4ARNA

Crystal structure of the n-terminal domain of drosophila toll receptor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
277
structure length
277
Chain Sequence
b'SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPTTGENLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOLL RECEPTOR, VARIABLE LYMPHOCYTE RECEPTOR B.61 CHIMERA
publication title Functional Insights from the Crystal Structure of the N-Terminal Domain of the Prototypical Toll Receptor.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Immune system
total genus 83
structure length 277
sequence length 277
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4arnA00
3W3MA 5GS0A 4I6JB 2IFGA 5CMNA 5IJCA 2V9SA 4U7LA 3RFSA 2ASSB 3E6JA 2Z7XA 2OMXA 4R5CA 3WN4A 1O6TA 3ZYNA 4FCGA 3TSRE 4L3FA 5AWCA 2V70A 4B8CD 3G06A 1FS2A 3O53A 1A9NA 5FTTB 3ZYIA 5AWBA 1K5DC 1W8AA 3BZ5A 3G3AA 4J4LA 3P72A 4ARNA 2UZXA 1WWLA 1QYYA 3ULUA 5B0NA 1O6SA 4CNMA 3W3JA 3C6OB 4V2DA 1OOKG 4V2EA 3OJAA 3ZYOA 4LSXC 4GLPA 3A79B 1XEUA 3UL9A 5GMFA 5AWAA 1YRGA 5IJBA 3RGZA 2Z82A 3OGKB 4FD0A 4R58A 4R6GA 4AY9X 2Z64A 4K17A 4PKIG 4C2AB 3WPEA 2BEXA 3RIZA 1OGQA 4M7EC 4KT1A 3CIGA 3OJAB 4R5DA 1OZNA 4XSQA 4ARRA 4LI1A 2R9UA 4ECOA 2JE0A 2UZYA 4H09A 3KJ4A 4EZGA 2XWTC 4NKGA 4R09A 3REZA 4RCWA 3WPBA 3C6PB 2Z81A 2JE1A 4MN8B 2CA6A 1O6VA 4RWTC 4CNCA 1K5GC 5A5CA 1PGVA 4BSUA 4WP6A 3WPIA 4GT6A 4QC0A 3OGMB 4CC4A 1P9AG 3W3KA 1G9UA 3E3ZA 3RJ0A 4BV4R 1GWBA 4HQ1A 1LTXA 2ELLA 2WQVA 2WQXA 1DFJI 4R6FA 1M9LA 3CVRA 4L3AA 3ULAA 3G04C 3M19A 4FDWA 1OTMA 5GMGA 4KNGA 4R6AA 2OMYA 2OMTA 1Z7XW 4P8SA 4U06A 4R6JA 1XCDA 1XKUA 2O6SA 1XECA 1FO1A 4AW4A 1D0BA 4OQTA 4Q3IA 4Z79A 1KOOA 4Z8GA 4XGOA 3RFJA 2O6RA 2P1OB 4FS7A 4Q62A 5GMHA 2XOTA 5HDHA 2OMWA 5LFNA 2RA8A 4BSSA 2Z65A 1DS9A 1H6TA 2FT3A 5AZ5A 4Z61C 2WQWA 2Z66A 3VQ1A 4CILA 2WQUA 4FHOA 5IJDA 4XOSA 5AWDA 4MQWX 2Z63A 4R07A 4C2BB 2A0ZA 2Y5QA 4PERA 4TZHA 2RR6A 3VQ2A 3CIYA 5GQRK 3DZEA 4PEQB 2OMUA 4Z94G 2Z62A 3M18A 4QBZA 1M9SA 3W3LA 4Y61B 4RCAB 4YEBB 2P1QB 4CC4C 4LSCA 1P8TA 5HZLB 3C6NB 1FT8A 4ECNA 1M0ZA 4CP6A 3E2JA 5GS2B 1P8VA 4U08A 3E4GA 4Z64C 3RFEA 2O6QA 3OGLB 3W3GA 2JQDA 1U0ND 5IYXC 4UFRA 1SQ0B 4NKHA 1H6UA 4BSRA 2Q4GW 3RW7A 3JB9j 1DCEA 2BNHA 4R0AA 3G3BA 3WPGA 2OMZA 3PMHG 3SB4A 4LSAA 4R08A 3G39A 2P1NB 4LXSA 5B0TA 2ID5A 4PQ8A 3RW6A 3WPDA 2V9TB 4KXFB 4G8AA 1ZIWA 5CMPA 4U09A 3ZYJA 4LSXA 1JL5A 4IM6A 2WFHA 5B4PA 2Z7XB 3UL7A 2ASTB 4J0MA 3O6NA 4V2CA 3RGXA 4Q3GA 1A4YA 4LXRA 3UL8A 1KOHA 4FMZA 1OTOA 1IO0A 3FXIA 2OMVA 2P1PB 3GOZA 4M7EA 3UN9A 5D3IA 3WPCA 3W3NA 3WPFA 1XWDC 4P91A 1FQVA 1OTNA 3WPHA 1M10B 4LI2A 2P1MB 4WYKA 4QXEA 4PSJA 3ULVA
chains in the Genus database with same CATH superfamily
3W3MA 5GS0A 4I6JB 2IFGA 5CMNA 5IJCA 2V9SA 4NZTM 4U7LA 3RFSA 2ASSB 3E6JA 2Z7XA 2OMXA 4R5CA 3WN4A 1O6TA 3ZYNA 4FCGA 3TSRE 4L3FA 5AWCA 2V70A 4B8CD 3G06A 1FS2A 3O53A 1A9NA 5FTTB 3ZYIA 5AWBA 1K5DC 1W8AA 3BZ5A 3G3AA 4J4LA 3P72A 4ARNA 2UZXA 1WWLA 1QYYA 3ULUA 5B0NA 1O6SA 4CNMA 3W3JA 3C6OB 4V2DA 1OOKG 4V2EA 3OJAA 3ZYOA 4LSXC 4GLPA 3A79B 1XEUA 3UL9A 5GMFA 5AWAA 1YRGA 5IJBA 3RGZA 2Z82A 3OGKB 4FD0A 4R58A 4R6GA 4AY9X 2Z64A 4K17A 4PKIG 4C2AB 3WPEA 2BEXA 3RIZA 1OGQA 4M7EC 4KT1A 3CIGA 3OJAB 4R5DA 1OZNA 4XSQA 4ARRA 4LI1A 2R9UA 4ECOA 2JE0A 2UZYA 4H09A 3KJ4A 4EZGA 2XWTC 4NKGA 4R09A 3REZA 4RCWA 3WPBA 3C6PB 2Z81A 2JE1A 4MN8B 2CA6A 1O6VA 4RWTC 4CNCA 1K5GC 5A5CA 1PGVA 4BSUA 4WP6A 3WPIA 4GT6A 4QC0A 3OGMB 4CC4A 1P9AG 3W3KA 1G9UA 3E3ZA 3RJ0A 4BV4R 1GWBA 4HQ1A 1LTXA 2ELLA 2WQVA 2WQXA 1DFJI 4R6FA 1M9LA 3CVRA 4L3AA 3ULAA 3G04C 3M19A 4FDWA 1OTMA 5GMGA 4KNGA 4R6AA 2OMYA 2OMTA 1Z7XW 4P8SA 4U06A 4R6JA 1XCDA 1XKUA 2O6SA 1XECA 4NZRM 1FO1A 4AW4A 1D0BA 4OQTA 4Q3IA 4Z79A 1KOOA 4Z8GA 4XGOA 3RFJA 2O6RA 2P1OB 4FS7A 4Q62A 5GMHA 2XOTA 5HDHA 2OMWA 5LFNA 2RA8A 4BSSA 2Z65A 1DS9A 1H6TA 2FT3A 5AZ5A 4Z61C 2WQWA 2Z66A 3VQ1A 4CILA 2WQUA 4FHOA 5IJDA 4XOSA 5AWDA 4MQWX 2Z63A 4R07A 4C2BB 2A0ZA 2Y5QA 4PERA 4TZHA 2RR6A 3VQ2A 3CIYA 5GQRK 3DZEA 4PEQB 2OMUA 4Z94G 2Z62A 3M18A 4QBZA 1M9SA 3W3LA 4Y61B 4RCAB 4YEBB 2P1QB 4CC4C 4LSCA 1P8TA 5HZLB 3C6NB 1FT8A 4ECNA 1M0ZA 4CP6A 3E2JA 5GS2B 1P8VA 4U08A 3E4GA 4Z64C 3RFEA 2O6QA 3OGLB 3W3GA 2JQDA 1U0ND 5IYXC 4UFRA 1SQ0B 4NKHA 1H6UA 4BSRA 2Q4GW 3RW7A 3JB9j 1DCEA 2BNHA 4R0AA 3G3BA 3WPGA 2OMZA 3PMHG 3SB4A 4LSAA 4R08A 3G39A 2P1NB 4LXSA 5B0TA 2ID5A 4PQ8A 3RW6A 3WPDA 2V9TB 4KXFB 4G8AA 1ZIWA 5CMPA 4U09A 3ZYJA 4LSXA 1JL5A 4IM6A 2WFHA 5B4PA 2Z7XB 3UL7A 2ASTB 4J0MA 3O6NA 4V2CA 3RGXA 4Q3GA 1A4YA 4LXRA 3UL8A 1KOHA 4FMZA 1OTOA 1IO0A 3FXIA 2OMVA 2P1PB 3GOZA 4M7EA 3UN9A 5D3IA 3WPCA 3W3NA 3WPFA 1XWDC 4P91A 1FQVA 1OTNA 3WPHA 1M10B 4LI2A 2P1MB 4WYKA 4QXEA 4PSJA 3ULVA
chains in the Genus database with same CATH topology
3W3MA 5GS0A 4I6JB 2IFGA 5CMNA 5IJCA 2V9SA 4U7LA 3RFSA 2ASSB 3E6JA 2Z7XA 2OMXA 4R5CA 3WN4A 1O6TA 3ZYNA 4FCGA 3TSRE 4L3FA 5AWCA 2V70A 4B8CD 3G06A 1FS2A 3O53A 1A9NA 5FTTB 3ZYIA 5AWBA 1K5DC 1W8AA 3BZ5A 3G3AA 4J4LA 3P72A 4ARNA 2UZXA 1WWLA 1QYYA 3ULUA 5B0NA 1O6SA 4CNMA 3W3JA 3C6OB 4V2DA 1OOKG 4V2EA 3OJAA 3ZYOA 4LSXC 4GLPA 3A79B 1XEUA 3UL9A 5GMFA 5AWAA 1YRGA 5IJBA 3RGZA 2Z82A 3OGKB 4FD0A 4R58A 4R6GA 4AY9X 2Z64A 4K17A 4PKIG 4C2AB 3WPEA 2BEXA 3RIZA 1OGQA 4M7EC 4KT1A 3CIGA 3OJAB 4R5DA 1OZNA 4XSQA 4ARRA 4LI1A 2R9UA 4ECOA 2JE0A 2UZYA 4H09A 3KJ4A 4EZGA 2XWTC 4NKGA 4R09A 3REZA 4RCWA 3WPBA 3C6PB 2Z81A 2JE1A 4MN8B 2CA6A 1O6VA 4RWTC 4CNCA 1K5GC 5A5CA 1PGVA 4BSUA 4WP6A 3WPIA 4GT6A 4QC0A 3OGMB 4CC4A 1P9AG 3W3KA 1G9UA 3E3ZA 3RJ0A 4BV4R 1GWBA 4HQ1A 1LTXA 2ELLA 2WQVA 2WQXA 1DFJI 4R6FA 1M9LA 3CVRA 4L3AA 3ULAA 3G04C 3M19A 4FDWA 1OTMA 5GMGA 4KNGA 4R6AA 2OMYA 2OMTA 1Z7XW 4P8SA 4U06A 4R6JA 1XCDA 1XKUA 2O6SA 1XECA 1FO1A 4AW4A 1D0BA 4OQTA 4Q3IA 4Z79A 1KOOA 4Z8GA 4XGOA 3RFJA 2O6RA 2P1OB 4FS7A 4Q62A 5GMHA 2XOTA 5HDHA 2OMWA 5LFNA 2RA8A 4BSSA 2Z65A 1DS9A 1H6TA 2FT3A 5AZ5A 4Z61C 2WQWA 2Z66A 3VQ1A 4CILA 2WQUA 4FHOA 5IJDA 4XOSA 5AWDA 4MQWX 2Z63A 4R07A 4C2BB 2A0ZA 2Y5QA 4PERA 4TZHA 2RR6A 3VQ2A 3CIYA 5GQRK 3DZEA 4PEQB 2OMUA 4Z94G 2Z62A 3M18A 4QBZA 1M9SA 3W3LA 4Y61B 4RCAB 4YEBB 2P1QB 4CC4C 4LSCA 1P8TA 5HZLB 3C6NB 1FT8A 4ECNA 1M0ZA 4CP6A 3E2JA 5GS2B 1P8VA 4U08A 3E4GA 4Z64C 3RFEA 2O6QA 3OGLB 3W3GA 2JQDA 1U0ND 5IYXC 4UFRA 1SQ0B 4NKHA 1H6UA 4BSRA 2Q4GW 3RW7A 3JB9j 1DCEA 2BNHA 4R0AA 3G3BA 3WPGA 2OMZA 3PMHG 3SB4A 4LSAA 4R08A 3G39A 2P1NB 4LXSA 5B0TA 2ID5A 4PQ8A 3RW6A 3WPDA 2V9TB 4KXFB 4G8AA 1ZIWA 5CMPA 4U09A 3ZYJA 4LSXA 1JL5A 4IM6A 2WFHA 5B4PA 2Z7XB 3UL7A 2ASTB 4J0MA 3O6NA 4V2CA 3RGXA 4Q3GA 1A4YA 4LXRA 3UL8A 1KOHA 4FMZA 1OTOA 1IO0A 3FXIA 2OMVA 2P1PB 3GOZA 4M7EA 3UN9A 5D3IA 3WPCA 3W3NA 3WPFA 1XWDC 4P91A 1FQVA 1OTNA 3WPHA 1M10B 4LI2A 2P1MB 4WYKA 4QXEA 4PSJA 3ULVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W3M A;  5GS0 A;  4I6J B;  2IFG A;  5CMN A;  5IJC A;  2V9S A;  4U7L A;  3RFS A;  2ASS B;  3E6J A;  2Z7X A;  2OMX A;  4R5C A;  3WN4 A;  1O6T A;  3ZYN A;  4FCG A;  3TSR E;  4L3F A;  5AWC A;  2V70 A;  4B8C D;  3G06 A;  1FS2 A;  3O53 A;  1A9N A;  5FTT B;  3ZYI A;  5AWB A;  1K5D C;  1W8A A;  3BZ5 A;  3G3A A;  4J4L A;  3P72 A;  4ARN A;  2UZX A;  1WWL A;  1QYY A;  3ULU A;  5B0N A;  1O6S A;  4CNM A;  3W3J A;  3C6O B;  4V2D A;  1OOK G;  4V2E A;  3OJA A;  3ZYO A;  4LSX C;  4GLP A;  3A79 B;  1XEU A;  3UL9 A;  5GMF A;  5AWA A;  1YRG A;  5IJB A;  3RGZ A;  2Z82 A;  3OGK B;  4FD0 A;  4R58 A;  4R6G A;  4AY9 X;  2Z64 A;  4K17 A;  4PKI G;  4C2A B;  3WPE A;  2BEX A;  3RIZ A;  1OGQ A;  4M7E C;  4KT1 A;  3CIG A;  3OJA B;  4R5D A;  1OZN A;  4XSQ A;  4ARR A;  4LI1 A;  2R9U A;  4ECO A;  2JE0 A;  2UZY A;  4H09 A;  3KJ4 A;  4EZG A;  2XWT C;  4NKG A;  4R09 A;  3REZ A;  4RCW A;  3WPB A;  3C6P B;  2Z81 A;  2JE1 A;  4MN8 B;  2CA6 A;  1O6V A;  4RWT C;  4CNC A;  1K5G C;  5A5C A;  1PGV A;  4BSU A;  4WP6 A;  3WPI A;  4GT6 A;  4QC0 A;  3OGM B;  4CC4 A;  1P9A G;  3W3K A;  1G9U A;  3E3Z A;  3RJ0 A;  4BV4 R;  1GWB A;  4HQ1 A;  1LTX A;  2ELL A;  2WQV A;  2WQX A;  1DFJ I;  4R6F A;  1M9L A;  3CVR A;  4L3A A;  3ULA A;  3G04 C;  3M19 A;  4FDW A;  1OTM A;  5GMG A;  4KNG A;  4R6A A;  2OMY A;  2OMT A;  1Z7X W;  4P8S A;  4U06 A;  4R6J A;  1XCD A;  1XKU A;  2O6S A;  1XEC A;  1FO1 A;  4AW4 A;  1D0B A;  4OQT A;  4Q3I A;  4Z79 A;  1KOO A;  4Z8G A;  4XGO A;  3RFJ A;  2O6R A;  2P1O B;  4FS7 A;  4Q62 A;  5GMH A;  2XOT A;  5HDH A;  2OMW A;  5LFN A;  2RA8 A;  4BSS A;  2Z65 A;  1DS9 A;  1H6T A;  2FT3 A;  5AZ5 A;  4Z61 C;  2WQW A;  2Z66 A;  3VQ1 A;  4CIL A;  2WQU A;  4FHO A;  5IJD A;  4XOS A;  5AWD A;  4MQW X;  2Z63 A;  4R07 A;  4C2B B;  2A0Z A;  2Y5Q A;  4PER A;  4TZH A;  2RR6 A;  3VQ2 A;  3CIY A;  5GQR K;  3DZE A;  4PEQ B;  2OMU A;  4Z94 G;  2Z62 A;  3M18 A;  4QBZ A;  1M9S A;  3W3L A;  4Y61 B;  4RCA B;  4YEB B;  2P1Q B;  4CC4 C;  4LSC A;  1P8T A;  5HZL B;  3C6N B;  1FT8 A;  4ECN A;  1M0Z A;  4CP6 A;  3E2J A;  5GS2 B;  1P8V A;  4U08 A;  3E4G A;  4Z64 C;  3RFE A;  2O6Q A;  3OGL B;  3W3G A;  2JQD A;  1U0N D;  5IYX C;  4UFR A;  1SQ0 B;  4NKH A;  1H6U A;  4BSR A;  2Q4G W;  3RW7 A;  3JB9 j;  1DCE A;  2BNH A;  4R0A A;  3G3B A;  3WPG A;  2OMZ A;  3PMH G;  3SB4 A;  4LSA A;  4R08 A;  3G39 A;  2P1N B;  4LXS A;  5B0T A;  2ID5 A;  4PQ8 A;  3RW6 A;  3WPD A;  2V9T B;  4KXF B;  4G8A A;  1ZIW A;  5CMP A;  4U09 A;  3ZYJ A;  4LSX A;  1JL5 A;  4IM6 A;  2WFH A;  5B4P A;  2Z7X B;  3UL7 A;  2AST B;  4J0M A;  3O6N A;  4V2C A;  3RGX A;  4Q3G A;  1A4Y A;  4LXR A;  3UL8 A;  1KOH A;  4FMZ A;  1OTO A;  1IO0 A;  3FXI A;  2OMV A;  2P1P B;  3GOZ A;  4M7E A;  3UN9 A;  5D3I A;  3WPC A;  3W3N A;  3WPF A;  1XWD C;  4P91 A;  1FQV A;  1OTN A;  3WPH A;  1M10 B;  4LI2 A;  2P1M B;  4WYK A;  4QXE A;  4PSJ A;  3ULV A; 
#chains in the Genus database with same CATH topology
 3W3M A;  5GS0 A;  4I6J B;  2IFG A;  5CMN A;  5IJC A;  2V9S A;  4NZT M;  4U7L A;  3RFS A;  2ASS B;  3E6J A;  2Z7X A;  2OMX A;  4R5C A;  3WN4 A;  1O6T A;  3ZYN A;  4FCG A;  3TSR E;  4L3F A;  5AWC A;  2V70 A;  4B8C D;  3G06 A;  1FS2 A;  3O53 A;  1A9N A;  5FTT B;  3ZYI A;  5AWB A;  1K5D C;  1W8A A;  3BZ5 A;  3G3A A;  4J4L A;  3P72 A;  4ARN A;  2UZX A;  1WWL A;  1QYY A;  3ULU A;  5B0N A;  1O6S A;  4CNM A;  3W3J A;  3C6O B;  4V2D A;  1OOK G;  4V2E A;  3OJA A;  3ZYO A;  4LSX C;  4GLP A;  3A79 B;  1XEU A;  3UL9 A;  5GMF A;  5AWA A;  1YRG A;  5IJB A;  3RGZ A;  2Z82 A;  3OGK B;  4FD0 A;  4R58 A;  4R6G A;  4AY9 X;  2Z64 A;  4K17 A;  4PKI G;  4C2A B;  3WPE A;  2BEX A;  3RIZ A;  1OGQ A;  4M7E C;  4KT1 A;  3CIG A;  3OJA B;  4R5D A;  1OZN A;  4XSQ A;  4ARR A;  4LI1 A;  2R9U A;  4ECO A;  2JE0 A;  2UZY A;  4H09 A;  3KJ4 A;  4EZG A;  2XWT C;  4NKG A;  4R09 A;  3REZ A;  4RCW A;  3WPB A;  3C6P B;  2Z81 A;  2JE1 A;  4MN8 B;  2CA6 A;  1O6V A;  4RWT C;  4CNC A;  1K5G C;  5A5C A;  1PGV A;  4BSU A;  4WP6 A;  3WPI A;  4GT6 A;  4QC0 A;  3OGM B;  4CC4 A;  1P9A G;  3W3K A;  1G9U A;  3E3Z A;  3RJ0 A;  4BV4 R;  1GWB A;  4HQ1 A;  1LTX A;  2ELL A;  2WQV A;  2WQX A;  1DFJ I;  4R6F A;  1M9L A;  3CVR A;  4L3A A;  3ULA A;  3G04 C;  3M19 A;  4FDW A;  1OTM A;  5GMG A;  4KNG A;  4R6A A;  2OMY A;  2OMT A;  1Z7X W;  4P8S A;  4U06 A;  4R6J A;  1XCD A;  1XKU A;  2O6S A;  1XEC A;  4NZR M;  1FO1 A;  4AW4 A;  1D0B A;  4OQT A;  4Q3I A;  4Z79 A;  1KOO A;  4Z8G A;  4XGO A;  3RFJ A;  2O6R A;  2P1O B;  4FS7 A;  4Q62 A;  5GMH A;  2XOT A;  5HDH A;  2OMW A;  5LFN A;  2RA8 A;  4BSS A;  2Z65 A;  1DS9 A;  1H6T A;  2FT3 A;  5AZ5 A;  4Z61 C;  2WQW A;  2Z66 A;  3VQ1 A;  4CIL A;  2WQU A;  4FHO A;  5IJD A;  4XOS A;  5AWD A;  4MQW X;  2Z63 A;  4R07 A;  4C2B B;  2A0Z A;  2Y5Q A;  4PER A;  4TZH A;  2RR6 A;  3VQ2 A;  3CIY A;  5GQR K;  3DZE A;  4PEQ B;  2OMU A;  4Z94 G;  2Z62 A;  3M18 A;  4QBZ A;  1M9S A;  3W3L A;  4Y61 B;  4RCA B;  4YEB B;  2P1Q B;  4CC4 C;  4LSC A;  1P8T A;  5HZL B;  3C6N B;  1FT8 A;  4ECN A;  1M0Z A;  4CP6 A;  3E2J A;  5GS2 B;  1P8V A;  4U08 A;  3E4G A;  4Z64 C;  3RFE A;  2O6Q A;  3OGL B;  3W3G A;  2JQD A;  1U0N D;  5IYX C;  4UFR A;  1SQ0 B;  4NKH A;  1H6U A;  4BSR A;  2Q4G W;  3RW7 A;  3JB9 j;  1DCE A;  2BNH A;  4R0A A;  3G3B A;  3WPG A;  2OMZ A;  3PMH G;  3SB4 A;  4LSA A;  4R08 A;  3G39 A;  2P1N B;  4LXS A;  5B0T A;  2ID5 A;  4PQ8 A;  3RW6 A;  3WPD A;  2V9T B;  4KXF B;  4G8A A;  1ZIW A;  5CMP A;  4U09 A;  3ZYJ A;  4LSX A;  1JL5 A;  4IM6 A;  2WFH A;  5B4P A;  2Z7X B;  3UL7 A;  2AST B;  4J0M A;  3O6N A;  4V2C A;  3RGX A;  4Q3G A;  1A4Y A;  4LXR A;  3UL8 A;  1KOH A;  4FMZ A;  1OTO A;  1IO0 A;  3FXI A;  2OMV A;  2P1P B;  3GOZ A;  4M7E A;  3UN9 A;  5D3I A;  3WPC A;  3W3N A;  3WPF A;  1XWD C;  4P91 A;  1FQV A;  1OTN A;  3WPH A;  1M10 B;  4LI2 A;  2P1M B;  4WYK A;  4QXE A;  4PSJ A;  3ULV A; 
#chains in the Genus database with same CATH homology
 3W3M A;  5GS0 A;  4I6J B;  2IFG A;  5CMN A;  5IJC A;  2V9S A;  4U7L A;  3RFS A;  2ASS B;  3E6J A;  2Z7X A;  2OMX A;  4R5C A;  3WN4 A;  1O6T A;  3ZYN A;  4FCG A;  3TSR E;  4L3F A;  5AWC A;  2V70 A;  4B8C D;  3G06 A;  1FS2 A;  3O53 A;  1A9N A;  5FTT B;  3ZYI A;  5AWB A;  1K5D C;  1W8A A;  3BZ5 A;  3G3A A;  4J4L A;  3P72 A;  4ARN A;  2UZX A;  1WWL A;  1QYY A;  3ULU A;  5B0N A;  1O6S A;  4CNM A;  3W3J A;  3C6O B;  4V2D A;  1OOK G;  4V2E A;  3OJA A;  3ZYO A;  4LSX C;  4GLP A;  3A79 B;  1XEU A;  3UL9 A;  5GMF A;  5AWA A;  1YRG A;  5IJB A;  3RGZ A;  2Z82 A;  3OGK B;  4FD0 A;  4R58 A;  4R6G A;  4AY9 X;  2Z64 A;  4K17 A;  4PKI G;  4C2A B;  3WPE A;  2BEX A;  3RIZ A;  1OGQ A;  4M7E C;  4KT1 A;  3CIG A;  3OJA B;  4R5D A;  1OZN A;  4XSQ A;  4ARR A;  4LI1 A;  2R9U A;  4ECO A;  2JE0 A;  2UZY A;  4H09 A;  3KJ4 A;  4EZG A;  2XWT C;  4NKG A;  4R09 A;  3REZ A;  4RCW A;  3WPB A;  3C6P B;  2Z81 A;  2JE1 A;  4MN8 B;  2CA6 A;  1O6V A;  4RWT C;  4CNC A;  1K5G C;  5A5C A;  1PGV A;  4BSU A;  4WP6 A;  3WPI A;  4GT6 A;  4QC0 A;  3OGM B;  4CC4 A;  1P9A G;  3W3K A;  1G9U A;  3E3Z A;  3RJ0 A;  4BV4 R;  1GWB A;  4HQ1 A;  1LTX A;  2ELL A;  2WQV A;  2WQX A;  1DFJ I;  4R6F A;  1M9L A;  3CVR A;  4L3A A;  3ULA A;  3G04 C;  3M19 A;  4FDW A;  1OTM A;  5GMG A;  4KNG A;  4R6A A;  2OMY A;  2OMT A;  1Z7X W;  4P8S A;  4U06 A;  4R6J A;  1XCD A;  1XKU A;  2O6S A;  1XEC A;  1FO1 A;  4AW4 A;  1D0B A;  4OQT A;  4Q3I A;  4Z79 A;  1KOO A;  4Z8G A;  4XGO A;  3RFJ A;  2O6R A;  2P1O B;  4FS7 A;  4Q62 A;  5GMH A;  2XOT A;  5HDH A;  2OMW A;  5LFN A;  2RA8 A;  4BSS A;  2Z65 A;  1DS9 A;  1H6T A;  2FT3 A;  5AZ5 A;  4Z61 C;  2WQW A;  2Z66 A;  3VQ1 A;  4CIL A;  2WQU A;  4FHO A;  5IJD A;  4XOS A;  5AWD A;  4MQW X;  2Z63 A;  4R07 A;  4C2B B;  2A0Z A;  2Y5Q A;  4PER A;  4TZH A;  2RR6 A;  3VQ2 A;  3CIY A;  5GQR K;  3DZE A;  4PEQ B;  2OMU A;  4Z94 G;  2Z62 A;  3M18 A;  4QBZ A;  1M9S A;  3W3L A;  4Y61 B;  4RCA B;  4YEB B;  2P1Q B;  4CC4 C;  4LSC A;  1P8T A;  5HZL B;  3C6N B;  1FT8 A;  4ECN A;  1M0Z A;  4CP6 A;  3E2J A;  5GS2 B;  1P8V A;  4U08 A;  3E4G A;  4Z64 C;  3RFE A;  2O6Q A;  3OGL B;  3W3G A;  2JQD A;  1U0N D;  5IYX C;  4UFR A;  1SQ0 B;  4NKH A;  1H6U A;  4BSR A;  2Q4G W;  3RW7 A;  3JB9 j;  1DCE A;  2BNH A;  4R0A A;  3G3B A;  3WPG A;  2OMZ A;  3PMH G;  3SB4 A;  4LSA A;  4R08 A;  3G39 A;  2P1N B;  4LXS A;  5B0T A;  2ID5 A;  4PQ8 A;  3RW6 A;  3WPD A;  2V9T B;  4KXF B;  4G8A A;  1ZIW A;  5CMP A;  4U09 A;  3ZYJ A;  4LSX A;  1JL5 A;  4IM6 A;  2WFH A;  5B4P A;  2Z7X B;  3UL7 A;  2AST B;  4J0M A;  3O6N A;  4V2C A;  3RGX A;  4Q3G A;  1A4Y A;  4LXR A;  3UL8 A;  1KOH A;  4FMZ A;  1OTO A;  1IO0 A;  3FXI A;  2OMV A;  2P1P B;  3GOZ A;  4M7E A;  3UN9 A;  5D3I A;  3WPC A;  3W3N A;  3WPF A;  1XWD C;  4P91 A;  1FQV A;  1OTN A;  3WPH A;  1M10 B;  4LI2 A;  2P1M B;  4WYK A;  4QXE A;  4PSJ A;  3ULV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...