4ARRA

Crystal structure of the n-terminal domain of drosophila toll receptor with the magic triangle i3c
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
272
structure length
272
Chain Sequence
b'SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOLL RECEPTOR, VARIABLE LYMPHOCYTE RECEPTOR B.61 CHIMERA
publication title Liesegang-Like Patterns of Toll Crystals Grown in Gel.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Immune system
total genus 76
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4arrA00
5HDHA 1XKUA 2ASTB 1M9SA 5LFNA 5B0TA 4I6JB 3C6PB 4RCAB 4MN8B 2UZYA 4FMZA 4KXFB 3RW6A 4Z64C 4BSSA 4ECNA 3A79B 4V2EA 5HZLB 4CILA 1P8VA 1OTOA 2CA6A 1G9UA 2Z81A 2P1NB 3WPDA 2Z7XA 4Q62A 3TSRE 4Y61B 4Q3IA 2UZXA 3WPIA 1DS9A 4CC4C 4NKHA 1PGVA 5B4PA 3E3ZA 3CVRA 4C2AB 4GLPA 3W3JA 4AY9X 1FQVA 1OZNA 4R0AA 1DFJI 2OMUA 4R5DA 2Z64A 1H6TA 3G06A 1A4YA 2JE0A 3PMHG 4AW4A 1K5DC 4P91A 5IJBA 2JQDA 3M18A 3OGLB 1K5GC 4R5CA 4OQTA 3WN4A 1XEUA 2WQXA 2O6RA 4Q3GA 3OJAA 1H6UA 3W3LA 3REZA 3UL9A 3ULVA 2Z63A 4BSRA 3G04C 3WPGA 2Z62A 5CMPA 4CC4A 2ELLA 4R09A 1P8TA 5GMFA 4Z8GA 2P1QB 4FDWA 2WQUA 4Z79A 2Y5QA 3P72A 3ZYJA 4C2BB 3W3MA 4V2CA 1XWDC 5CMNA 3KJ4A 4KT1A 5B0NA 3G39A 4ECOA 4Z94G 4R6FA 5AZ5A 2OMVA 4L3FA 2O6QA 1YRGA 4LXSA 2R9UA 5AWDA 3CIGA 3WPFA 1GWBA 2XOTA 4B8CD 4K17A 3FXIA 3ULUA 4P8SA 2WFHA 1FO1A 4V2DA 3M19A 4LSXC 4R6GA 4NKGA 1M10B 3RJ0A 3C6OB 2OMXA 4U08A 3UN9A 3WPBA 3G3BA 4IM6A 3C6NB 5A5CA 2ASSB 2Z66A 2ID5A 4H09A 3ZYIA 3ZYOA 4PQ8A 4R07A 1FT8A 5GQRK 1ZIWA 2A0ZA 3RIZA 1JL5A 1Z7XW 1KOHA 3WPCA 3JB9j 4U09A 4QC0A 3ULAA 4J0MA 3W3NA 4LXRA 4ARNA 2P1MB 2RR6A 4ARRA 5AWAA 3RFJA 2BNHA 4G8AA 5AWCA 4KNGA 2WQWA 2Q4GW 4HQ1A 4LI2A 3SB4A 1U0ND 4LI1A 2OMYA 4LSXA 3W3KA 1DCEA 3WPEA 1A9NA 2FT3A 4QXEA 3W3GA 1FS2A 3E6JA 4R08A 5GS0A 3RFEA 4CNCA 4FS7A 3DZEA 3RGZA 2XWTC 3O53A 1OGQA 4MQWX 4Z61C 4FHOA 1W8AA 4BV4R 4CNMA 4WP6A 2OMZA 4M7EC 2Z7XB 1KOOA 3O6NA 3ZYNA 1XCDA 4XOSA 4R6JA 1SQ0B 3GOZA 1O6VA 4GT6A 5FTTB 2P1PB 1LTXA 2IFGA 2V70A 4BSUA 5D3IA 1QYYA 4J4LA 2Z82A 2P1OB 2Z65A 1O6TA 4UFRA 3BZ5A 4XSQA 1XECA 3RW7A 5GMGA 4L3AA 2BEXA 4FD0A 4PKIG 4XGOA 4EZGA 2V9TB 3OGMB 1M0ZA 3UL7A 4LSAA 3RGXA 1IO0A 4YEBB 1O6SA 3OGKB 3VQ1A 3OJAB 4WYKA 1D0BA 5IJDA 2OMTA 4M7EA 4FCGA 2WQVA 4U06A 3G3AA 5AWBA 2V9SA 3CIYA 1OTMA 3RFSA 3VQ2A 2O6SA 5GS2B 5IYXC 1OOKG 2OMWA 4R58A 1P9AG 4RWTC 5GMHA 4PEQB 4CP6A 3E4GA 4RCWA 4LSCA 3WPHA 2JE1A 4QBZA 4PSJA 1M9LA 4TZHA 1WWLA 4U7LA 1OTNA 3UL8A 4PERA 3E2JA 4R6AA 2RA8A 5IJCA
chains in the Genus database with same CATH superfamily
5HDHA 1XKUA 2ASTB 1M9SA 5LFNA 5B0TA 4I6JB 3C6PB 4RCAB 4MN8B 2UZYA 4FMZA 4KXFB 3RW6A 4Z64C 4BSSA 4ECNA 3A79B 4V2EA 5HZLB 4CILA 1P8VA 1OTOA 2CA6A 1G9UA 2Z81A 2P1NB 3WPDA 2Z7XA 4Q62A 3TSRE 4Y61B 4Q3IA 2UZXA 3WPIA 1DS9A 4CC4C 4NZTM 4NKHA 1PGVA 5B4PA 3E3ZA 3CVRA 4C2AB 4GLPA 3W3JA 4AY9X 1FQVA 1OZNA 4R0AA 1DFJI 2OMUA 4R5DA 2Z64A 1H6TA 3G06A 1A4YA 2JE0A 3PMHG 4AW4A 1K5DC 4P91A 5IJBA 2JQDA 3M18A 3OGLB 1K5GC 4R5CA 4OQTA 3WN4A 1XEUA 2WQXA 2O6RA 4Q3GA 3OJAA 1H6UA 3W3LA 3REZA 3UL9A 3ULVA 2Z63A 4BSRA 3G04C 3WPGA 2Z62A 5CMPA 4CC4A 2ELLA 4R09A 1P8TA 5GMFA 4Z8GA 2P1QB 4FDWA 2WQUA 4Z79A 2Y5QA 3P72A 3ZYJA 4C2BB 3W3MA 4V2CA 1XWDC 5CMNA 3KJ4A 4KT1A 5B0NA 3G39A 4ECOA 4Z94G 4R6FA 5AZ5A 2OMVA 4L3FA 2O6QA 1YRGA 4LXSA 2R9UA 5AWDA 3CIGA 3WPFA 1GWBA 2XOTA 4B8CD 4K17A 3FXIA 3ULUA 4P8SA 2WFHA 1FO1A 4V2DA 3M19A 4LSXC 4R6GA 4NKGA 1M10B 3RJ0A 3C6OB 2OMXA 4U08A 3UN9A 3WPBA 3G3BA 4IM6A 3C6NB 5A5CA 2ASSB 2Z66A 2ID5A 4H09A 3ZYIA 3ZYOA 4PQ8A 4R07A 1FT8A 5GQRK 1ZIWA 2A0ZA 3RIZA 1JL5A 1Z7XW 1KOHA 3WPCA 3JB9j 4U09A 4QC0A 3ULAA 4J0MA 3W3NA 4LXRA 4ARNA 2P1MB 2RR6A 4ARRA 5AWAA 3RFJA 2BNHA 4G8AA 5AWCA 4KNGA 2WQWA 2Q4GW 4HQ1A 4LI2A 3SB4A 1U0ND 4LI1A 2OMYA 4LSXA 3W3KA 1DCEA 3WPEA 1A9NA 2FT3A 4QXEA 3W3GA 1FS2A 3E6JA 4R08A 5GS0A 3RFEA 4CNCA 4FS7A 3DZEA 3RGZA 2XWTC 3O53A 1OGQA 4MQWX 4Z61C 4FHOA 1W8AA 4BV4R 4CNMA 4WP6A 2OMZA 4M7EC 2Z7XB 1KOOA 3O6NA 3ZYNA 1XCDA 4XOSA 4R6JA 1SQ0B 3GOZA 1O6VA 4GT6A 5FTTB 2P1PB 1LTXA 2IFGA 2V70A 4BSUA 5D3IA 1QYYA 4J4LA 2Z82A 4NZRM 2P1OB 2Z65A 1O6TA 4UFRA 3BZ5A 4XSQA 1XECA 3RW7A 5GMGA 4L3AA 2BEXA 4FD0A 4PKIG 4XGOA 4EZGA 2V9TB 3OGMB 1M0ZA 3UL7A 4LSAA 3RGXA 1IO0A 4YEBB 1O6SA 3OGKB 3VQ1A 3OJAB 4WYKA 1D0BA 5IJDA 2OMTA 4M7EA 4FCGA 2WQVA 4U06A 3G3AA 5AWBA 2V9SA 3CIYA 1OTMA 3RFSA 3VQ2A 2O6SA 5GS2B 5IYXC 1OOKG 2OMWA 4R58A 1P9AG 4RWTC 5GMHA 4PEQB 4CP6A 3E4GA 4RCWA 4LSCA 3WPHA 2JE1A 4QBZA 4PSJA 1M9LA 4TZHA 1WWLA 4U7LA 1OTNA 3UL8A 4PERA 3E2JA 4R6AA 2RA8A 5IJCA
chains in the Genus database with same CATH topology
5HDHA 1XKUA 2ASTB 1M9SA 5LFNA 5B0TA 4I6JB 3C6PB 4RCAB 4MN8B 2UZYA 4FMZA 4KXFB 3RW6A 4Z64C 4BSSA 4ECNA 3A79B 4V2EA 5HZLB 4CILA 1P8VA 1OTOA 2CA6A 1G9UA 2Z81A 2P1NB 3WPDA 2Z7XA 4Q62A 3TSRE 4Y61B 4Q3IA 2UZXA 3WPIA 1DS9A 4CC4C 4NKHA 1PGVA 5B4PA 3E3ZA 3CVRA 4C2AB 4GLPA 3W3JA 4AY9X 1FQVA 1OZNA 4R0AA 1DFJI 2OMUA 4R5DA 2Z64A 1H6TA 3G06A 1A4YA 2JE0A 3PMHG 4AW4A 1K5DC 4P91A 5IJBA 2JQDA 3M18A 3OGLB 1K5GC 4R5CA 4OQTA 3WN4A 1XEUA 2WQXA 2O6RA 4Q3GA 3OJAA 1H6UA 3W3LA 3REZA 3UL9A 3ULVA 2Z63A 4BSRA 3G04C 3WPGA 2Z62A 5CMPA 4CC4A 2ELLA 4R09A 1P8TA 5GMFA 4Z8GA 2P1QB 4FDWA 2WQUA 4Z79A 2Y5QA 3P72A 3ZYJA 4C2BB 3W3MA 4V2CA 1XWDC 5CMNA 3KJ4A 4KT1A 5B0NA 3G39A 4ECOA 4Z94G 4R6FA 5AZ5A 2OMVA 4L3FA 2O6QA 1YRGA 4LXSA 2R9UA 5AWDA 3CIGA 3WPFA 1GWBA 2XOTA 4B8CD 4K17A 3FXIA 3ULUA 4P8SA 2WFHA 1FO1A 4V2DA 3M19A 4LSXC 4R6GA 4NKGA 1M10B 3RJ0A 3C6OB 2OMXA 4U08A 3UN9A 3WPBA 3G3BA 4IM6A 3C6NB 5A5CA 2ASSB 2Z66A 2ID5A 4H09A 3ZYIA 3ZYOA 4PQ8A 4R07A 1FT8A 5GQRK 1ZIWA 2A0ZA 3RIZA 1JL5A 1Z7XW 1KOHA 3WPCA 3JB9j 4U09A 4QC0A 3ULAA 4J0MA 3W3NA 4LXRA 4ARNA 2P1MB 2RR6A 4ARRA 5AWAA 3RFJA 2BNHA 4G8AA 5AWCA 4KNGA 2WQWA 2Q4GW 4HQ1A 4LI2A 3SB4A 1U0ND 4LI1A 2OMYA 4LSXA 3W3KA 1DCEA 3WPEA 1A9NA 2FT3A 4QXEA 3W3GA 1FS2A 3E6JA 4R08A 5GS0A 3RFEA 4CNCA 4FS7A 3DZEA 3RGZA 2XWTC 3O53A 1OGQA 4MQWX 4Z61C 4FHOA 1W8AA 4BV4R 4CNMA 4WP6A 2OMZA 4M7EC 2Z7XB 1KOOA 3O6NA 3ZYNA 1XCDA 4XOSA 4R6JA 1SQ0B 3GOZA 1O6VA 4GT6A 5FTTB 2P1PB 1LTXA 2IFGA 2V70A 4BSUA 5D3IA 1QYYA 4J4LA 2Z82A 2P1OB 2Z65A 1O6TA 4UFRA 3BZ5A 4XSQA 1XECA 3RW7A 5GMGA 4L3AA 2BEXA 4FD0A 4PKIG 4XGOA 4EZGA 2V9TB 3OGMB 1M0ZA 3UL7A 4LSAA 3RGXA 1IO0A 4YEBB 1O6SA 3OGKB 3VQ1A 3OJAB 4WYKA 1D0BA 5IJDA 2OMTA 4M7EA 4FCGA 2WQVA 4U06A 3G3AA 5AWBA 2V9SA 3CIYA 1OTMA 3RFSA 3VQ2A 2O6SA 5GS2B 5IYXC 1OOKG 2OMWA 4R58A 1P9AG 4RWTC 5GMHA 4PEQB 4CP6A 3E4GA 4RCWA 4LSCA 3WPHA 2JE1A 4QBZA 4PSJA 1M9LA 4TZHA 1WWLA 4U7LA 1OTNA 3UL8A 4PERA 3E2JA 4R6AA 2RA8A 5IJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDH A;  1XKU A;  2AST B;  1M9S A;  5LFN A;  5B0T A;  4I6J B;  3C6P B;  4RCA B;  4MN8 B;  2UZY A;  4FMZ A;  4KXF B;  3RW6 A;  4Z64 C;  4BSS A;  4ECN A;  3A79 B;  4V2E A;  5HZL B;  4CIL A;  1P8V A;  1OTO A;  2CA6 A;  1G9U A;  2Z81 A;  2P1N B;  3WPD A;  2Z7X A;  4Q62 A;  3TSR E;  4Y61 B;  4Q3I A;  2UZX A;  3WPI A;  1DS9 A;  4CC4 C;  4NKH A;  1PGV A;  5B4P A;  3E3Z A;  3CVR A;  4C2A B;  4GLP A;  3W3J A;  4AY9 X;  1FQV A;  1OZN A;  4R0A A;  1DFJ I;  2OMU A;  4R5D A;  2Z64 A;  1H6T A;  3G06 A;  1A4Y A;  2JE0 A;  3PMH G;  4AW4 A;  1K5D C;  4P91 A;  5IJB A;  2JQD A;  3M18 A;  3OGL B;  1K5G C;  4R5C A;  4OQT A;  3WN4 A;  1XEU A;  2WQX A;  2O6R A;  4Q3G A;  3OJA A;  1H6U A;  3W3L A;  3REZ A;  3UL9 A;  3ULV A;  2Z63 A;  4BSR A;  3G04 C;  3WPG A;  2Z62 A;  5CMP A;  4CC4 A;  2ELL A;  4R09 A;  1P8T A;  5GMF A;  4Z8G A;  2P1Q B;  4FDW A;  2WQU A;  4Z79 A;  2Y5Q A;  3P72 A;  3ZYJ A;  4C2B B;  3W3M A;  4V2C A;  1XWD C;  5CMN A;  3KJ4 A;  4KT1 A;  5B0N A;  3G39 A;  4ECO A;  4Z94 G;  4R6F A;  5AZ5 A;  2OMV A;  4L3F A;  2O6Q A;  1YRG A;  4LXS A;  2R9U A;  5AWD A;  3CIG A;  3WPF A;  1GWB A;  2XOT A;  4B8C D;  4K17 A;  3FXI A;  3ULU A;  4P8S A;  2WFH A;  1FO1 A;  4V2D A;  3M19 A;  4LSX C;  4R6G A;  4NKG A;  1M10 B;  3RJ0 A;  3C6O B;  2OMX A;  4U08 A;  3UN9 A;  3WPB A;  3G3B A;  4IM6 A;  3C6N B;  5A5C A;  2ASS B;  2Z66 A;  2ID5 A;  4H09 A;  3ZYI A;  3ZYO A;  4PQ8 A;  4R07 A;  1FT8 A;  5GQR K;  1ZIW A;  2A0Z A;  3RIZ A;  1JL5 A;  1Z7X W;  1KOH A;  3WPC A;  3JB9 j;  4U09 A;  4QC0 A;  3ULA A;  4J0M A;  3W3N A;  4LXR A;  4ARN A;  2P1M B;  2RR6 A;  4ARR A;  5AWA A;  3RFJ A;  2BNH A;  4G8A A;  5AWC A;  4KNG A;  2WQW A;  2Q4G W;  4HQ1 A;  4LI2 A;  3SB4 A;  1U0N D;  4LI1 A;  2OMY A;  4LSX A;  3W3K A;  1DCE A;  3WPE A;  1A9N A;  2FT3 A;  4QXE A;  3W3G A;  1FS2 A;  3E6J A;  4R08 A;  5GS0 A;  3RFE A;  4CNC A;  4FS7 A;  3DZE A;  3RGZ A;  2XWT C;  3O53 A;  1OGQ A;  4MQW X;  4Z61 C;  4FHO A;  1W8A A;  4BV4 R;  4CNM A;  4WP6 A;  2OMZ A;  4M7E C;  2Z7X B;  1KOO A;  3O6N A;  3ZYN A;  1XCD A;  4XOS A;  4R6J A;  1SQ0 B;  3GOZ A;  1O6V A;  4GT6 A;  5FTT B;  2P1P B;  1LTX A;  2IFG A;  2V70 A;  4BSU A;  5D3I A;  1QYY A;  4J4L A;  2Z82 A;  2P1O B;  2Z65 A;  1O6T A;  4UFR A;  3BZ5 A;  4XSQ A;  1XEC A;  3RW7 A;  5GMG A;  4L3A A;  2BEX A;  4FD0 A;  4PKI G;  4XGO A;  4EZG A;  2V9T B;  3OGM B;  1M0Z A;  3UL7 A;  4LSA A;  3RGX A;  1IO0 A;  4YEB B;  1O6S A;  3OGK B;  3VQ1 A;  3OJA B;  4WYK A;  1D0B A;  5IJD A;  2OMT A;  4M7E A;  4FCG A;  2WQV A;  4U06 A;  3G3A A;  5AWB A;  2V9S A;  3CIY A;  1OTM A;  3RFS A;  3VQ2 A;  2O6S A;  5GS2 B;  5IYX C;  1OOK G;  2OMW A;  4R58 A;  1P9A G;  4RWT C;  5GMH A;  4PEQ B;  4CP6 A;  3E4G A;  4RCW A;  4LSC A;  3WPH A;  2JE1 A;  4QBZ A;  4PSJ A;  1M9L A;  4TZH A;  1WWL A;  4U7L A;  1OTN A;  3UL8 A;  4PER A;  3E2J A;  4R6A A;  2RA8 A;  5IJC A; 
#chains in the Genus database with same CATH topology
 5HDH A;  1XKU A;  2AST B;  1M9S A;  5LFN A;  5B0T A;  4I6J B;  3C6P B;  4RCA B;  4MN8 B;  2UZY A;  4FMZ A;  4KXF B;  3RW6 A;  4Z64 C;  4BSS A;  4ECN A;  3A79 B;  4V2E A;  5HZL B;  4CIL A;  1P8V A;  1OTO A;  2CA6 A;  1G9U A;  2Z81 A;  2P1N B;  3WPD A;  2Z7X A;  4Q62 A;  3TSR E;  4Y61 B;  4Q3I A;  2UZX A;  3WPI A;  1DS9 A;  4CC4 C;  4NZT M;  4NKH A;  1PGV A;  5B4P A;  3E3Z A;  3CVR A;  4C2A B;  4GLP A;  3W3J A;  4AY9 X;  1FQV A;  1OZN A;  4R0A A;  1DFJ I;  2OMU A;  4R5D A;  2Z64 A;  1H6T A;  3G06 A;  1A4Y A;  2JE0 A;  3PMH G;  4AW4 A;  1K5D C;  4P91 A;  5IJB A;  2JQD A;  3M18 A;  3OGL B;  1K5G C;  4R5C A;  4OQT A;  3WN4 A;  1XEU A;  2WQX A;  2O6R A;  4Q3G A;  3OJA A;  1H6U A;  3W3L A;  3REZ A;  3UL9 A;  3ULV A;  2Z63 A;  4BSR A;  3G04 C;  3WPG A;  2Z62 A;  5CMP A;  4CC4 A;  2ELL A;  4R09 A;  1P8T A;  5GMF A;  4Z8G A;  2P1Q B;  4FDW A;  2WQU A;  4Z79 A;  2Y5Q A;  3P72 A;  3ZYJ A;  4C2B B;  3W3M A;  4V2C A;  1XWD C;  5CMN A;  3KJ4 A;  4KT1 A;  5B0N A;  3G39 A;  4ECO A;  4Z94 G;  4R6F A;  5AZ5 A;  2OMV A;  4L3F A;  2O6Q A;  1YRG A;  4LXS A;  2R9U A;  5AWD A;  3CIG A;  3WPF A;  1GWB A;  2XOT A;  4B8C D;  4K17 A;  3FXI A;  3ULU A;  4P8S A;  2WFH A;  1FO1 A;  4V2D A;  3M19 A;  4LSX C;  4R6G A;  4NKG A;  1M10 B;  3RJ0 A;  3C6O B;  2OMX A;  4U08 A;  3UN9 A;  3WPB A;  3G3B A;  4IM6 A;  3C6N B;  5A5C A;  2ASS B;  2Z66 A;  2ID5 A;  4H09 A;  3ZYI A;  3ZYO A;  4PQ8 A;  4R07 A;  1FT8 A;  5GQR K;  1ZIW A;  2A0Z A;  3RIZ A;  1JL5 A;  1Z7X W;  1KOH A;  3WPC A;  3JB9 j;  4U09 A;  4QC0 A;  3ULA A;  4J0M A;  3W3N A;  4LXR A;  4ARN A;  2P1M B;  2RR6 A;  4ARR A;  5AWA A;  3RFJ A;  2BNH A;  4G8A A;  5AWC A;  4KNG A;  2WQW A;  2Q4G W;  4HQ1 A;  4LI2 A;  3SB4 A;  1U0N D;  4LI1 A;  2OMY A;  4LSX A;  3W3K A;  1DCE A;  3WPE A;  1A9N A;  2FT3 A;  4QXE A;  3W3G A;  1FS2 A;  3E6J A;  4R08 A;  5GS0 A;  3RFE A;  4CNC A;  4FS7 A;  3DZE A;  3RGZ A;  2XWT C;  3O53 A;  1OGQ A;  4MQW X;  4Z61 C;  4FHO A;  1W8A A;  4BV4 R;  4CNM A;  4WP6 A;  2OMZ A;  4M7E C;  2Z7X B;  1KOO A;  3O6N A;  3ZYN A;  1XCD A;  4XOS A;  4R6J A;  1SQ0 B;  3GOZ A;  1O6V A;  4GT6 A;  5FTT B;  2P1P B;  1LTX A;  2IFG A;  2V70 A;  4BSU A;  5D3I A;  1QYY A;  4J4L A;  2Z82 A;  4NZR M;  2P1O B;  2Z65 A;  1O6T A;  4UFR A;  3BZ5 A;  4XSQ A;  1XEC A;  3RW7 A;  5GMG A;  4L3A A;  2BEX A;  4FD0 A;  4PKI G;  4XGO A;  4EZG A;  2V9T B;  3OGM B;  1M0Z A;  3UL7 A;  4LSA A;  3RGX A;  1IO0 A;  4YEB B;  1O6S A;  3OGK B;  3VQ1 A;  3OJA B;  4WYK A;  1D0B A;  5IJD A;  2OMT A;  4M7E A;  4FCG A;  2WQV A;  4U06 A;  3G3A A;  5AWB A;  2V9S A;  3CIY A;  1OTM A;  3RFS A;  3VQ2 A;  2O6S A;  5GS2 B;  5IYX C;  1OOK G;  2OMW A;  4R58 A;  1P9A G;  4RWT C;  5GMH A;  4PEQ B;  4CP6 A;  3E4G A;  4RCW A;  4LSC A;  3WPH A;  2JE1 A;  4QBZ A;  4PSJ A;  1M9L A;  4TZH A;  1WWL A;  4U7L A;  1OTN A;  3UL8 A;  4PER A;  3E2J A;  4R6A A;  2RA8 A;  5IJC A; 
#chains in the Genus database with same CATH homology
 5HDH A;  1XKU A;  2AST B;  1M9S A;  5LFN A;  5B0T A;  4I6J B;  3C6P B;  4RCA B;  4MN8 B;  2UZY A;  4FMZ A;  4KXF B;  3RW6 A;  4Z64 C;  4BSS A;  4ECN A;  3A79 B;  4V2E A;  5HZL B;  4CIL A;  1P8V A;  1OTO A;  2CA6 A;  1G9U A;  2Z81 A;  2P1N B;  3WPD A;  2Z7X A;  4Q62 A;  3TSR E;  4Y61 B;  4Q3I A;  2UZX A;  3WPI A;  1DS9 A;  4CC4 C;  4NKH A;  1PGV A;  5B4P A;  3E3Z A;  3CVR A;  4C2A B;  4GLP A;  3W3J A;  4AY9 X;  1FQV A;  1OZN A;  4R0A A;  1DFJ I;  2OMU A;  4R5D A;  2Z64 A;  1H6T A;  3G06 A;  1A4Y A;  2JE0 A;  3PMH G;  4AW4 A;  1K5D C;  4P91 A;  5IJB A;  2JQD A;  3M18 A;  3OGL B;  1K5G C;  4R5C A;  4OQT A;  3WN4 A;  1XEU A;  2WQX A;  2O6R A;  4Q3G A;  3OJA A;  1H6U A;  3W3L A;  3REZ A;  3UL9 A;  3ULV A;  2Z63 A;  4BSR A;  3G04 C;  3WPG A;  2Z62 A;  5CMP A;  4CC4 A;  2ELL A;  4R09 A;  1P8T A;  5GMF A;  4Z8G A;  2P1Q B;  4FDW A;  2WQU A;  4Z79 A;  2Y5Q A;  3P72 A;  3ZYJ A;  4C2B B;  3W3M A;  4V2C A;  1XWD C;  5CMN A;  3KJ4 A;  4KT1 A;  5B0N A;  3G39 A;  4ECO A;  4Z94 G;  4R6F A;  5AZ5 A;  2OMV A;  4L3F A;  2O6Q A;  1YRG A;  4LXS A;  2R9U A;  5AWD A;  3CIG A;  3WPF A;  1GWB A;  2XOT A;  4B8C D;  4K17 A;  3FXI A;  3ULU A;  4P8S A;  2WFH A;  1FO1 A;  4V2D A;  3M19 A;  4LSX C;  4R6G A;  4NKG A;  1M10 B;  3RJ0 A;  3C6O B;  2OMX A;  4U08 A;  3UN9 A;  3WPB A;  3G3B A;  4IM6 A;  3C6N B;  5A5C A;  2ASS B;  2Z66 A;  2ID5 A;  4H09 A;  3ZYI A;  3ZYO A;  4PQ8 A;  4R07 A;  1FT8 A;  5GQR K;  1ZIW A;  2A0Z A;  3RIZ A;  1JL5 A;  1Z7X W;  1KOH A;  3WPC A;  3JB9 j;  4U09 A;  4QC0 A;  3ULA A;  4J0M A;  3W3N A;  4LXR A;  4ARN A;  2P1M B;  2RR6 A;  4ARR A;  5AWA A;  3RFJ A;  2BNH A;  4G8A A;  5AWC A;  4KNG A;  2WQW A;  2Q4G W;  4HQ1 A;  4LI2 A;  3SB4 A;  1U0N D;  4LI1 A;  2OMY A;  4LSX A;  3W3K A;  1DCE A;  3WPE A;  1A9N A;  2FT3 A;  4QXE A;  3W3G A;  1FS2 A;  3E6J A;  4R08 A;  5GS0 A;  3RFE A;  4CNC A;  4FS7 A;  3DZE A;  3RGZ A;  2XWT C;  3O53 A;  1OGQ A;  4MQW X;  4Z61 C;  4FHO A;  1W8A A;  4BV4 R;  4CNM A;  4WP6 A;  2OMZ A;  4M7E C;  2Z7X B;  1KOO A;  3O6N A;  3ZYN A;  1XCD A;  4XOS A;  4R6J A;  1SQ0 B;  3GOZ A;  1O6V A;  4GT6 A;  5FTT B;  2P1P B;  1LTX A;  2IFG A;  2V70 A;  4BSU A;  5D3I A;  1QYY A;  4J4L A;  2Z82 A;  2P1O B;  2Z65 A;  1O6T A;  4UFR A;  3BZ5 A;  4XSQ A;  1XEC A;  3RW7 A;  5GMG A;  4L3A A;  2BEX A;  4FD0 A;  4PKI G;  4XGO A;  4EZG A;  2V9T B;  3OGM B;  1M0Z A;  3UL7 A;  4LSA A;  3RGX A;  1IO0 A;  4YEB B;  1O6S A;  3OGK B;  3VQ1 A;  3OJA B;  4WYK A;  1D0B A;  5IJD A;  2OMT A;  4M7E A;  4FCG A;  2WQV A;  4U06 A;  3G3A A;  5AWB A;  2V9S A;  3CIY A;  1OTM A;  3RFS A;  3VQ2 A;  2O6S A;  5GS2 B;  5IYX C;  1OOK G;  2OMW A;  4R58 A;  1P9A G;  4RWT C;  5GMH A;  4PEQ B;  4CP6 A;  3E4G A;  4RCW A;  4LSC A;  3WPH A;  2JE1 A;  4QBZ A;  4PSJ A;  1M9L A;  4TZH A;  1WWL A;  4U7L A;  1OTN A;  3UL8 A;  4PER A;  3E2J A;  4R6A A;  2RA8 A;  5IJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...