4AQYM

Structure of ribosome-apramycin complexes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 25
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4aqyM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4aqyM02
4LF7M 1Z5BA 4DV3M 4DR3M 1XMQM 4DUYM 2F5QA 2F5OA 3SATA 5ITXE 5IWAM 5BR8M 5ITXA 3GP1A 2OQ4A 4DV6M 1FJGM 3GPXA 2UUCM 3SARA 2XZUA 2F5NA 4AQYM 3OTOM 4B3MM 4YHHM 1R2ZA 1MX0A 1Q39A 1K82A 1L1ZA 3GQ5A 5ITQA 1Q3CA 3A46A 4DR7M 4GKJM 1Z5CA 5ITRA 2Q2EB 4G4QA 5FLXS 2E5LM 2XZFA 4LF6M 4JI8M 2UXBM 3U6MA 1N34M 4JI1M 2VQEM 4LFAM 3DOAA 3GPYA 1KFVA 4PDGA 3U6OA 2UXDM 4JI0M 1IBMM 3SAWA 4X66M 3VK8A 2EA0A 4LF4M 4DUZM 4JI7M 1PJIA 4B3TM 3W0FA 4YY3M 4NXNM 1J5EM 3U6EA 4JI4M 2F5PA 4B3SM 1N32M 1HR0M 3GO8A 1XNRM 1L1TA 2F5SA 4NRVA 4JI5M 3SBJA 2F4VM 3TWKA 2HHHM 4DR1M 3U6QA 1HNWM 2UXCM 4MB7A 3U6PA 3SAUA 3VK7A 1PJJA 1N33M 3C58A 4LF8M 3SAVA 1MU5A 4PCZA 5LMNM 4DV1M 4X62M 4B3RM 2UUBM 4JV5M 4DR2M 4LFBM 1TDHA 2ZM6M 4LF5M 3TWLA 3TWMA 1I94M 4JYAM 1IBKM 3JAMS 5A2QS 4K0KM 3GPPA 3GQ4A 3A42A 3JR4A 2UUAM 2UU9M 4NRWA 3U6LA 4OX9M 4DR5M 1Q3BA 4G4NA 2HKJA 3U6DA 4NXMM 4DV5M 3U6CA 3U6SA 4GKKM 4DV0M 1EE8A 3J81S 4JI6M 4PD2A 1HNZM 1L2CA 1TDZA 3SASA 5IT9S 3A45A 4X64M 3T1HM 1HNXM 4G4OA 1K3WA 4KHPM 4DV4M 4G4RA 1XMOM 1L2BA 1L2DA 1R2YA 1XC8A 3JR5A 3T1YM 4DR4M 1XNQM 4JI3M 5ITYA 4LFCM 1PM5A 5ITUA 4DR6M 2OPFA 5ITTA 1K3XA 3J80S 4CISA 3GQ3A 4DV2M 1NNJA 1IBLM 4ITQA 2VQFM 3J7AS 4JI2M 4LF9M 5LMUM 1N36M 4DV7M 4PDIA 2ZBKB 3GPUA 1Z59A 1Z5AA 4X65M
chains in the Genus database with same CATH superfamily
3VKGA 4FD2A 4DV3M 1GJTA 2CWBA 1N78A 1TF0B 2QCUA 1QAQA 2F5QA 5EXPA 3AKZA 1SXJB 1ZQ9A 1QANA 5KO3A 1NJGA 1UFZA 4FWHA 3GP1A 2QBYB 2LVAA 4LGYA 1RU3A 3IHPA 2MROB 1DO2A 2C96A 1H6UA 4B3MM 3ZQJA 5KQDA 3CF2A 3KP1E 4CIZA 1LV7A 2QPAA 3F92A 1IQPA 3GRYA 2H5XA 1SXJD 4FWDA 1GVNA 1Z5CA 2VF7A 2M60A 2XSZD 2DWNA 2D7HA 4G4QA 2ZTDA 2XZFA 4BB9A 5DYIA 4MGZE 2UXBM 4BBAA 1KYIA 3HHWA 3HX3A 4LFAM 3AOGA 3SHGB 3U61B 1DO0A 3K92A 3T38A 1KFVA 3TL4X 2UXDM 4FCVA 1SXJC 3I01M 1IBMM 3VK8A 1GL6A 4DUZM 5FSWA 5FTLA 4B3TM 4OVZA 3FYDA 5EP3A 1G3IA 3AV0A 3W0FA 8CATA 4JI4M 3UZUA 3B7ZA 2DWMA 1NY5A 3GLFA 1QZEA 2R4JA 2DXIA 3ILKA 2JY5A 3KXEC 4NRVA 3A98B 4NSOB 4NL4H 3FRIA 3U61A 4AKIA 2DAKA 2LVOC 2YFQA 1IFYA 2UXCM 1HQYE 1NY6A 3E9SA 4MB7A 1J09A 1AIPC 3VK7A 1N33M 3AFHA 3C58A 1GKIA 4WP2A 3I51A 1OFHA 1OJLA 2JY7A 2M5ZA 2MR9A 2RGHA 4LJ9A 2K9DA 2ZTCA 1VQ1A 3FUXA 4I8OA 1TDHA 1I4WA 1V92A 4LF5M 2Y21A 2Z7JA 1OQYA 3TWLA 2R18A 3ZH9B 5F3WA 2QZ4A 3FTFA 1HQCA 4K0KM 3GPPA 4LJAA 3U60B 3B74A 2XFTA 3KP0E 3GLIA 5EJCA 1WJ7A 4IBBA 4I4LA 3BBZA 1GLNA 1Q3BA 3M0EA 4DR5M 2CV1A 4M0WA 4IBEA 1J7KA 4DV5M 3U6CA 4IBFA 2WSEF 3WHKA 5E26A 4GKKM 3GLHE 4S12A 5FTNA 4AG5A 1DV0A 2DWLA 2L4FA 3RFWA 1CUKA 3KOWE 5EQTA 3W68A 2KDLA 4D80A 1HNXM 3LVVA 2CHQA 2DNAA 2OOBA 1T43A 2YNMD 4FWGA 4GH9A 2YR0A 1TTEA 3M7GA 4LCBA 3KOXE 4G4RA 1L2DA 3HKPA 2Y0TA 4GMQA 1XC8A 3JR5A 1R2YA 4MGHA 2J7NA 3HY5A 1IN5A 2AHMA 2I7PA 1XNQM 3GRVA 4QHTA 2KNVA 2OPFA 3RGSA 5ITTA 3J80S 3GQ3A 1IBLM 1HT2E 2JP7A 3HZJA 3LCVB 2X49A 4G6ZA 3E46A 2C5RA 1NV8A 1ZMUA 2Z4RA 3SAUA 2JZ0A 3IG8A 4REZA 4UN2B 1XHBA 4QOZC 4B7GA 4D81A 3J7BA 1Z5BA 1NJFA 1VEGA 4LJ6A 4AZFA 1R6BX 5EXXA 2RKOA 3V76A 3L2AA 2L6OA 1XMQM 2EJSA 4DUYM 1HT1E 3AJIB 3FYCA 4XBOA 4P16A 4B7FA 4IIWA 3U60A 1G8PA 3C9PA 4IBGA 5IWAM 5BR8M 1FJGM 3GPXA 3SARA 4L6V6 1WGLA 1VDDA 2XZUA 3J2PB 5KPRA 4FVMA 3OTOM 1YE9A 1R2ZA 1MX0A 7CATA 1YSYA 4GHAA 4FCTA 2KZSA 2D7GA 4Y28F 2J7OA 3FKEA 2B3TA 1EFUB 5ITQA 3CTWB 1Q3CA 2C99A 1OAOC 3HHZA 2DENA 3PNYA 1NVMA 3NBXX 3KSXA 2K0BX 5FLXS 2R0IA 2MH8A 4LF6M 4JN6A 3GLHA 1N34M 4NSRA 4MGKE 1SG9A 2RGOA 3UJNA 1G71A 2R6FA 2MGWA 3U6OA 1IY2A 1IM2A 3FUVA 3K9PA 4AW4A 3SAWA 5FTMA 1PJQA 2DWZB 2LNHC 4M0DA 3TQSA 3KVWA 3PNVA 3L29A 1ZV1A 1PJIA 4BLCA 4NXNM 1J5EM 3HU2A 2BJVA 2F5PA 1KSFX 2Z3XA 1LTMA 4OU7A 5H37D 3GO8A 3GLFE 4MH0E 2LHGA 3B7NA 3U5ZB 3L26A 1JR3A 3PVSA 3W0LB 3SC3A 4NOOB 4LJ5A 2RRUA 3MMPA 4CJ6A 4LG2A 1QUTA 3KDSE 2K47A 2G5GX 3HGIA 4IBKA 1TH4A 3VFDA 1PRBA 1WR1B 3SAVA 3RGPA 4X62M 4R71A 4B3RM 2CRUA 2GNOA 3ZC7B 3K1JA 2FH0A 3QYBA 2DAEA 4LFBM 1TR8A 3KS4A 3E4RA 4LRSA 4DBGB 3TWMA 1I94M 4JYAM 2QBYA 2CEAA 2FFJA 3SYKA 3R9XB 5BPVA 4KODA 3GQ4A 1AUAA 3J27B 2A5YB 2OOAA 2WSFF 4A3VB 2VDBB 4G4NA 3U6DA 4NXMM 4GC5A 1IXSB 2FNAA 1ZMVA 3DZDA 2DZOB 2HAKA 1PGYA 1E9RA 4FCWA 4I5SA 3J81S 4PD2A 4LJ8A 5IT9S 4GC9A 2DAMA 3A45A 4L4UA 4QHSA 3HHXA 3T1HM 1R5LA 3GLIB 1F4IA 4LZJA 2WSCF 1K3WA 3KSJA 3KFUG 3FD9A 1YUBA 2XEPA 1SXJE 1JR3D 2L7HA 1QDRA 1TH3A 5ITUA 1S3SA 3AOEC 4IBDA 3K9OA 5E6JA 3L25A 3H4JA 3VLFB 4DR6M 4DV2M 3GLHB 4ITQA 1IXZA 2CUZA 5LMUM 1V33A 1WHCA 5EP2A 4DV7M 4PDIA 3I4VA 3WHLA 2OO9A 1IXRC 1D2NA 3UGJA 1Z59A 3GPUA 4X65M 2G3QA 4LF7M 4Z6YA 2V6ZM 4OW0A 3Q8XA 2JY6B 4B7HA 2QHOB 3SATA 2KZUA 3SMSA 5ITXE 1DGHB 2Z8YM 3LVWA 5ITXA 4DV6M 5KPTA 5KQ8A 1R7RA 3NWLA 3L28A 3LQRA 2LBCA 2F5NA 4AQYM 3NBIA 2JUJA 1WIVA 2Y20A 1GL7A 4L15A 2FS1A 3UK6A 1K82A 2C98A 2KA6B 3C3DA 2XSZA 2JA2A 1IXSA 5JI3E 3GQ5A 1JB0F 2QSFX 3MK6A 2MJ5B 2N35A 1G4AE 1D0KA 1VDLA 2KRUA 3HWSA 4D82A 3A46A 4DR7M 2JXNA 2XH9A 2BWEA 2Q2EB 3MHVC 3BOSA 3QWLA 1XXHE 5FTKA 1G59A 4F2LA 1PJSA 4JI1M 2KHHA 3GPYA 3FTDA 3K8ZA 2NQ8C 1DGHA 1NHWC 4JI0M 4X66M 3MJ5A 3QAUA 4FW9A 2I7NA 1YLAA 3GRRA 3W67A 3VKHA 3B7QA 3KOYE 4YY3M 1Z6TA 1IN6A 4MGIE 3U6EA 1EIJA 4B3SM 1N32M 2LXEA 1E94E 2HL7A 5IREB 2JZ1A 4LJ4A 1XNRM 1GJSA 2F5SA 2QP9X 3K2LA 4M9ZA 2L09A 4JI5M 2HHHM 4IBIA 4B08A 4DR1M 3U6QA 2CE7A 4MGYE 2R46A 3FE3A 3HU3A 4PCZA 5LMNM 2APLA 4L78A 3KS8A 1TGUA 2UUBM 4JV5M 2O01F 4DR2M 2CHVA 4WW0A 3LMMA 1XWIA 3SHFA 4AKGA 2BJWA 2DZLA 1IBKM 3HJ8A 4IBJA 5A2QS 2Y0QA 1QZMA 3VDUA 2J5YA 2C9CA 2X4AA 2XGNA 3JR4A 2UU9M 4GEWA 4NRWA 3U6LA 1QVRA 1ZMWA 2HKJA 4L8RC 1UM8A 4XK8F 4RF0A 3B9PA 1DGBA 4MM3B 4RKUF 2ZANA 1OIZA 4GITA 4Z8XA 2JNHA 3BXWA 2XFSA 4KT0F 1L2CA 4QNRA 1MN3A 1T6OA 2KXEA 1GO5A 4X64M 2L7IA 3CGWA 1OKSA 2GQFA 2VF8A 4KHPM 2H1RA 2LVQD 3DA1A 4GHLA 4DV4M 1XMOM 4LZZA 2LVNC 2LHCA 3T1YM 1Y8GA 1HJPA 1D0LA 4HL4A 2EKKA 4JI3M 2HCBA 1PM5A 1QDTA 2FOIC 2W82A 1G41A 3I4YA 4LGMA 3T6PA 3GLGE 2P5TA 3SMPA 1C1KA 1QUSA 2EKFA 2O25A 2EUCA 2V1UA 4CISA 1IY0A 1W5TA 2VQFM 4JI2M 3EIEA 3TE6A 1N36M 3RE8A 4LJ7A 4LRTA 1NHGC 5EXSA 4RNAA 5EP1A 1Z5AA 2DVWB 4II7A 3FUWA 3AOEA 2YQZA 1DGFA 2D7EA 2HWJA 3LCUA 3ZCBB 1N75A 4DR3M 2QNJA 2KNZA 3HJQA 1VEJA 2JY8A 3THGA 2F5OA 1PJTA 2CFOA 1MJGM 4NC6A 4ZPXA 2R62A 2OQ4A 2R44A 4PT5A 3R8FA 2UUCM 3D8LA 4M9SA 5EXTA 3TPZA 1E32A 2DHRA 1IN4A 2BNKA 2L4EA 4QOSA 4YHHM 4GRIA 1Q39A 2KNAA 2LWXA 1L1ZA 4CHTB 1XXHB 3SFZA 4XGIA 2ZAOA 3VDPA 3FTEA 4LY6A 2DI0A 3SYLA 4GKJM 4TUWA 1XXHA 2L2DA 5ITRA 2X8AA 3DFZA 3GLFB 3I04M 2LH0A 2E5LM 4JI8M 3EIHA 5C18A 3U6MA 1V34A 2VQEM 3DOAA 4PDGA 4M9XA 1T3TA 2DKLA 4OVZB 2WZJA 1WGNA 3FRHA 2EA0A 2CHGA 2JWSA 4LF4M 2DZNB 4JI7M 4KO8A 3CF0A 3GLGA 3FUUA 2KW0A 1HR0M 3T15A 1L1TA 5DYGA 4R3DA 1X37A 3KW6A 3PFIA 4R7GA 3SBJA 1NNUC 3TWKA 1L8QA 2F4VM 2DAGA 3L27A 1Q02A 1WXQA 3FUTA 3H4MA 4RF1A 1HNWM 3Q8GA 2C9OA 3B89A 3U6PA 4QNMA 1JR3E 2XF3A 1PJJA 4IBCA 4CGYB 2XLJA 4LF8M 1OIPA 3IECA 5DFLA 1MU5A 4DV1M 1ORYB 1E9SA 5L8RF 1OTRA 1R4GA 2K6BA 4HLQA 1A5TA 1D0MA 2Z4SA 5C1BA 2ZM6M 4Q7JA 1JQJC 2LTUA 4EIWA 5EP4A 4AG6A 3GRUA 5IZ7D 5GKNA 4HEOA 3JAMS 1QAMA 3D8BA 5DNYA 2R45A 3GLIE 4G3OA 1GABA 1ZAEA 2UUAM 3A42A 1FNNA 1BVSA 2DHYA 3HU1A 4L16A 1QAOA 4OX9M 1TH2A 2VIIA 2KEBA 4AKHA 1IN7A 3LW5F 2DAIA 1OAIA 3IG5A 4F1IA 1C7YA 3U6SA 1QYRA 3E21A 2G8LA 3PXGA 4IJFA 3UMMA 2QQ8A 1N77A 3AL0C 1QQWA 2ZAMA 1EE8A 4W5WA 4DV0M 2R4EA 1P3QQ 1VEKA 2CP8A 1HNZM 2CV2A 1TDZA 3SASA 4JI6M 2ERCA 3CF6E 3HJSA 3GLGB 1W5SA 1NV9A 3M6AA 3KOZE 4G4OA 1DGGA 3HHYA 1SXJA 2QENA 1IN8A 1L2BA 1XB2B 2O5RA 4IJEA 4DR4M 2R65A 4ANRA 5ITYA 4LFCM 4AI6A 2CV0A 4KLNA 3FTCA 1K3XA 2BWBA 4JXJA 1NO1A 3U5ZA 1NNJA 3J7AS 4GIPA 1IY1A 5FTJA 2EO2A 5KPZA 4LF9M 1NSFA 4I81A 4P17A 4WURA 3QYEA 2V1CA 2KRKA 1VG5A 2FE8A 5JI2E 3LQQA 2LVPC 2ZBKB 1OFIA 3C3EA
chains in the Genus database with same CATH topology
3VKGA 4FD2A 4DV3M 1N78A 2QCUA 1QAQA 2F5QA 5EXPA 3AKZA 1SXJB 1ZQ9A 1QANA 5KO3A 1NJGA 4FWHA 3GP1A 2QBYB 4LGYA 1DO2A 2C96A 1H6UA 4B3MM 5KQDA 3CF2A 3KP1E 1LV7A 2QPAA 1IQPA 3GRYA 1SXJD 4FWDA 1GVNA 1Z5CA 2M60A 2XSZD 2DWNA 2D7HA 4G4QA 2XZFA 4BB9A 5DYIA 4MGZE 2UXBM 4BBAA 1KYIA 3HHWA 4LFAM 3SHGB 3AOGA 3U61B 1DO0A 3K92A 3T38A 1KFVA 3TL4X 2UXDM 4FCVA 1SXJC 1IBMM 3VK8A 1GL6A 4DUZM 5FSWA 5FTLA 4B3TM 4OVZA 3FYDA 5EP3A 1G3IA 3AV0A 3W0FA 8CATA 4JI4M 3UZUA 1NY5A 3GLFA 2R4JA 2DXIA 3ILKA 3KXEC 4NRVA 3A98B 4NSOB 4NL4H 3U61A 4AKIA 2YFQA 2UXCM 1HQYE 1NY6A 3E9SA 4MB7A 1J09A 3VK7A 1N33M 3AFHA 3C58A 1GKIA 3I51A 1OFHA 1OJLA 2M5ZA 2RGHA 4LJ9A 3FUXA 1TDHA 1I4WA 4LF5M 2Y21A 2Z7JA 3TWLA 2R18A 3ZH9B 5F3WA 2QZ4A 1HQCA 4K0KM 3GPPA 4LJAA 3U60B 3KP0E 2XFTA 3GLIA 5EJCA 4IBBA 4I4LA 1GLNA 1Q3BA 3M0EA 4DR5M 2CV1A 4M0WA 4IBEA 1J7KA 4DV5M 3U6CA 4IBFA 3WHKA 5E26A 4GKKM 4S12A 5FTNA 4AG5A 2DWLA 3RFWA 3KOWE 5EQTA 1HNXM 4D80A 3LVVA 2CHQA 4FWGA 2YNMD 4I8OA 4GH9A 4LCBA 2DWMA 3M7GA 2YR0A 1L2DA 4G4RA 3KOXE 3FTFA 3HKPA 2Y0TA 4GMQA 1XC8A 3JR5A 1R2YA 4MGHA 2J7NA 1XNQM 1IN5A 2AHMA 2I7PA 3GRVA 4QHTA 2OPFA 3RGSA 5ITTA 3J80S 3GQ3A 1IBLM 1HT2E 2X49A 4G6ZA 2C5RA 2Z4RA 3SAUA 3IG8A 4REZA 1XHBA 4QOZC 4B7GA 4D81A 3J7BA 1Z5BA 1NJFA 4AZFA 4LJ6A 1R6BX 5EXXA 2RKOA 1XMQM 3L2AA 2L6OA 4DUYM 1HT1E 3AJIB 3FYCA 4XBOA 4P16A 4B7FA 4IIWA 3U60A 1G8PA 5IWAM 4IBGA 5BR8M 1FJGM 3GPXA 3SARA 2XZUA 1VDDA 3J2PB 5KPRA 4FVMA 3OTOM 1YE9A 1R2ZA 1MX0A 7CATA 1YSYA 4GHAA 4FCTA 2KZSA 2D7GA 2J7OA 3FKEA 5ITQA 3CTWB 1Q3CA 2C99A 3HHZA 3PNYA 1NVMA 3KSXA 5FLXS 4LF6M 4JN6A 3GLHA 1N34M 4NSRA 4MGKE 2RGOA 3UJNA 3U6OA 1IY2A 1IM2A 3FUVA 4AW4A 3SAWA 5FTMA 2DWZB 2LNHC 4M0DA 3TQSA 3KVWA 3PNVA 3L29A 1PJIA 4BLCA 4NXNM 1J5EM 3HU2A 2BJVA 2F5PA 1KSFX 2Z3XA 4OU7A 5H37D 3GO8A 4MH0E 3U5ZB 3L26A 1JR3A 3PVSA 3W0LB 3SC3A 4NOOB 4LJ5A 4LG2A 3KDSE 2K47A 2G5GX 3HGIA 4IBKA 1TH4A 3VFDA 3SAVA 3RGPA 4X62M 4B3RM 3ZC7B 3K1JA 4LFBM 3KS4A 3E4RA 4LRSA 3TWMA 1I94M 4JYAM 2QBYA 2CEAA 2FFJA 3SYKA 3R9XB 5BPVA 4KODA 3GQ4A 3J27B 2A5YB 4A3VB 4G4NA 3U6DA 4NXMM 4GC5A 1IXSB 2FNAA 3DZDA 2DZOB 1E9RA 4FCWA 4I5SA 3J81S 4PD2A 4LJ8A 5IT9S 4GC9A 3A45A 4L4UA 4QHSA 3HHXA 3T1HM 3GLIB 4LZJA 3KFUG 1K3WA 3KSJA 3FD9A 1YUBA 2XEPA 1SXJE 1JR3D 2L7HA 1TH3A 5ITUA 1S3SA 3AOEC 4IBDA 5E6JA 3L25A 4DR6M 3VLFB 4DV2M 3GLHB 4ITQA 1IXZA 2CUZA 5LMUM 5EP2A 4DV7M 4PDIA 3I4VA 3WHLA 1IXRC 3UGJA 1D2NA 3GPUA 1Z59A 4X65M 4LF7M 4Z6YA 2V6ZM 4OW0A 3Q8XA 4B7HA 3SATA 2KZUA 3SMSA 5ITXE 1DGHB 3LVWA 5ITXA 4DV6M 5KPTA 5KQ8A 1R7RA 3NWLA 3L28A 3LQRA 2F5NA 4AQYM 3NBIA 2Y20A 1GL7A 4L15A 3UK6A 1K82A 2C98A 2KA6B 2XSZA 2JA2A 5JI3E 3GQ5A 3MK6A 1G4AE 3A46A 4DR7M 2KRUA 3HWSA 4D82A 2XH9A 2Q2EB 3MHVC 3BOSA 3QWLA 5FTKA 1G59A 4JI1M 3GPYA 3FTDA 3K8ZA 2NQ8C 1DGHA 1NHWC 4JI0M 4X66M 3MJ5A 3QAUA 4FW9A 2I7NA 3GRRA 3VKHA 3KOYE 4YY3M 1Z6TA 1IN6A 4MGIE 3U6EA 4B3SM 1N32M 2LXEA 1E94E 2HL7A 5IREB 1XNRM 4LJ4A 2F5SA 2QP9X 3K2LA 4M9ZA 2L09A 4JI5M 2HHHM 4IBIA 4B08A 4DR1M 3U6QA 2CE7A 4MGYE 2R46A 3HU3A 4PCZA 5LMNM 4L78A 3KS8A 1TGUA 2UUBM 4JV5M 4DR2M 2CHVA 4WW0A 3LMMA 1XWIA 3SHFA 4AKGA 2BJWA 1IBKM 3HJ8A 4IBJA 5A2QS 2Y0QA 1QZMA 3VDUA 2XGNA 2C9CA 2X4AA 3JR4A 2UU9M 4NRWA 3U6LA 1QVRA 4L8RC 2HKJA 1UM8A 4RF0A 3B9PA 1DGBA 4MM3B 2ZANA 4GITA 4Z8XA 2XFSA 1L2CA 4QNRA 2KXEA 4X64M 2L7IA 4KHPM 2H1RA 3DA1A 4GHLA 4DV4M 1XMOM 4LZZA 3T1YM 4HL4A 4JI3M 2HCBA 1PM5A 2FOIC 2W82A 1G41A 3I4YA 4LGMA 2P5TA 3SMPA 1C1KA 2EUCA 2V1UA 4CISA 1IY0A 1W5TA 2VQFM 4JI2M 3EIEA 3TE6A 1N36M 3RE8A 4LJ7A 4LRTA 1NHGC 5EXSA 4RNAA 5EP1A 1Z5AA 2DVWB 4II7A 3FUWA 3AOEA 2YQZA 1DGFA 2D7EA 3ZCBB 1N75A 4DR3M 3HJQA 3THGA 2F5OA 2CFOA 4ZPXA 2R62A 2OQ4A 4PT5A 3R8FA 2UUCM 3D8LA 4M9SA 5EXTA 3TPZA 1E32A 2DHRA 1IN4A 2BNKA 4QOSA 4YHHM 4GRIA 1Q39A 2LWXA 1L1ZA 4CHTB 1XXHB 3SFZA 4XGIA 2ZAOA 3VDPA 3FTEA 4LY6A 3SYLA 4GKJM 4TUWA 1XXHA 5ITRA 2X8AA 3DFZA 3GLFB 2LH0A 2E5LM 4JI8M 3EIHA 5C18A 3U6MA 2VQEM 3DOAA 4PDGA 4M9XA 1T3TA 4OVZB 2EA0A 4LF4M 2CHGA 2DZNB 4JI7M 4KO8A 3CF0A 3GLGA 3FUUA 2KW0A 1HR0M 3T15A 1L1TA 5DYGA 4R3DA 1X37A 3KW6A 3PFIA 4R7GA 3SBJA 1NNUC 3TWKA 1L8QA 2F4VM 3L27A 1WXQA 3FUTA 3H4MA 4RF1A 1HNWM 2C9OA 3U6PA 4QNMA 2XF3A 1PJJA 4IBCA 4CGYB 2XLJA 4LF8M 1MU5A 4DV1M 1ORYB 1E9SA 4HLQA 2Z4SA 5C1BA 2ZM6M 1JQJC 4EIWA 5EP4A 4AG6A 3GRUA 5IZ7D 5GKNA 3JAMS 1QAMA 3D8BA 5DNYA 2R45A 1ZAEA 2UUAM 3A42A 1FNNA 3HU1A 4L16A 1QAOA 4OX9M 1TH2A 2VIIA 2KEBA 4AKHA 1IN7A 3IG5A 3U6SA 1QYRA 2G8LA 3PXGA 4IJFA 3UMMA 1N77A 3AL0C 1QQWA 2ZAMA 1EE8A 4W5WA 4DV0M 2R4EA 4JI6M 1HNZM 2CV2A 3SASA 1TDZA 2ERCA 3CF6E 3HJSA 3GLGB 1W5SA 3M6AA 3KOZE 4G4OA 1DGGA 3HHYA 1SXJA 2QENA 1IN8A 1L2BA 2O5RA 4IJEA 4DR4M 2R65A 4LFCM 5ITYA 4AI6A 2CV0A 4KLNA 3FTCA 1K3XA 4JXJA 3U5ZA 1NNJA 3J7AS 4GIPA 1IY1A 5FTJA 2EO2A 5KPZA 4LF9M 1NSFA 4I81A 4WURA 5JI2E 2V1CA 2KRKA 2FE8A 3LQQA 2ZBKB 1OFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 M;  1Z5B A;  4DV3 M;  4DR3 M;  1XMQ M;  4DUY M;  2F5Q A;  2F5O A;  3SAT A;  5ITX E;  5IWA M;  5BR8 M;  5ITX A;  3GP1 A;  2OQ4 A;  4DV6 M;  1FJG M;  3GPX A;  2UUC M;  3SAR A;  2XZU A;  2F5N A;  4AQY M;  3OTO M;  4B3M M;  4YHH M;  1R2Z A;  1MX0 A;  1Q39 A;  1K82 A;  1L1Z A;  3GQ5 A;  5ITQ A;  1Q3C A;  3A46 A;  4DR7 M;  4GKJ M;  1Z5C A;  5ITR A;  2Q2E B;  4G4Q A;  5FLX S;  2E5L M;  2XZF A;  4LF6 M;  4JI8 M;  2UXB M;  3U6M A;  1N34 M;  4JI1 M;  2VQE M;  4LFA M;  3DOA A;  3GPY A;  1KFV A;  4PDG A;  3U6O A;  2UXD M;  4JI0 M;  1IBM M;  3SAW A;  4X66 M;  3VK8 A;  2EA0 A;  4LF4 M;  4DUZ M;  4JI7 M;  1PJI A;  4B3T M;  3W0F A;  4YY3 M;  4NXN M;  1J5E M;  3U6E A;  4JI4 M;  2F5P A;  4B3S M;  1N32 M;  1HR0 M;  3GO8 A;  1XNR M;  1L1T A;  2F5S A;  4NRV A;  4JI5 M;  3SBJ A;  2F4V M;  3TWK A;  2HHH M;  4DR1 M;  3U6Q A;  1HNW M;  2UXC M;  4MB7 A;  3U6P A;  3SAU A;  3VK7 A;  1PJJ A;  1N33 M;  3C58 A;  4LF8 M;  3SAV A;  1MU5 A;  4PCZ A;  5LMN M;  4DV1 M;  4X62 M;  4B3R M;  2UUB M;  4JV5 M;  4DR2 M;  4LFB M;  1TDH A;  2ZM6 M;  4LF5 M;  3TWL A;  3TWM A;  1I94 M;  4JYA M;  1IBK M;  3JAM S;  5A2Q S;  4K0K M;  3GPP A;  3GQ4 A;  3A42 A;  3JR4 A;  2UUA M;  2UU9 M;  4NRW A;  3U6L A;  4OX9 M;  4DR5 M;  1Q3B A;  4G4N A;  2HKJ A;  3U6D A;  4NXM M;  4DV5 M;  3U6C A;  3U6S A;  4GKK M;  4DV0 M;  1EE8 A;  3J81 S;  4JI6 M;  4PD2 A;  1HNZ M;  1L2C A;  1TDZ A;  3SAS A;  5IT9 S;  3A45 A;  4X64 M;  3T1H M;  1HNX M;  4G4O A;  1K3W A;  4KHP M;  4DV4 M;  4G4R A;  1XMO M;  1L2B A;  1L2D A;  1R2Y A;  1XC8 A;  3JR5 A;  3T1Y M;  4DR4 M;  1XNQ M;  4JI3 M;  5ITY A;  4LFC M;  1PM5 A;  5ITU A;  4DR6 M;  2OPF A;  5ITT A;  1K3X A;  3J80 S;  4CIS A;  3GQ3 A;  4DV2 M;  1NNJ A;  1IBL M;  4ITQ A;  2VQF M;  3J7A S;  4JI2 M;  4LF9 M;  5LMU M;  1N36 M;  4DV7 M;  4PDI A;  2ZBK B;  3GPU A;  1Z59 A;  1Z5A A;  4X65 M; 
#chains in the Genus database with same CATH topology
 3VKG A;  4FD2 A;  4DV3 M;  1GJT A;  2CWB A;  1N78 A;  1TF0 B;  2QCU A;  1QAQ A;  2F5Q A;  5EXP A;  3AKZ A;  1SXJ B;  1ZQ9 A;  1QAN A;  5KO3 A;  1NJG A;  1UFZ A;  4FWH A;  3GP1 A;  2QBY B;  2LVA A;  4LGY A;  1RU3 A;  3IHP A;  2MRO B;  1DO2 A;  2C96 A;  1H6U A;  4B3M M;  3ZQJ A;  5KQD A;  3CF2 A;  3KP1 E;  4CIZ A;  1LV7 A;  2QPA A;  3F92 A;  1IQP A;  3GRY A;  2H5X A;  1SXJ D;  4FWD A;  1GVN A;  1Z5C A;  2VF7 A;  2M60 A;  2XSZ D;  2DWN A;  2D7H A;  4G4Q A;  2ZTD A;  2XZF A;  4BB9 A;  5DYI A;  4MGZ E;  2UXB M;  4BBA A;  1KYI A;  3HHW A;  3HX3 A;  4LFA M;  3AOG A;  3SHG B;  3U61 B;  1DO0 A;  3K92 A;  3T38 A;  1KFV A;  3TL4 X;  2UXD M;  4FCV A;  1SXJ C;  3I01 M;  1IBM M;  3VK8 A;  1GL6 A;  4DUZ M;  5FSW A;  5FTL A;  4B3T M;  4OVZ A;  3FYD A;  5EP3 A;  1G3I A;  3AV0 A;  3W0F A;  8CAT A;  4JI4 M;  3UZU A;  3B7Z A;  2DWM A;  1NY5 A;  3GLF A;  1QZE A;  2R4J A;  2DXI A;  3ILK A;  2JY5 A;  3KXE C;  4NRV A;  3A98 B;  4NSO B;  4NL4 H;  3FRI A;  3U61 A;  4AKI A;  2DAK A;  2LVO C;  2YFQ A;  1IFY A;  2UXC M;  1HQY E;  1NY6 A;  3E9S A;  4MB7 A;  1J09 A;  1AIP C;  3VK7 A;  1N33 M;  3AFH A;  3C58 A;  1GKI A;  4WP2 A;  3I51 A;  1OFH A;  1OJL A;  2JY7 A;  2M5Z A;  2MR9 A;  2RGH A;  4LJ9 A;  2K9D A;  2ZTC A;  1VQ1 A;  3FUX A;  4I8O A;  1TDH A;  1I4W A;  1V92 A;  4LF5 M;  2Y21 A;  2Z7J A;  1OQY A;  3TWL A;  2R18 A;  3ZH9 B;  5F3W A;  2QZ4 A;  3FTF A;  1HQC A;  4K0K M;  3GPP A;  4LJA A;  3U60 B;  3B74 A;  2XFT A;  3KP0 E;  3GLI A;  5EJC A;  1WJ7 A;  4IBB A;  4I4L A;  3BBZ A;  1GLN A;  1Q3B A;  3M0E A;  4DR5 M;  2CV1 A;  4M0W A;  4IBE A;  1J7K A;  4DV5 M;  3U6C A;  4IBF A;  2WSE F;  3WHK A;  5E26 A;  4GKK M;  3GLH E;  4S12 A;  5FTN A;  4AG5 A;  1DV0 A;  2DWL A;  2L4F A;  3RFW A;  1CUK A;  3KOW E;  5EQT A;  3W68 A;  2KDL A;  4D80 A;  1HNX M;  3LVV A;  2CHQ A;  2DNA A;  2OOB A;  1T43 A;  2YNM D;  4FWG A;  4GH9 A;  2YR0 A;  1TTE A;  3M7G A;  4LCB A;  3KOX E;  4G4R A;  1L2D A;  3HKP A;  2Y0T A;  4GMQ A;  1XC8 A;  3JR5 A;  1R2Y A;  4MGH A;  2J7N A;  3HY5 A;  1IN5 A;  2AHM A;  2I7P A;  1XNQ M;  3GRV A;  4QHT A;  2KNV A;  2OPF A;  3RGS A;  5ITT A;  3J80 S;  3GQ3 A;  1IBL M;  1HT2 E;  2JP7 A;  3HZJ A;  3LCV B;  2X49 A;  4G6Z A;  3E46 A;  2C5R A;  1NV8 A;  1ZMU A;  2Z4R A;  3SAU A;  2JZ0 A;  3IG8 A;  4REZ A;  4UN2 B;  1XHB A;  4QOZ C;  4B7G A;  4D81 A;  3J7B A;  1Z5B A;  1NJF A;  1VEG A;  4LJ6 A;  4AZF A;  1R6B X;  5EXX A;  2RKO A;  3V76 A;  3L2A A;  2L6O A;  1XMQ M;  2EJS A;  4DUY M;  1HT1 E;  3AJI B;  3FYC A;  4XBO A;  4P16 A;  4B7F A;  4IIW A;  3U60 A;  1G8P A;  3C9P A;  4IBG A;  5IWA M;  5BR8 M;  1FJG M;  3GPX A;  3SAR A;  4L6V 6;  1WGL A;  1VDD A;  2XZU A;  3J2P B;  5KPR A;  4FVM A;  3OTO M;  1YE9 A;  1R2Z A;  1MX0 A;  7CAT A;  1YSY A;  4GHA A;  4FCT A;  2KZS A;  2D7G A;  4Y28 F;  2J7O A;  3FKE A;  2B3T A;  1EFU B;  5ITQ A;  3CTW B;  1Q3C A;  2C99 A;  1OAO C;  3HHZ A;  2DEN A;  3PNY A;  1NVM A;  3NBX X;  3KSX A;  2K0B X;  5FLX S;  2R0I A;  2MH8 A;  4LF6 M;  4JN6 A;  3GLH A;  1N34 M;  4NSR A;  4MGK E;  1SG9 A;  2RGO A;  3UJN A;  1G71 A;  2R6F A;  2MGW A;  3U6O A;  1IY2 A;  1IM2 A;  3FUV A;  3K9P A;  4AW4 A;  3SAW A;  5FTM A;  1PJQ A;  2DWZ B;  2LNH C;  4M0D A;  3TQS A;  3KVW A;  3PNV A;  3L29 A;  1ZV1 A;  1PJI A;  4BLC A;  4NXN M;  1J5E M;  3HU2 A;  2BJV A;  2F5P A;  1KSF X;  2Z3X A;  1LTM A;  4OU7 A;  5H37 D;  3GO8 A;  3GLF E;  4MH0 E;  2LHG A;  3B7N A;  3U5Z B;  3L26 A;  1JR3 A;  3PVS A;  3W0L B;  3SC3 A;  4NOO B;  4LJ5 A;  2RRU A;  3MMP A;  4CJ6 A;  4LG2 A;  1QUT A;  3KDS E;  2K47 A;  2G5G X;  3HGI A;  4IBK A;  1TH4 A;  3VFD A;  1PRB A;  1WR1 B;  3SAV A;  3RGP A;  4X62 M;  4R71 A;  4B3R M;  2CRU A;  2GNO A;  3ZC7 B;  3K1J A;  2FH0 A;  3QYB A;  2DAE A;  4LFB M;  1TR8 A;  3KS4 A;  3E4R A;  4LRS A;  4DBG B;  3TWM A;  1I94 M;  4JYA M;  2QBY A;  2CEA A;  2FFJ A;  3SYK A;  3R9X B;  5BPV A;  4KOD A;  3GQ4 A;  1AUA A;  3J27 B;  2A5Y B;  2OOA A;  2WSF F;  4A3V B;  2VDB B;  4G4N A;  3U6D A;  4NXM M;  4GC5 A;  1IXS B;  2FNA A;  1ZMV A;  3DZD A;  2DZO B;  2HAK A;  1PGY A;  1E9R A;  4FCW A;  4I5S A;  3J81 S;  4PD2 A;  4LJ8 A;  5IT9 S;  4GC9 A;  2DAM A;  3A45 A;  4L4U A;  4QHS A;  3HHX A;  3T1H M;  1R5L A;  3GLI B;  1F4I A;  4LZJ A;  2WSC F;  1K3W A;  3KSJ A;  3KFU G;  3FD9 A;  1YUB A;  2XEP A;  1SXJ E;  1JR3 D;  2L7H A;  1QDR A;  1TH3 A;  5ITU A;  1S3S A;  3AOE C;  4IBD A;  3K9O A;  5E6J A;  3L25 A;  3H4J A;  3VLF B;  4DR6 M;  4DV2 M;  3GLH B;  4ITQ A;  1IXZ A;  2CUZ A;  5LMU M;  1V33 A;  1WHC A;  5EP2 A;  4DV7 M;  4PDI A;  3I4V A;  3WHL A;  2OO9 A;  1IXR C;  1D2N A;  3UGJ A;  1Z59 A;  3GPU A;  4X65 M;  2G3Q A;  4LF7 M;  4Z6Y A;  2V6Z M;  4OW0 A;  3Q8X A;  2JY6 B;  4B7H A;  2QHO B;  3SAT A;  2KZU A;  3SMS A;  5ITX E;  1DGH B;  2Z8Y M;  3LVW A;  5ITX A;  4DV6 M;  5KPT A;  5KQ8 A;  1R7R A;  3NWL A;  3L28 A;  3LQR A;  2LBC A;  2F5N A;  4AQY M;  3NBI A;  2JUJ A;  1WIV A;  2Y20 A;  1GL7 A;  4L15 A;  2FS1 A;  3UK6 A;  1K82 A;  2C98 A;  2KA6 B;  3C3D A;  2XSZ A;  2JA2 A;  1IXS A;  5JI3 E;  3GQ5 A;  1JB0 F;  2QSF X;  3MK6 A;  2MJ5 B;  2N35 A;  1G4A E;  1D0K A;  1VDL A;  2KRU A;  3HWS A;  4D82 A;  3A46 A;  4DR7 M;  2JXN A;  2XH9 A;  2BWE A;  2Q2E B;  3MHV C;  3BOS A;  3QWL A;  1XXH E;  5FTK A;  1G59 A;  4F2L A;  1PJS A;  4JI1 M;  2KHH A;  3GPY A;  3FTD A;  3K8Z A;  2NQ8 C;  1DGH A;  1NHW C;  4JI0 M;  4X66 M;  3MJ5 A;  3QAU A;  4FW9 A;  2I7N A;  1YLA A;  3GRR A;  3W67 A;  3VKH A;  3B7Q A;  3KOY E;  4YY3 M;  1Z6T A;  1IN6 A;  4MGI E;  3U6E A;  1EIJ A;  4B3S M;  1N32 M;  2LXE A;  1E94 E;  2HL7 A;  5IRE B;  2JZ1 A;  4LJ4 A;  1XNR M;  1GJS A;  2F5S A;  2QP9 X;  3K2L A;  4M9Z A;  2L09 A;  4JI5 M;  2HHH M;  4IBI A;  4B08 A;  4DR1 M;  3U6Q A;  2CE7 A;  4MGY E;  2R46 A;  3FE3 A;  3HU3 A;  4PCZ A;  5LMN M;  2APL A;  4L78 A;  3KS8 A;  1TGU A;  2UUB M;  4JV5 M;  2O01 F;  4DR2 M;  2CHV A;  4WW0 A;  3LMM A;  1XWI A;  3SHF A;  4AKG A;  2BJW A;  2DZL A;  1IBK M;  3HJ8 A;  4IBJ A;  5A2Q S;  2Y0Q A;  1QZM A;  3VDU A;  2J5Y A;  2C9C A;  2X4A A;  2XGN A;  3JR4 A;  2UU9 M;  4GEW A;  4NRW A;  3U6L A;  1QVR A;  1ZMW A;  2HKJ A;  4L8R C;  1UM8 A;  4XK8 F;  4RF0 A;  3B9P A;  1DGB A;  4MM3 B;  4RKU F;  2ZAN A;  1OIZ A;  4GIT A;  4Z8X A;  2JNH A;  3BXW A;  2XFS A;  4KT0 F;  1L2C A;  4QNR A;  1MN3 A;  1T6O A;  2KXE A;  1GO5 A;  4X64 M;  2L7I A;  3CGW A;  1OKS A;  2GQF A;  2VF8 A;  4KHP M;  2H1R A;  2LVQ D;  3DA1 A;  4GHL A;  4DV4 M;  1XMO M;  4LZZ A;  2LVN C;  2LHC A;  3T1Y M;  1Y8G A;  1HJP A;  1D0L A;  4HL4 A;  2EKK A;  4JI3 M;  2HCB A;  1PM5 A;  1QDT A;  2FOI C;  2W82 A;  1G41 A;  3I4Y A;  4LGM A;  3T6P A;  3GLG E;  2P5T A;  3SMP A;  1C1K A;  1QUS A;  2EKF A;  2O25 A;  2EUC A;  2V1U A;  4CIS A;  1IY0 A;  1W5T A;  2VQF M;  4JI2 M;  3EIE A;  3TE6 A;  1N36 M;  3RE8 A;  4LJ7 A;  4LRT A;  1NHG C;  5EXS A;  4RNA A;  5EP1 A;  1Z5A A;  2DVW B;  4II7 A;  3FUW A;  3AOE A;  2YQZ A;  1DGF A;  2D7E A;  2HWJ A;  3LCU A;  3ZCB B;  1N75 A;  4DR3 M;  2QNJ A;  2KNZ A;  3HJQ A;  1VEJ A;  2JY8 A;  3THG A;  2F5O A;  1PJT A;  2CFO A;  1MJG M;  4NC6 A;  4ZPX A;  2R62 A;  2OQ4 A;  2R44 A;  4PT5 A;  3R8F A;  2UUC M;  3D8L A;  4M9S A;  5EXT A;  3TPZ A;  1E32 A;  2DHR A;  1IN4 A;  2BNK A;  2L4E A;  4QOS A;  4YHH M;  4GRI A;  1Q39 A;  2KNA A;  2LWX A;  1L1Z A;  4CHT B;  1XXH B;  3SFZ A;  4XGI A;  2ZAO A;  3VDP A;  3FTE A;  4LY6 A;  2DI0 A;  3SYL A;  4GKJ M;  4TUW A;  1XXH A;  2L2D A;  5ITR A;  2X8A A;  3DFZ A;  3GLF B;  3I04 M;  2LH0 A;  2E5L M;  4JI8 M;  3EIH A;  5C18 A;  3U6M A;  1V34 A;  2VQE M;  3DOA A;  4PDG A;  4M9X A;  1T3T A;  2DKL A;  4OVZ B;  2WZJ A;  1WGN A;  3FRH A;  2EA0 A;  2CHG A;  2JWS A;  4LF4 M;  2DZN B;  4JI7 M;  4KO8 A;  3CF0 A;  3GLG A;  3FUU A;  2KW0 A;  1HR0 M;  3T15 A;  1L1T A;  5DYG A;  4R3D A;  1X37 A;  3KW6 A;  3PFI A;  4R7G A;  3SBJ A;  1NNU C;  3TWK A;  1L8Q A;  2F4V M;  2DAG A;  3L27 A;  1Q02 A;  1WXQ A;  3FUT A;  3H4M A;  4RF1 A;  1HNW M;  3Q8G A;  2C9O A;  3B89 A;  3U6P A;  4QNM A;  1JR3 E;  2XF3 A;  1PJJ A;  4IBC A;  4CGY B;  2XLJ A;  4LF8 M;  1OIP A;  3IEC A;  5DFL A;  1MU5 A;  4DV1 M;  1ORY B;  1E9S A;  5L8R F;  1OTR A;  1R4G A;  2K6B A;  4HLQ A;  1A5T A;  1D0M A;  2Z4S A;  5C1B A;  2ZM6 M;  4Q7J A;  1JQJ C;  2LTU A;  4EIW A;  5EP4 A;  4AG6 A;  3GRU A;  5IZ7 D;  5GKN A;  4HEO A;  3JAM S;  1QAM A;  3D8B A;  5DNY A;  2R45 A;  3GLI E;  4G3O A;  1GAB A;  1ZAE A;  2UUA M;  3A42 A;  1FNN A;  1BVS A;  2DHY A;  3HU1 A;  4L16 A;  1QAO A;  4OX9 M;  1TH2 A;  2VII A;  2KEB A;  4AKH A;  1IN7 A;  3LW5 F;  2DAI A;  1OAI A;  3IG5 A;  4F1I A;  1C7Y A;  3U6S A;  1QYR A;  3E21 A;  2G8L A;  3PXG A;  4IJF A;  3UMM A;  2QQ8 A;  1N77 A;  3AL0 C;  1QQW A;  2ZAM A;  1EE8 A;  4W5W A;  4DV0 M;  2R4E A;  1P3Q Q;  1VEK A;  2CP8 A;  1HNZ M;  2CV2 A;  1TDZ A;  3SAS A;  4JI6 M;  2ERC A;  3CF6 E;  3HJS A;  3GLG B;  1W5S A;  1NV9 A;  3M6A A;  3KOZ E;  4G4O A;  1DGG A;  3HHY A;  1SXJ A;  2QEN A;  1IN8 A;  1L2B A;  1XB2 B;  2O5R A;  4IJE A;  4DR4 M;  2R65 A;  4ANR A;  5ITY A;  4LFC M;  4AI6 A;  2CV0 A;  4KLN A;  3FTC A;  1K3X A;  2BWB A;  4JXJ A;  1NO1 A;  3U5Z A;  1NNJ A;  3J7A S;  4GIP A;  1IY1 A;  5FTJ A;  2EO2 A;  5KPZ A;  4LF9 M;  1NSF A;  4I81 A;  4P17 A;  4WUR A;  3QYE A;  2V1C A;  2KRK A;  1VG5 A;  2FE8 A;  5JI2 E;  3LQQ A;  2LVP C;  2ZBK B;  1OFI A;  3C3E A; 
#chains in the Genus database with same CATH homology
 3VKG A;  4FD2 A;  4DV3 M;  1N78 A;  2QCU A;  1QAQ A;  2F5Q A;  5EXP A;  3AKZ A;  1SXJ B;  1ZQ9 A;  1QAN A;  5KO3 A;  1NJG A;  4FWH A;  3GP1 A;  2QBY B;  4LGY A;  1DO2 A;  2C96 A;  1H6U A;  4B3M M;  5KQD A;  3CF2 A;  3KP1 E;  1LV7 A;  2QPA A;  1IQP A;  3GRY A;  1SXJ D;  4FWD A;  1GVN A;  1Z5C A;  2M60 A;  2XSZ D;  2DWN A;  2D7H A;  4G4Q A;  2XZF A;  4BB9 A;  5DYI A;  4MGZ E;  2UXB M;  4BBA A;  1KYI A;  3HHW A;  4LFA M;  3SHG B;  3AOG A;  3U61 B;  1DO0 A;  3K92 A;  3T38 A;  1KFV A;  3TL4 X;  2UXD M;  4FCV A;  1SXJ C;  1IBM M;  3VK8 A;  1GL6 A;  4DUZ M;  5FSW A;  5FTL A;  4B3T M;  4OVZ A;  3FYD A;  5EP3 A;  1G3I A;  3AV0 A;  3W0F A;  8CAT A;  4JI4 M;  3UZU A;  1NY5 A;  3GLF A;  2R4J A;  2DXI A;  3ILK A;  3KXE C;  4NRV A;  3A98 B;  4NSO B;  4NL4 H;  3U61 A;  4AKI A;  2YFQ A;  2UXC M;  1HQY E;  1NY6 A;  3E9S A;  4MB7 A;  1J09 A;  3VK7 A;  1N33 M;  3AFH A;  3C58 A;  1GKI A;  3I51 A;  1OFH A;  1OJL A;  2M5Z A;  2RGH A;  4LJ9 A;  3FUX A;  1TDH A;  1I4W A;  4LF5 M;  2Y21 A;  2Z7J A;  3TWL A;  2R18 A;  3ZH9 B;  5F3W A;  2QZ4 A;  1HQC A;  4K0K M;  3GPP A;  4LJA A;  3U60 B;  3KP0 E;  2XFT A;  3GLI A;  5EJC A;  4IBB A;  4I4L A;  1GLN A;  1Q3B A;  3M0E A;  4DR5 M;  2CV1 A;  4M0W A;  4IBE A;  1J7K A;  4DV5 M;  3U6C A;  4IBF A;  3WHK A;  5E26 A;  4GKK M;  4S12 A;  5FTN A;  4AG5 A;  2DWL A;  3RFW A;  3KOW E;  5EQT A;  1HNX M;  4D80 A;  3LVV A;  2CHQ A;  4FWG A;  2YNM D;  4I8O A;  4GH9 A;  4LCB A;  2DWM A;  3M7G A;  2YR0 A;  1L2D A;  4G4R A;  3KOX E;  3FTF A;  3HKP A;  2Y0T A;  4GMQ A;  1XC8 A;  3JR5 A;  1R2Y A;  4MGH A;  2J7N A;  1XNQ M;  1IN5 A;  2AHM A;  2I7P A;  3GRV A;  4QHT A;  2OPF A;  3RGS A;  5ITT A;  3J80 S;  3GQ3 A;  1IBL M;  1HT2 E;  2X49 A;  4G6Z A;  2C5R A;  2Z4R A;  3SAU A;  3IG8 A;  4REZ A;  1XHB A;  4QOZ C;  4B7G A;  4D81 A;  3J7B A;  1Z5B A;  1NJF A;  4AZF A;  4LJ6 A;  1R6B X;  5EXX A;  2RKO A;  1XMQ M;  3L2A A;  2L6O A;  4DUY M;  1HT1 E;  3AJI B;  3FYC A;  4XBO A;  4P16 A;  4B7F A;  4IIW A;  3U60 A;  1G8P A;  5IWA M;  4IBG A;  5BR8 M;  1FJG M;  3GPX A;  3SAR A;  2XZU A;  1VDD A;  3J2P B;  5KPR A;  4FVM A;  3OTO M;  1YE9 A;  1R2Z A;  1MX0 A;  7CAT A;  1YSY A;  4GHA A;  4FCT A;  2KZS A;  2D7G A;  2J7O A;  3FKE A;  5ITQ A;  3CTW B;  1Q3C A;  2C99 A;  3HHZ A;  3PNY A;  1NVM A;  3KSX A;  5FLX S;  4LF6 M;  4JN6 A;  3GLH A;  1N34 M;  4NSR A;  4MGK E;  2RGO A;  3UJN A;  3U6O A;  1IY2 A;  1IM2 A;  3FUV A;  4AW4 A;  3SAW A;  5FTM A;  2DWZ B;  2LNH C;  4M0D A;  3TQS A;  3KVW A;  3PNV A;  3L29 A;  1PJI A;  4BLC A;  4NXN M;  1J5E M;  3HU2 A;  2BJV A;  2F5P A;  1KSF X;  2Z3X A;  4OU7 A;  5H37 D;  3GO8 A;  4MH0 E;  3U5Z B;  3L26 A;  1JR3 A;  3PVS A;  3W0L B;  3SC3 A;  4NOO B;  4LJ5 A;  4LG2 A;  3KDS E;  2K47 A;  2G5G X;  3HGI A;  4IBK A;  1TH4 A;  3VFD A;  3SAV A;  3RGP A;  4X62 M;  4B3R M;  3ZC7 B;  3K1J A;  4LFB M;  3KS4 A;  3E4R A;  4LRS A;  3TWM A;  1I94 M;  4JYA M;  2QBY A;  2CEA A;  2FFJ A;  3SYK A;  3R9X B;  5BPV A;  4KOD A;  3GQ4 A;  3J27 B;  2A5Y B;  4A3V B;  4G4N A;  3U6D A;  4NXM M;  4GC5 A;  1IXS B;  2FNA A;  3DZD A;  2DZO B;  1E9R A;  4FCW A;  4I5S A;  3J81 S;  4PD2 A;  4LJ8 A;  5IT9 S;  4GC9 A;  3A45 A;  4L4U A;  4QHS A;  3HHX A;  3T1H M;  3GLI B;  4LZJ A;  3KFU G;  1K3W A;  3KSJ A;  3FD9 A;  1YUB A;  2XEP A;  1SXJ E;  1JR3 D;  2L7H A;  1TH3 A;  5ITU A;  1S3S A;  3AOE C;  4IBD A;  5E6J A;  3L25 A;  4DR6 M;  3VLF B;  4DV2 M;  3GLH B;  4ITQ A;  1IXZ A;  2CUZ A;  5LMU M;  5EP2 A;  4DV7 M;  4PDI A;  3I4V A;  3WHL A;  1IXR C;  3UGJ A;  1D2N A;  3GPU A;  1Z59 A;  4X65 M;  4LF7 M;  4Z6Y A;  2V6Z M;  4OW0 A;  3Q8X A;  4B7H A;  3SAT A;  2KZU A;  3SMS A;  5ITX E;  1DGH B;  3LVW A;  5ITX A;  4DV6 M;  5KPT A;  5KQ8 A;  1R7R A;  3NWL A;  3L28 A;  3LQR A;  2F5N A;  4AQY M;  3NBI A;  2Y20 A;  1GL7 A;  4L15 A;  3UK6 A;  1K82 A;  2C98 A;  2KA6 B;  2XSZ A;  2JA2 A;  5JI3 E;  3GQ5 A;  3MK6 A;  1G4A E;  3A46 A;  4DR7 M;  2KRU A;  3HWS A;  4D82 A;  2XH9 A;  2Q2E B;  3MHV C;  3BOS A;  3QWL A;  5FTK A;  1G59 A;  4JI1 M;  3GPY A;  3FTD A;  3K8Z A;  2NQ8 C;  1DGH A;  1NHW C;  4JI0 M;  4X66 M;  3MJ5 A;  3QAU A;  4FW9 A;  2I7N A;  3GRR A;  3VKH A;  3KOY E;  4YY3 M;  1Z6T A;  1IN6 A;  4MGI E;  3U6E A;  4B3S M;  1N32 M;  2LXE A;  1E94 E;  2HL7 A;  5IRE B;  1XNR M;  4LJ4 A;  2F5S A;  2QP9 X;  3K2L A;  4M9Z A;  2L09 A;  4JI5 M;  2HHH M;  4IBI A;  4B08 A;  4DR1 M;  3U6Q A;  2CE7 A;  4MGY E;  2R46 A;  3HU3 A;  4PCZ A;  5LMN M;  4L78 A;  3KS8 A;  1TGU A;  2UUB M;  4JV5 M;  4DR2 M;  2CHV A;  4WW0 A;  3LMM A;  1XWI A;  3SHF A;  4AKG A;  2BJW A;  1IBK M;  3HJ8 A;  4IBJ A;  5A2Q S;  2Y0Q A;  1QZM A;  3VDU A;  2XGN A;  2C9C A;  2X4A A;  3JR4 A;  2UU9 M;  4NRW A;  3U6L A;  1QVR A;  4L8R C;  2HKJ A;  1UM8 A;  4RF0 A;  3B9P A;  1DGB A;  4MM3 B;  2ZAN A;  4GIT A;  4Z8X A;  2XFS A;  1L2C A;  4QNR A;  2KXE A;  4X64 M;  2L7I A;  4KHP M;  2H1R A;  3DA1 A;  4GHL A;  4DV4 M;  1XMO M;  4LZZ A;  3T1Y M;  4HL4 A;  4JI3 M;  2HCB A;  1PM5 A;  2FOI C;  2W82 A;  1G41 A;  3I4Y A;  4LGM A;  2P5T A;  3SMP A;  1C1K A;  2EUC A;  2V1U A;  4CIS A;  1IY0 A;  1W5T A;  2VQF M;  4JI2 M;  3EIE A;  3TE6 A;  1N36 M;  3RE8 A;  4LJ7 A;  4LRT A;  1NHG C;  5EXS A;  4RNA A;  5EP1 A;  1Z5A A;  2DVW B;  4II7 A;  3FUW A;  3AOE A;  2YQZ A;  1DGF A;  2D7E A;  3ZCB B;  1N75 A;  4DR3 M;  3HJQ A;  3THG A;  2F5O A;  2CFO A;  4ZPX A;  2R62 A;  2OQ4 A;  4PT5 A;  3R8F A;  2UUC M;  3D8L A;  4M9S A;  5EXT A;  3TPZ A;  1E32 A;  2DHR A;  1IN4 A;  2BNK A;  4QOS A;  4YHH M;  4GRI A;  1Q39 A;  2LWX A;  1L1Z A;  4CHT B;  1XXH B;  3SFZ A;  4XGI A;  2ZAO A;  3VDP A;  3FTE A;  4LY6 A;  3SYL A;  4GKJ M;  4TUW A;  1XXH A;  5ITR A;  2X8A A;  3DFZ A;  3GLF B;  2LH0 A;  2E5L M;  4JI8 M;  3EIH A;  5C18 A;  3U6M A;  2VQE M;  3DOA A;  4PDG A;  4M9X A;  1T3T A;  4OVZ B;  2EA0 A;  4LF4 M;  2CHG A;  2DZN B;  4JI7 M;  4KO8 A;  3CF0 A;  3GLG A;  3FUU A;  2KW0 A;  1HR0 M;  3T15 A;  1L1T A;  5DYG A;  4R3D A;  1X37 A;  3KW6 A;  3PFI A;  4R7G A;  3SBJ A;  1NNU C;  3TWK A;  1L8Q A;  2F4V M;  3L27 A;  1WXQ A;  3FUT A;  3H4M A;  4RF1 A;  1HNW M;  2C9O A;  3U6P A;  4QNM A;  2XF3 A;  1PJJ A;  4IBC A;  4CGY B;  2XLJ A;  4LF8 M;  1MU5 A;  4DV1 M;  1ORY B;  1E9S A;  4HLQ A;  2Z4S A;  5C1B A;  2ZM6 M;  1JQJ C;  4EIW A;  5EP4 A;  4AG6 A;  3GRU A;  5IZ7 D;  5GKN A;  3JAM S;  1QAM A;  3D8B A;  5DNY A;  2R45 A;  1ZAE A;  2UUA M;  3A42 A;  1FNN A;  3HU1 A;  4L16 A;  1QAO A;  4OX9 M;  1TH2 A;  2VII A;  2KEB A;  4AKH A;  1IN7 A;  3IG5 A;  3U6S A;  1QYR A;  2G8L A;  3PXG A;  4IJF A;  3UMM A;  1N77 A;  3AL0 C;  1QQW A;  2ZAM A;  1EE8 A;  4W5W A;  4DV0 M;  2R4E A;  4JI6 M;  1HNZ M;  2CV2 A;  3SAS A;  1TDZ A;  2ERC A;  3CF6 E;  3HJS A;  3GLG B;  1W5S A;  3M6A A;  3KOZ E;  4G4O A;  1DGG A;  3HHY A;  1SXJ A;  2QEN A;  1IN8 A;  1L2B A;  2O5R A;  4IJE A;  4DR4 M;  2R65 A;  4LFC M;  5ITY A;  4AI6 A;  2CV0 A;  4KLN A;  3FTC A;  1K3X A;  4JXJ A;  3U5Z A;  1NNJ A;  3J7A S;  4GIP A;  1IY1 A;  5FTJ A;  2EO2 A;  5KPZ A;  4LF9 M;  1NSF A;  4I81 A;  4WUR A;  5JI2 E;  2V1C A;  2KRK A;  2FE8 A;  3LQQ A;  2ZBK B;  1OFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...