4ARUA

Hafnia alvei phytase in complex with tartrate
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
410
structure length
405
Chain Sequence
APAGFQLERVVILSRHGVRAPTKMTQTMRDVTPHQWPEWPVKLGYITPRGEHLISLMGGFYRERFQQQGLLPKDNCPTPDAVYVWADVDQRTRKTGEAFLAGLAPQCDLAIHHQQNTQQADPLFHPVKAGICSMDKSQVHAAVEKQAGTPIETLNQRYQASLALMSSVLDFPKSPYCQQHCDFSQAMPSRLAINDDGNKVALEGAVGLASTLAEIFLLEHAQGMPKVAWGNIHTEQQWNSLLKLHNAQFDLMSRTPYIAKHNGTPLLQTIAHALGSNITSRPLPDISPDNKILFIAGHDTNIANISGMLGMTWTLPGQPDNTPPGGALVFERWVDNAGKPYVSVNMVYQTLAQLHDQAPLTLQHPAGSVRLNIPGCSDQTPDGYCPLSTFSRLVSHSVEPACQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTIDINE ACID PHOSPHATASE
publication title Degradation of Phytate by the 6-Phytase from Hafnia Alvei: A Combined Structural and Solution Study.
pubmed doi rcsb
source organism Hafnia alvei
molecule tags Hydrolase
total genus 136
structure length 405
sequence length 410
ec nomenclature ec 3.1.3.26: 4-phytase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4aruA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4aruA02
1SKBA 2RFLA 2I1VB 2P6MA 2AXNA 2ENWA 5CX4A 4AROA 4TSRA 4FDUA 5HTKA 4IJ5A 2HPAA 4ARUA 2DWOA 3QPWA 1BIFA 2P9FA 1SK9A 4QIHA 1C7ZA 1ND5A 2OWDA 2YN2A 4HBZA 3FDZB 1FBTA 4GPZA 2BIFA 2EKZA 1QFXA 2HHJA 5CDHA 2WNIA 5AJXA 1SKAA 1V7QA 3C7TA 3D6AA 5AJWA 1DKLA 3DCYA 3QPVA 3MBKA 1CVIA 4ARVA 1FZTA 2H4ZA 5CU7A 3EZNA 1K6MA 2H0QA 1DKOA 1YJXA 1UJBA 3O0TA 3E9DA 4D4MA 1SK8A 3D4IA 2P30A 5HR5A 1IHPA 5AJZA 3ZHCA 2P2YA 3GP3A 1TIPA 3K4PA 2WNHA 1DKNA 3GW8A 3R7AA 1T8PA 3KKKA 3K4QA 2OWEA 3DB1A 2P75A 4GPIB 3MXOA 3IT0A 2P78A 4PZ9A 2GFIA 4D4KA 1DKMA 3FDZA 2PA0A 1YFKA 4D4LA 1EBBA 2F90A 3LNTA 4JOCA 5PGMA 3D8HA 3F2IA 1NT4A 2H4XA 1C80A 1RPAA 3NFYA 3LG2A 1ND6A 3HJGA 2H52A 4JOBA 1V37A 2IKQA 2QNIA 1RPTA 4EMBA 1H2EA 5AJVB 4JODA 2P79A 4IJ6A 1C81A 1H2FA 4E3WA 1XQ9A 3E9EA 3IT3A 2P9YA 3EOZA 1BQ4A 1E59A 2YN0A 4EO9A 2P77A 2P9ZA 1E58A 3QPUA 3FJYA 4FDTA 2A9JA 3E9CA 1QWOA 1UJCA 1DKQA 3PGMA 1QHFA 1DKPA 2P6OA 3BIFA 2P2ZA 2WU0A 2EKBA 3OI7A 2EOAA 3IT2A 3IT1A 4MA4A 3GP5A 1BQ3A 2A6PA 4ODIA 4PGMA 1RIIA 2ENUA 3LL4A 2HIAA 4PZAA 4ARSA 2DWPA 5AJYA 4D4JA 3NTLA 5AK0A 3F3KA
chains in the Genus database with same CATH superfamily
1NW7A 1P2SA 1FDSA 2IZ5A 3Q3GE 3BB1A 3WGNA 4A5SA 4QFCA 5FTLA 1KZ9A 1YR1A 3HU3A 3PUJA 3QJGA 1JEOA 1IOZA 1TAUA 1XMPA 3G85A 3ZHTA 2P11A 2QOEA 3AIKA 4ARAA 2VPZA 3T4PA 5LP6A 5C1IA 5UKDA 4JBYA 1F8GA 5HKKD 2A14A 2C7BA 2Y76A 1Z5GA 4JEMA 5AKIA 1QVRA 3SF8B 2OCPA 3WGQA 2V3VA 2YVKA 1J8DA 2X0IA 3R8CA 4YMGA 3TG2A 4JXXA 2HLNA 3L92A 5H8WA 5CVUA 3EUFA 2R751 4ZAWA 4MI1A 3BSFA 1CLUA 4YPOA 3SC2B 2G5TA 5TB5A 4IF6A 4EGSA 4XWKA 3LUBA 2ZR8A 4YBZA 1Y6FA 3DO5A 2BFFA 2FKAA 1MJNA 4YRPA 2OTCA 2QLLA 2JC3A 2B5WA 3O3NB 4W9NC 3HUEA 2FRDC 3ZPXA 4F3YA 2OCXA 3X44A 1QF7A 1QDEA 2B1RA 2W2NA 3DE5X 1F38A 1ZN8A 3E6AA 3IEIA 3UQZA 5IMBA 3MMZA 1ISFA 4OPMA 1QPZA 1TA4A 4XDZA 3VR6D 5K3SA 1G21B 3B5IA 3CNOA 4BIMA 1QKJA 2Q1TA 4MTLA 4MCHA 3RSSA 3PE3A 5JNSA 1OZFA 1G5IA 4NMMA 3FN4A 3BOSA 3BORA 4YRAA 1ZNYA 4XQ0A 1L5HA 1SC9A 1OFHA 4KREA 2DLCX 3H2HA 2EX4A 2GFIA 1N5IA 4TLDA 1U3FA 2IPXA 4GSKA 4XX0B 5GZ6A 2WU1A 2NUTA 3F1LA 13PKA 3OIUA 4BLVA 1MFPA 1UMDA 5IH7A 1E4EA 1JB9A 1SAYA 2QRVB 4PLYA 5CUQA 1YF3A 1A2QA 3RJZA 1VLVA 4BX8A 2C0PA 4GKVA 3K30A 1P5RA 3O3CA 3RBAA 1N6LA 1FNSA 5JVDA 1NJ5A 2C7PA 1H2EA 1SC4A 3NHYA 1GNRA 1EDDA 1XJ5A 5KOYA 1XTQA 1GDHA 4JC0A 1ZC4A 4NFSA 1RM5A 3OLCX 3MAGA 4BKUA 3FNRA 4CEHB 1BD3A 3JWIA 1MXFA 3KB1A 4PAGA 4E5NA 8ATCA 1YRAA 1EB9A 1SBQA 2TMDA 2ZAIA 4EENA 3NONA 1BW9B 1QDLB 4M0FA 1SIOA 1DBWA 4XPIB 5CYOA 4D9HA 3E7DA 1KJZA 1WXXA 1Z0UA 3A3NA 5DWQA 2H2AA 4HQRA 4IYJA 1VKOA 3WGOA 4DNXA 1DKQA 1F2UA 1VI6A 1UOPA 4FXPA 4OTZA 3FSGA 3VZSA 4DUPA 2CJPA 4LE1A 1QK5A 2VPPA 4EFKA 4JI1B 3TR0A 4HUTA 3QELB 1H66A 3D6UA 1A9TA 2POCA 3UB4A 2QE7D 1QG6A 2W4QA 1EFVB 3E9RA 4O3FA 3ML1A 3VDXA 2QRJA 3L8FA 4HNGA 2XTJA 3B3AA 3FOZA 4JYPA 1W73A 3WWPA 2XWBF 1GRRA 4YGXB 3FDJA 1R8QA 1MKYA 2O54A 3L9XA 2VKTA 2PKCA 2AK2A 3DTVA 1XLWA 4PAMA 4QOIA 1X38A 3CRW1 2ZJFA 2WW8A 3O4RA 2QRNA 4U6NA 3P19A 5ESDA 5BSVA 3G9QA 4WK4B 3TAUA 5C8DA 1SCDA 2QLFA 2ZW9A 5KX5F 5ALXA 4Z0TA 3RYFB 5DYWA 3I4LA 2EW8A 3UPTA 3SZOA 3VJLA 4KHPB 3TDMA 2QAIA 5DKFA 1KRWA 1Q1NA 3GA7A 3NETA 4LRSB 2PZKA 1OAKA 3ZWWA 1LRLA 2ZYHA 4G07A 3ANTA 3IUQA 1BIFA 2D4AA 3CEPB 3QUSA 4U7FA 4UDYX 5FBLB 1VMEA 4BASA 1WW2A 2P6NA 2VQSA 3BXHA 2WHQA 1FQWA 1N2OA 2YHIB 4MLPA 4IDQA 4O4LF 4JH0A 4JVOA 3W4JA 3KQUA 4QM6A 2VA9A 4OXNA 1G7RA 4BLOA 3BXFA 3WIUA 1XZ8A 4IIHA 1W4RA 1DOAA 1Q1AA 5AK6A 2FN9A 3F71A 4YA6A 3S1AB 4JLVA 4EPXA 3PFWO 4QNNA 2XXAB 1KZ7B 2DECA 2PQ0A 1RWBA 5AXBA 3G2LA 3MINA 3TMYA 2AVNA 2IJGX 5K3AA 3FF1A 1T3ZA 3MUEA 4DVJA 3CM0A 4NS1A 1G9TA 4J07A 4V0RA 4MGZR 2RK3A 3KDSE 5KAMA 3WMGA 3SHQA 3QX8A 5JJKA 4HATA 2C94A 2ZROA 3GJTA 1U1FA 4AYXA 1IZYA 3EVCA 4TLMB 3AERA 3B9RA 5IANA 4R71A 1NM5A 4O8ZA 1UOEA 5CRIA 5CB0A 1XRRA 2OBBA 1OA1A 2X1VA 4A8HA 1MOPA 2ORYA 4BBJA 2BWJA 4JXZA 2BPOA 3AWDA 1L7OA 3DQPA 1BXZA 5FBVB 3I6MA 3DDNA 5IARA 1GPH1 4HLQB 5REQB 1RQLA 3T9FA 4E6PA 5BSFA 2F90A 4NZOA 1OZHA 2DFNA 2V7QA 4C6TA 2YJZA 4YXWD 1CEEA 2F8LA 3ZW8A 3DFFA 4FHDA 4Q34A 1QR6A 3LF2A 2E4VA 3OLVA 2ILVA 4FFWA 3MZ0A 4KZKA 4RMIA 2SKCA 2WTXA 4LXGA 4JUDX 3RVMA 2FZCA 4MGYR 1H0KA 1DDIA 1VE3A 5ADWA 1OZGA 1D2NA 1UMKA 4F92B 4QUEA 5T64A 1T4DA 3HJNA 1MG5A 2QYHA 4Q0MA 1W34A 4E3WA 1PL0A 5C3MA 5T5QA 3WSWA 2X7HA 2RGCA 3N2GB 3PDIB 1OXSC 1M76A 1I6KA 1FFCA 1M2VB 1ODJA 3EJWA 4TTPA 3R7DA 2VTBA 4DVGA 1BNCA 4B3FX 2ON6A 1OILA 1G5TA 2P5TB 5BMVF 2P90A 3GXBA 1PYDA 4BVLA 1W1WA 3FFXA 3QEMA 3GDHA 1WBBA 3DBHB 4KITB 4UBLA 1QO0D 4D4IA 5C5IA 2GJ9A 1SBYA 4LSGA 2H8GA 4D5GA 2E49A 1QCCA 3A26A 5DN9A 1J8YF 2I78A 2ZIEA 5KEIA 5KNLA 3QMWA 4BN5A 3LA8A 4DLKA 2PPVA 4M8IA 4R69A 1GPAA 1YB7A 5ADVA 5LMNB 1M1NA 3LL4A 1XRLA 1KZYC 1KMIY 4B32A 3BQNB 4JUAA 4BNKA 4EW3A 2QNRA 1WKCA 1W8IA 3IXLA 3N8HA 1XMVA 1PR6A 1YA4A 3HXLA 4FGZA 4NH4A 1NVVR 4GM4A 4MEBA 3JW8A 2P1ZA 4HAWA 4ZT6A 5KJFA 1NBMD 2NU7B 5E6SB 1M8GA 2NT3A 3Q2KA 2GHQA 1GV0A 4JSTA 1H0RA 2HDHA 3DMPA 4J76A 3HDJA 3V97A 3D0OA 4C5BA 3IQIX 3N74A 3T95A 1BCRA 1JJVA 2PRZA 4RZQA 3M3DA 3VNSA 3VPDA 4F6RA 1EWRA 3BGWA 2IVZA 3NCHA 4TVOA 3JD4A 4HDRB 3GHHA 3ECCA 3L7LA 2QM3A 1NUHA 5CR9A 3X43A 4DSTA 3Q88A 4JYBA 2OM2A 1GRQA 2H5IA 2V8BA 3U7EB 2HHJA 2IZ0A 4BTLA 3FYDA 3B12A 3R3WA 1QVAA 2JD2A 1V6CA 4FHFA 2AE1A 3NORA 4RKEA 4ARZA 4P33A 4CDRA 1FVOA 3OY2A 1ZJ4A 1JV2B 2V1XA 5GPBA 3W1EA 1T5DX 1C5KA 2PLFA 5IJZA 3EZNA 3EZYA 1OASA 3DE4X 3NEPX 1QX4A 4OB8A 4E03A 3B1VA 5G0UA 4CM8B 3KKNA 3W8FA 1H0SA 3E9DA 3P7MA 2DJIA 2LCFA 4JJEA 4ETWA 4AVYA 4ARIA 1ZD9A 4UEWA 1AJEA 1N0HA 5I8ZA 4EA6A 2QEQA 1GARA 5KIAA 3V6LA 4EI8A 5A9SB 2ECOA 1DELA 4R2KA 1QTRA 4I6GA 1YKSA 1RWVA 2XNDD 3GCDA 1TUEA 1WV0A 3O8DA 4ROSA 4JKOA 1QP0A 2BKUA 4DR2B 4PV7A 1YS4A 4AC9A 3HRKA 1DXYA 3PU6A 4WSOA 3FCEA 1T29A 3M6MD 4NJMB 4QEDA 2XMRA 1RDFA 4CODB 4AKGA 2PRSA 2GDZA 3C8UA 4U2CA 5IZCC 4D8XA 3CZRA 1DU4A 1NUSA 2BEWB 1M5UA 1Y1SA 3H0CA 3C85A 3LQQA 3UGQA 3VPBA 4DXAA 5B2EA 3BRWD 1UBJS 4BCBA 1DFHA 1UDWA 5CFOA 2XUGA 1PZXA 3U7FB 3LLVA 1EWTA 4EFMA 3DEJA 5C8YB 1K0UA 2VJMB 1UK8A 4UEKA 4G0NA 3TAHA 3PUYA 5K0LA 5JCPA 5LBIA 2PXHA 1RM4A 4HY3A 1RWWA 2Q9CA 3CQ9A 4TTIA 4EGAA 4I0WB 5HCUA 3ZIAA 3L41A 2PRIA 3LGXA 4WLNA 4QULA 5CA0B 3SG0A 4KR6A 1WQ1R 1KPGA 4KQKA 4DA4A 3M4JA 1DKRA 1KI3A 1MPTA 1QIIA 2WUDA 3RLFA 1U2RA 1EZ4A 1PYGA 2CY0A 4NPHA 4OQFA 1NLZA 3WWDA 4N6OA 3JATB 4XWTA 5LDGA 4HWPA 3I2JA 5CP8A 3RS3A 3VJRA 1C0KA 4GM0A 5CPFA 1KP3A 4JQZA 2B61A 3NDJA 4YDHB 1DZ3A 3H5AA 1KI6A 3F6EX 1AVTA 3HV0A 3L6EA 4Y6PA 1DL5A 1MAHA 3EE6A 1ZMRA 1YD7A 2V6BA 4CR7A 2CHGA 3C7DB 3VZCA 1SGWA 2JZNA 3ET5A 2OORA 2R1TB 3TW0A 1GCOA 1K6XA 4I4IA 4Q03A 2Z1MA 3F6BX 5T57A 2F1JA 2X1HA 2DSTA 1NYTA 1KYVA 4MS1B 1O9GA 1FS6A 4JOSA 1T4CA 3NBZC 4DQXA 4R16A 4I99A 4HB0A 4MWBA 3KQTA 4R8SA 2JCVA 4P98A 3TLYA 4YQYA 4JA0A 4C3ZA 3OA2A 3VR4D 5K4HA 1RQ2A 2PFSA 1GTL1 1XZQA 3DBVO 3DL7A 1F5NA 4HNQA 4NAVA 2C5AA 3EVZA 4W8GA 5AW1A 1OLSA 5GJVC 3PDUA 1G20B 1FYWA 2P4QA 1AHNA 4G4SO 3ZHBA 2GN6A 2ODEA 4TT3D 2RGGA 2C88A 2O8BB 3UT0A 4BE9A 1KVRA 1NSTA 2H57A 3HPQA 4HAYA 1ZIOA 5C37A 4BNUA 1VJDA 4M9RA 1RXCA 4MITA 5F1PA 1D7AA 1K97A 2GYUA 2HCTA 2L19A 2N1BA 3A32A 1FXUA 4YAEA 3T1OA 1XU9A 4CBVA 3IHWA 2VVTA 2C99A 3WIOA 1GLVA 1SBTA 4TXNA 4A1OA 4EEXA 3AZOA 3PEVA 4V0OA 4QUDA 4Z4IA 1XALA 2CBXA 1UBNA 2VTKA 4FTWA 3OP4A 2FZ4A 4MWGA 4Q3DA 1YDFA 3SR4A 4LHXA 1NVKA 2ZWMA 1KQPA 2FV8A 2AS0A 4IJQA 1KZ4A 1I7QB 3ENZA 1QLHA 5TR9A 2RJOA 3V46A 3F6SA 1C0LA 2BOVA 2YRFA 4MQ4A 1BXGB 2WV7A 4IG9A 3A1FA 3FBGA 1AV6A 1Q7BA 2BEUB 2MYUA 2GCNA 2ZOSA 3HYNA 2W48A 4GRAA 4ZP1A 3RC9A 4RWZA 2XQVA 1O54A 2PSFA 2RONA 3GW8A 2ZP1A 5LPNA 1TYAE 4QBKA 2AZTA 2RGRA 3OCXA 1JA1A 3KG2A 5FBKA 4PN3A 5CLGA 5ERGB 2F1IA 4O1HA 4MKRA 1L3BA 1D5WA 3EAFA 1Z7BA 1PZEA 2BMJA 4LJKA 1S2LA 4QJIA 3ZY4A 2ZANA 1T2AA 3O4IA 4BN4A 5LDDC 4WXEA 1EUQA 3ZEAA 3LV8A 3AVOA 2FUKA 3HEBA 3OSZA 1EJ6A 5ADUS 2B4KA 3QVGA 4B3DA 4AULA 2VT2A 4CKBA 5E9JA 3GB9A 1PEYA 1QS0B 4HFRA 4XD7D 3AM1A 1X87A 3AHFA 3VO8A 5DU2A 1R6TA 2B92A 2DFTA 5KSOA 4RZ2A 4MI3A 1TX4B 4WFIA 1ZK0A 2XQGA 4Q4HB 3UH0A 2OD7A 1NMSA 3L4BA 5HJ2A 1OH5A 3C43A 4KHZA 5T8KA 1CQXA 2BRUA 1I30A 1UBTS 1S02A 2HM7A 3GD5A 3HMKA 3ZHRA 5JZMA 3HWRA 4JJ8A 2VDOB 2CNWD 1ZNQO 1RRGA 1JHXA 1Z5VA 3KXIA 4OIMA 2O2SA 5KOHB 3SZUA 2O0MA 2PTHA 4R1LA 3LW8A 4TYPA 3Q6MA 1X7ZB 3C3YA 1HI9A 2CDBA 1L7PA 4AP5A 4EBFA 4F60A 2DBYA 2GD0A 3TCKA 3NWPA 1K3UB 2W6ZA 5K0JA 1PTJA 1EQ2A 2JLBA 4FKMA 3FA2A 3MM4A 4KQXA 1W25A 2CXSA 4RPHA 1NI5A 1YUNA 4JLDA 5C7IO 3WRVA 4QHSA 1HTBA 4G4GA 3RAJA 4Y1RB 3WKEA 4TQUS 3T4EA 4LJ9A 2IU3A 4KNVA 3E9QA 2PUVA 1YIAA 2GRUA 4FLFA 2PKQP 5BNFA 3GLUA 2R6DA 4M88A 5JZSA 3AHJA 3LI2A 3VU1A 1KVQA 3MTEA 3GJ4A 3SVZA 3K0AA 1IWPB 2V9ZA 5A3RA 3LY8A 4MJXA 4XSGA 1UPTA 1CFZA 3CNEA 1R16A 1RYNA 1Y4DE 2A7QA 1TQHA 3ZXSA 1C30B 1RHMA 4H0NA 4DB2A 3ZVMA 2QTAA 5EJMA 4B4OA 2HA7A 4V02A 3PNLA 4RJ2A 4DUGD 4OXRA 4D5EA 1H85A 2JRCA 3NO4A 3O74A 4OKIA 2ZUFA 2RCYA 3RC3A 1M0EA 1J5XA 1K08A 3QX7A 4EAQA 4TMWA 2RHBA 2X8WA 3ONNA 5GOZA 5HFNA 3KOOA 4NBWA 5EKUA 2VUSA 3DW3X 1MVLA 4UHKA 3L0OA 2ZBEA 2XOEA 3PP8A 1QSGA 4IQ0A 4AZSA 4AZVA 2R5WA 2APJA 2IPOA 3KZVA 5JSYA 4DM4A 2DQ4A 3U80A 3NIGB 1EP2B 1CEXA 1I32A 1OBVA 2EJBA 2G4LA 4HWOA 4O4JA 1HYBA 3JWHA 4NL4H 4PBTA 2PH1A 3TW6A 5EAIA 3EOAI 1KY4A 1L4KA 3D8UA 3LUAA 2OSVA 3FYUA 1U0LA 2HGZA 4MWCA 5LDHA 3E05A 3O0TA 3PNQA 5ALIA 1TUIA 2EF0A 3OSUA 3RSZA 1M2FA 5M2QA 2OHGA 2PAFA 3C39A 1K5GA 3ZDXB 3BAZA 2FX5A 1YNOA 3G2MA 4I9GA 1PT6A 1TT5B 4JASB 1F6DA 4RVNA 4CLOB 1PJQA 4MW2A 1N3IA 4KACA 3D0KA 3O4GA 1MAUA 3ZWDA 4CVNA 8MHTA 1SZDA 1TU0A 2J4FA 3AUAA 2EQBA 1EESA 3OO1A 2IW1A 2YY5A 3WG9A 4W5OA 2QYSA 2SICE 3LSYA 4Z7OB 1KBOA 4BGUA 1P7CA 1VIMA 2HNAA 4IMPA 2XTZA 3WAKA 4YCNA 1VSBA 5KYXA 4QASA 4MR8B 1AF7A 1UDCA 3IBYA 3B8EA 3QF7A 5L9AA 1T0IA 2ZKLA 1DRKA 1F0NA 5ESXA 1F1BA 1X1EA 4L0CA 1TUBB 1SKYE 3JZIA 1HR0B 1EE1A 4JU9A 4BP8A 3MUNA 3I3SR 4HAUA 5IABA 2L2QA 3U19A 4DUGA 2MMGA 2IHBA 3FNIA 1OVGA 3AUFA 4MRNA 4TSFA 2QNIA 2J09A 1YKGA 3B52X 3BWCA 3F97A 3NHPA 4UAJA 5AM4A 3CFYA 3RS0A 2P6PA 2H06A 2JATA 3DDSA 4FJ0A 2PMWB 3KQWA 4GQAA 5CVDA 5SZHB 4WLOA 4DN6A 2J3LA 3LRTA 4M87A 3LBIA 4BFTA 2NO4A 2R8OA 1A88A 1G7SA 1XZEA 2QP3A 4DKXA 3T12A 5BSWA 3QVSA 1ONPA 1PR9A 1UK6A 1GKUB 1YE5A 1GQOA 3AEUB 1G8AA 3NUGA 1BEZA 1F4VA 4KVGA 1TPZA 5J47A 3RVNA 3VC2A 3LT2A 5B3JA 1WQ3A 4V2IA 3EZ2A 4PR3A 1R18A 2C92A 3PDCA 5I47A 3OZRA 2FGKA 3QLUA 5A9TA 2JFPA 1KYXA 3I2HA 3AV0B 1QF9A 1NRWA 2FPRA 2ODPA 4RHTA 4EJ0A 4DDVA 1QRDA 3C1UA 5JDCA 2FEXA 2A67A 2W43A 3QV2A 3U31A 4M0MA 1IUPA 4PGMA 3UMSA 2FUCA 1V7CA 4GU5A 1E0SA 4PFSA 1QGYA 2BC9A 5IDXA 2Q6OA 4JI8B 2J1LA 2F55A 1JJBA 2EHJA 1M7GA 2DTEA 3PX2A 2OMEA 2VP0A 3LGAA 4KXQA 5G4KA 1EMDA 3PFIA 1K8QA 4PCUA 4D0SA 1UC8A 2XB9A 4CFSA 1ZG3A 5F77A 4BCDA 4GDMA 3IKJA 2DBZA 4P4UA 3VXKA 1I80A 3WGZA 4QVIA 1ZH0A 4QXAA 3NB0A 5SZIA 4WCVA 2D7CA 5AWFC 1ETHA 2FCAA 1V47A 3JQ8A 2OO5C 3ODGA 3O8BA 3OEYA 5DGXA 1J7KA 1I6MA 3MGAA 3P9CA 5FLEX 1OT5A 2XMZA 4U3JA 3C3PA 4ZVUA 3VU8A 2C4WA 4XRGA 1Q1GA 3CVJA 3ZKWA 2BIFA 3FW1A 3MMSA 5JXIA 4JNCA 2JK0A 1JNYA 2P1DA 3DAGA 4D8VA 4FYJA 5K0BA 5MHTA 2AJCA 3LPLA 3PPIA 4PG4A 2CYBA 1PCXA 1Z39A 4XR4A 3MTDA 5ICSA 5DM70 1RYMA 2HA2A 1QONA 3UWOA 3V8VA 1W4LA 1NLYA 5BSEA 1J4AA 5JS7A 4JEUA 4GNKA 3UATA 2WD7A 3PFHA 1FNBA 4P4SA 3WB1A 5J58A 5DNDA 4R01A 3WLQA 3P5SA 1D1QA 1PR5A 2Q5OA 3BB3A 5KNCA 2VIIA 3DE6X 1J56A 2QMZA 1KH3A 1DEOA 3RKRA 2X23A 1JN0A 3REFA 2C2OA 3CGGA 4U0JA 2XVMA 3NASA 4Y2SA 5A4KA 5L4SA 2C04A 4TVSA 4BTEA 1NVXQ 4C0KA 4J7XA 3RJMA 3RS8A 1ZHFA 3I39X 2CL0X 4A1FA 5PNTA 2IUYA 1JIXA 3BZWA 1I3LA 4JQYA 2QZ4A 4LRTB 1LLQA 2A9VA 4NAUA 3C6MA 3FXAA 3IDSA 4HVCA 3GLFE 3GT0A 2VH2A 4JOCA 5PGMA 4J2HA 1W46A 1YMQA 2JJYA 3RJ5A 5DWDA 5F3RA 4XLLA 1LSUA 3ZWYA 4BFUA 4CKCB 1KKLA 4BNLA 1OI7A 2VCEA 2HSWA 2HUPA 3BK1A 1M9NA 4QTZA 2CNOA 4RDXA 3F4BA 1SKMA 1GD1O 3L0BA 5JFOA 5LUBA 2VQ3A 4HS4A 2BKLA 4YFVA 3HVRA 5B7QA 1MQ9A 1O97D 2YOHA 4Q7KA 1L5GB 2Q2NA 4O4HF 1C41A 3WV4A 4BO1A 1VIDA 2G25A 2GUGA 2GVZC 2W2LD 1T8TA 3UAYA 9LDBA 1AGYA 3PGXA 3TF5A 4RABA 1D6NA 1KBZA 1U2GC 3BFPA 3TQSA 4ZGBA 2X0DA 5KQRA 1I2BA 2JFQA 1TGVA 2QM0A 5IF9A 5IM4F 1JXOA 4K3UA 4XVHA 1T34A 4CMEC 2PLRA 1NRJB 3C6QA 3FSJX 2OZLB 3WOHA 3IMFA 3GRAA 1K5HA 2Y0EA 1K1EA 3D0QA 3EIEA 4I6JA 3HNPA 4WN3A 5FBQB 3TQHA 5EQFA 5AW0A 3NVDA 4EUKA 1CQZA 4F9EA 2DR3A 3U6KA 1S2NA 2ORVA 3G0HA 1JQEA 4KQ2A 1N1DA 5KTTA 3F1KA 5COQA 1QH1A 4M54A 4YJHA 3Q5DA 3RU9A 3WB0A 4EHIA 1EVYA 3AR3A 3ELWA 4PQYA 3H1TA 4MW4A 1X9GA 1MXHA 1OLUB 1H3EA 3DL0A 3CRQA 1SCKA 3GNSA 3HH8A 4KK3A 3VSDA 5BQ3A 3G88A 4Y2QA 2NU8A 1XF1A 4LXXA 1VGVA 2BHRA 3C4JA 2GPYA 3L0ZA 3TLJA 4MKHA 4Q4JA 2WSBA 1F06A 2C20A 3FNFA 1NVTA 1GGNA 2A9RA 4XLZA 3W9BA 3L8ZA 4EG8A 4JI2B 2JI6A 4UAGA 4JD5A 5KNBH 1ACJA 3EDQA 4ZQHA 5AVTA 5FOUA 1PR4A 4QXMA 2J5BA 4H3KB 4IFEA 4EB3A 2HNKA 1C7ZA 3JU3A 3QWIA 2C00A 2MWMA 3I4FA 5JARA 2J9ZB 5H80A 1GPYA 3LDUA 3HDQA 4X41A 2Y3IA 1UXGA 4FOPA 3BWYA 4TZTA 2OD9A 3B51X 2IPMA 3JRWA 3QKSB 4TV9B 4DLBA 2XE4A 4LZJA 2CMGA 2GBIA 2QI9C 4A0FA 2IYEA 1BH2A 3KVNA 4NCBA 4I3HA 1EDBA 1COWD 2H0AA 3L6DA 2RGDA 2Z98A 1GA4A 2ADMA 2XJ9A 2WQ6A 4OLBA 4I8DA 3QKRA 3PIIA 5F35A 1V3VA 3A3KA 4I1RA 3JQPA 5T7BA 2ATXA 1JI3A 4WGFA 2G70A 1ZM7A 4YRIA 2YBEA 1B4DA 2ISQA 4BGIA 1OLXA 5BV0A 4YRQA 1V6AA 5AM1A 1C0PA 1EFTA 4V0LA 3K16A 1RWQA 1E3TA 1CB0A 3BH7A 1K92A 4HEQA 4IXTA 2AW3A 2UYQA 4M7PA 4P35A 4WZBE 1HETA 4N47A 2M6RA 4Q6BA 5IP5A 4EJSB 1B8NA 4F8EA 3IEVA 4NSNA 1U9IC 1E32A 3LXUX 4NK4A 4XQEA 5IDWA 2C4TA 1B41A 4B2LA 3P9PA 4XZ3A 4QYWA 3DWGA 1WVMA 1S8AA 1SHLA 2XUIA 1IN6A 4IQ8A 3WGGA 3ZHYA 2P3SA 4IGFA 1TLLA 1QHHB 1UEIA 4Q24A 4QC2A 4TTVA 3DEYX 3SF8A 3SYMA 3VR0A 3I32A 3GJQA 2QUIA 3N05A 2ECFA 4QA9A 2CL5A 2I4OA 3E03A 4LC0A 4C0JA 1IB0A 3GZNB 3LHIA 3IH5A 4ZOLB 3WJAA 4EOGA 1UBLS 3VUFA 3AHEA 4E70A 3SC2A 3HP7A 1Y9AA 5IG2A 1XFDA 1GAQA 3F9IA 3WLMA 3FFBA 1R5JA 1C9YA 3P2JA 2DPGA 4MJ3A 3D8TA 1ML3A 4JHLA 1Z4JA 2Q41A 4QDZA 2YXPX 3JY6A 4L50A 5LLSA 1MV8A 3VR6H 2ODWA 4S2EA 3ZCXA 3OX1A 4E0BA 1HEIA 1NN5A 3PFCA 2ZRHA 4M98A 2GEJA 2FG5A 1G21A 5EN4A 1ZVMA 4ITVA 3WMWA 3IL2A 3KX2A 3E5RA 2XOKD 4DMMA 1U1IA 1IN5A 2OQIA 3RYHB 4O3MA 3L4KA 2V55B 1XG5A 4MKFA 3KZNA 4RD4A 3RRFA 5ALDA 5FYDA 1UK9A 4XX0A 4PY2A 4ZI5A 1PL6A 1QBGA 1K2WA 1L4NA 2ZJBA 2A4KA 5AVZA 2H85A 2ID7A 2V0NA 3EYWA 4FHEA 4K46A 1N4AA 2QRVA 3MSXA 4ENRA 4TM7A 5JNTA 3LWBA 5A7GA 4QUHA 2W6QA 3O0DA 4KDCA 4G1VA 1EGAA 3KQQA 3S68A 3UBMA 3OFSA 1ADBA 1UADA 3CGWA 2ODNA 2WT8A 4KLNA 3ZR4B 2PSDA 5ALOA 2OC4A 4CEHA 1B8VA 1VG1A 1YTLA 1JFFB 3O92A 3LPCA 3DTYA 3K72B 1J1ZA 3A9RA 3B89A 4AJ4A 3LLSA 3OQMA 1BW9A 3R7NA 4PZPA 4RVUA 4KWCA 4XPIA 2JLUA 4GZ3A 2ZRGA 3V48A 3ESZA 4ALIA 1FUUA 1N2XA 4ZZ2A 3ZTTA 2RC5A 4XGRA 5BR4A 2BZ1A 3WHIA 5SV2A 2CW5A 5H83A 3KOXA 4ME6A 2ZUEA 3SCZA 3AR4A 1KVTA 3GAMA 4MGEA 4D0NA 3QELA 1ECGA 4CW7A 1B6RA 2JJ2A 3BKXA 5BSGA 3CWCA 5AJHA 3ZGYA 5C34B 5LQCA 4KX5A 3HGMA 4RCYA 3PQ8A 5JWRA 4ZIRB 4ICIA 1JMKC 1TKRA 4WY2A 1WDKA 4DAEA 3FOFC 1ZOSA 3KCQA 3KYCB 3TTVA 4FGLA 4BLRA 4OU5A 3S27A 3UB2A 1AQIA 1L4YA 4PEVA 3P94A 3A6FA 2PJUA 5LNK1 4XA8A 3K9CA 2I3DA 4FSXA 2YYYA 1BMTA 4DQ0A 2XE6A 4JL6A 4LUCA 1Z0JA 4YP0A 4E07A 2ZDQA 3LBFA 4ZDWA 4OGKA 3RYFA 3GCXA 2IIBA 2NVBA 4BNDB 3FNEA 5A5FA 4LYYA 4PTYA 4ZD6A 5A4AA 2H8KA 3LKZA 4I55F 2YXLA 2YFYA 1XMJA 2BHNA 4RIEA 3GEBA 2DH6A 1V8DA 3VSEA 1YZ3A 2H00A 3E3MA 5DCLA 3COSA 4HX5A 4ETIA 1E99A 1Q22A 4IGEA 2O50A 3CXUA 4LEIA 2IYSA 2YHIA 4LTMA 5C5EA 4KIJA 4F6LA 1EP3B 1TCUA 3AHHA 3EY4A 4KOAA 3U4HA 4F4JA 2Q5JA 4S1WA 5IKMA 4BB6A 5E3JA 1G8PA 2HMUA 4LV5B 5LM3A 4PLZA 1YA8A 3C3CA 2JLZA 4LVNA 1Z0KA 4II3A 1U02A 4R9NA 3RWBA 3ZQJA 3S1AA 1CRQA 4KYTA 4I1VA 5D3MB 4EKIA 2XXAA 4I14A 3SNHA 3QWBA 3V7NA 2PUBA 2YS7A 4Q1BA 2C3OA 3T3PB 5JSZB 1HK7A 4GOKA 1TEVA 4D96A 1EKXA 2IYNA 1C7EA 5CM2Z 4TWZA 1DIAA 1TQDA 2BMFA 1BA3A 2Q50A 5M7EA 2AFHE 2NZUG 2CXNA 3CH5A 2OYSA 1RKQA 2OBXA 3A8TA 3EEYA 3HBNA 2XB6A 3OZCA 3MMPA 4KMOA 3H1BA 3ZWKA 3C97A 3MMXA 3ORYA 2O8CB 5CTAA 4MUJA 2JAPA 2E7ZA 3JCZA 2ZIAA 1NPTO 4Q02A 5K8IA 4QXOA 3NBUA 4NRDA 1NTRA 2JCXA 1DINA 1KI9A 1CUAA 1O6FA 3S1LA 1KS2A 1SU7A 3HYLA 3NGLA 4HWSA 4Z54A 3KBBA 3FOAA 5BMOA 1F7UA 3FZQA 1U2PA 2SECE 3QIAA 1S6YA 2NTYC 3VMMA 5A5GA 5REQA 1J8MF 1CUCA 3WFIA 4CMBA 3D81A 1OC4A 1XDGA 3H5TA 1EFKA 3DZIA 4MROA 5CA1F 1SCQA 4R84A 1YR7A 5CEEA 3PPYA 2JGEA 3GFGA 3R3XA 5JSHA 1BVUA 1GL3A 4DPMA 4EI2A 1E8DA 4P0PB 2FEWB 2D1RA 3N28A 3OF3A 2VEDA 2XIJA 4KPGA 2NZ2A 2G9RA 3MFYA 4B6QA 1Q12A 5K8TA 4JB0A 1VIVA 5EP3A 3U3RA 4Y2UA 4ERXA 4Q66C 5B55A 3M4ZA 1E1YA 2A33A 2FZWA 2YFQA 4FLEA 3DFUA 3HWSA 4ILKA 4LZOA 4DM7A 2OQ2A 1H42A 3VKHA 2EIXA 4BGEA 4E13A 3V2GA 3LT0A 1R6VA 4CQMD 3OT4A 1C4OA 1K66A 3FCXA 4XB6B 3N2GA 2ZVDA 3H97A 3HNOA 3PDIA 2Q4OA 3ZVNA 1J0XO 1M2VA 1UJ6A 1UM8A 1ZCAA 1SXPA 4FZ3A 1QYWA 2ZITA 3EQZA 3V4RA 1GTVA 1E2GA 4LOKA 2CK3A 4C1BA 3DBHA 4B3MB 2F1RA 2NYRA 4OD0A 4DRYA 3DONA 2IYTA 1K4MA 1KH2A 2EKPA 1P4SA 2BAGA 3L05A 4TROA 3RTAA 1H69A 3M0EA 2ZBQA 5CFPA 1E5TA 2JFZA 4FWIB 3TMAA 4KQIA 4YBRA 2GDJA 1QFZA 4D7AA 1J5PA 3R77A 1QNLA 1IM2A 1BMQA 4YQFA 3G23A 4IHJF 5J9FA 5IUJC 3W5CA 3HYTA 1F3LA 4EJ2A 4FEAA 1HYGA 4AW9A 5I4IA 4NZNA 4D98A 3AG5A 1MAVA 2E18A 1O2DA 5KYWA 1QE5A 1H3FA 2NU7A 3HR7A 5E6SA 3WAGA 4KQFA 1X7HA 1N2IA 1TYDE 1VCOA 5AOBA 1L1EA 2L0XA 4UPEA 1EFUA 1WXQA 2CNBA 2W0SA 5P21A 2R44A 4R7ZA 2HRCA 2IU0A 1AD2A 3BL6A 1TECE 3KR1A 3PHLA 2HZ7A 3A3PA 2R8XA 1DT3A 3OCCA 4HDRA 2WJAA 1XKQA 3FIJA 5CFNA 4RGBA 1YHYA 4MV1A 1ACMA 1QH0A 3C3WA 2WA2A 3BG5A 3NJ8A 2CXXA 3T5TA 1C7JA 1FSZA 4PSVA 1FVFA 3SKVA 5DTJA 3HACA 1NUUA 4K88A 4A5OA 3FD8A 4O02B 5AVRA 2I6TA 5FWDA 3VR2A 3LDHA 1RYDA 3MJ4A 5JBIA 2PJRA 1RYFA 1UQUA 2ID8A 2JDID 4AJ1A 2JKYA 3DJYA 4ZK2A 2HDOA 4DNQA 4R83A 1OJ7A 2ZUSA 3V4ZA 4ZMRA 1SCJA 1U8XX 4H4CA 1JHUA 1RWKA 2DGDA 1EM8B 1S3SA 2JA1A 3BCSA 4US1R 1ZM9A 4CM8A 3AFGA 5TLSA 1W96A 1OBOA 1TCAA 1JT2A 2CFTA 3KOWA 1U8UA 2POQX 4OJNA 1P6QA 2BYTA 3SZLA 5AUPB 4QWMA 4P5PA 1XI2A 3G1WA 2EQ5A 2GBCA 5A9SA 3ZJ4A 4FYIA 4WASA 5GAJA 4UUQA 1NNSA 3AUYA 1TAQA 2X1MA 3AEXA 3BUSA 4IHKA 4C89A 1N0IA 3IQHX 3R6LA 4NJMA 4FZRA 4MQ6A 3DUFB 2YW9A 5B7PA 4N7MA 1OU4A 3RODA 1N2EA 3BJZA 5H4GA 3LOQA 1E98A 2BEWA 2C9CA 1UPCA 1KIAA 3UAGA 5DJ5A 5CVJA 3C2QA 4ZO4A 1YB5A 4K9MA 4Y7DA 4WACA 4ZTBA 3PQ4A 4DRZA 5ESWA 2HF8A 1T2EA 1QFSA 3X1DA 2I66A 4QBTA 3N9IA 2QPAA 5BW6B 5C8YA 1ENYA 2HLHA 2VJMA 4JP2A 5DSXA 3RBVA 4EHHA 4HH3C 3NAMA 3UV3A 5IKEA 5L7WA 1UXHA 3DM9B 3UWMA 5J5VA 2J33A 3M83A 2RFLA 5FOXA 5KQPA 5JV5A 4LV6A 5CA0A 4MUEA 3IALA 5LMZA 4NZYA 2C5HA 2G9UA 4X63A 2EFHB 5ALHA 1BJTA 1LB1B 2I76A 2BBWA 4E5UA 4ZYLA 2YX1A 4CV1A 2Z1DA 2GF0A 3L1HA 3JRNA 3QE0A 4L76A 3IO3A 4EA7A 4TLBA 5G0SA 2OAP1 4US2R 3JATA 4RFLA 3H9EO 1GPNA 1NG1A 1A4IA 1HFKA 2I4RA 2NUPB 4HDOB 3SE0A 1U7OA 2MSNA 3DF7A 3LGSA 3W3AA 1A9YA 1GZUA 2QXUA 3OOHA 3TX2A 4UTNA 1BFKA 3OX3A 3AZPA 1ZMOA 4IQ4A 2JFHA 2JCSA 2OM6A 4L6IA 4EG4A 1BOOA 4PX2A 3C7TA 3HZRA 4Q3CA 4B8ZA 4UDOA 5TQ2B 1Q7GA 2JIMA 2M32A 2JPDA 3H4IA 1YZVA 1BWSA 4C0AC 4QDJA 3I01M 2R1TA 1DG9A 1S1MA 1DLIA 3JZMA 2W6CX 4NCNA 3CONA 2X5KO 2ZR9A 4MS1A 2JBWA 3VR4H 3W1WA 5C4IA 2J3IA 4JZKA 3TM5A 3E22A 3RIXA 5FF9A 4EP1A 3TZBA 1H8HD 2NN3C 1A96A 2XH8A 1U0BB 3DOEA 1P1IA 3B5JA 1X1BA 5AI0A 5CM8B 3W34A 5AI9A 3GPIA 2ORED 1D1PA 3WQBA 3DYIA 4WD3A 3M82A 3TEJA 1JIKA 2PA3A 4M1WA 1G20A 5ECDA 3ROQA 1FMJA 1QLJA 3IMKA 3UJ9A 1H5QA 5BYBA 3VKGA 6REQB 5TRTA 4CF3A 1E3MA 1HF3A 2CFIA 2O8BA 1MX5A 1XTTA 1YMVA 2WIDA 3KQSA 3R3VA 2O07A 3AVVA 2WM2A 4CIAA 4AURA 4D4LA 3AEZA 4J0EA 1XNJA 4B5LA 2IITA 3A4MA 3ESXA 2VRWA 1KQFA 9MHTA 4Q39A 4KG7A 3ZOKA 1ND6A 3L8DA 3ULKA 5DEIA 2VATA 4KPFC 3FJ1A 1Y80A 1L4BA 2ID4A 4UZEA 4WZZA 5JDIA 4QICA 5A03A 5JYBA 2FHPA 4S1TA 2GHIA 4FU0A 2B8JA 3CUWA 5TY0A 1YRBA 2I7XA 1S01A 4JZYA 3ZLBA 4DV6B 2HHHB 4OEHA 3IT3A 1R9GA 1YZHA 2H11A 3H83A 5IBCA 1BXGA 3JYLA 3PQ5A 2PTGA 2BEUA 3TQQA 3OPQA 1O5OA 3C70A 3NHAA 2QRGA 1L6IA 1SVUA 4C4TA 2IOQA 1SU6A 4BO8A 2LDXA 3A6LA 2OB2A 3GNQA 5KNDH 2FMTA 4B3XA 1FLVA 1F9AA 2G9ZA 1H23A 2P4SA 3BL8A 4NBRA 4NE2A 4P8RA 5DX0A 1ZM4A 5IJXA 1UJMA 3T3OA 3H6GA 3FHJA 1Q16A 3ABQB 3TNDA 1SC3A 4JVLA 3WK8A 1F0PA 2R5NA 4YJ2B 4I50B 2GM9A 1XTSA 1WBJB 3JTMA 2W6IA 3KD2A 2JHCA 5EZ6B 5ARBA 3QOYA 1LGYA 3C8DA 1GUZA 1JSRA 4Z3KA 3AJDA 2QRHA 1C50A 1P4GA 5BY2A 4JAVC 2FSUA 3UAWA 4AJJA 4ZTZB 1LBIA 3IKMB 1CC1S 2FG7C 3JQ9C 5IMSA 1ZAYA 1RJ9B 1QU2A 1QS0A 1EXNA 2GN9A 4D6XA 4YUZA 2ZSFA 3O91A 2OSBA 3V33A 3PEUA 1S8FA 3EZ7A 4JLUA 1JMVA 4Q4HA 2ZWVA 3KT6A 2AJTA 4IZOA 1SD1A 2H1IA 1QGDA 1YRYE 2QUHA 3ZW9A 1SOAA 2VR1A 2WF9A 2AOUB 4L0MA 4PNZA 3UUWA 5B1HA 3VAZA 4U00A 4KPEC 2DXIA 2ECPA 5F7JA 1XWIA 2P2CA 3W7BA 3AOEA 1EU1A 5I4KA 4BNMA 4BP9A 1X7ZA 1FBTA 2KQUA 5EZYB 1BWRA 2NO5A 3SXJA 2BGTA 3EGXB 3EFOB 4KXWA 4OQYA 4AK9A 4MRVA 3LZCA 1JR2A 2P2DA 3NM6B 1XWFA 4Y6GB 3FR8A 3I9FA 3WB9A 3ZUGA 2VPYA 2WOOA 3H7AA 4OJMX 3MTJA 1NPYA 2WG1A 3N3AC 4WFKA 2OAGA 1SUAA 2B21A 4Y1RA 1OYYA 3VRHA 2C7GA 2PWZA 5BQPA 4E12A 1P3Y1 3I05A 3PENA 3K1AB 3FHLA 3TQTA 5BVHB 3QEJA 1JA0A 1Z4MA 4IKPA 3RVLA 2HTEA 3DE0X 2P2YA 1OIVA 2XNKA 2JAOA 3IVGA 4LJ6A 5ALKA 4F85A 2Q3JA 4FQ7A 1C30A 1QZTA 3BH6A 3GLKA 3KZMA 3IJPA 3A4YA 3ZHUA 4L07A 1L4LA 1ZP6A 3W79A 5L3VA 2IYPA 3QPCA 3S44A 2F7SA 4J75A 3UG6A 4QRHA 3L6UA 4EHBA 3KKQA 3AWIA 1XTPA 3RREA 1APBA 4KPUB 4TZ6A 2PA0A 3FTQA 4KXFB 4YV7A 1BEEA 1CZNA 1AGNA 1B93A 5GONF 2C8VA 4ZCQA 3VYVA 2H5JA 3SVLA 3DLBA 2HH9A 1A8UA 1NMQA 3AJRA 3ZLTA 1QGAA 3A58B 1G98A 3PUIA 2QB5A 1KERA 2JFGA 3HO8A 4J0GA 1UFVA 3OTOB 3TPCA 2TS1A 5FOTA 4IDPA 3L1KA 1P9RA 3TCXB 3K1YA 1MF7A 1MVOA 5CNJA 5LZ8A 4WBNF 4YRMA 3A28A 4EUSA 4HLUC 5JECA 4N39A 4ALKA 1BX3A 2YS6A 3LC1O 2GA8A 1VE1A 4GKAA 4IDCA 5DZSA 1TT5A 4CLOA 3W5SA 1ZSYA 1F6BA 1CZLA 3ZH2A 1P0QA 3CKKA 2P77A 3UZUA 1E6LA 2HT6A 4RPGA 2GA9A 2GN8A 4QYXA 4ND3A 3EA0A 3GPBA 3AJ9A 5K3FB 4RSGA 4X60A 5AUQA 1Z25A 1DX9A 1D07A 3R0IA 4EYGA 5JEDA 1EVIA 1UFQA 1ZINA 3CJQA 2FWPA 1J24A 4WBXC 4BN0A 3AVTA 1IN4A 3JPWA 3NOQA 2XW6A 2ERYA 1AG9A 1CY0A 3L02A 2EOAA 3P5BA 4MR8A 3RU2A 4BNHA 2H1SA 2V5UA 4M89A 3GEGA 1UEXC 3PCTA 1TUBA 1M7HA 2NTJA 2ZYRA 4BRSA 2B35A 2CJFA 3KB6A 5JMOA 3CCBA 1KEEB 4R1QA 4Q6WA 4BL5A 4GBED 3UHAA 4C6RA 4DHEA 5JSFA 5L7YA 3HRIA 1WY5A 3I5AA 1KJYA 2JFUA 3O73A 2G1KA 2R5FA 1IVSA 2PS0A 5K6AA 1FW8A 5DYIA 3U39A 1Z68A 1I4EB 4HGQA 4Q9NA 2E4WA 4CDMA 1T4MA 1D9XA 2CXHA 4P4GA 3A2MA 1DWPA 2AN4A 3BJIC 1UOQA 4WFQA 2JAWA 4QXQA 5CXXA 2OFFA 2HPZA 2WVAA 3TIIA 3FHCB 4P7JA 3AEUA 4OMFG 3CH7A 2VSFA 4DTIA 4D3SA 1JT9A 4IY1A 4HBZA 3U3DA 2W98A 1C1XB 2VWHA 4R8KA 4E32A 3LK7A 3N07A 2B30A 3ST7A 1S8NA 1P62B 1XNRB 4DA6A 3DE1X 3ILSA 4HUJA 5E6RB 4RTQA 5JO0A 1B8OA 1V7ZA 1JR3E 1N57A 1O4VA 2UKDA 1WNFA 2Q6TA 2RB5A 1YVDA 2IHJA 4G84A 3PRJA 4C5AA 4DSOA 4XFDA 5U4QA 4DSZA 5FOQA 3ZLVA 3ASUA 3BRSA 2O7SA 2YOGA 1M34E 2D5AA 1PLLA 2JRLA 1YQQA 1J0EA 2QG9A 3KSRA 4H4DA 4X54A 4YRFA 3FUTA 1E1LA 2ZYVX 1SQGA 2DR0A 4ALMA 4EPVA 5LYJF 3S29A 3WE7A 3B13B 5IVIA 2IDJA 2JIPA 4OYRA 2W22A 3HP1A 4ONEA 3RTEA 3W2EA 2Q45A 5IVDA 4DQKA 5EIWA 1E5LA 3ZHCA 2JJ1D 4DSNA 4YR9A 2X2EA 2QL7A 5M34A 1FMFA 4HEJA 2AN1A 5KVCA 1P72A 1D2RA 3LT5A 3G7SA 2AKEA 3OQNA 1MZVA 2GKGA 4KO3S 4C1NA 4YAJA 3VAAA 4MVJF 2PZGA 4OGFA 3TGLA 1B23P 4JP8A 4EJMA 4KWIA 1DBRA 1QWSA 2IIQA 3BBLA 1ORRA 5TE9A 4CLEA 1QPBA 2XCIA 3WGUA 3K2BA 3HB0A 3HABA 2J7KA 3HGQA 1Z7EA 2GEKA 3NWEA 1RE0A 3P96A 4OMUA 2D5IA 4UE6A 1NT4A 5DBHX 5J5CA 3AU8A 2HU8A 3ER9A 1TQ4A 3IS3A 2A5GA 1R27A 4MCIA 3C5CA 4K6CA 1M74A 3AK4A 2W6MA 1UJ2A 3A9CA 3LQYA 4MYTA 2QUJA 1ZSNA 1QG0A 1IQUA 1ZYUA 4MV4A 4DADA 3NR2A 4MUFA 2UU9B 1MGPA 2VNIA 1MHPA 2ZWOA 2RARA 3ZUPA 5TC4A 2J9YB 1XV5A 3NS7A 5LMCA 4Z8XA 3M81A 1OFIA 2RI6A 3WYCA 4BX0A 1X8JA 2XZLA 3T1YB 2AVDA 1JIVA 2E6UX 4MP6A 4D8TA 2PQ2A 1FLDA 2YTZA 2Z2YA 4YEDA 1TYBE 2XDQB 2XUHA 3WGIA 2UUBB 2VJBA 1PSZA 3FRJA 2PHZA 2HMAA 5JS8A 1PJCA 1YONA 2Q1SA 4IRUB 1GN8A 1OE0A 3D1VA 1GN9A 3C41J 2QMEA 2WYHA 2Q6KA 2PKEA 4L75A 3PXDA 5DLQC 1ZZGA 1K4KA 4CPDA 2FDXA 4X24A 1R1DA 3FPEA 3QY0A 4YMSA 3LUGA 3OH8A 4Q1DA 3TN7A 2AXPA 1KK2A 1U8EA 2VPWA 4KSBA 1CIVA 5DOVA 4XVCA 1JKJB 3ZV3A 4B87A 2R86A 2WHXA 1RCTE 1QBKC 3E0QA 3EQ8A 3CPEA 4F45A 3L7OA 3W7AA 4MV3A 3OIYA 1KEZA 3NHKA 4ER3A 3WNQA 3GFOA 4DCCA 1P2VA 1GQRA 2Z4SA 4FDMA 3ROEA 3R7SA 3ZEIA 2PD4A 4LOAA 4ZOQI 4PZDA 1SIBE 1XKLA 1WP9A 5G3ZA 3IPLA 3SJ7A 4A9AA 3GV0A 2OUIA 2JI7A 1NUPA 1L8XA 1I3MA 4FK8A 1SJ9A 4E09A 2CXRA 3EPHA 2WAAA 5E6UB 1YA6A 3FBTA 3HR8A 2OZLA 1ZITA 4DSAA 3OIDA 3T8YA 3DKRA 3Q8MA 3FF4A 1MJGA 1I7PA 1P0IA 2OB1A 2QLMA 4PWZA 4AXBA 1ABFA 2HK9A 1HZZA 4CL0A 5EHZA 3AVXA 2NQTA 4G8DA 1BS2A 1ZK4A 1QX3A 2RAUA 2WIJA 3ANSA 3K20A 2VWGA 4K7JA 5EI5A 1NVVQ 1OLUA 1E6KA 1UC5B 3MOIA 3GBPA 2DX7A 4DG5A 4DW8A 3JWGA 4JJ7A 3K0KA 1QVWA 1YQWA 3QXCA 1A50B 4FFVA 2ATIA 2Q5HA 3UG7A 2DC1A 2HBYA 2J9FB 4A0QA 1VPWA 1VE6A 4RIHA 3O1LA 2DB3A 3QOXA 3OQ6A 4CU2A 1TM2A 1I7LA 1NRIA 4GYKA 4D8UA 1W35A 4QYSA 1OWLA 1THGA 4D42A 1YUMA 1JQ3A 3HS3A 2J4CA 1G8MA 2IEDA 1M6YA 1YRQA 4Z6KA 2QYOA 2P7IA 1EWYA 5BOVA 3KQOA 1SBCA 4GBJA 5DLPA 5FIUA 3UXYA 1T1RA 1N2GA 1ZJZA 5EMLA 4D25A 5JOQA 1QZXA 3HSSA 3KZOA 3DQQA 4QJ4A 4CETA 3GN1A 4ZZ0A 5TMEA 5F7XA 5HCNA 4NJOA 1X42A 3UPUA 3GP8A 3QKSA 4TV9A 1CW2B 3NALA 3ITEA 4JLWA 4B45A 1Y6QA 4FMPA 2UXDB 3ZHZA 2XRFA 2EP8A 3DHYA 4A3SA 1IG3A 4GOOD 5IYZF 3HN7A 3RROA 3KELA 1NUQA 2PRYA 4LFAB 2FEKA 4KRGA 4YLGA 3B3JA 3FAKA 3LU1A 4M83A 1IEXA 2BKEA 4G0UA 2BHLA 2P79A 4U2DA 1XJCA 2X3FA 2OPHA 5AK5A 2G5GX 4C01A 4CM7A 3GJZA 5A4JA 2Y0CA 3LCCA 4TZKA 2JFFA 4XM2A 5AW3A 6YASA 2SNIE 5DM60 1NJFA 3W8RA 2VJYA 4N5NA 4BZPA 2XVYA 2TSYB 1U28A 1SVLA 4EJSA 2P5UA 4V38A 4DWWA 3HY4A 3OPYB 3J81A 5I9BA 2SBTA 3U4QB 4N76A 1CUEA 3PFBA 10MHA 1VPLA 2I4IA 4FD3A 1R12A 3ZXXA 1CF2O 5K05A 1WULS 1T5SA 2P3QA 4H1UA 1IQPA 3C7AA 1QHHA 3K31A 5DE3A 1XYVA 2Q2QA 4ND8B 1ZJWA 1CHDA 1UKCA 2B7BA 3ZNQA 4FIDA 4DBLE 3VSBA 1DO0A 5CW1A 2L82A 2QMYA 3GZNA 4ZOLA 5F3DA 1XQVA 1KA9H 1CDDA 2QXYA 3KLBA 3NCTA 1KHHA 4O2AB 4TYYA 3DHVA 3OX2A 3OZFA 2OQVA 1AK2A 3DMNA 1HT2E 2AOTB 3EH2A 4II7A 1RTTA 4PLGA 5A3SA 1KE1A 5JALA 3LKVA 1WOYA 2ZI4A 3CX6A 3D5TA 5AKGA 1SQ0A 2N3ZA 1GRCA 1MIHA 1ZGGA 5E7JA 3R75A 1A9QA 5CHYA 3NQ41 1GCAA 1NQXA 2WJ3A 3MS7A 4GIBA 3UMJA 4ZC1A 1R4AA 1TEHA 2XRMA 3Q5EA 3NVAA 2ACVA 4GZLA 2JGLA 2O48X 1IM5A 1MIOB 2AC2A 2CUKA 3UAVA 2VHWA 4JENA 2QA5A 4B1FA 4DLWA 2V74B 3HZZA 3RYHA 1CE8B 3HCOA 4RIGA 3W5VA 4C4SA 1JKMA 3E8XA 1LRJA 1FNMA 5LBUA 1KU0A 2OECA 4MKXA 4Q19A 2K87A 3JR3A 1KEPA 1BHJA 4C0LA 2EJTA 1RWMA 2DH5A 3M5DA 3JALB 5IC6A 3B20A 4CL2A 1FRQA 5I9NA 1O4WA 1ENOA 2IODA 2Y9PB 5J5AA 2P8JA 2YNMA 5IT4A 4DR1B 3IBTA 1UUFA 2QX7A 2ORWA 2QT9A 4JCOA 1XAHA 1Y9DA 2G08A 3LDFA 4P93A 1YCDA 3WGJA 4UTPA 5LIPA 5BVGA 3GLFB 5EJIA 4P08A 4UTXA 4AP6A 4YIKA 3L1UA 5F4BA 2HYDA 1KIFA 3VU0A 3AVYA 1JFFA 2AN9A 3K32A 3A27A 3A9SA 3MQFA 1WPRA 3HVIA 3PQFA 4N3GA 1NN3A 5AKXA 3TRJA 4DHWA 2KW5A 4O63O 1NXTA 2WF7A 1C9KA 2YHAA 2V4ZA 5L7TA 2FVXA 4XASA 4YQEA 5IM5A 4RVDA 1PT7A 3K0CC 1EJBA 2IXEA 1SUBA 5HK8A 3RDPA 4UTOA 2GPBA 1SG6A 3RJ9A 1R8YA 1T1EA 4RK4A 5KDLA 1HDIA 2KSQA 1RPAA 3QZUA 4BKPA 3PX7A 1JJIA 2JHFA 4NPAA 1JFRA 2NUBA 3GMSA 3LYLA 4J9UE 1DAFA 4NS4A 3S7TA 1RI1A 4J0KA 1WUHS 2IYQA 2J48A 4ZIRA 3MERA 1IXRC 2II6A 5K7SA 3KYCA 3LBYA 4N8SA 5IVPA 5IAAA 2ZT7A 1EWQA 2HWYA 2GM3A 2BMVA 4P53A 1ODIA 4OQDA 3A9UA 2WUGA 4JODA 2BKVA 1TK3A 5FI5A 3ON5A 5AW6A 3CSDA 2DUUA 5BV8A 2AZ4A 3DC2A 5B57C 4YY3B 3UANA 3USZA 2WT9A 3ZDBA 2RH8A 1DLJA 4HCJA 2XKKA 1RWPA 3AUJB 4EG6A 2NGRA 3IIMA 3PL5A 1EINA 3PKJA 1MDFA 5LA6F 3WTCA 4BNDA 4EX7A 3RS5A 3TZQA 3R4CA 1E9CA 2DUJA 2HRBA 3UJ8A 1X8KA 3LH5A 4NU5A 4AJPA 3ZGLA 3ZHSA 3FROA 5HKBA 4M1SA 2VTEA 2YYZA 3WA7A 3EXAA 2QN7A 2WU0A 3CTMA 8ADHA 1AMNA 1QF6A 1JG1A 2JIZD 4NKRA 1Q6ZA 1HSZA 3SHVA 5ICCA 3ANYB 1CS0B 1Q74A 1YCHA 3UYLA 3V4PB 5FV4A 3F3SA 1NJ6A 2MR6A 5FTWA 3ZU5A 4FC6A 2BEKA 3SQXA 3VHXB 2GZ3A 4RCZA 5EINA 5D6NA 1YDHA 4OYYA 1IRIA 1RE1A 1Y8AA 2HLDA 3ZD6A 1XLUA 3OZVA 3H3JA 1X13A 5D3MA 3KQKA 2O06A 3UN1A 1WTAA 3ZE1B 4Q21A 4RTLA 3NHUA 5JSZA 4IDOA 4PM4A 1YC2A 5IZ4A 2XZOA 2X1LA 1CVRA 4NHOA 1TOAA 4CF7A 4FFMA 3KQYA 4KC0A 1WMDA 2MT9A 7ADHA 2BGKA 4QM7A 1P2TA 4LYGA 1ZUNA 2CVQA 3KWJA 4XKJA 4YT5A 1L5NA 4BNXA 2PGDA 4GI1A 4ZN6A 5JMTA 2O8CA 4EL0A 3FNGA 3U62A 3SC4A 5K8VA 1JPVA 4WK2B 2XYPA 4FNMA 1R6DA 3GJ7A 4ZCRA 1FFHA 1NVGA 1MO5A 1T9DA 1E8MA 2I2DA 4E1BA 5JLAA 3K8YA 1YJ8A 2R8PA 3U44B 4JEIA 1AKEA 2XADA 5HZHA 1SCNE 3FFAA 2ZR7A 4Q9DA 2ZRFA 3M6XA 4UTZA 3CKYA 3EW7A 2XEXA 5EXSA 1LW7A 2NVWA 1CRPA 5C52B 2VZLA 2MYTA 1A9ZA 3QJ5A 5DK6A 2YHBA 1G5HA 1K8XB 3L04A 4WLVA 2QTRA 2V9CA 3AHCA 3MWLA 3BTVA 1H6AA 4BBAA 2OILA 1W6UA 2EL7A 4HB3A 1LFDB 3V4FA 3FCSB 4PYJA 4G0XA 3WNVA 1ST2A 1R0LA 2C4MA 3BCRA 3D8BA 4IDAA 4MLDA 2F64A 1YBFA 1F2DA 4GVXA 4MWTA 4DEXA 4N8DA 4ADSG 2G1JA 1A0OA 3PB3A 4RA6B 1TO2E 4MO9A 1MTOA 4L3OA 3E15A 3QSGA 3T52A 1PBNA 2NSLA 2QTVB 3G0GA 2PLNA 4CKWB 3H1EA 4DPKA 2PT9A 2XECA 1S2GA 2GFHA 1EHCA 4TMFA 4ZOAA 1FXWF 3THRA 2AUMA 4OQPA 1EDZA 4QQFA 3IBSA 5K99A 2P5YA 4W1RA 5KQGA 3Q3JB 1V5EA 1UANA 2OPBA 1XQ6A 1PV2A 2H4JA 2ZSKA 1ZI8A 3B38A 3HA3A 1QGZA 4QSMA 2DUWA 1IMJA 16PKA 2QW8A 3P4XA 4PWYA 5EIFA 3FBWA 3UUFA 3W6OA 4EABA 5BWNA 4GPBA 4TMZA 1B2LA 4WN9B 3GVIA 2C1EA 4LJ5A 3GRUA 3C7CB 4Z9YA 5IBPA 2IYZA 3UJ3X 3WQRA 1XNGA 1NUTA 1U2EA 2IC5A 2QAGB 1LJUA 1BC5A 2R7MA 1DQYA 5BN4B 1GLNA 4YRNA 1DC8A 2VZEA 5AI8A 2XMBA 1KSJA 1QVVA 4R40A 1N2CB 1T24A 3T7EA 3NG1A 2PZMA 5G3YA 4E22A 4JBWA 4Y2XA 3E3OA 4F2HA 1DQSA 1A7UA 5IF3A 3KEQA 3SQWA 3DAOA 2FZ5A 1O58A 3EDOA 2XQJA 2NXEA 2PX2A 4CTMA 1CJKC 4K9OA 1JW9B 3C5EA 3WSVA 5JQGF 1HT3A 1C0IA 2WIAA 5DHRA 1FDRA 1R0RE 4H2DA 3DCJA 4RZIA 3GA5A 5HGXA 2ZATA 3GHYA 3OKPA 2OVFA 1XRMA 4PONA 3TLMA 4AMGA 2CB9A 2M1XA 3L84A 2HT1A 3NP7A 4RE6A 1N32B 2PRKA 4L7QA 4UNRA 1L7BA 4YMVA 3JQAB 3AZQA 1EWKA 1G0NA 3ZJUA 4U02A 1SRRA 1ZDMA 3T5BA 4BFVA 4HC4A 1MC4A 2J41A 4IMIB 2M9MA 2XE8A 3ZI7A 4XIYA 1MQAA 4PIPA 3OA0A 1TM3E 4UQOA 4QQNA 1XLTA 3ILVA 1I4TD 3QVMA 2DY1A 1EM8A 1Z0DA 2H0RA 3MXOA 2HWWA 1BD4A 3NUQA 5JNRA 5K8CA 3L8HA 2UVQA 1TVCA 3BCUA 3PCRB 1GADO 1R4ZA 1Z34A 5BQFA 2AX3A 4QNRA 2ID9A 2GWRA 2W2OA 5CYPA 1QHNA 2BT4A 2O0JA 3MLEA 1VE7A 2ZUUA 3EZGA 1RHJA 1G3MA 2CNNA 3NNDA 3OETA 3UOWA 1Z4QA 3MD0A 3VYWA 5JAUA 2W9XA 3GGJA 4I9FA 3LECA 1E79D 2JLQA 2RH5A 2QN9A 3JQ6A 4UUBA 3T9DA 2Z9BA 4EELA 2O8DB 5A7HA 4GOND 1FUYB 1QQAA 1BE0A 3MA0A 4AL4A 3DUFA 2H9YA 1MC1A 2KBEA 4DBVO 1EK5A 1BGXT 1J25A 4EVSA 1CB7A 4J4HA 1PQPA 4LF5B 2PZBA 3CINA 4IDDA 1GM5A 3AKYA 4R98A 2FN3A 3AFOA 2H6EA 1FUKA 1Z15A 2G5CA 2W00A 1A9XB 4N03A 1FU8A 3AI2A 1EFLA 1J2RA 1LBEA 1G4AE 1RR6A 3H3FA 3I45A 4JLMA 4ZPXA 3TTUA 5C1PA 2P4EA 3HEAA 3REOA 1F4LA 5DT9A 4R05A 5BXQC 1Y6ZA 2VHTA 3FDIA 1UBSB 4UHBA 4YAWA 1OU0A 4XYBA 4N7BA 1LY1A 5KYTA 3KR0A 3JQBA 3E84A 4NMXB 4UXIA 4KLRA 5IAOA 1J0AA 1YIDA 3I3OA 2GH1A 3EIHA 2FUG6 4R3UC 2AQKA 2F1OA 4E15A 2NUPA 3WGTA 1SOVA 3H05A 4HTFB 1NI4A 2ZYWX 4Q9HA 3I9LA 5D3ZA 4ZU6X 5DGDA 3WLRA 5AJUA 5DV9A 4D6YA 2H08A 4JP1A 3K96A 3MTIA 3T5PA 3TEMA 3HY3A 2CGEA 1E69A 2H4XA 4DLUA 3GIDA 5ER9A 2H5EA 4OG2A 2GVNA 5AW9A 1ECCA 2WU4A 4MDHA 1JA9A 4PO1A 5TQ2A 1P61B 3F8WA 1IN8A 3TM4A 3E1KA 3R23A 3VR3D 4MPRA 1S2MA 4QUIA 1EX6A 2M6LA 3BHJA 2R6GA 2FPIA 1RZRD 2ZB4A 3RC8A 3KCNA 4KAJA 1YZGA 3L6RA 3CEJA 3H8SA 4WXHA 2Z4TA 3O7MA 4PANA 5AVWA 4L1KA 4Y2JA 4UXJA 3W4IA 3MS2A 2NQ8A 2VSNA 1Q1EA 1WMAA 5JJCA 5FWNA 1W4ZA 4J1TA 4AB1A 5CDTA 1ES9A 2PIAA 2F3TA 2FRXA 4MZXA 3ZXYA 4IH1A 6REQA 5HTOA 4NCAA 2BH2A 4IIJF 2JIOA 2ORIA 4AKHA 4BO2A 2V7BA 3IMEA 1PN3A 2HD4A 3Q87B 3SLRA 4BVFA 1N3YA 3DB2A 3WLLA 5CJ2A 2DEUA 4DCPA 3QE9Y 4IH4A 3GFRA 3O84A 4QTTB 2HNBA 3BXXA 4ZT5A 4BMXA 1ZNZA 3KKEA 4PC2A 4WT7A 1P9LA 4WZAB 1EE2A 3CKMA 3LZDA 3B2QA 2FK8A 3ZCQA 4O2BB 4K03A 1V1MB 4EF6A 2AD1A 5CXUA 3OQOA 5AJYA 4BEVA 3JYOA 5A0VA 1XQ1A 3HCAA 4A0RA 1XVLA 3HDTA 4ES6A 2BLNA 3FGZA 4WKGA 4G5OA 3QSYA 1NBOA 3KB8A 4M1QA 2CVOA 2FPMA 3DJFA 4KSYA 1F4PA 1W59A 1CY1A 1P75A 3G2QA 3AM3A 5AK3A 4NX2A 4X97A 3I64A 4L4RA 1P19A 3LSTA 3K70D 1LLCA 3EZFA 4R7TA 4MS3B 2V97A 3QV1A 3AFNA 4EEKA 2FWIA 3S28A 1FL9A 2JGAA 3T7AA 1AKTA 1D4AA 4Q05A 1G41A 2HGSA 3KUXA 4O8CA 1XMIA 4ZGWA 2DG2A 5DO9A 4QPDA 4LXQA 1Q1QA 4YJ2A 4I50A 3WIDA 2JVIA 1ZN9A 4IUDS 1JKXA 3QGMA 3EGIA 3L46A 2PLWA 3T1QA 3UUGA 1MQSA 2AJ8A 4B3HA 3CLSD 2W0MA 3IUEA 4BMZA 4EG3A 3MC1A 1RMYA 1YE3A 1XVIA 2X42A 5DK4A 1Z88A 2EHDA 3QKTA 4O08A 3KYIB 2JNWA 3R41A 3ABRB 3E9ZA 3F96A 4ZVVA 5JFGA 5CDUA 5D3KA 1RJ9A 1DP4A 2A9OA 3LCVB 1IHXA 1EG2A 5C4GB 4F4DA 1JJAA 4N0PA 3IRVA 3BM5A 3K70C 3ZD9A 3UK1A 1Y7PA 3CMCO 4GXTA 1CP3A 1SCBA 1X80A 1E63A 2AOUA 3E7PA 4N9WA 3RF6A 3PGLA 3WYAA 3J7AC 2HAEA 2UZ0A 2O2DA 4XB2A 4YALA 5CB6A 5AVKA 1NE7A 1OD6A 3LUKA 2WY2D 2DERA 4AMZA 1FE8A 1TC2A 1U5CA 2VHJA 3O8RA 3TD6A 5EZYA 3A2NA 3F7MA 4JL8A 3EGXA 1D8AA 3EFOA 1U0GA 2X4IA 4OH1A 4KUHA 3CLSC 3MJRA 1JLMA 1WVIA 3OOSA 4JYAB 2XCTB 1B15A 1SZCA 3NAZA 2EWVA 4QECA 2CYAA 1O9BA 3EIWA 4TYQA 4XX1A 3HCDA 1GZDA 5KTNA 4D02A 5DGHA 4Q15A 2B37A 1DARA 1SVOA 3CBQA 5DYYA 4DG8A 1AKRA 2Y9MB 1HRKA 3AHDA 4UAVA 4I66A 3SEAA 4L16A 3A9WA 4BWVA 2GEDA 4GH5A 3K1AA 1VJ5A 4BQOA 5BVHA 4QO7A 5BNWA 3C3KA 5TV2A 3ICCA 4ARBA 1CZRA 2HSEA 4Z5XA 3GLIB 1C4WA 2PXCA 3LFUA 4UNPA 5IUKC 2UXCB 1D0IA 2F62A 2PCJA 2YQ4A 3T0FA 3S5JA 4D9JA 1QR2A 3GBVA 1LPBB 4MYSA 1E1KA 4XQCA 4AWXA 4C4AA 3UV6A 3UJPA 2D2EA 4HLDA 1A76A 3PIDA 3BXGA 3KXPA 2Q4TA 4L9RA 3MELA 1GWNA 1QQ6A 2X4GA 3A37A 1U65A 4EJ6A 2PZLA 4KXVA 5EWMB 1KTIA 4RAQA 2C2ZA 2EZTA 4KPUA 3KYBA 3GRVA 4MVJP 3EGDB 1VDZA 4JXJA 1BMFD 1N2BA 4D74A 2AG8A 3H4VA 3D7KA 3ZQ6A 5LQJA 3DAFA 4Q7JB 2PD3A 1DIRA 4J0IA 2AWOA 5FUWA 2DCUA 4OREX 1CY7A 5DP2A 4MUKA 3W7VA 5BORA 4ZK6A 3ISTA 1PL7A 4ASUA 2GJSA 3AF2A 2L17A 4HDAA 4OUDB 4B6RA 2VDQB 3HJUA 2Q0SA 5JCOA 1Z7WA 4IILA 2FQYA 2A1TS 4D41A 1JZSA 4CQJA 1NJ8A 4ZVKA 1U8YA 4EX6A 3A4VA 2XITA 3OTWA 4FNOA 3T34A 1YR9A 2BGWA 1NNLA 4MVJM 3KT3A 3N1UA 4HKTA 3G68A 1GU0A 2R4TA 3GL9A 3TG8A 2V7GA 1CU1A 3MB5A 2A84A 2W6OA 4XGKA 5K3FA 5BYAA 1JDUA 5CAEB 1VKRA 3ANLA 4I1PA 3MUOA 4X5OA 3VU9B 4B7CA 4AZ0B 3ZDEA 1TTQB 1NAIA 1ADJA 3FTPA 3A6DA 3OQPA 4QXPA 5FUMA 1ODCA 2CVPA 2DT8A 1G16A 2OCBA 4IX9A 4ESHA 3SSOA 5JXHA 4LF4B 2PPLA 3A3YA 1HG1A 4H0CA 3Q98A 4UNQA 1K8ZB 5LQRA 2IW3A 1LSOA 4Y2TA 1YHZA 4CM5A 1KEEA 3H99A 3A1DA 1T3LA 2WWVD 5TVGA 2V0CA 2NXNA 3QQ5A 5FPPA 1II9A 1P2GA 2C5BA 4KUGA 4DC0A 3R0QA 1PNRA 2UZ3A 2ZI3A 5LXTF 3V42A 1UL1X 3V4SA 1WOMA 4MO2A 3AVWA 2QZJA 4A0GA 1K2VN 3DKKA 2BUAA 2O3UA 3L0YA 3O4VA 1OYOA 1Y1RA 3K4QA 2ZUTA 5COAA 4EF4A 4EVIA 2IV7A 1Q21A 3H19A 3LUPA 2BKXA 2BFBB 3RBZA 3TUIC 1QIHA 1XEFA 2IDMA 2K5UA 1JPNA 3KPJA 4C76A 4DLVA 1C1XA 5KVAA 3MT0A 1TJ5A 3H1AA 4AMBA 3AG6A 1Z0SA 1P7WA 3LHKA 4IVNA 4NULA 1DAIA 2OO3A 2EGUA 5E6RA 1M6VA 4IOLA 1NHWA 4I1UA 4L3VA 3DEZA 4WNCA 5JH7B 4WKOA 3H65A 1MX9A 3AP2A 4JUBA 4IP0A 3SBXA 2BTOA 5LU9A 1DEKA 5LYJB 1D09A 1XC7A 2J5QA 3N75A 4JEHA 4G8JA 4A6DA 2D6FA 4KQ6A 5AVSA 3G02A 3E23A 1TEXA 2WIBA 4YJFB 5IJAA 2Q7DA 3WKCA 3MHTA 1H2FA 1A7JA 1SXQA 2P62A 4BO0A 2E21A 4F3RA 1QYIA 5HS6A 4DMUB 4EUEA 2Y1XA 3D8RA 5EE3A 1BN6A 2QTFA 2IWHA 3PDWA 1I3NA 3PEFA 5C7YA 1GU7A 2EW1A 3IXQA 5JHGB 3MSCA 3ZK8A 4EGFA 2HRQA 1CUVA 3A0UA 3U3MA 3IJRA 4Q12A 1JJFA 1X7GA 2X4LA 2P2ZA 1LQ2A 5JJLA 2E5WA 1T9ZA 5HM6A 5K0TA 4EJFA 3KETA 1VA4A 2AJBA 1XCJA 3E2MA 2QRQA 4W82A 3AR8A 1VG9B 2PX5A 5JRJA 2JGMA 1PVDA 2VUHB 4LBYA 5CXQA 3WBBA 1KMNA 3ROGA 5KTPA 1AUPA 3GDFA 4WJLA 3BGIA 2F8TA 2ZAGA 3HMQA 4PXSA 1TB4A 1Z63A 1Z26A 3T0IA 3NMUF 3I34X 2FPWA 1R5NA 3LJKA 3DVRX 3MHPA 4FE4A 4HQNA 4DR5B 1CUDA 5GOTA 3BMXA 3LPNA 1U9JA 3B2NA 3E9NA 3LD9A 5K01A 4KB5A 4B46A 1SPXA 1BOFA 2ETXA 3MJVA 1ZQ1A 3FCUB 4KBGA 2GYVA 3EWNA 4MTCA 3V1LA 3GFSA 5EJ4A 4M1OA 4JI4B 5DTEA 2HDWA 2I22A 2WRZA 2O9JA 1ZX1A 3UMRA 5A4IS 3D4OA 2CBGA 5E1BA 5KMGB 2WAOA 2GEUA 2RHWA 2XDQA 1G9SA 4AI6A 2ZREA 4H3SA 1CZUA 5K51A 3VOTA 3TNYA 4OMDA 4P6VF 4R6WA 8GPBA 4BECA 5H81A 2O3QA 3OLQA 3G0OA 1HNNA 5T4HA 3RARA 1PW5A 2R1VB 1ZOOA 3FE2A 1H2AS 3VH4A 3BQMB 3L1IA 2PAAA 2DWCA 4W5HA 4I4CA 4BBPA 1I0IA 1WXEA 4BUZA 4BX3A 2WJZB 2WJGA 3DZFA 1RLJA 1AKVA 1YSCA 2QM7A 2R8BA 3N0WA 1JKJA 2I54A 3T3NA 1GSIA 5KSZA 2QTNA 3UFXB 1RVDA 2CD9A 2JEOA 1B1AA 2J6IA 3ASVA 2XR1A 4ZEXA 4Y9DA 1O6CA 1VJ1A 5EFZA 1JLHA 1GL7A 1Y48E 2R8EA 3II6X 4KDFA 3NP9A 2MOKA 2V58A 4PZLA 4RVOA 4QZVA 3RK4A 3Q9SA 2ACWA 1OFGA 5DM4A 1JXAA 1Q7TA 3I6ZA 4Q3LA 3SYKA 2Q2OA 1X14A 2Z30A 5DI9A 5C81A 1SWVA 4U2FA 1C1HA 2FYTA 3DBRB 4FN5A 1M2WA 4UZSA 4YJ3F 5JAIA 1OCEA 5E6UA 3K71B 1E9DA 1SO8A 1UZLA 5AI5A 5AKZA 2EG5A 3I61A 4R5MA 2IDKA 2KB0A 2XRYA 5G0WA 2JLSA 4RGQA 1NVAA 3PUZA 4L22A 3CLHA 2I8LA 1KP9A 1RZUA 3BXZA 3DCIA 4PC3A 1YVRA 5B1YA 1EAYA 2BZ0A 2G8NA 2H4HA 4DMGA 1VB3A 2VC2B 5AP9A 1YFJA 4PLCA 3DV2A 3EMBA 2VSQA 4JT8A 3INYA 4F5ZA 4PZUA 2W2VA 4GP6A 1PZFA 5DM1A 2HHAA 3ASYA 2AZDA 1C14A 1KAOA 5HKLA 3ED1A 1ZPDA 1NQAO 5EP1A 5JY6A 2I34A 3AESB 3AGQA 2PFGA 2J9FA 4K6HA 2GO1A 3NTRA 3M1LA 4AG5A 2I3GA 3E18A 4HDNB 5IK2D 3DDZX 4BQIA 3HBMA 2LW7A 5CHEA 3TLXA 1HMYA 4HD8A 4DV7B 2HA0A 3VO1A 3EXG1 1X0XA 4U5QA 5HIAA 4NABA 3RNLA 2WJPA 2OXRA 3E7FA 4A0HA 5A04A 4XI9A 1MEJA 3P0HA 1G8SA 1AS2A 1V9CA 4MHSA 1RADA 4K86A 5DRTA 4HFJA 1UPUA 4JLNA 4ZQGA 2MJLA 3GEMA 4ZRMA 3SYTA 3U4DA 2EBFX 4U0KA 3AQ4A 5GTDA 4U7PB 1N6IA 2OCIA 1Y1QA 1YQDA 2W8ZA 3IHTA 3OG9A 1NVDA 4QLOA 3KEMA 4RO0A 2GK6A 2XYVA 2XTAA 4MVJD 3GCZA 1UXJA 4P82A 4MCAA 3KHKA 2QUBA 3ENKA 3O1HB 5LN1A 5LP6F 3GR6A 1TFUA 2NACA 3MAAC 1KARA 3FUCA 1PWZA 3FI0A 4ZVTA 3FKSA 1RKXA 4QT0A 4IICA 1RI5A 5EXEA 5F5NA 3CR7A 2H7VA 5JXJA 2EARA 4YDRA 1V5IA 4QREA 3U60B 1Y6GA 5TF4A 4LF8B 5JCJA 2QVCA 1PQ4A 3IIEA 3ZNNA 2Y67A 3CV3A 2OHXA 3DGFC 4RELA 4JR1A 4HXGA 4EI7A 4LXIA 5TQ0B 4C2BA 1E9EA 4FJ2A 5LQSA 4UTRA 5K0CA 3Q0EA 5KQSA 3D2BA 1PLJA 2RJ3A 1P1RA 2CFRA 2BE7A 2HUNA 4KW7A 4OQZA 3W1VA 3ZTYA 3PNKA 3VNUA 1A95A 5DYNA 3OPYA 1ULAA 2I7TA 1X92A 1XA3A 1Q95A 3TQFA 3U4QA 5GWXA 4DKJA 1XD2B 1SNYA 3HDYA 4LKRA 2GBPA 2N46A 3TXXA 1ZM2A 5IK2A 3PNPA 4DJDC 1RQXA 4I5DA 2HXYA 1VL6A 2VP6A 1MX1A 3PICA 1RAAA 2H4ZA 4ND8A 5IW8A 1NN1A 2B36A 3UV7A 1BJKA 1I7DA 4ABTA 1ENPA 3NBAA 4PVDA 1GYQA 2X7XA 3LVRE 1EK1A 3SDZA 2FMIA 3ROTA 4JVNA 3T5AA 4O2AA 3D7LA 5ITVA 3HRHA 2G17A 2AOTA 1H4QA 1K68A 2Y1OA 3KS9A 3OU6A 3DP9A 5AUNB 1P2BA 5ALTA 3GAFA 2KM1A 4DG9A 2R6AA 2Z2XA 5LZ5A 1Q2UA 2WIFA 2WYUA 1K98A 3E58A 2VAWA 4QO8A 3F2VA 5JVDF 1U31A 1PIWA 1BRMA 2C4HA 1SBIA 2BUBA 4RJIA 3A70A 2Q5LA 4H1TA 5KJEA 1AQUA 1YS9A 4G2TA 1MIOA 3GQBB 3OQIB 2IF2A 1QZUA 1LTQA 1DAEA 3D8HA 4DDKA 2Q0QA 2PT5A 3EF1A 2JD1A 3PDHA 4YX9A 3KEFA 3V1NA 5LU8A 1NVFA 2AMFA 2FK7A 1MOSA 2Z1NA 3AO0B 4B9EA 4YV2A 4HNUA 1U7TA 3KJXA 1LDBA 1Z56C 5ERYA 3H1PA 4Y6SA 2X2PA 4MIEA 1T15A 1FDIA 3JALA 1T5BA 1WCXA 2ZU6A 3D4PA 4UHEA 3UWDA 4YUYA 1ZD8A 4C7BA 4W5RA 2Y71A 2GXSA 2R8ZA 2VLIA 1KJWA 2ATCA 2Z0MA 1UDXA 2XI4A 1IZ8A 4DIMA 4F4FA 1W6RA 1XRSB 1SXGA 1D4OA 4QYTA 2FSPA 5ARDA 2AXQA 4YCMA 3GLFA 3K9QO 1OF1A 1UWCA 2ANCA 3B8HA 4CUJA 3N39C 2BGNA 1W88B 1Y81A 1U0RA 3TE7A 4B4DA 1MRNA 1Q19A 4DZTA 4NHEA 2HCJB 3UBTA 1TYCA 1TZ2A 2IZOA 1U9YA 3GGOA 2A92A 3LX8A 4HGOA 3OPYI 4FONA 1VZ2A 3I9NA 3TAXA 3DHEA 4E2FA 2JFWA 2A88A 2RGYA 4G56A 3OKAA 1ZWLA 5IHXA 3C4QA 3RT9A 4G26A 1ECPA 1UR5A 4ZQIA 3I09A 3GY0A 3G8DA 1ZO8A 1C3JA 1LJ8A 2H1RA 2VPQA 5AW2A 2C77A 4L5IA 3NEAA 4EHDA 5JW6A 3ZV4A 1AKNA 1ZJ5A 2XDAA 3D6VA 4LI3X 4RFSB 5EJGA 4HR7A 1OAOC 2FEMA 3Q3VA 3PFNA 3H2JA 1KIMA 3TSCA 2RHRA 1B73A 5IH3A 1Z33A 4CN8A 3QVOA 3GYGA 3T5MA 4W6ZA 1Y3IA 3QVVA 4KGXA 3KSAC 1LDNA 2VP3A 2HPAA 1L1RA 2RI0A 2YVAA 1FTGA 1GPUA 2J59A 5CVEA 2WTBA 3VI3B 5KINB 2C5EA 2C78A 5B1DA 3PFKA 5L3RA 2FDCA 4HAZA 4L5AA 4YCBA 3GLRA 3KUDA 4U6SA 3VGPA 4B9AA 2VNKA 2GKSA 1IHYA 2H7YA 5DHQA 4UEJA 3ESQA 4MW0A 3IYLW 1EVZA 4GX1A 1NMEA 5EIOA 1J42A 2PYZA 1KOGA 4N3CA 2FPXA 1DAPA 4YRBA 2JI4A 1DB3A 1AMOA 3VYSB 1CS0A 4JLKA 2A3RA 3TOCA 3N0XA 2FPKA 4GEGA 4AMUA 2E82A 2TYSB 2Y66A 3KTFA 3DZ8A 3VHXA 4LC9A 1XD9A 3KLOA 3EVBA 3EVEA 3GMDA 3D02A 1HE2A 4RD2A 5TNXA 2Q6LA 3PQ6A 4M1MA 4RS3A 2C29D 3Q3HA 3I2YX 4F2DA 3U7HB 2XGOA 3P0EA 2MSEB 4KXXA 4Y2HA 1ZMXA 2JZOA 4IHJB 4NWIA 3V1UA 1QP4A 2V6GA 3KBOA 4FMCB 4KQEA 5HSGA 5I7WA 2OEPA 1HE3A 2ZRAA 3PJFA 5I9TA 3RR2A 1P44A 4EPYA 1O89A 2YASA 4B71A 1K6JA 1RKUA 4WNYA 2O2HA 2WABA 2XKBA 3PXCX 4FGJA 2ZVQX 1M5RA 5H82A 1UK7A 3ND6A 4R3NA 3V3TA 1NR1A 3D6FA 5JG7A 1ZIXA 5E2AA 3TMKA 4GI3A 4E5MA 1IJBA 4Q93A 2Y99A 3DKIA 1RWXA 3O1JC 1YQEA 4PF1A 1FXSA 4HS9A 2QIOA 3BHIA 1N8KA 1AB6A 4QX6A 1SG9A 2IUUA 1H8ED 1WPQA 1I1HA 4HWGA 1NN0A 4AUMA 3PKZA 1C3OB 3AP1A 1E64A 4N18A 2IFTA 2JHPA 3IQWA 3KR9A 3I04A 2EFGA 3DMTC 4MYHA 2VH5R 1XN4A 1YK1A 2CHQA 3CZPA 4WADA 1DX4A 4E5YA 4IZHA 1H0HA 4EHAA 1T6ZA 2EX0A 2QXTA 3BSWA 5I51A 4J94A 3GDGA 4EO9A 1NF8A 4K9PA 3SIRA 2YJ3A 1XTVA 4RA6A 5A0TA 4UMEA 1W4AA 4URUR 5HZMA 1ZU4A 1A9OA 3OQJA 4W6QA 2WF8A 2G07A 2QTVA 9ATCA 1ZVQA 3HA5A 4CKWA 3LC2O 1P77A 1V4VA 1YJBA 2AT1A