4AR4A

Neutron crystallographic structure of the reduced form perdeuterated pyrococcus furiosus rubredoxin to 1.38 angstrom resolution.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Near-Atomic Resolution Neutron Crystallography on Perdeuterated Pyrococcus Furiosus Rubredoxin: Implication of Hydronium Ions and Protonation State Equilibria in Redox Changes.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Electron transport
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ar4A00
3KYVA 1YUZA 3KYXA 1R0IA 1YK5A 4AR3A 1VCXA 1BRFA 1IROA 1SMUA 3MPSA 2KN9A 1BFYA 5IY0A 1T9OA 2K2DA 3KYWA 1S24A 2QL0A 1BQ8A 1C09A 1SMMA 1R0FA 2HR5A 1SMWA 4POFA 3RYGA 1IU5A 1IRNA 1RDVA 2RDVA 1RB9A 8RXNA 2PVEA 1QYBA 2LCQA 3PZAA 1B13A 1RDGA 5AI3A 1R0GA 7RXNA 1NNQA 3SS2A 4ME3A 3RZ6A 1R0JA 4AR4A 1FHMA 1FHHA 2PVXA 1LKPA 1S2ZA 1LKOA 3PWFA 4K9FA 2DSXA 2PYAA 4AR6A 2GMGA 1DVBA 1H7VA 2V3BB 1LKMA 1DX8A 1RWDA 4RXNA 3KYUA 3KYYA 1CADA 1IU6A 2MS3A 5AI2A 2KKDA 4POGA 1BE7A 1B71A 1T9QA 1ZRPA 3RZTA 4AR5A 6RXNA 4YWMA 1JYBA 1YUXA 1QCVA 1YK4A 5RXNA 3A44A 4TPUA 1LTLA 1T9PA 1E8JA 1B2JA 3QVDA 1RYTA 1YV1A 2M4YA 4YWLA 1BQ9A 1CAAA 2VL6A 1B2OA 1S30A 1R0HA
chains in the Genus database with same CATH superfamily
3KYVA 1NXEA 1VCXA 2JA8L 2JI1A 3MQKB 1TWCL 3HAXC 1SMUA 4G6BA 1VZIA 1OWBA 3MPSA 3GTKL 1BFYA 5DM71 3KYWA 3HOUL 3RZDL 4A3FL 4AYBP 4Y7NL 2Z3QB 1F4LA 2Z3RB 1VZHA 5MGNA 3HOZL 1SMWA 2HVYC 3PIO1 1PFYA 2RFKB 3S2HL 4A3LL 4BBRL 5FLML 2A69D 3GTQL 1B13A 1Y1VL 1RDGA 4B8CD 7RXNA 2XJSA 4ME3A 3S1ML 3J7Y1 2B63L 1FHMA 2NVXL 5JVG1 1LKPA 4A3DL 2CKCA 1LKOA 3PWFA 2M4VA 5C3EL 5K2ME 4A3BL 3PKJA 4JAFA 1DX8A 4JAGA 1K83L 3S14L 1TWGL 2ZIXA 3GTPL 2BE5D 1WCML 1ZRPA 3PO3L 4AR5A 4C3IL 3LWRB 4WFN1 5GAEc 4U671 3M3YL 2WAQP 3JR7A 5EINC 2O5JD 4AI3A 1YUZA 2APOB 5IYDL 1ODHA 2R93L 5C4JL 4AHYA 2XJUA 2KN9A 5M3ML 2NVQL 3LWVB 1S24A 2AUSB 5MF6A 2CR8A 4QIWP 1C09A 1SMMA 5MFPA 4ZN1B 2E2HL 4GS7D 3RYGA 4AHXA 2H12A 3CQZL 4A3CL 2LCQA 3PZAA 4V196 3H9BA 3M4OL 3S2DL 5AI3A 2XJQA 2J9UB 4AR4A 1FHHA 5GADc 3LWQB 2E2JL 5IP9L 1P7PA 4AR6A 1DVBA 1TWHL 2JI3A 3ZG6A 4C3HL 5M5WL 1H7VA 3HJWB 3H3VM 2NVYL 3B0AB 1IU6A 4AI0A 5AI2A 4AI2A 3WWLA 1BE7A 2C6BA 3S15L 2JI2A 2WB1P 2B5ID 4YWMA 3LNLA 2E2IL 1YUXA 2A6HD 5M5XL 3PKIA 3K35A 4TPUA 5IP7L 1TWFL 2ERSA 4YWLA 1BQ9A 4BY7L 1R0HA 3QQCE 3H9CA 3H97A 1R0IA 1YK5A 4X6AL 3S1NL 3HJYB 3HOVL 1IROA 3GTJL 3HKZP 5IYBL 4TVMA 3S17L 1T9OA 2NVTL 3GTOL 2A6ED 1BQ8A 5GAHc 3S1QL 4A93L 5MFZA 1R0FA 3S16L 2HR5A 4XGHA 2Y0SP 4Y52L 3PL5A 1IU5A 1SFOL 2RDVA 1RB9A 2L0ZA 1QYBA 2XJVA 4C2M1 1PFUA 1R0GA 3LWPB 1NNQA 3RZ6A 1R0JA 4AI1A 1I50L 2ERJA 4BY1L 1I3QL 2GMGA 2XJTA 5JVH1 5M5YL 2V3BB 2V0EA 4BXXL 1LKMA 2M6PA 4AHWA 1PFVA 1PFWA 1RWDA 4AHZA 5M3FL 1QQTA 3LPEB 4ZN3B 5IYCL 4A3JL 1B71A 1T9QA 3RZTA 3NFPI 1Z92B 1JYBA 3HOWL 5EIOC 3I4ML 1PZXA 3PIP1 2JA5L 1E8JA 3QVDA 1RYTA 1YV1A 2M4YA 5MLC3 2VL6A 2JA6L 1S30A 5DM61 5C44L 3KYXA 4AR3A 2R7ZL 1BRFA 3J7Z1 5IY0A 4BBSL 2K2DA 2QL0A 3GTGL 4JADA 1OWCA 3MSUA 2YU9L 5FJ8L 4A3GL 4JAEA 2JA7L 2A68D 4POFA 1IRNA 2M6OA 1RDVA 1IW7D 3GTML 3LWOB 3VPBE 8RXNA 3S1RL 2PVEA 5GAGc 2CKAA 5AN9H 3GTLL 3SS2A 4C3JL 3I4NL 2PVXA 2XJRA 1TWAL 1RYQA 4E6YA 3PO2L 1S2ZA 2EY4E 4UY81 2PSMC 4K9FA 1NXGA 2DSXA 2PYAA 4A3IL 2PMZP 4A3ML 2R92L 5C4XL 4RXNA 3KYUA 3P2AA 3KYYA 2AYJA 4A3KL 1CADA 4A3EL 2MS3A 2KKDA 4POGA 2XJPA 2VUML 5H1Sc 3K7AL 3H99A 4LHNA 6RXNA 1I6HL 3FKIL 3FDJA 1QCVA 3P8BA 4XXBB 1YK4A 1VZGA 5RXNA 3H0GL 3RZOL 3A44A 3HOYL 2NYDA 1LTLA 1T9PA 3HOXL 2AQCA 1B2JA 1R9TL 3IU3I 1CAAA 2PPTA 1B2OA 3B08B 2C6AA 1WJVA 4LHLA 3WWNB 2V0FA 1Y1WL
chains in the Genus database with same CATH topology
3KYVA 1YUZA 1NXEA 3KYXA 1R0IA 1YK5A 4AR3A 1VCXA 1ODHA 1BRFA 2JI1A 1IROA 4AHYA 2XJUA 1SMUA 4G6BA 3J7Z1 1VZIA 1OWBA 3MPSA 2KN9A 1BFYA 4TVMA 5IY0A 1T9OA 2K2DA 5DM71 3KYWA 1S24A 2A6ED 2QL0A 1BQ8A 4JADA 1OWCA 2CR8A 5GAHc 5MF6A 2Z3QB 2Z3RB 1VZHA 3MSUA 5MFZA 1C09A 1SMMA 5MGNA 1R0FA 2HR5A 5MFPA 4XGHA 4ZN1B 1SMWA 4JAEA 3PIO1 2A68D 4POFA 4GS7D 3RYGA 4AHXA 1IU5A 1IRNA 2H12A 1RDVA 2M6OA 2RDVA 2A69D 1IW7D 3VPBE 1RB9A 2L0ZA 8RXNA 2PVEA 1QYBA 2XJVA 2LCQA 3PZAA 5GAGc 1B13A 4V196 1RDGA 2CKAA 5AN9H 4B8CD 5AI3A 1R0GA 7RXNA 2XJSA 1NNQA 3SS2A 4ME3A 3J7Y1 3RZ6A 2XJQA 2J9UB 1R0JA 4AR4A 1FHMA 1FHHA 2PVXA 2XJRA 1LKPA 4AI1A 5GADc 1RYQA 5JVG1 4E6YA 2CKCA 1S2ZA 2ERJA 1LKOA 3PWFA 4UY81 2PSMC 4K9FA 1NXGA 2DSXA 2M4VA 2PYAA 5K2ME 4AR6A 2GMGA 1DVBA 3ZG6A 2JI3A 3PKJA 2XJTA 4JAFA 1H7VA 5JVH1 2V3BB 2V0EA 1LKMA 1DX8A 2M6PA 4JAGA 4AHWA 1RWDA 4AHZA 5DM61 4RXNA 3KYUA 3P2AA 3KYYA 2AYJA 3LPEB 1CADA 3B0AB 4ZN3B 1IU6A 2MS3A 4AI0A 5AI2A 4AI2A 2KKDA 3WWLA 4POGA 2XJPA 1BE7A 2C6BA 2ZIXA 5H1Sc 2BE5D 2JI2A 1B71A 1T9QA 1ZRPA 3RZTA 4LHNA 3NFPI 2B5ID 4AR5A 6RXNA 1Z92B 4YWMA 1JYBA 3LNLA 1YUXA 2A6HD 1QCVA 3P8BA 4XXBB 1YK4A 5EIOC 1VZGA 5RXNA 3PKIA 4WFN1 5GAEc 3A44A 3K35A 4TPUA 4U671 2NYDA 1LTLA 1T9PA 3PIP1 1E8JA 1B2JA 1R0HA 3QVDA 1RYTA 1YV1A 2ERSA 2M4YA 4YWLA 1BQ9A 3IU3I 5MLC3 1CAAA 2VL6A 2PPTA 1B2OA 3B08B 2C6AA 1WJVA 4LHLA 1S30A 3WWNB 5EINC 2O5JD 2V0FA 3QQCE 4AI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYV A;  1YUZ A;  3KYX A;  1R0I A;  1YK5 A;  4AR3 A;  1VCX A;  1BRF A;  1IRO A;  1SMU A;  3MPS A;  2KN9 A;  1BFY A;  5IY0 A;  1T9O A;  2K2D A;  3KYW A;  1S24 A;  2QL0 A;  1BQ8 A;  1C09 A;  1SMM A;  1R0F A;  2HR5 A;  1SMW A;  4POF A;  3RYG A;  1IU5 A;  1IRN A;  1RDV A;  2RDV A;  1RB9 A;  8RXN A;  2PVE A;  1QYB A;  2LCQ A;  3PZA A;  1B13 A;  1RDG A;  5AI3 A;  1R0G A;  7RXN A;  1NNQ A;  3SS2 A;  4ME3 A;  3RZ6 A;  1R0J A;  4AR4 A;  1FHM A;  1FHH A;  2PVX A;  1LKP A;  1S2Z A;  1LKO A;  3PWF A;  4K9F A;  2DSX A;  2PYA A;  4AR6 A;  2GMG A;  1DVB A;  1H7V A;  2V3B B;  1LKM A;  1DX8 A;  1RWD A;  4RXN A;  3KYU A;  3KYY A;  1CAD A;  1IU6 A;  2MS3 A;  5AI2 A;  2KKD A;  4POG A;  1BE7 A;  1B71 A;  1T9Q A;  1ZRP A;  3RZT A;  4AR5 A;  6RXN A;  4YWM A;  1JYB A;  1YUX A;  1QCV A;  1YK4 A;  5RXN A;  3A44 A;  4TPU A;  1LTL A;  1T9P A;  1E8J A;  1B2J A;  3QVD A;  1RYT A;  1YV1 A;  2M4Y A;  4YWL A;  1BQ9 A;  1CAA A;  2VL6 A;  1B2O A;  1S30 A;  1R0H A; 
#chains in the Genus database with same CATH topology
 3KYV A;  1NXE A;  1VCX A;  2JA8 L;  2JI1 A;  3MQK B;  1TWC L;  3HAX C;  1SMU A;  4G6B A;  1VZI A;  1OWB A;  3MPS A;  3GTK L;  1BFY A;  5DM7 1;  3KYW A;  3HOU L;  3RZD L;  4A3F L;  4AYB P;  4Y7N L;  2Z3Q B;  1F4L A;  2Z3R B;  1VZH A;  5MGN A;  3HOZ L;  1SMW A;  2HVY C;  3PIO 1;  1PFY A;  2RFK B;  3S2H L;  4A3L L;  4BBR L;  5FLM L;  2A69 D;  3GTQ L;  1B13 A;  1Y1V L;  1RDG A;  4B8C D;  7RXN A;  2XJS A;  4ME3 A;  3S1M L;  3J7Y 1;  2B63 L;  1FHM A;  2NVX L;  5JVG 1;  1LKP A;  4A3D L;  2CKC A;  1LKO A;  3PWF A;  2M4V A;  5C3E L;  5K2M E;  4A3B L;  3PKJ A;  4JAF A;  1DX8 A;  4JAG A;  1K83 L;  3S14 L;  1TWG L;  2ZIX A;  3GTP L;  2BE5 D;  1WCM L;  1ZRP A;  3PO3 L;  4AR5 A;  4C3I L;  3LWR B;  4WFN 1;  5GAE c;  4U67 1;  3M3Y L;  2WAQ P;  3JR7 A;  5EIN C;  2O5J D;  4AI3 A;  1YUZ A;  2APO B;  5IYD L;  1ODH A;  2R93 L;  5C4J L;  4AHY A;  2XJU A;  2KN9 A;  5M3M L;  2NVQ L;  3LWV B;  1S24 A;  2AUS B;  5MF6 A;  2CR8 A;  4QIW P;  1C09 A;  1SMM A;  5MFP A;  4ZN1 B;  2E2H L;  4GS7 D;  3RYG A;  4AHX A;  2H12 A;  3CQZ L;  4A3C L;  2LCQ A;  3PZA A;  4V19 6;  3H9B A;  3M4O L;  3S2D L;  5AI3 A;  2XJQ A;  2J9U B;  4AR4 A;  1FHH A;  5GAD c;  3LWQ B;  2E2J L;  5IP9 L;  1P7P A;  4AR6 A;  1DVB A;  1TWH L;  2JI3 A;  3ZG6 A;  4C3H L;  5M5W L;  1H7V A;  3HJW B;  3H3V M;  2NVY L;  3B0A B;  1IU6 A;  4AI0 A;  5AI2 A;  4AI2 A;  3WWL A;  1BE7 A;  2C6B A;  3S15 L;  2JI2 A;  2WB1 P;  2B5I D;  4YWM A;  3LNL A;  2E2I L;  1YUX A;  2A6H D;  5M5X L;  3PKI A;  3K35 A;  4TPU A;  5IP7 L;  1TWF L;  2ERS A;  4YWL A;  1BQ9 A;  4BY7 L;  1R0H A;  3QQC E;  3H9C A;  3H97 A;  1R0I A;  1YK5 A;  4X6A L;  3S1N L;  3HJY B;  3HOV L;  1IRO A;  3GTJ L;  3HKZ P;  5IYB L;  4TVM A;  3S17 L;  1T9O A;  2NVT L;  3GTO L;  2A6E D;  1BQ8 A;  5GAH c;  3S1Q L;  4A93 L;  5MFZ A;  1R0F A;  3S16 L;  2HR5 A;  4XGH A;  2Y0S P;  4Y52 L;  3PL5 A;  1IU5 A;  1SFO L;  2RDV A;  1RB9 A;  2L0Z A;  1QYB A;  2XJV A;  4C2M 1;  1PFU A;  1R0G A;  3LWP B;  1NNQ A;  3RZ6 A;  1R0J A;  4AI1 A;  1I50 L;  2ERJ A;  4BY1 L;  1I3Q L;  2GMG A;  2XJT A;  5JVH 1;  5M5Y L;  2V3B B;  2V0E A;  4BXX L;  1LKM A;  2M6P A;  4AHW A;  1PFV A;  1PFW A;  1RWD A;  4AHZ A;  5M3F L;  1QQT A;  3LPE B;  4ZN3 B;  5IYC L;  4A3J L;  1B71 A;  1T9Q A;  3RZT A;  3NFP I;  1Z92 B;  1JYB A;  3HOW L;  5EIO C;  3I4M L;  1PZX A;  3PIP 1;  2JA5 L;  1E8J A;  3QVD A;  1RYT A;  1YV1 A;  2M4Y A;  5MLC 3;  2VL6 A;  2JA6 L;  1S30 A;  5DM6 1;  5C44 L;  3KYX A;  4AR3 A;  2R7Z L;  1BRF A;  3J7Z 1;  5IY0 A;  4BBS L;  2K2D A;  2QL0 A;  3GTG L;  4JAD A;  1OWC A;  3MSU A;  2YU9 L;  5FJ8 L;  4A3G L;  4JAE A;  2JA7 L;  2A68 D;  4POF A;  1IRN A;  2M6O A;  1RDV A;  1IW7 D;  3GTM L;  3LWO B;  3VPB E;  8RXN A;  3S1R L;  2PVE A;  5GAG c;  2CKA A;  5AN9 H;  3GTL L;  3SS2 A;  4C3J L;  3I4N L;  2PVX A;  2XJR A;  1TWA L;  1RYQ A;  4E6Y A;  3PO2 L;  1S2Z A;  2EY4 E;  4UY8 1;  2PSM C;  4K9F A;  1NXG A;  2DSX A;  2PYA A;  4A3I L;  2PMZ P;  4A3M L;  2R92 L;  5C4X L;  4RXN A;  3KYU A;  3P2A A;  3KYY A;  2AYJ A;  4A3K L;  1CAD A;  4A3E L;  2MS3 A;  2KKD A;  4POG A;  2XJP A;  2VUM L;  5H1S c;  3K7A L;  3H99 A;  4LHN A;  6RXN A;  1I6H L;  3FKI L;  3FDJ A;  1QCV A;  3P8B A;  4XXB B;  1YK4 A;  1VZG A;  5RXN A;  3H0G L;  3RZO L;  3A44 A;  3HOY L;  2NYD A;  1LTL A;  1T9P A;  3HOX L;  2AQC A;  1B2J A;  1R9T L;  3IU3 I;  1CAA A;  2PPT A;  1B2O A;  3B08 B;  2C6A A;  1WJV A;  4LHL A;  3WWN B;  2V0F A;  1Y1W L; 
#chains in the Genus database with same CATH homology
 3KYV A;  1YUZ A;  1NXE A;  3KYX A;  1R0I A;  1YK5 A;  4AR3 A;  1VCX A;  1ODH A;  1BRF A;  2JI1 A;  1IRO A;  4AHY A;  2XJU A;  1SMU A;  4G6B A;  3J7Z 1;  1VZI A;  1OWB A;  3MPS A;  2KN9 A;  1BFY A;  4TVM A;  5IY0 A;  1T9O A;  2K2D A;  5DM7 1;  3KYW A;  1S24 A;  2A6E D;  2QL0 A;  1BQ8 A;  4JAD A;  1OWC A;  2CR8 A;  5GAH c;  5MF6 A;  2Z3Q B;  2Z3R B;  1VZH A;  3MSU A;  5MFZ A;  1C09 A;  1SMM A;  5MGN A;  1R0F A;  2HR5 A;  5MFP A;  4XGH A;  4ZN1 B;  1SMW A;  4JAE A;  3PIO 1;  2A68 D;  4POF A;  4GS7 D;  3RYG A;  4AHX A;  1IU5 A;  1IRN A;  2H12 A;  1RDV A;  2M6O A;  2RDV A;  2A69 D;  1IW7 D;  3VPB E;  1RB9 A;  2L0Z A;  8RXN A;  2PVE A;  1QYB A;  2XJV A;  2LCQ A;  3PZA A;  5GAG c;  1B13 A;  4V19 6;  1RDG A;  2CKA A;  5AN9 H;  4B8C D;  5AI3 A;  1R0G A;  7RXN A;  2XJS A;  1NNQ A;  3SS2 A;  4ME3 A;  3J7Y 1;  3RZ6 A;  2XJQ A;  2J9U B;  1R0J A;  4AR4 A;  1FHM A;  1FHH A;  2PVX A;  2XJR A;  1LKP A;  4AI1 A;  5GAD c;  1RYQ A;  5JVG 1;  4E6Y A;  2CKC A;  1S2Z A;  2ERJ A;  1LKO A;  3PWF A;  4UY8 1;  2PSM C;  4K9F A;  1NXG A;  2DSX A;  2M4V A;  2PYA A;  5K2M E;  4AR6 A;  2GMG A;  1DVB A;  3ZG6 A;  2JI3 A;  3PKJ A;  2XJT A;  4JAF A;  1H7V A;  5JVH 1;  2V3B B;  2V0E A;  1LKM A;  1DX8 A;  2M6P A;  4JAG A;  4AHW A;  1RWD A;  4AHZ A;  5DM6 1;  4RXN A;  3KYU A;  3P2A A;  3KYY A;  2AYJ A;  3LPE B;  1CAD A;  3B0A B;  4ZN3 B;  1IU6 A;  2MS3 A;  4AI0 A;  5AI2 A;  4AI2 A;  2KKD A;  3WWL A;  4POG A;  2XJP A;  1BE7 A;  2C6B A;  2ZIX A;  5H1S c;  2BE5 D;  2JI2 A;  1B71 A;  1T9Q A;  1ZRP A;  3RZT A;  4LHN A;  3NFP I;  2B5I D;  4AR5 A;  6RXN A;  1Z92 B;  4YWM A;  1JYB A;  3LNL A;  1YUX A;  2A6H D;  1QCV A;  3P8B A;  4XXB B;  1YK4 A;  5EIO C;  1VZG A;  5RXN A;  3PKI A;  4WFN 1;  5GAE c;  3A44 A;  3K35 A;  4TPU A;  4U67 1;  2NYD A;  1LTL A;  1T9P A;  3PIP 1;  1E8J A;  1B2J A;  1R0H A;  3QVD A;  1RYT A;  1YV1 A;  2ERS A;  2M4Y A;  4YWL A;  1BQ9 A;  3IU3 I;  5MLC 3;  1CAA A;  2VL6 A;  2PPT A;  1B2O A;  3B08 B;  2C6A A;  1WJV A;  4LHL A;  1S30 A;  3WWN B;  5EIN C;  2O5J D;  2V0F A;  3QQC E;  4AI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...