4ARRA

Crystal structure of the n-terminal domain of drosophila toll receptor with the magic triangle i3c
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
272
structure length
272
Chain Sequence
SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Liesegang-Like Patterns of Toll Crystals Grown in Gel.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Immune system
molecule keywords TOLL RECEPTOR, VARIABLE LYMPHOCYTE RECEPTOR B.61 CHIMERA
total genus 76
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4arrA00
2IFGA 4CILA 5IJBA 2RR6A 4V2EA 1IO0A 2JQDA 3E2JA 4RWTC 2A0ZA 2OMVA 4GT6A 4MN8B 4QXEA 2WQUA 2UZXA 4V2DA 4R09A 4R6AA 1A4YA 1K5DC 4R6JA 3RGZA 3W3LA 3WPIA 4P8SA 4CC4C 4V2CA 3P72A 3WPEA 4H09A 4Z79A 4CP6A 4Q3IA 5FTTB 1OGQA 4M7EA 2UZYA 3WN4A 1P8TA 4KNGA 3UL7A 4PQ8A 4PSJA 4R5CA 1XECA 4UFRA 2FT3A 4YEBB 1XKUA 1LTXA 1OTNA 2JE0A 2OMXA 1JL5A 5GQRK 1O6SA 2P1QB 3CVRA 2BEXA 2WFHA 2XOTA 4FD0A 4BV4R 4Z61C 5AWAA 3W3NA 4PEQB 4I6JB 3DZEA 1DS9A 3SB4A 3PMHG 4R58A 4GLPA 1O6VA 4AY9X 5AWBA 1OOKG 1QYYA 2O6QA 2RA8A 3VQ2A 3A79B 2V9SA 4RCWA 4XSQA 3W3KA 3OGLB 2Z64A 4OQTA 4TZHA 1H6UA 4WP6A 4LSAA 3FXIA 4Q62A 1O6TA 3O6NA 5B0NA 5B0TA 3E6JA 1G9UA 3G3BA 2Y5QA 4FCGA 4ECNA 5AWCA 4LSCA 4R6FA 2Z66A 3KJ4A 3VQ1A 2JE1A 1FS2A 3WPFA 4BSSA 3RIZA 2WQVA 3RJ0A 2V9TB 4BSRA 4QC0A 1GWBA 3OJAB 4MQWX 4KXFB 4R5DA 5D3IA 1K5GC 2WQWA 3UN9A 1OTOA 5IYXC 1M0ZA 1M9LA 3G06A 5B4PA 4CNCA 3ULVA 4Z64C 3O53A 2ASSB 1WWLA 5A5CA 5GMGA 3WPCA 4LSXA 5HZLB 1XWDC 1FT8A 4K17A 3OGKB 4R6GA 4C2AB 4ECOA 2CA6A 4KT1A 4BSUA 1M9SA 2P1MB 3WPHA 5AWDA 4IM6A 2P1OB 2WQXA 4FDWA 2BNHA 2Z65A 3ZYIA 2ELLA 3E4GA 4Z8GA 3RGXA 5GMFA 1DCEA 3M18A 2ID5A 4U09A 1W8AA 4FHOA 2Z7XB 3RFSA 3ZYOA 4PKIG 4QBZA 1Z7XW 2P1PB 2Z82A 4R0AA 1OZNA 1SQ0B 3UL8A 3W3MA 3G3AA 4LI1A 4U7LA 3WPGA 3RFJA 2V70A 3C6OB 3RW7A 3REZA 3OGMB 2OMTA 2Z7XA 1XCDA 2Z62A 3RFEA 5IJCA 1KOOA 2OMUA 1D0BA 3W3GA 4HQ1A 2Z63A 4RCAB 5GS2B 2Z81A 4CC4A 1ZIWA 3G04C 4Z94G 5GS0A 4XGOA 5LFNA 2OMWA 3ULAA 1DFJI 3E3ZA 1U0ND 3BZ5A 1M10B 4FMZA 4LI2A 4WYKA 3TSRE 4AW4A 2OMZA 4R08A 5AZ5A 5IJDA 4FS7A 2XWTC 1FO1A 4LXRA 3W3JA 2O6SA 3M19A 3RW6A 1FQVA 1P9AG 4C2BB 1PGVA 4B8CD 4LSXC 1A9NA 4EZGA 3OJAA 1P8VA 4Y61B 4J0MA 4CNMA 2P1NB 3UL9A 4PERA 3C6NB 3G39A 1KOHA 2OMYA 5CMNA 2O6RA 2Q4GW 4L3AA 4M7EC 1XEUA 2R9UA 4Q3GA 3GOZA 4P91A 4R07A 3WPDA 3ULUA 4XOSA 4NKGA 4U06A 2ASTB 3CIYA 3C6PB 5HDHA 4NKHA 4U08A 5CMPA 1OTMA 4ARRA 3CIGA 4L3FA 1YRGA 3JB9j 5GMHA 4ARNA 4G8AA 3WPBA 4J4LA 3ZYNA 1H6TA 4LXSA 3ZYJA
chains in the Genus database with same CATH superfamily
2IFGA 4CILA 5IJBA 2RR6A 4V2EA 1IO0A 2JQDA 3E2JA 4RWTC 2A0ZA 2OMVA 4GT6A 4MN8B 4QXEA 2WQUA 2UZXA 4V2DA 4R09A 4R6AA 1A4YA 1K5DC 4R6JA 3RGZA 3W3LA 3WPIA 4P8SA 4CC4C 4V2CA 3P72A 3WPEA 4H09A 4Z79A 4CP6A 4Q3IA 5FTTB 1OGQA 4M7EA 2UZYA 3WN4A 1P8TA 4KNGA 3UL7A 4PQ8A 4PSJA 4R5CA 1XECA 4UFRA 2FT3A 4YEBB 1XKUA 1LTXA 1OTNA 2JE0A 2OMXA 1JL5A 5GQRK 1O6SA 2P1QB 3CVRA 2BEXA 2WFHA 2XOTA 4FD0A 4BV4R 4Z61C 5AWAA 3W3NA 4PEQB 4I6JB 3DZEA 1DS9A 3SB4A 3PMHG 4R58A 4GLPA 1O6VA 4AY9X 5AWBA 1OOKG 1QYYA 2O6QA 2RA8A 3VQ2A 3A79B 2V9SA 4RCWA 4XSQA 3W3KA 3OGLB 2Z64A 4OQTA 4TZHA 1H6UA 4WP6A 4NZTM 4LSAA 3FXIA 4Q62A 1O6TA 3O6NA 5B0NA 5B0TA 3E6JA 1G9UA 3G3BA 2Y5QA 4FCGA 4ECNA 5AWCA 4LSCA 4R6FA 2Z66A 3KJ4A 3VQ1A 2JE1A 1FS2A 3WPFA 4BSSA 3RIZA 2WQVA 3RJ0A 2V9TB 4BSRA 4QC0A 1GWBA 3OJAB 4MQWX 4KXFB 4R5DA 5D3IA 1K5GC 2WQWA 3UN9A 1OTOA 5IYXC 1M0ZA 1M9LA 3G06A 5B4PA 4CNCA 3ULVA 4Z64C 3O53A 2ASSB 1WWLA 5A5CA 5GMGA 3WPCA 4LSXA 5HZLB 1XWDC 1FT8A 4K17A 3OGKB 4R6GA 4C2AB 4ECOA 2CA6A 4KT1A 4BSUA 1M9SA 2P1MB 3WPHA 5AWDA 4IM6A 2P1OB 2WQXA 4FDWA 2BNHA 2Z65A 3ZYIA 2ELLA 3E4GA 4Z8GA 3RGXA 5GMFA 1DCEA 3M18A 2ID5A 4U09A 1W8AA 4FHOA 2Z7XB 3RFSA 3ZYOA 4PKIG 4QBZA 1Z7XW 2P1PB 2Z82A 4R0AA 1OZNA 1SQ0B 3UL8A 3W3MA 3G3AA 4LI1A 4U7LA 3WPGA 3RFJA 2V70A 3C6OB 3RW7A 3REZA 3OGMB 2OMTA 2Z7XA 1XCDA 2Z62A 3RFEA 5IJCA 1KOOA 2OMUA 1D0BA 3W3GA 4HQ1A 2Z63A 4RCAB 5GS2B 2Z81A 4CC4A 1ZIWA 3G04C 4Z94G 5GS0A 4XGOA 5LFNA 2OMWA 3ULAA 1DFJI 3E3ZA 1U0ND 3BZ5A 1M10B 4FMZA 4LI2A 4WYKA 3TSRE 4AW4A 2OMZA 4R08A 5AZ5A 5IJDA 4FS7A 2XWTC 1FO1A 4LXRA 3W3JA 2O6SA 3M19A 3RW6A 1FQVA 1P9AG 4C2BB 1PGVA 4B8CD 4LSXC 1A9NA 4EZGA 3OJAA 1P8VA 4Y61B 4J0MA 4CNMA 2P1NB 3UL9A 4PERA 3C6NB 3G39A 1KOHA 2OMYA 5CMNA 2O6RA 2Q4GW 4L3AA 4M7EC 1XEUA 2R9UA 4Q3GA 3GOZA 4P91A 4R07A 3WPDA 3ULUA 4XOSA 4NKGA 4U06A 2ASTB 3CIYA 3C6PB 5HDHA 4NKHA 4U08A 5CMPA 1OTMA 4ARRA 3CIGA 4L3FA 1YRGA 3JB9j 5GMHA 4NZRM 4ARNA 4G8AA 3WPBA 4J4LA 3ZYNA 1H6TA 4LXSA 3ZYJA
chains in the Genus database with same CATH topology
2IFGA 4CILA 5IJBA 2RR6A 4V2EA 1IO0A 2JQDA 3E2JA 4RWTC 2A0ZA 2OMVA 4GT6A 4MN8B 4QXEA 2WQUA 2UZXA 4V2DA 4R09A 4R6AA 1A4YA 1K5DC 4R6JA 3RGZA 3W3LA 3WPIA 4P8SA 4CC4C 4V2CA 3P72A 3WPEA 4H09A 4Z79A 4CP6A 4Q3IA 5FTTB 1OGQA 4M7EA 2UZYA 3WN4A 1P8TA 4KNGA 3UL7A 4PQ8A 4PSJA 4R5CA 1XECA 4UFRA 2FT3A 4YEBB 1XKUA 1LTXA 1OTNA 2JE0A 2OMXA 1JL5A 5GQRK 1O6SA 2P1QB 3CVRA 2BEXA 2WFHA 2XOTA 4FD0A 4BV4R 4Z61C 5AWAA 3W3NA 4PEQB 4I6JB 3DZEA 1DS9A 3SB4A 3PMHG 4R58A 4GLPA 1O6VA 4AY9X 5AWBA 1OOKG 1QYYA 2O6QA 2RA8A 3VQ2A 3A79B 2V9SA 4RCWA 4XSQA 3W3KA 3OGLB 2Z64A 4OQTA 4TZHA 1H6UA 4WP6A 4LSAA 3FXIA 4Q62A 1O6TA 3O6NA 5B0NA 5B0TA 3E6JA 1G9UA 3G3BA 2Y5QA 4FCGA 4ECNA 5AWCA 4LSCA 4R6FA 2Z66A 3KJ4A 3VQ1A 2JE1A 1FS2A 3WPFA 4BSSA 3RIZA 2WQVA 3RJ0A 2V9TB 4BSRA 4QC0A 1GWBA 3OJAB 4MQWX 4KXFB 4R5DA 5D3IA 1K5GC 2WQWA 3UN9A 1OTOA 5IYXC 1M0ZA 1M9LA 3G06A 5B4PA 4CNCA 3ULVA 4Z64C 3O53A 2ASSB 1WWLA 5A5CA 5GMGA 3WPCA 4LSXA 5HZLB 1XWDC 1FT8A 4K17A 3OGKB 4R6GA 4C2AB 4ECOA 2CA6A 4KT1A 4BSUA 1M9SA 2P1MB 3WPHA 5AWDA 4IM6A 2P1OB 2WQXA 4FDWA 2BNHA 2Z65A 3ZYIA 2ELLA 3E4GA 4Z8GA 3RGXA 5GMFA 1DCEA 3M18A 2ID5A 4U09A 1W8AA 4FHOA 2Z7XB 3RFSA 3ZYOA 4PKIG 4QBZA 1Z7XW 2P1PB 2Z82A 4R0AA 1OZNA 1SQ0B 3UL8A 3W3MA 3G3AA 4LI1A 4U7LA 3WPGA 3RFJA 2V70A 3C6OB 3RW7A 3REZA 3OGMB 2OMTA 2Z7XA 1XCDA 2Z62A 3RFEA 5IJCA 1KOOA 2OMUA 1D0BA 3W3GA 4HQ1A 2Z63A 4RCAB 5GS2B 2Z81A 4CC4A 1ZIWA 3G04C 4Z94G 5GS0A 4XGOA 5LFNA 2OMWA 3ULAA 1DFJI 3E3ZA 1U0ND 3BZ5A 1M10B 4FMZA 4LI2A 4WYKA 3TSRE 4AW4A 2OMZA 4R08A 5AZ5A 5IJDA 4FS7A 2XWTC 1FO1A 4LXRA 3W3JA 2O6SA 3M19A 3RW6A 1FQVA 1P9AG 4C2BB 1PGVA 4B8CD 4LSXC 1A9NA 4EZGA 3OJAA 1P8VA 4Y61B 4J0MA 4CNMA 2P1NB 3UL9A 4PERA 3C6NB 3G39A 1KOHA 2OMYA 5CMNA 2O6RA 2Q4GW 4L3AA 4M7EC 1XEUA 2R9UA 4Q3GA 3GOZA 4P91A 4R07A 3WPDA 3ULUA 4XOSA 4NKGA 4U06A 2ASTB 3CIYA 3C6PB 5HDHA 4NKHA 4U08A 5CMPA 1OTMA 4ARRA 3CIGA 4L3FA 1YRGA 3JB9j 5GMHA 4ARNA 4G8AA 3WPBA 4J4LA 3ZYNA 1H6TA 4LXSA 3ZYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFG A;  4CIL A;  5IJB A;  2RR6 A;  4V2E A;  1IO0 A;  2JQD A;  3E2J A;  4RWT C;  2A0Z A;  2OMV A;  4GT6 A;  4MN8 B;  4QXE A;  2WQU A;  2UZX A;  4V2D A;  4R09 A;  4R6A A;  1A4Y A;  1K5D C;  4R6J A;  3RGZ A;  3W3L A;  3WPI A;  4P8S A;  4CC4 C;  4V2C A;  3P72 A;  3WPE A;  4H09 A;  4Z79 A;  4CP6 A;  4Q3I A;  5FTT B;  1OGQ A;  4M7E A;  2UZY A;  3WN4 A;  1P8T A;  4KNG A;  3UL7 A;  4PQ8 A;  4PSJ A;  4R5C A;  1XEC A;  4UFR A;  2FT3 A;  4YEB B;  1XKU A;  1LTX A;  1OTN A;  2JE0 A;  2OMX A;  1JL5 A;  5GQR K;  1O6S A;  2P1Q B;  3CVR A;  2BEX A;  2WFH A;  2XOT A;  4FD0 A;  4BV4 R;  4Z61 C;  5AWA A;  3W3N A;  4PEQ B;  4I6J B;  3DZE A;  1DS9 A;  3SB4 A;  3PMH G;  4R58 A;  4GLP A;  1O6V A;  4AY9 X;  5AWB A;  1OOK G;  1QYY A;  2O6Q A;  2RA8 A;  3VQ2 A;  3A79 B;  2V9S A;  4RCW A;  4XSQ A;  3W3K A;  3OGL B;  2Z64 A;  4OQT A;  4TZH A;  1H6U A;  4WP6 A;  4LSA A;  3FXI A;  4Q62 A;  1O6T A;  3O6N A;  5B0N A;  5B0T A;  3E6J A;  1G9U A;  3G3B A;  2Y5Q A;  4FCG A;  4ECN A;  5AWC A;  4LSC A;  4R6F A;  2Z66 A;  3KJ4 A;  3VQ1 A;  2JE1 A;  1FS2 A;  3WPF A;  4BSS A;  3RIZ A;  2WQV A;  3RJ0 A;  2V9T B;  4BSR A;  4QC0 A;  1GWB A;  3OJA B;  4MQW X;  4KXF B;  4R5D A;  5D3I A;  1K5G C;  2WQW A;  3UN9 A;  1OTO A;  5IYX C;  1M0Z A;  1M9L A;  3G06 A;  5B4P A;  4CNC A;  3ULV A;  4Z64 C;  3O53 A;  2ASS B;  1WWL A;  5A5C A;  5GMG A;  3WPC A;  4LSX A;  5HZL B;  1XWD C;  1FT8 A;  4K17 A;  3OGK B;  4R6G A;  4C2A B;  4ECO A;  2CA6 A;  4KT1 A;  4BSU A;  1M9S A;  2P1M B;  3WPH A;  5AWD A;  4IM6 A;  2P1O B;  2WQX A;  4FDW A;  2BNH A;  2Z65 A;  3ZYI A;  2ELL A;  3E4G A;  4Z8G A;  3RGX A;  5GMF A;  1DCE A;  3M18 A;  2ID5 A;  4U09 A;  1W8A A;  4FHO A;  2Z7X B;  3RFS A;  3ZYO A;  4PKI G;  4QBZ A;  1Z7X W;  2P1P B;  2Z82 A;  4R0A A;  1OZN A;  1SQ0 B;  3UL8 A;  3W3M A;  3G3A A;  4LI1 A;  4U7L A;  3WPG A;  3RFJ A;  2V70 A;  3C6O B;  3RW7 A;  3REZ A;  3OGM B;  2OMT A;  2Z7X A;  1XCD A;  2Z62 A;  3RFE A;  5IJC A;  1KOO A;  2OMU A;  1D0B A;  3W3G A;  4HQ1 A;  2Z63 A;  4RCA B;  5GS2 B;  2Z81 A;  4CC4 A;  1ZIW A;  3G04 C;  4Z94 G;  5GS0 A;  4XGO A;  5LFN A;  2OMW A;  3ULA A;  1DFJ I;  3E3Z A;  1U0N D;  3BZ5 A;  1M10 B;  4FMZ A;  4LI2 A;  4WYK A;  3TSR E;  4AW4 A;  2OMZ A;  4R08 A;  5AZ5 A;  5IJD A;  4FS7 A;  2XWT C;  1FO1 A;  4LXR A;  3W3J A;  2O6S A;  3M19 A;  3RW6 A;  1FQV A;  1P9A G;  4C2B B;  1PGV A;  4B8C D;  4LSX C;  1A9N A;  4EZG A;  3OJA A;  1P8V A;  4Y61 B;  4J0M A;  4CNM A;  2P1N B;  3UL9 A;  4PER A;  3C6N B;  3G39 A;  1KOH A;  2OMY A;  5CMN A;  2O6R A;  2Q4G W;  4L3A A;  4M7E C;  1XEU A;  2R9U A;  4Q3G A;  3GOZ A;  4P91 A;  4R07 A;  3WPD A;  3ULU A;  4XOS A;  4NKG A;  4U06 A;  2AST B;  3CIY A;  3C6P B;  5HDH A;  4NKH A;  4U08 A;  5CMP A;  1OTM A;  4ARR A;  3CIG A;  4L3F A;  1YRG A;  3JB9 j;  5GMH A;  4ARN A;  4G8A A;  3WPB A;  4J4L A;  3ZYN A;  1H6T A;  4LXS A;  3ZYJ A; 
#chains in the Genus database with same CATH topology
 2IFG A;  4CIL A;  5IJB A;  2RR6 A;  4V2E A;  1IO0 A;  2JQD A;  3E2J A;  4RWT C;  2A0Z A;  2OMV A;  4GT6 A;  4MN8 B;  4QXE A;  2WQU A;  2UZX A;  4V2D A;  4R09 A;  4R6A A;  1A4Y A;  1K5D C;  4R6J A;  3RGZ A;  3W3L A;  3WPI A;  4P8S A;  4CC4 C;  4V2C A;  3P72 A;  3WPE A;  4H09 A;  4Z79 A;  4CP6 A;  4Q3I A;  5FTT B;  1OGQ A;  4M7E A;  2UZY A;  3WN4 A;  1P8T A;  4KNG A;  3UL7 A;  4PQ8 A;  4PSJ A;  4R5C A;  1XEC A;  4UFR A;  2FT3 A;  4YEB B;  1XKU A;  1LTX A;  1OTN A;  2JE0 A;  2OMX A;  1JL5 A;  5GQR K;  1O6S A;  2P1Q B;  3CVR A;  2BEX A;  2WFH A;  2XOT A;  4FD0 A;  4BV4 R;  4Z61 C;  5AWA A;  3W3N A;  4PEQ B;  4I6J B;  3DZE A;  1DS9 A;  3SB4 A;  3PMH G;  4R58 A;  4GLP A;  1O6V A;  4AY9 X;  5AWB A;  1OOK G;  1QYY A;  2O6Q A;  2RA8 A;  3VQ2 A;  3A79 B;  2V9S A;  4RCW A;  4XSQ A;  3W3K A;  3OGL B;  2Z64 A;  4OQT A;  4TZH A;  1H6U A;  4WP6 A;  4NZT M;  4LSA A;  3FXI A;  4Q62 A;  1O6T A;  3O6N A;  5B0N A;  5B0T A;  3E6J A;  1G9U A;  3G3B A;  2Y5Q A;  4FCG A;  4ECN A;  5AWC A;  4LSC A;  4R6F A;  2Z66 A;  3KJ4 A;  3VQ1 A;  2JE1 A;  1FS2 A;  3WPF A;  4BSS A;  3RIZ A;  2WQV A;  3RJ0 A;  2V9T B;  4BSR A;  4QC0 A;  1GWB A;  3OJA B;  4MQW X;  4KXF B;  4R5D A;  5D3I A;  1K5G C;  2WQW A;  3UN9 A;  1OTO A;  5IYX C;  1M0Z A;  1M9L A;  3G06 A;  5B4P A;  4CNC A;  3ULV A;  4Z64 C;  3O53 A;  2ASS B;  1WWL A;  5A5C A;  5GMG A;  3WPC A;  4LSX A;  5HZL B;  1XWD C;  1FT8 A;  4K17 A;  3OGK B;  4R6G A;  4C2A B;  4ECO A;  2CA6 A;  4KT1 A;  4BSU A;  1M9S A;  2P1M B;  3WPH A;  5AWD A;  4IM6 A;  2P1O B;  2WQX A;  4FDW A;  2BNH A;  2Z65 A;  3ZYI A;  2ELL A;  3E4G A;  4Z8G A;  3RGX A;  5GMF A;  1DCE A;  3M18 A;  2ID5 A;  4U09 A;  1W8A A;  4FHO A;  2Z7X B;  3RFS A;  3ZYO A;  4PKI G;  4QBZ A;  1Z7X W;  2P1P B;  2Z82 A;  4R0A A;  1OZN A;  1SQ0 B;  3UL8 A;  3W3M A;  3G3A A;  4LI1 A;  4U7L A;  3WPG A;  3RFJ A;  2V70 A;  3C6O B;  3RW7 A;  3REZ A;  3OGM B;  2OMT A;  2Z7X A;  1XCD A;  2Z62 A;  3RFE A;  5IJC A;  1KOO A;  2OMU A;  1D0B A;  3W3G A;  4HQ1 A;  2Z63 A;  4RCA B;  5GS2 B;  2Z81 A;  4CC4 A;  1ZIW A;  3G04 C;  4Z94 G;  5GS0 A;  4XGO A;  5LFN A;  2OMW A;  3ULA A;  1DFJ I;  3E3Z A;  1U0N D;  3BZ5 A;  1M10 B;  4FMZ A;  4LI2 A;  4WYK A;  3TSR E;  4AW4 A;  2OMZ A;  4R08 A;  5AZ5 A;  5IJD A;  4FS7 A;  2XWT C;  1FO1 A;  4LXR A;  3W3J A;  2O6S A;  3M19 A;  3RW6 A;  1FQV A;  1P9A G;  4C2B B;  1PGV A;  4B8C D;  4LSX C;  1A9N A;  4EZG A;  3OJA A;  1P8V A;  4Y61 B;  4J0M A;  4CNM A;  2P1N B;  3UL9 A;  4PER A;  3C6N B;  3G39 A;  1KOH A;  2OMY A;  5CMN A;  2O6R A;  2Q4G W;  4L3A A;  4M7E C;  1XEU A;  2R9U A;  4Q3G A;  3GOZ A;  4P91 A;  4R07 A;  3WPD A;  3ULU A;  4XOS A;  4NKG A;  4U06 A;  2AST B;  3CIY A;  3C6P B;  5HDH A;  4NKH A;  4U08 A;  5CMP A;  1OTM A;  4ARR A;  3CIG A;  4L3F A;  1YRG A;  3JB9 j;  5GMH A;  4NZR M;  4ARN A;  4G8A A;  3WPB A;  4J4L A;  3ZYN A;  1H6T A;  4LXS A;  3ZYJ A; 
#chains in the Genus database with same CATH homology
 2IFG A;  4CIL A;  5IJB A;  2RR6 A;  4V2E A;  1IO0 A;  2JQD A;  3E2J A;  4RWT C;  2A0Z A;  2OMV A;  4GT6 A;  4MN8 B;  4QXE A;  2WQU A;  2UZX A;  4V2D A;  4R09 A;  4R6A A;  1A4Y A;  1K5D C;  4R6J A;  3RGZ A;  3W3L A;  3WPI A;  4P8S A;  4CC4 C;  4V2C A;  3P72 A;  3WPE A;  4H09 A;  4Z79 A;  4CP6 A;  4Q3I A;  5FTT B;  1OGQ A;  4M7E A;  2UZY A;  3WN4 A;  1P8T A;  4KNG A;  3UL7 A;  4PQ8 A;  4PSJ A;  4R5C A;  1XEC A;  4UFR A;  2FT3 A;  4YEB B;  1XKU A;  1LTX A;  1OTN A;  2JE0 A;  2OMX A;  1JL5 A;  5GQR K;  1O6S A;  2P1Q B;  3CVR A;  2BEX A;  2WFH A;  2XOT A;  4FD0 A;  4BV4 R;  4Z61 C;  5AWA A;  3W3N A;  4PEQ B;  4I6J B;  3DZE A;  1DS9 A;  3SB4 A;  3PMH G;  4R58 A;  4GLP A;  1O6V A;  4AY9 X;  5AWB A;  1OOK G;  1QYY A;  2O6Q A;  2RA8 A;  3VQ2 A;  3A79 B;  2V9S A;  4RCW A;  4XSQ A;  3W3K A;  3OGL B;  2Z64 A;  4OQT A;  4TZH A;  1H6U A;  4WP6 A;  4LSA A;  3FXI A;  4Q62 A;  1O6T A;  3O6N A;  5B0N A;  5B0T A;  3E6J A;  1G9U A;  3G3B A;  2Y5Q A;  4FCG A;  4ECN A;  5AWC A;  4LSC A;  4R6F A;  2Z66 A;  3KJ4 A;  3VQ1 A;  2JE1 A;  1FS2 A;  3WPF A;  4BSS A;  3RIZ A;  2WQV A;  3RJ0 A;  2V9T B;  4BSR A;  4QC0 A;  1GWB A;  3OJA B;  4MQW X;  4KXF B;  4R5D A;  5D3I A;  1K5G C;  2WQW A;  3UN9 A;  1OTO A;  5IYX C;  1M0Z A;  1M9L A;  3G06 A;  5B4P A;  4CNC A;  3ULV A;  4Z64 C;  3O53 A;  2ASS B;  1WWL A;  5A5C A;  5GMG A;  3WPC A;  4LSX A;  5HZL B;  1XWD C;  1FT8 A;  4K17 A;  3OGK B;  4R6G A;  4C2A B;  4ECO A;  2CA6 A;  4KT1 A;  4BSU A;  1M9S A;  2P1M B;  3WPH A;  5AWD A;  4IM6 A;  2P1O B;  2WQX A;  4FDW A;  2BNH A;  2Z65 A;  3ZYI A;  2ELL A;  3E4G A;  4Z8G A;  3RGX A;  5GMF A;  1DCE A;  3M18 A;  2ID5 A;  4U09 A;  1W8A A;  4FHO A;  2Z7X B;  3RFS A;  3ZYO A;  4PKI G;  4QBZ A;  1Z7X W;  2P1P B;  2Z82 A;  4R0A A;  1OZN A;  1SQ0 B;  3UL8 A;  3W3M A;  3G3A A;  4LI1 A;  4U7L A;  3WPG A;  3RFJ A;  2V70 A;  3C6O B;  3RW7 A;  3REZ A;  3OGM B;  2OMT A;  2Z7X A;  1XCD A;  2Z62 A;  3RFE A;  5IJC A;  1KOO A;  2OMU A;  1D0B A;  3W3G A;  4HQ1 A;  2Z63 A;  4RCA B;  5GS2 B;  2Z81 A;  4CC4 A;  1ZIW A;  3G04 C;  4Z94 G;  5GS0 A;  4XGO A;  5LFN A;  2OMW A;  3ULA A;  1DFJ I;  3E3Z A;  1U0N D;  3BZ5 A;  1M10 B;  4FMZ A;  4LI2 A;  4WYK A;  3TSR E;  4AW4 A;  2OMZ A;  4R08 A;  5AZ5 A;  5IJD A;  4FS7 A;  2XWT C;  1FO1 A;  4LXR A;  3W3J A;  2O6S A;  3M19 A;  3RW6 A;  1FQV A;  1P9A G;  4C2B B;  1PGV A;  4B8C D;  4LSX C;  1A9N A;  4EZG A;  3OJA A;  1P8V A;  4Y61 B;  4J0M A;  4CNM A;  2P1N B;  3UL9 A;  4PER A;  3C6N B;  3G39 A;  1KOH A;  2OMY A;  5CMN A;  2O6R A;  2Q4G W;  4L3A A;  4M7E C;  1XEU A;  2R9U A;  4Q3G A;  3GOZ A;  4P91 A;  4R07 A;  3WPD A;  3ULU A;  4XOS A;  4NKG A;  4U06 A;  2AST B;  3CIY A;  3C6P B;  5HDH A;  4NKH A;  4U08 A;  5CMP A;  1OTM A;  4ARR A;  3CIG A;  4L3F A;  1YRG A;  3JB9 j;  5GMH A;  4ARN A;  4G8A A;  3WPB A;  4J4L A;  3ZYN A;  1H6T A;  4LXS A;  3ZYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...