOD A;  1FNN A;  2XEP A;  1GVN A;  4IIW A;  3I4Y A;  3FTE A;  4K0K M;  5KPT A;  3U6L A;  2UXC M;  4LF6 M;  3L28 A;  2KW0 A;  2R46 A;  3HU3 A;  1N75 A;  1R6B X;  4I8O A;  2DWL A;  3KS8 A;  1Q39 A;  2Z4R A;  4MGY E;  3ZCB B;  3GLG A;  4LG2 A;  1QZM A;  1IN4 A;  4B7H A;  1XC8 A;  2BJV A;  3MJ5 A;  1WXQ A;  3U61 A;  2CV0 A;  5LMN M;  1HR0 M;  1SXJ A;  2F5P A;  4G4Q A;  2ZM6 M;  1IBL M;  3KOZ E;  3GLH A;  3LQQ A;  1G8P A;  4JYA M;  2NQ8 C;  4TUW A;  1KYI A;  3HHW A;  2KZS A;  4FWD A;  3PNV A;  5EXS A;  1G41 A;  5FTN A;  5KQ8 A;  4LRS A;  2Z7J A;  2Y0T A;  4W5W A;  2EA0 A;  4G4N A;  3FTD A;  4GKJ M;  4BB9 A;  5FLX S;  3A98 B;  4PD2 A;  3KFU G;  3KS4 A;  2I7P A;  4LGY A;  2QBY B;  4JV5 M;  3CF6 E;  3AKZ A;  4D82 A;  3W0L B;  3TWM A;  4JN6 A;  4LF5 M;  4CHT B;  3AV0 A;  2CE7 A;  3SAR A;  1L1T A;  3JR5 A;  1HNW M;  4LJ7 A;  3HJS A;  3J27 B;  1R2Y A;  3WHK A;  2F5N A;  4MGK E;  1T3T A;  2R18 A;  4GRI A;  4MM3 B;  4B7F A;  3L2A A;  2Q2E B;  4PDG A;  5FTJ A;  4IBI A;  5KPR A;  1XMO M;  3GPP A;  2ERC A;  1IY0 A;  1LV7 A;  3J7B A;  2F5Q A;  3FUV A;  1IY1 A;  4AW4 A;  3JAM S;  2C98 A;  4OVZ A;  4G4R A;  1JR3 A;  1DGG A;  2X8A A;  1QAO A;  4BBA A;  4LY6 A;  1DGF A;  4Z6Y A;  4P16 A;  3LVW A;  3UMM A;  3UGJ A;  2R45 A;  1QAM A;  1N34 M;  2V6Z M;  2XFT A;  2F5O A;  4CIS A;  2C9O A;  2LXE A;  3KOW E;  3K92 A;  5C1B A;  3FYC A;  3LMM A;  2KXE A;  2LH0 A;  2UUB M;  1NHW C;  2ZAN A;  3AOE C;  2DWM A;  2CUZ A;  2K47 A;  5EXP A;  3SBJ A;  2QCU A;  3U6P A;  4L4U A;  3U61 B;  2L7I A;  5IZ7 D;  3KVW A;  1QAN A;  2VQF M;  2DWN A;  4DV1 M;  3DFZ A;  3DZD A;  5JI2 E;  3KW6 A;  1N32 M;  4FCV A;  2XLJ A;  3D8B A;  4M9Z A;  2W82 A;  4AI6 A;  3HU2 A;  5DYG A;  1L1Z A;  4I81 A;  1W5S A;  4G6Z A;  3CF2 A;  4GIP A;  2XFS A;  3ILK A;  2QBY A;  1JQJ C;  5BPV A;  4B3T M;  1J09 A;  4KLN A;  2QPA A;  1L8Q A;  1TDH A;  5IT9 S;  4I4L A;  1E32 A;  2CHV A;  2L09 A;  4IBE A;  1I4W A;  4JI6 M;  4DR6 M;  4GC5 A;  1DGH B;  2G8L A;  3GPY A;  2CEA A;  1HQY E;  2UU9 M;  2VQE M;  3JR4 A;  1MX0 A;  5C18 A;  2DZN B;  3EIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...