4ARVA

Yersinia kristensenii phytase apo form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
409
structure length
409
Chain Sequence
GYTLERVVILSRHGVRSPTKQTQLMNDVTPDKWPQWPVKAGYLTPRGAGLVTLMGGFYGDYFRSYGLLPAGCPADESIYVQADVDQRTRLTGQAFLDGIAPDCGLKVHYQADLKKIDPLFHTVEAGVCKLDPEKTHQAVEKRLGGPLNELSQRYAKPFALMGEVLNFSASPYCNSLQQKGKACDFATFAANEIEVNKEGTKVSLSGPLALSSTLGEIFLLQNSQAMPDVAWNRLSGEENWISLLSLHNAQFDLMAKTPYIARHKGTPLLQQIDTALVLQRDAQGQTLPLSPQTKLLFLGGHDTNIANIAGMLGANWQLPQQPDNTPPGGGLVFELWQNPDNHQRYVAVKMFYQTMEQLRNADKLDLKNNPARIVPIAIEGCENEGDNKLCQLETFQKKVAQVIEPSCHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Degradation of Phytate by the 6-Phytase from Hafnia Alvei: A Combined Structural and Solution Study.
pubmed doi rcsb
source organism Yersinia kristensenii
molecule tags Hydrolase
molecule keywords PHYTASE
total genus 143
structure length 409
sequence length 409
chains with identical sequence B
ec nomenclature ec 3.1.3.26: 4-phytase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4arvA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4arvA02
3FDZA 2WNIA 2P2ZA 4PGMA 5HR5A 1H2FA 4EMBA 3IT2A 1DKLA 4ARSA 3D6AA 3R7AA 1BQ4A 3EZNA 5PGMA 2P9YA 2QNIA 4PZAA 3DCYA 4D4JA 1IHPA 1YFKA 2EKBA 1RPAA 3HJGA 4FDUA 4IJ6A 4EO9A 4GPIB 1YJXA 1C81A 3GW8A 2EKZA 3EOZA 4MA4A 1UJBA 2A9JA 2P78A 3BIFA 1FBTA 2P30A 2AXNA 2P75A 1V7QA 2EOAA 2HIAA 4D4KA 3MXOA 3D8HA 4IJ5A 3K4QA 4PZ9A 4GPZA 2WNHA 3OI7A 3E9CA 4ARVA 3K4PA 3FDZB 2P6OA 2P79A 3D4IA 3NFYA 4FDTA 4D4MA 5AJZA 3IT1A 1BQ3A 1DKNA 2IKQA 2H0QA 1K6MA 1QHFA 3QPWA 2YN0A 3FJYA 3QPVA 2H4ZA 2P9FA 2H52A 2HHJA 1EBBA 1QFXA 1CVIA 4QIHA 1DKOA 4TSRA 5HTKA 5CDHA 2H4XA 3GP5A 1DKPA 3F3KA 1SKAA 1ND6A 2ENWA 3LNTA 1E59A 1SK8A 1RPTA 3IT3A 4AROA 1FZTA 2YN2A 3O0TA 3C7TA 1UJCA 1H2EA 4E3WA 3LG2A 4JOCA 4JODA 1V37A 1BIFA 2HPAA 1C80A 1RIIA 3LL4A 3QPUA 5AJYA 2F90A 5AK0A 4HBZA 4ODIA 3ZHCA 2RFLA 3NTLA 3DB1A 3MBKA 1XQ9A 2P9ZA 2OWEA 2P2YA 2DWPA 5AJVB 2OWDA 2A6PA 1NT4A 3KKKA 1C7ZA 5CU7A 4ARUA 2I1VB 1DKQA 4JOBA 1SK9A 1TIPA 1ND5A 5AJWA 1T8PA 2P77A 2WU0A 2DWOA 5CX4A 3E9EA 2PA0A 1E58A 5AJXA 1SKBA 3PGMA 2ENUA 3F2IA 2BIFA 3E9DA 4D4LA 2P6MA 3GP3A 1QWOA 2GFIA 1DKMA 3IT0A
chains in the Genus database with same CATH superfamily
1CF9A 2WP0A 1FJXA 3PX7A 3QU2A 1OWMA 1B41A 2WBLC 1Z4JA 3P52A 1G8KA 3DWFA 2CLDX 1FJHA 4M55A 3EZNA 2W8BA 3L7MA 4KXXA 3ZH9B 3G59A 2FJUA 2EYQA 3KQWA 2QZZA 4PSKA 2XOEA 3TCKA 4U2CA 2BGMA 3U3ZA 4P3KA 1U4NA 4IJ6A 1W19A 3H83A 1PL7A 2MMCA 5J1TB 3V1TC 5ENZA 2YX1A 2L69A 2FZGA 2PYZA 3ESQA 3HO6A 1S8OA 3M6XA 5JD5A 2D2EA 2VDUE 4DDUA 1YRWA 5JS6A 1MG0A 3NLLA 4GWLA 4RY2A 3ER8A 3OO0A 1KR5A 2RH9B 2VQ3A 3Q7IA 5JH7A 4UXJA 5HKBA 2QR2A 2ZULA 3OEED 3U80A 4HS9A 5A4FS 4D57A 4Q4DA 1FTSA 3CCCA 3OOHA 4R6XA 5JMOA 2PX0A 3CVVA 3MCTA 4JLBA 3R7BA 5CT9A 3Q5GA 2IIVA 5LDHA 3AR5A 3PIRA 3W2EA 5C8XA 1M6EX 4ZDJA 5K4GA 1K7FB 1P1HA 4KR0A 1ONOA 1JP7A 1X8JA 1XDZA 3NHYA 1RZ3A 1XC7A 1YBMA 2GAFA 2R1UA 3PWTA 2ZQ5A 3PYMA 4MVJG 4B81A 1DIBA 3V4PB 3AESB 4X7RA 5SYMA 4ZDIA 2BM8A 4KAJA 2V55B 4E3ZA 4RU1A 4WXEA 3DMYA 3LW8A 4KO8A 4N54A 3VR6D 4EK9A 3RK4A 1U2TA 2KHZA 5LIRA 1U80A 1Z7GA 4MWSA 4H18A 3CPJB 3OEEA 5DM60 3LC2O 1Y1TA 1GPAA 3IVXA 3R1IA 2B1RA 4AW9A 2SCUA 4BO8A 2XF8A 2YQ4A 2YV4A 1ZZEA 3F3KA 2FX3A 1WHTA 1COWD 3DMDA 3GAMA 4B84A 4QECA 2HIHA 1X1RA 4IX1A 1NQ5A 4EW6A 1G6OA 4FNOA 4Q9NA 4C6SA 4F46A 4OLAA 2HK6A 3WDKA 2VRCA 1KI4A 5DYWA 4BUZA 3H2BA 2XWSA 3HPQA 4PVCA 4OH1A 2B4QA 2F43B 3N74A 3ABRB 3BJEA 4BV2A 1Z6PA 2ZIWB 3AEZA 1RIIA 1KDTA 5EE3A 4AI6A 4JLNA 1X7DA 3S68A 4ODIA 1HTTA 1MPXA 3YASA 4KKVA 1RPNA 1A8UA 3DL4A 3OIVA 4YCCA 2C7QA 2G04A 1W0CA 5AXCA 2GF9A 3KJFA 3WXBA 1F8FA 4AM8A 4J2TA 4ARCA 4L51A 3TS1A 4TLLB 4GMGA 2H4HA 5KNBA 4OYLA 2X14A 1ZH0A 3NYQA 3KKKA 1TYAE 4Q4HA 5I48A 4OKIA 4R1MA 1ZNZA 2O1SA 1MCZA 4NNPA 1YZKA 4I2NA 1C3VA 2GF0A 2Q3HA 4I19A 1NNUA 3FKSD 3NT2A 3VV2A 2HSEA 1SUEA 1ACJA 4BCDA 4OBWA 1HKHA 2R1VB 1CR1A 5EC8A 4D42A 4EO7A 5E7IA 3KVOA 3RT7A 1Z0IA 4L27A 4QRHA 3OZIA 3UAWA 4B5KA 1NZDA 2NQ2C 3KLNA 1QYWA 4RJLA 2PH1A 5BP7A 3WBBA 5T7BA 4F2HA 2X1VA 2PMKA 4C5CA 1BJTA 1C4WA 4IHJF 2GNPA 1EHIA 2I34A 3BDVA 3T94A 5HRUA 1OSNA 3TLYA 1L7BA 1GZDA 1NHWA 1SR8A 4WDQA 2WJAA 3PR1A 1R4NB 1XYGA 2AJCA 1AK1A 2VAVA 3QVWA 4UOZA 3PGLA 4OGGA 3PDIB 1MW9X 1YQGA 5KTNA 1Y1KE 1RDFA 2GILA 2IC5A 5AK3A 5T6BA 3JZAA 4OHMA 4LRSB 5AI6A 1ZUD1 1SC9A 2IDJA 2COUA 5FBLB 3BRCA 5F7OA 2E37A 1MO2A 3D6VA 3DZCA 1WCIB 4HI0E 4MI9A 5ECWA 4EMSA 2BOVA 4BMDA 3MJCA 1FDOA 4C08A 4MRSA 1XK6A 2AXNA 2VJQA 2ZI5A 3E2IA 3P9NA 5E6RA 3ZWNA 3B8EA 2J33A 1GIAA 2CNLA 2NTYC 3WWEA 3RBXA 1CY7A 5H70A 1G8FA 4PZ9A 3V2HA 4COKA 3D43A 1YFJA 4EYQA 5IMSA 4AQYB 1Q5PA 3CMCO 5CT6A 5CA0A 4J07A 4NE7A 4ZCRA 3IAAA 2CNKA 3O26A 4OB7A 3GBSA 1JHQA 1KSFX 2OSBA 3PGKA 1CX9B 4HH0A 4URWR 1ZD8A 3DMTA 2BRUC 4FWBA 1QC5B 2QX6A 4XR9A 4YJ2B 5FV7A 3RTGA 4ZGBA 5CIQA 3TKLA 3W8NA 3KJNA 5TRTA 5J58A 4A9AA 1J5XA 3EBPA 2PLFA 4LGMA 3H1AA 1O57A 3WRWA 3IQFA 4BLTA 2IRWA 2AV6A 4N5NA 4B6GA 1JG6A 3G9UA 3KOMA 4TTPA 3NBFA 4R83A 1Y9AA 2C3MA 4BNZA 4D82A 3RJMA 5JJKA 1UKEA 9LDTA 2VI5A 2AQIA 5BV8A 2YFKA 1XTUA 3NKFA 4EB6B 2XT9A 3IT3A 2P69A 2XMCA 4G5RA 1X39A 4RKYA 4Q21A 1Y6GA 3NDIA 5D5PA 3NAZA 5TDHA 2X4GA 4HDKA 1DUSA 1MAVA 2V7UA 4YDHB 4EUNA 5C37A 2ONZA 1TM5E 1KFCB 1RXEA 2FP4A 4G1FA 5EP2A 3VOTA 2CF6A 4EG0A 1A4UA 2GBLC 1T0BA 3L6BA 1HYEA 4MRRA 1C30A 2H2HA 2HZBA 2P40A 2QPTA 4CNQA 4OKNA 2W6NA 2IP2A 2FV8A 3N76A 1JNXX 3A2MA 5DP1A 5B55A 3H0CA 1EG7A 3RUPA 3WNVA 4EB6A 2GBPA 3DXZA 4UNRA 1C7ZA 2GM4A 1DKQA 4LRYA 1DEKA 1MX5A 4NBRA 4RK1A 4JYAB 2KE5A 3C6YA 1E99A 3EXFB 4TMVA 2C84A 4P84A 1G1MA 1YL5A 4XX0A 4ZEVA 3HYTA 2A5LA 2CXSA 1IPEA 3EC7A 4HDKB 5IZCC 4YMIA 3DTNA 3LDFA 2CJWA 4XFJA 3GVIA 2RD2A 1OILA 4R2HA 1B6TA 3DL7A 4B4VA 8ATCA 5JPIA 4KOEC 3ZVKA 1YFLA 5BWLA 3TQIA 5AVWA 2PA0A 1GAXA 3BT7A 1IIBA 3GQBB 3UB4A 2YMMA 2R97A 3VPHA 4PICA 4IHKA 4E51A 3A1FA 3WLLA 1RAIA 2JKYA 1V8DA 4HNSA 1C8KA 4L7QA 5JSYA 2GRJA 2NXCA 5HJ2A 4CG3A 2Y0BA 4G0NA 3GLFB 2F3TA 1WY5A 1ULAA 4YO7A 2ZK7A 4P53A 4C2BA 3EOBI 2VK1A 3R6GA 4MGZR 2ID9A 5KUTA 2P9YA 4TYPA 2H1FA 1QJ4A 2VLBA 3KV3O 1W7AA 2PJRA 4MQMA 3OTQA 1BFUA 1Y81A 2EG9A 2D0OB 3QE4A 5ECYA 3L7BA 5B3KA 3TKAA 3SCZA 4LBWA 3MIIA 1X2EA 1ECLA 3BDIA 2GNOA 4XUCA 3WAKA 1CXZA 2YTZA 3VZSA 3CEMA 3ZI4A 3QTLA 4EHIA 2XE8A 1EUCA 2O8EA 2W83A 2BEVB 2OBXA 1VB5A 2Y1XA 2GCNA 1NVDA 4J94A 5AVJA 3HU1A 4GM0A 2CLMB 3G7NA 1U6JA 5MN6A 3KXDA 2G1PA 3GLTA 1UXJA 2P65A 3TLEA 4JFRA 1AS0A 3CXUA 2FK7A 5E3JA 1TVKB 4B73A 3O31A 3QUAA 3E3LA 4PR3A 3CX3A 3H9CA 3BXZA 5KAPA 1M5TA 3L40A 2IYRA 1JHRA 2YYSA 3QIVA 2XUFA 2GTPA 2ON6A 3CZPA 3OZRA 3A9CA 3W5SA 4BX2A 4JJKA 1K2VN 1P19A 1Z74A 3JTEA 1J8QA 4WEQA 1YVRA 4PX3A 3CPHA 3T12A 4PZUA 4QBKA 3ZDQA 4RKEA 2JAQA 2JZCA 2WYOA 2IWHA 1N2CB 1O0CA 3KYBA 1UC9A 2PUCA 5A6VA 2YIMA 1YD7A 3K15A 2CDRA 3IVAA 4HSEA 4NBUA 4GPTA 4PS1A 1JJIA 4PYMA 2OCDA 3HN2A 3KJHA 4GKAA 4S0XA 3UZUA 4A8JB 2A88A 1WBBA 2BMWA 1FNBA 4B1FA 2PNJA 4GH5A 5K8JB 1HA3A 5EKUA 2ECFA 2TECE 4GGMX 4HNRA 3SAJA 2AN9A 2FPPA 2Y2UA 1PL8A 3ET5A 2H9IA 2QRZA 4ZO8A 3G5MA 1T5LA 1IN5A 4YV7A 5DNVA 3A1UA 2NP7A 1IEVA 4Q4AB 1MTZA 3OQIA 2FN3A 4ZARA 1MAUA 5EY5B 1VL6A 3DTVB 5H8WA 5A2QA 2BDUA 3LYAA 2ZJOA 3AM4A 2GJAA 1V3QE 3WOHA 5IFKA 2UUBB 2HYIC 1AHNA 1G6HA 2ZE6A 4MV3A 2XYVA 3T15A 5JYDA 2QRJA 3FVRA 1EIZA 1SU8A 3GWGA 3MBKA 1YKFA 4E5NA 2FZLA 3EQ2A 2VH2A 4B3RB 2QSUA 1SRQA 4N6OA 2B8WA 1XSEA 2QX4A 3I92A 5J4HA 3IHLA 1YJ8A 4YLYA 4R01A 3S29A 1FK8A 2LP4Y 2HN9A 3THOA 1KI7A 4BKUA 2WTEA 4F4JA 4FSHA 2M6KA 4KG7A 4EVSA 3TE7A 1L4NA 2W42A 1VCMA 5EMKA 3PIIA 1WCIA 3V1NA 3GLIE 4P6VF 1QTNA 2QK4A 5T41A 1TAUA 1KZGB 2J32A 1FP7A 1IZ0A 3IUSA 4RPHA 3NALA 3BCHA 3WWZA 5FX2A 2P27A 3HVUA 3GHHA 4KWEA 1B00A 1GUDA 1KK2A 1V96A 2VYVD 3D6AA 5E9AA 3U56A 3VNUA 2DBVO 4TWJA 3TNJA 2XT6A 1H8EA 3F6SA 3G0IA 2IHUA 2GN2A 1J8FA 2CLIB 4MGEA 4ND6A 3FX2A 2C31A 1C0IA 1XVAA 1DUIA 2JI9A 3L6CA 2WJPA 4ZA2A 3EQ7A 3TQHA 4AUKA 1DINA 1UAYA 3QKIA 3UV7A 1V0JA 3EDMA 1CRLA 3HKBB 3FVVA 4A2CA 3QU7A 4M8LA 4RDCA 2WWXA 2VHEA 4FDUA 3IBGA 4YRNA 2ZYSA 1YB1A 3A70A 4KUHA 2G5TA 5CLGA 3INNA 5AKKA 2AG6A 1T6YA 4WHMA 1V41E 3OTWA 3ADBA 4YUVA 3O91A 4L76A 2O7RA 3QU5A 3Q3IA 3K9BA 5JD6A 5KHLB 1XR3A 1OYWA 4I50A 4YREA 4FYJA 4FR5A 1EZZA 3QSGA 1EJ6A 1W96A 2O05A 1T3GA 1CEXA 3FTPA 4N3CA 2RAFA 3TDNA 5CFMA 1BEEA 3HYCA 2DETA 2A3NA 2OOKA 1W36C 2EX0A 2OHXA 4CLOB 3W79A 4D97A 3W7BA 3ZR4B 2BVNA 4KIWA 3BE4A 2X2EA 1HEYA 1CUDA 3HC7A 3TFWA 4D5GA 5HIIA 4LW8A 4UFPA 4LJ6A 3IP8A 1ILWA 1B6GA 2PKQO 3M6UA 3SEFA 4D0GA 2DLDA 3NQ41 5GZ6A 3FR8A 3NOQA 4MQLA 4FR2A 3RIGA 2XB6A 2VDWA 1UJ5A 2BN4A 5FBVB 3B6IA 4B3JA 4PYJA 5I7EA 1LTQA 4V0OA 4WLOA 1EDBA 1NXPA 5FUYA 3H18A 3UKOA 1K0FA 1MOZA 2GUWA 3LF2A 4TSFD 1TQ4A 1Z4NA 1R9JA 3EVTA 2BZ0A 2JAHA 3B2EA 3FWZA 1YS6A 3TZBA 5HFAA 2PUWA 1M6YA 2QV0A 1ZHFA 4I0WB 1XOIA 4Q66C 4EJSB 3D2CA 5TMEA 5BVHA 5GIPE 3KFXA 1FP6A 5FI3A 5JZ9A 1SVSA 1DIHA 2VK4A 4IIJB 4R2XA 2WZBA 4DQXA 5DNUA 5F33A 1NN0A 2AL7A 1XZ8A 2MDTA 2PEZA 2VDWB 4G01B 2EFHB 1KVSA 5I9MA 2AJ8A 2E1PA 3ZWQA 5KQLA 5IJ0A 1CPYA 1QVZA 1SXJC 2GZSA 2JA1A 2JIDA 4Q39A 2PH5A 5LA6F 4QUEA 1KJQA 3R23A 4J16C 2QD2A 4ND4A 4WJZA 4Z0TA 4ZVVA 4OUDB 1BDJA 1HRDA 2FXVA 3N70A 3V1KA 5G0WA 2B8JA 1EIWA 1YQXA 3MCAA 4PEVA 2ZVPX 1PR1A 4UVGA 4AXBA 4AG5A 1Z2CA 1IAVA 2Q0XA 2RH8A 2I87A 4Z4GA 2QQ0A 3T5CA 2ZRCA 3GJ5A 3BA1A 1MG5A 1ENYA 3LFUA 3ZNPA 1B8UA 2X9VA 3A7DA 1T5OA 1SVOA 2ADFA 1BOOA 4LBYA 2Z2IA 4Y2YA 5FF9A 4D9FA 2OQRA 3CPSA 2AD5A 2QRKA 3F0TA 5A9TA 1X7ZA 1FFGA 4NFLA 3EWAA 3QJGA 2VT3A 1CQJB 3SQWA 1T4BA 2XUQA 3CZQA 2XY4A 4R8KA 5TPWA 3F2IA 2O8FB 4I9GA 4CN9A 1L8AA 4DFDA 2ECOA 3OOYA 2Y8EA 2ZYVX 3KSMA 3GJ8A 4DANA 2G80A 1EJ2A 2SKCA 3DNMA 4PAQA 4DT1B 2XSZD 3DEFA 1P29A 4G0WA 1U3UA 3VAZA 3QIAA 2PCLA 3R4CA 3JWHA 3AP1A 3C5HA 4F85A 3OICA 1FDIA 2HJ9A 4BEBA 4WMLA 4DA4A 2I80A 4TLDA 1H23A 5IEBA 3HXPA 4IILA 3SHTA 5LQUA 4GKKB 2IS2A 2ZSKA 3OJLA 1T5BA 1JFFA 4OLHA 3ACBA 5BNIA 2Q07A 3AONB 1T8WA 1XLUA 3EZ2A 3CGWA 3LX5A 3W5CA 4UCQA 2ZS7A 4HXFB 5MFPA 2GN9A 1C81A 1W85A 3DB2A 3GJ4A 3ROXA 1YA4A 3ENNA 3A2KA 2YDXA 1NX6A 4LYJA 5IT4A 5JQWA 3P96A 1JJ7A 3BIFA 4LPSA 5EXDA 5LB4A 1NJ8A 2FLKA 4II7A 5KTSA 2G71A 3AR9A 3N58A 5ESRA 2IXFA 3Q3VA 1Q0RA 1POXA 1WF3A 4LOHA 2W6QA 3U7HB 1CRPA 4EGJA 2YHBA 3UYLA 1YZGA 3WLIA 1QONA 2J0VA 3IKVA 1C7JA 3F5DA 2D0IA 1R3DA 1RBZA 4IDPA 2VYNA 5K51A 5FQOA 1OXUA 4Q1FA 3G8AA 1P2VA 4M9SA 3EUEA 4YBZA 4YRTA 1ZDMA 2ZRDA 3K1JA 5B1SA 3TSOA 1SQGA 5K8TA 4HY3A 5C35A 4K9DA 3KKPA 4OQNA 2P6RA 4Z54A 1E2BA 1KI8A 4O2RA 1NW7A 4LXIA 1MABA 4C7KA 3G2IA 4FSXA 3ZYZA 3NHUA 4RVCA 4TZ6A 4DRXB 3KOWA 2PV0A 1WW3A 2J5XA 5TPWB 4W1QA 3R3WA 5JHHB 4J0JA 5M29A 2GRUA 3M82A 5LZ5A 3VR5D 4PANA 2AUNA 1DKRA 1YWGO 2R85A 3AEXA 4LVCA 2AFHA 3WYDA 4CGYA 4DCMA 4K05A 5H0IA 3PC2A 3ULKA 4E2WA 3IIEA 1ZW6A 3S7TA 2FPWA 3KLMX 3E9NA 4URXR 5YASA 3CA8A 5C46F 3IV7A 1JSCA 2A2ZA 2GSDA 3C97A 1PTKA 1U7XA 3PNQA 5EMJA 4AP9A 1QG2A 5CTAA 4BX8A 5B1EA 5EPEA 3M6VA 1BXRB 3MJSA 2NT3A 2O2XA 3HKCA 5GVRA 5KKAA 4FHCA 1GZ4A 2PFGA 3JU3A 4CWAA 2RHWA 2ZT6A 4UAGA 2G9RA 3W5AA 1G6KA 3DBLA 3MZ0A 3NTLA 4P86A 3P0HA 2ZTHA 3L4BC 3I2HA 4TRRA 3RVDA 3SSNA 4CQMA 2XXAB 3OZBA 5KOHB 1M73E 3MCVA 5KSYA 1NP6A 3C6XA 1IB6A 2WIFA 3NXKA 4A0RA 1BMFA 2O7QA 2OWDA 4GLJA 4DUPA 2VJBA 3A1VA 2F3PA 1IEQA 3WK8A 4ESEA 5DGXA 3DGEC 4YJ3B 1A27A 1YI8A 3LMKA 3QUQA 3RF6A 4BNVA 1O6BA 3H1PA 3TLCA 3H1BA 1T15A 3KZOA 3L79A 3WFIA 5BXQC 4YRGA 4ZV9A 1OX6A 1Z2DA 3NJRA 5MN4A 2BAGA 1K7SN 2FQQA 2O2JA 3PGMA 4JQSA 4QGFA 4B34A 4TQGA 2IZ7A 1UDWA 1XEAA 2ZI7A 1EFRD 4JP8A 4F60A 1U3CA 4H6PA 1P4JA 3G7UA 1PK9A 1HDIA 2AR7A 3N05A 5E2BA 3PSHA 5IU6A 1RADA 3Q8WA 2QYHA 4ZTBA 2PRIA 3JV7A 1IVSA 3ADDA 4FHGA 3HWSA 5LQSA 2HV8A 2XEXA 5F73A 1IZ9A 4QM6A 5IXYA 4E03A 3PDHA 3PEFA 2KBFA 1M8JA 3WLNA 4BATA 3C8UA 5IYZB 1AXRA 2O2HA 2P90A 5CW2A 5EHXA 1IY2A 4BMXA 1R0ZA 5JANA 2ZPTX 1H1LB 1WKCA 4R51A 3IMFA 4RESA 5C31A 1T2UA 4C0XA 1I1QB 4AFNA 3KHUA 4Y9RA 1UMCA 3K0KA 4UTOA 1SIOA 5CVDA 5DMHA 5F2OA 3EEOA 2IU3A 3RUIA 1UXIA 2ODPA 2WAXA 4Q18A 1JHXA 5TQ0A 4DR1B 3EMBA 3EMKA 3C6BA 1GNQA 3EPRA 2W6JD 1ZK3A 1E7QA 4PLGA 1Z8DA 2YY6A 2F2TA 1K08A 1NR5A 4YJHA 2NSYA 1IQRA 1YE8A 2C54A 1X14A 4Z4QA 4DV2B 4V2UA 5CIYA 2IBTA 2IGTA 2G7MC 3TN7A 1X7XB 2FYTA 2NV2B 4WX2B 3UFBA 2FPGA 3NETA 3GJQA 5DASA 5LJIA 1EX9A 2PKQP 3M4YA 3I53A 3OE4A 4TYMA 3VOSA 3N7UA 2Y1WA 1PD1A 3P4UA 2AXEA 3C41J 3BMNB 1BXZA 3FPBA 2VQDA 4LDJA 5ITVA 1W46A 4GC9A 4NZYA 3T7TA 2YV3A 1DO2A 1PS9A 1QFZA 3BRWD 3MWDA 5ADVA 3BK2A 4HGNA 5LLTA 1MU0A 3PA8A 1E6UA 1CEYA 1T9KA 3D4BA 3LYLA 5KYXA 2AZXA 3PLNA 3EULA 2IZZA 4LG1A 4PZ0A 1L4HA 1R0KA 4LQCA 4Q9DA 2OOSA 3ITDA 4OB6A 5T4FA 1PWEA 1U1CA 5T8KA 3T5MA 3ZDFA 4HNHA 4QXQA 4DBLE 5KNBD 1OHHA 2QL7A 4WINA 1TU0A 3TJRA 1CUAA 1X92A 4XE5A 3ROQA 4R2IA 3TH5A 4G5OA 2HM7A 3NHFA 1TW3A 2E4ZA 2VT7A 3DXXA 3KPYA 3ROGA 1UEXC 1Z22A 3LK6A 2NUTB 3KUDA 4NARA 4CKBB 2B2CA 2WJ6A 4UUBA 3AERB 1Y3FE 2XVAA 5F23A 4KU4A 3KV1A 5KC8A 2ZTUA 5HNKA 3OEWA 3PFNA 1R9MA 4DLRA 2W6ID 3GFSA 1XAJA 3GMIA 2OGZA 1JLLA 3UXHA 4HQLA 3NTUA 3WLQA 3C1AA 1V16A 4E08A 1WDWB 2ZDQA 3LU1A 1W76A 3NWEA 4MARA 4FHEA 3V6MA 4QG3A 1W1IA 1LNZA 2CBGA 3IE2A 5AW9A 4EG4A 4BQFA 2QTRA 4YHBA 1FU7A 5HMMA 3Q9LA 3ELBA 5TX7A 4IXNA 4KJXA 2ACEA 3DD1A 4A91A 1TX4B 2BMJA 3TB6A 1PVVA 3WK4A 1I4EB 3WFZA 4NV0A 1L5WA 5EWJA 3BCUA 4YLGA 3NIGB 2DBYA 3T3MB 4U6SA 4N7MA 3RS7A 1I3MA 1DKLA 1QHNA 2NSDA 1E9BA 4DM7A 3WHIA 1ZR2A 3IGFA 1EMDA 2QW8A 1XRQA 3CY6A 3OQIB 1GTSA 1TCUA 2RGRA 1AGPA 4K9OA 1Q7GA 5DLYA 4B79A 3REQB 5A5EA 5JECA 1EAMA 1SUAA 5BWMA 3D64A 3ZE2B 1FYWA 1QYIA 1F3OA 4X62B 3V33A 3KKZA 1C7IA 4NS4A 4OF4A 1VL5A 2ZB2A 3M3DA 3WHPA 1E2NA 5IWAB 2W90A 1BE6A 3H5WA 4QSMA 2YV1A 1T5SA 3H4VA 1Y8AA 3G02A 3O4IA 4J7UA 4M37A 1W8DA 4UAUA 4W63A 3V8EA 5LLDA 2P6NA 1CQIA 2WA2A 1U2GC 3KPJA 5JSHA 3ZQUA 1X7HA 1ZVMA 4HDNA 3A11A 5B64A 3U0BA 3HO8A 1NRJB 2H5IA 2PGXA 5LZ4A 3JVVA 1IN4A 1DTEA 1NQTA 1O3YA 1QRDA 4K6CA 3W0LB 1FYFA 1QO0A 2BP7A 1H6DA 1N2GA 2CKMA 1QG0A 3NWOA 1TT7A 4ZD6A 3C5VA 3BFJA 5HKAA 1T5HX 1GD1O 1I10A 4KQFA 3TG8A 4BVJA 4YQZA 4YRPA 1JG7A 2VSFA 4DA6A 3SX0A 1A96A 3P94A 1MXHA 2WWVD 1RM3A 5JWRA 4Y1GA 2MTBA 2PJUA 3W5HA 2O0LA 1CQIB 2XMRA 5I9LA 4E88A 1M2KA 2R8OA 2NQ8A 3BB1A 3DBHA 1X9GA 5AHKA 3TSCA 4DIOA 1N3LA 1UH5A 3L7OA 3OLCX 4Y7DA 1FS6A 3MINB 1MA3A 2PJZA 3FROA 3K1YA 2D54A 5KNCH 2HWKA 2C59A 2SCUB 2ZS8A 3L6UA 5H4HA 1E79A 3HUFA 5DXFA 3RIXA 3HZHA 3VQTA 1ZJ4A 2YVUA 2VYVA 3GEIA 3IPXA 1NOIA 2FDRA 3FFTA 1XE3A 4AJPA 2ZJ5A 1KOLA 4BP8A 1LDGA 2VIIA 5AVTA 1YNOA 4YRAA 2Q5EA 2DSTA 4IJKA 1UK6A 2WSSD 4EELA 4GVXA 3JW8A 4J0CA 4GC5A 1NVXQ 3C5CA 4UCFA 2ZRIA 2W00A 4OJYA 5EJ5A 2P0YA 4P3XA 4D4KA 1XD2B 4Y0AA 3TW6A 4E46A 4F9EA 3U6BA 3AY3A 4IFTA 3ENVA 5JE8A 3JARA 3H4MA 1GQSA 1PIWA 2R2AA 2R66A 5JZOA 4WBXC 3ZLVA 2HMUA 1YRHA 2FHSA 1BVRA 3VR6H 5GJBA 3HGQA 4DB2A 4ASUD 3G9QA 4UCXA 1NW4A 4XLLA 3CRQA 5EHGA 3ZY3A 4DLSA 2XOKD 4Z3KA 1NW5A 4B6PA 1NT4A 4N5IX 2C58A 4RPIA 1UZNA 1VLQA 3ZU6A 4JI5B 4XQ0A 3B7GA 3ETHA 4BVHA 2D4AA 4B32A 4HS4A 3L0DA 2V6BA 2Q45A 2ZSBA 1M0EA 1IUNA 1B74A 2ZWVA 3KJXA 1QP0A 3L43A 5EA2A 4W5JA 4MLCA 1D1TA 2K7ZA 3LA8A 1UK9A 2AK3A 2QUIA 3DQZA 2EFGA 4XUDA 2QTAA 4CN8A 5KOJA 3WL3A 4QTTB 1F51E 1W4CA 2BE9A 4KACA 3BM5A 2IDKA 1MHTA 2NPIA 3QOWA 3NIFB 2GN4A 3UW3A 4XI9A 4Y2JA 4AZVA 4F8YA 2B0CA 2GAIA 3DF9A 1VHLA 2VK8A 4PONA 2A1UB 5H3HA 3ZH2A 3STYA 5DNCA 2C57A 3HBLA 3V7UA 1R0BA 3K09A 4BUCA 4GNRA 2N1MA 3UPDA 3HUDA 5B7NA 1CNFA 1CYDA 1N1DA 2Q8NA 2QUBA 3LCUA 2ZRFA 3CPEA 1M67A 3VJRA 2KM1A 1J0EA 1CUUA 3FSEA 5I6DA 4G8JA 1SCUA 4L07A 3T7AA 4DPMA 5LN1A 4A1OA 4DILA 2YYYA 5L6LB 1RJFA 4FNGA 1I3KA 2IIBA 3AK4A 1Y5NA 1F5SA 1KP3A 1MJFA 2QM7A 3LXMA 4KC0A 5KZMB 2A67A 1PR5A 2PUEA 1KH1A 3NNSA 3RFUA 2ODQA 2QMOA 5EE1A 4DLBA 3R6DA 4C7OB 5DYGA 2WR8A 3TF5A 2W2KA 3M3PA 5HFJA 1XN4A 2GJKA 5C81A 1QBGA 3TMAA 1NTRA 3JQRA 3PXGA 3TUJC 5TE9A 5D3QA 4ZRMA 4UASA 3EXG1 4PLHA 4YI5A 2GN0A 5TMBA 2V1UA 2NPOA 1Q74A 4JOSA 4EFKA 2CNBA 4K6MA 2I7DA 2X23A 2ZSFA 1D3AA 4H77A 4JLKA 2NT4A 3W5DA 4OX9B 4GKBA 1JFTA 2XA1A 1EE9A 1VG1A 1PKXA 2I22A 5AJTA 3I62A 3AVVA 1Z73A 2PU5A 2PMBA 2IITA 3QRWA 1JYEA 4LN1A 1CDZA 1QP7A 3OJWA 3QLVA 4NU8X 2W2PA 2IU4A 2Z04A 4YRQA 3SKVA 3VR2A 4JUAA 3UATA 4TS9A 1WEKA 1IHXA 1JV2B 5IZCA 1UBKS 4MITA 4FXPA 3WGUA 1N5DA 2D1RA 1BE0A 2W58A 2QX7A 1B42A 1C0EA 3M6FA 2RGBA 3RODA 2FP3A 1YIAA 1N2ZA 3H19A 3TYXA 1KZ9A 2EWWA 2R1TB 2IPMA 3TR6A 5K5EA 2JLRA 1ONSA 3V8BA 5BSUA 3GN2A 3I9MA 1QMPA 1SVIA 1ETUA 1MC1A 1NYTA 4O6VA 4RD1A 5F51A 3EDOA 1NDHA 2VOEA 3VDXA 4QEKA 4O5AA 4ND3A 5LB2A 1NVMB 1QH9A 2G5GX 2QIPA 4A15A 2K87A 4K6HA 3OCYA 4CTMA 3QV1A 1TA0A 2Q3LA 2C5GA 1GU0A 4BAUA 5LXTA 1Y5MA 2C0CA 3S7ZA 1K97A 3D6NB 4J1TA 1KMNA 2A9RA 1IXSB 4V0ME 6LDHA 4UJ3A 1MORA 1BCRA 1PHRA 1M6HA 3GJ3A 1AGYA 1T2FA 2XMSA 3ETNA 5AI8A 2AYXA 4KH0A 4R40A 3T52A 3HN6A 4LDNA 2QUJA 3F9RA 1GAJA 1Q12A 1Y1RA 5EUBA 3D8NA 1UC4B 3FDJA 3SEZA 4BBZA 4US2R 3QVJA 3RWMB 2XDQB 2WPNA 3FGNA 3K1AA 3SC4A 1E9DA 3D7MA 4ZHQB 3HXQA 2BONA 4NX2A 5EFZA 2X5XA 3NVKI 2DX7A 3QELB 3CT4A 1LQ2A 2FKNA 1YDMA 3B8HA 1KYQA 4MVYA 4I5IA 5DB4A 5ETJA 3UT5B 3SVLA 4MP6A 2J6IA 5BRAA 2C7PA 2E87A 3BSYA 4BN0A 3HM2A 4DGSA 5ALTA 1GG2A 5AJXA 1P7CA 1TUBB 4PS0A 4FDVA 4AJKA 1V2HE 3GT4A 3HVHA 3FYDA 1WP4A 3PQ6A 1S2GA 3RJZA 2X0EA 4AS3A 4E31A 2Q3FA 3B85A 3CZRA 4AQDA 1ZLYA 1EP1B 4UHHA 2AEFA 1DAOA 4FYXA 2Y1DA 1JDJA 1G5QA 1K4MA 3BWMA 4HBGA 1EK5A 3RS2A 4CM1A 4ZPXA 3M81A 2YJ4A 3LKVA 1KQNA 1A95A 1G8MA 1XJQA 4GP7A 5KCZA 2OO3A 3UC5A 3NOXA 1GXSA 3LJKA 4JLAA 4HYEA 4D4JA 3C74A 5J47A 3NC4A 2EKBA 2VWPA 1A72A 1N0WA 3M33A 4QDUA 3NH9A 2OFWA 3A1TA 4UQOA 5EJFA 1M8GA 1JTFA 3TRJA 3F5FA 4MIYA 4C4AA 3W04A 5KDLA 1IDN1 5KPDA 1LCIA 4OAOA 3ANMA 1NP3A 1EM8B 3DEHA 4ZC8A 2XOXA 5BMOA 2Q3MA 1P2DA 4P31A 2DTEA 2N0SA 4DYDA 4QT0A 3O95A 1O2DA 1R8YA 1VM6A 1M6VA 2C8LA 2W4QA 5THKA 1RXUA 4X91A 5LXTF 3FF4A 2C5EA 3TO5A 1ZXLA 4IJMA 3DONA 1TYZA 3PNMA 4Y6QA 1JFVA 1YA8A 2AJBA 2ZIXB 1LF5A 1MOSA 1MRNA 4CUKA 4KODA 2GEDA 1VPWA 5GONB 3K8QA 3ZE0B 3D0RA 4B9AA 3FJYA 3BB3A 4EFMA 4R7TA 1OH5A 4NCAA 1HNWB 3PICA 2VAWA 4DCCA 1CT9A 4N0PA 4CDMA 4WN9B 1RCFA 3FSGD 1N1EA 2LKDA 1E1LA 1JDNA 3GCDA 4I3GA 3TZCA 2FSGA 5EQJB 4I1PA 1BMDA 4RE6A 3T1TA 4GZLA 2OENG 1YE5A 3AIKA 4JHXA 4CJXA 5REQA 1NXOA 1ZC4A 1QQ6A 1BJRE 4MPTA 4B80A 3O84A 1I0ZA 1N7HA 4OGWA 4UEQA 1E0SA 4WK0B 4AS1A 1JQEA 1PT5A 2HZ7A 5AI5A 2HJRA 2O59A 1B8PA 2X1MA 1KF0A 2ODAA 4BPBA 3BBLA 2YJNA 5HBGA 5IABA 1MABB 5IANA 4MA5A 1ULHA 1B4DA 1C1DA 1MLDA 4U4AA 5FWYB 4XFDA 2XHEA 4BL5A 1US8B 1ZQ1A 4BQRA 2VDMB 3JAWB 5A05A 4F3YA 4J0GA 1D2CA 1V37A 5DM4A 2I55A 4HWKA 4ZOLA 2AE2A 2G0TA 2OCYC 4FI3F 4FOSA 4I4LA 4BNTA 821PA 4B3TB 4NICA 3MS2A 4YDRA 3TR5A 2EGHA 2OFPA 3G2NA 2WAYA 5JWHA 1LNQA 1LS6A 4TMFA 3M6MD 4F86A 4TZKA 2WYIA 4WJKB 3U60B 2B3DA 3R9IA 1QP4A 2PUJA 1A77A 2GPSA 3TUZC 1H5QA 3DKPA 2ZIEA 1SVUA 2GT1A 2EW1A 1RI3A 2E4XA 2OCIA 5DBEX 2LDXA 3K2IA 4DL9A 1MX3A 3E5RA 4LK2A 2WKQA 2ZUVA 1XWFA 5AJWA 4M54A 3OPMA 1T36B 2FW7A 3L4JA 3BTUA 5AXBA 1PW5A 3STTA 3PXXA 4I8IA 2NG1A 4LK3A 4WKGA 4MGHA 5C3UA 4LXYA 2Q27A 2Z08A 4PR0A 1QIFA 1XTKA 1E3DA 1QZXA 1WABA 1J09A 1Z8NA 2XQVA 4FCTA 4YCLA 2NO4A 4P33A 3D4LA 2XRZA 1Z5PA 1M34E 2ENUA 1WVMA 2M6RA 2C9BA 2RJNA 4HC4A 5DV9A 2P91A 3GEPA 1ILEA 1AY0A 1RXIA 1K92A 1RMQA 2LW7A 2VTKA 1O5OA 2REBA 3ROFA 3T3EA 2P9JA 2HLNA 2QMZA 1PEKE 1HLFA 1GUBA 1WDMA 2ZUCA 4JVOA 3Q7TA 5MHTA 3KL2A 2ERXA 2JGJA 4UEJA 2O48X 4QXAA 2Q2QA 3OT1A 1LUAA 2I4NA 4G25A 2VJPA 2VWQA 3RS3A 1OZGA 3BE5A 3V4VB 1KYYA 2WFMA 3VAAA 4AD8A 2B35A 5G53C 1AVTA 1OGJA 2C4UA 1XF9A 3K9LA 3KJIA 1NVEA 2EJUA 4G5XA 2WHPB 5T67A 2ZRPA 4J1SA 3G9ZA 4GRAA 4HF7A 4MVCA 4R3NA 4UPDA 3RK1A 5TMPA 5B7PA 5H3CA 2X3YA 2YIJA 3QEOA 4N12A 1RKXA 1JG4A 3QITA 5ILGA 4Q6WA 3VR4D 3IFSA 3OPQA 3WMGA 3GT0A 1YJCA 3S55A 4XJSA 2I8LA 4ZJZA 1SVMA 1JJBA 2JCYA 4DT1A 2P6OA 3IVMA 1R3UA 1NJ5A 1QX4A 3BL5A 3RUDA 1TLTA 1DFIA 4O4LF 2C00A 1N5JA 3Q6IA 4YB8A 4YAWA 1Y80A 2FMUA 5EP1A 5DMXA 4BY9E 3PT5A 1FQOA 3IKLA 5IM4F 1P2TA 4K7JA 1B8VA 1KO8A 3CN9A 3LT1A 2BTQB 4X1KA 5D5QA 4FFSA 4WKCA 1PQWA 1QTQA 5BWOA 4RTMA 3HB7A 1HT1E 2HK9A 4Q3KA 1BCRB 3DUFA 4M1YA 5LDGA 1Z3IX 4D3DA 1JB9A 5T3YA 4FCWA 5DYYA 5TEWA 5CBPB 2Y1FA 4LHYA 2A84A 2BEJA 4WXYB 3DOOA 3TL3A 2IEGA 3KELA 2FR0A 2HLPA 1KERA 2FMXA 1G3RA 3PK0A 4LY9A 1XLWA 2XBLA 4QC2A 4B17A 5ENDA 1JEQA 5FHQA 2WJJA 3ZBPA 1HX7A 2E3JA 3QVGA 4HH4A 3TLKA 1O77A 4KFTA 5HHTA 2WQ6A 4YT8A 5F98A 1YS1X 4Q7MB 1BW9B 1XLTA 4YPOA 4B4KA 3H9JA 3H13A 3LPAA 1VE1A 5JTTA 3TOZA 2QLNA 4X24A 2HMYB 4NC9A 4RSMA 1J22A 2AN3A 3EC2A 5GGXA 1WNFA 2WZCA 2G9QA 3PLRA 4F7DA 3BZWA 1Z0ZA 1DBSA 1T4MA 1JVBA 2KI5A 4CT5A 5I5GA 1S8NA 5C5DA 5DT2A 3CZ4A 5BUQA 1NF8A 5ADHA 5ES4B 3BWBA 3Q5DA 1MJGA 4BJ5A 5JISA 4KR6A 4ZJUA 3KZKA 2B1QA 4UHCA 5JO0A 2ILTA 1EVJA 2WICA 3JD4A 4ME6A 4RNDB 1MRSA 3FYCA 5K8IA 3ONWA 2ZZNA 2RB4A 3RAJA 1FRNA 3UWSA 4RSGA 2IUEA 3SPXA 1DBQA 1II9A 3V32A 1G2PA 1QPBA 3MAGA 4D3SA 1FPMA 4IV5A 3OX3A 4EY3A 1CUEA 4YYEA 2R4TA 1TAHA 2OZVA 3AYXB 3H97A 5UKDA 2JFUA 1NVAA 1JJAA 2OV3A 1SCBA 4LMAA 1JILA 4TN1A 3RKSA 2Y1GA 4EHJA 4YT4A 4FP9A 2BMAA 4R2JA 2PZMA 4E2FA 4IZHA 1FX0A 2AUTA 3R7NA 5B30A 5JS1A 3RC1A 1Y8CA 3LBIA 3L8HA 5FO0A 2A58A 3LGSA 1O08A 4F1KA 1AQLA 1DX9A 2FN8A 5ALIA 1A8SA 1RBYA 2WJWA 2CFIA 1QGZA 1M2OA 2V59A 3GN1A 5DHUA 3X1ZA 4BGEA 1AQUA 2XXJA 3A1CA 1P0CA 5FTMA 3ANSA 2X7HA 4HDMA 3AHIA 2F3RA 1KU0A 1WCWA 1FNNA 1SOVA 1KBQA 2V7QD 3LKBA 2VSYA 1BDHA 1QZ3A 1I80A 2VG8A 3CX6A 4D81A 3GO4A 5EIFA 5LUAA 2QSZA 3AJ8A 2X6RA 4JI4B 5CAEB 5D6NA 3TUIC 2FQXA 4X1IB 4AAYA 1NBEA 2QG4A 2A0YA 5JJ5A 2C7OA 2J5QA 3NGLA 4BMOB 5DNYB 2XB2A 3UOAB 3OECA 3EFOB 1EGHA 3BXPA 4G5QA 3QUCA 4M9CA 1AV7A 4PC1A 4YONB 4ARZA 5C1OA 1DG9A 4J4HA 3W6ZA 1OH7A 1II8B 3VR5H 1J0BA 1RXSA 1JPVA 2IKSA 1YIDA 4LC9A 1SC1A 4I6JA 3OHPA 1GSOA 1I30A 3GXOA 1KC1A 2Y67A 3LBFA 3H2SA 3LY9A 4I5DA 3S81A 1VGVA 3DEKA 2YNMC 1T1GA 3OJ0A 4KRGA 2E4VA 1SC3A 1ZL2A 2WWGA 4G24A 3DYIA 2VPPA 5F2KA 4CMCA 3SEAA 4LZJA 4I4TF 4H31A 2R6DA 4EI8A 5A9SB 1DJMA 1WIWA 1ZNQO 2BGIA 4X8LA 3THWA 2PD4A 3OAAA 3WE7A 2E5LB 1V9LA 4X3OA 5CVVA 1I2ZA 5AKZA 1HEUA 1XXHE 1QHYA 1NNI1 1UMBA 1I2DA 3WOVA 1HE2A 4OHZA 5I47A 2X3UA 4LHZA 5F64A 4IO1A 1KWKA 1DX4A 2Q41A 2ZROA 2WW8A 1ACLA 3EIWA 4G1UC 4M0MA 1MAHA 5JFTA 5CEJA 1Y33E 2IQ5A 1N4DA 1V26A 3L9WA 6REQB 1CJSA 3AI2A 1DQSA 1X86B 2DKOA 4NDAA 5JDIA 2XUZA 1OAOC 2LNDA 5KVSA 1YASA 2DR2A 1EM6A 2OKGA 1JJVA 1OWOA 2RKOA 3LNTA 4WLNA 3GLIB 3I9V6 4BWVA 3UUFA 3AFHA 1A9PA 1E1CA 2IYQA 4HDSA 3T1QA 1JVNA 5AJUA 4ENPA 5IVIA 2G67A 3A1NA 4QAQA 4Z7NB 1VXOA 2OBBA 3B6EA 3K0FA 4GGPA 4NCKA 4EKGA 2R6FA 1TUEA 2FEWB 3EEFA 1W2HA 1GR0A 2ACWA 2MHCA 2RH5A 2MT9A 3IILA 5C9ZA 1VG8A 3HP7A 2QMHA 2JK0A 1LI7A 1KI6B 4P4NA 1PT6A 4LJAA 4CPDA 2XBUA 3JR7A 5KYUA 1NR7A 4ZIRB 1JKJB 3HWRA 5MGNA 2BPOA 2WZDA 1EGVB 1YZYA 3L7JA 5K2MA 4L85A 2BI8A 3C1OA 3KLBA 2BHTA 1GFIA 3HYRA 4HDSB 4L8LA 1ZY2A 5DLPA 1AMNA 3M9XA 4MVJD 4EBBA 1MN6A 1CZLA 2CEAA 4L6IA 3R74A 5BSVA 1AGNA 3ILVA 1LFAA 4O0MA 1TVKA 2Y4NA 1MBZA 1HE4A 4Y98A 5HDQA 1NULA 5K3OA 3P0IA 1WLSA 4KGDA 4LC1A 2TRSB 2IBSA 1XCBA 4OQDA 5DRYA 2FRDA 3H2IA 3D8TA 3LVRE 4J0EA 1KOFA 4P22A 5GJVC 3U81A 3ZHUA 1KY4A 3DAOA 3T4UA 1OX4B 2H7YA 1DQRA 3BSSA 3THYB 2O7VA 1IFXA 1HNNA 3LUJA 4NMLA 4XWWA 4TMXA 5L9AA 1FDVA 5C80A 1DC6A 4KMRA 5BW4A 1XZQA 3TTYA 4KHPB 2WTUA 3F5MA 3DZ8A 3L4SO 3L7LA 3NI2A 3OZDA 1Q84A 4HATA 4UMVA 5CB4A 1T9DA 1R5BA 5JOQA 2X0JA 1Q2UA 4IRXA 5CYPA 7GPBA 3LCRA 2B4AA 2JCSA 3AF2A 5D51S 2R0QC 4LYEA 1OH6A 4HWTA 3QU9A 2ZUBA 1FFEA 1OLSA 1SQ0A 3QF7A 1C41A 4PN7A 4ONEA 2P9CA 2YWJA 1B3BA 1IRIA 2FDXA 4F4CA 4XLTA 1QGDA 3GFPA 2CVFA 1F4VA 3AR3A 5IAKA 3M6WA 4YJ2F 2RHGB 4D26A 1SO8A 3EQ9A 3FSRA 4LECA 4B31A 3AVUA 4N48A 2QSYA 5KQPA 3BRWA 4HB4A 4RX1A 4EGQA 4EPTA 3E3AA 4HN4B 3GQBA 1YHNA 3GRKA 3OPYB 3D3NA 3S2IA 2BCGY 4Y2PA 3LC1O 1TF7A 4ICIA 2H2WA 3IDFA 4BOYA 3U17A 5BMVF 3LIIA 3K20A 5E8RA 1K7EB 2VCHA 4DQ0A 5A4JA 3EHEA 1I5RA 4F3CA 3NFYA 2VJNA 2YZKA 2V4UA 1U3VA 3FPLA 3NKVA 2J5RA 2HJHA 4FGLA 4QPNA 1NW8A 3VNQA 2O06A 4BKQA 5L6MB 3DDSA 3K3PA 1C7QA 2FVXA 1U0BB 4PBTA 1YT5A 3BMOA 3RTAA 2X5NA 3CBGA 3C14C 4FE7A 2CXPA 4MQ4A 3H75A 5BN4B 1MVNA 1WXDA 4HQ6A 2W70A 1CSEE 1XMVA 2YN4A 4H08A 1MW8X 2CSXA 4GMXA 3EXIB 3NBUA 2BSXA 1PJ8A 1EAYA 3WKBA 1P61B 4LV8B 4D8XA 5FULA 2PMDA 3HUEA 2C97A 4DV1B 3FUUA 3EUWA 5EMHA 5LSAA 2GO1A 4N82A 1R8XA 3QWHA 4MHOA 5EIBC 2GKOA 3S2GA 2CMHA 1TGYA 1Z28A 2RHHA 5EXEA 1ESZA 3W5JA 3ZYCA 3FOWA 1CE8B 2YKGA 3M6IA 4Z99A 5FHRA 3ZHSA 1ZIDA 1PP4A 7ABPA 3P9IA 5CLQA 4GMKA 3LG2A 3OY2A 2G0NA 3R5TA 4DMLA 2F9MA 4Z4EA 4IAOA 3QX9A 3WGHA 4CL0A 5DHSA 4BFZA 1JE1A 4BV3A 3K70B 1NATA 2PGJA 2PKYX 2IYFA 4LRWA 1FLVA 2VJOA 3I4LA 4GSLA 1WZCA 2W48A 3CXRA 3G3EA 4V02A 1GEGA 2ZYWX 1P81A 2XYPA 3LYUA 3MAAC 1WCV1 2X2PA 3K2EA 2WTMA 1V2GA 2CWDA 3V34A 2PQ0A 3W5BA 1H8HA 1SELA 3BWCA 4EGFA 2GKGA 5L7TA 3W5UA 5IAAA 2NZJA 4HD8A 2DT8A 1E2LA 1TJNA 3EVAA 3QYJA 3FE2A 3NTOA 5JVDB 2XCRB 2II6A 3BGSA 1IAQA 2P3SA 2Z56A 1DOAA 4WN9A 5BN3B 2PVCA 5IH3A 3UJCA 4U7JA 1JIJA 3V4SA 1FXUA 1IY9A 5CX4A 5BYBA 5TJHA 1P7YA 4CMIA 2MR6A 4QZVA 1RTTA 1E3IA 4FJ1A 1D0IA 3LFHA 3T34A 4KWIA 1O5TA 2F00A 3T3PB 4FFVA 1M2VB 1TL7C 2ZUWA 3AUJB 1KRWA 1UOOA 4G0PA 1C0LA 2J4DA 1WKVA 1NOJA 2Z2ZA 1PV4A 1XMOB 1JQKA 1G4HA 1QMGA 1L3CA 3HB1A 2CLLB 2Z6AA 2QU8A 4IF4A 3HA7A 4WFQA 1QE5A 3NWJA 3ABOB 2OYRA 1RPJA 3EXIA 2PKXA 4RVFA 5KVAA 1ZN9A 4UKDA 4XD7A 3C70A 4GI1A 4DVJA 2FRDC 1A4RA 1Y4AE 4OOEA 1NIJA 5J2TB 3RV4A 4JR1A 4B45A 2IHYA 1LLQA 5J2UF 1JLKA 1J2EA 3A4NA 4LOKA 4R2MA 1JG1A 2E9SA 4L0MA 4P5EA 3UAVA 4WEOA 2EQBA 3HYSA 1T2DA 1HL3A 2IF0A 1W5FA 3KSUA 1M2VA 1ZUIA 2I3GA 4MDYA 2VTEA 2KLBA 3VHQA 4G4IA 3DV0A 4ZI5A 4AQ7A 2V65A 1C7RA 1W581 3ZWAA 4ZICA 2NAPA 3EVBA 4J1TC 1YZNA 1J2UA 4P7GA 1W88B 4PAWA 5C1DA 3PZBA 4KFCA 1RQ2A 2PA3A 2F48A 4K0RA 4FIDA 3R7DA 4PAMA 4K9MA 5KWIA 3U3MA 1JAXA 2R6JA 2QT9A 1SU4A 3VISA 3IODA 1QQTA 3USZA 1NLFA 1DKNA 2QN8A 1EFVB 1YCHA 4AKTA 3PRJA 1KJZA 1BJKA 1W9HA 1KP9A 2YY5A 4KIUA 3WLHA 4GYWA 2D5CA 3OIDA 2HDOA 2ZYAA 4ENSA 1S4MA 2P9FA 5FWAA 3P9XA 2HHHB 4UVEA 4BGVA 1X7YB 1AG9A 3DG9A 1KPHA 3O03A 2PR2A 2A0WA 2WKPA 4KXVA 3R8CA 4XWKA 5K2OA 1EUDA 1UZAA 1YI0A 1ZJYA 4B09A 3L9XA 4RPGA 3WJAA 3ZHBA 5C5CA 4OJQA 3VNVA 4DQLA 1SD2A 1KXJA 2XCQA 1DXYA 4S05A 2B5WA 1SPXA 2PANA 4O2LA 2QI9F 3N7TA 1IZYA 3T3HA 4WKPA 2HGSA 1T9ZA 2IXBA 3X1MA 1N4AA 4K9SA 1FZTA 5H59A 2WVJA 4KW7A 5HIJA 5H9VA 4NKRA 2QE7D 4XW2A 2RGCA 4A03A 3CF2A 2FEKA 1I9GA 1WPQA 4MUKA 2VBGA 1Z6ZA 5DXAA 1OZAA 4KMOA 5C18A 2CXTA 2F17A 1T5DX 2FPLA 3KUKA 3QKRA 2DUNA 1DL5A 2FLVA 3Q7QA 1REQA 5DHQA 1OC4A 1TAQA 3WAGA 4H17A 3M83A 4D4IA 4XWOA 3PG5A 4NZOA 4F9TA 5BQXA 1LPOA 1LX7A 3LY8A 4KDFA 3PRYA 2C5AA 4WH0A 3ZVRA 4TPKA 2VBFA 3GCZA 3EPKA 1M1YE 1A88A 1R0WA 3MCZA 4E07A 4ZALA 2D2IA 3NT4A 4R0NA 1ZSNA 5BQOA 4L5CA 5K4AA 4A8JA 3Q5EA 4MQ6A 3FGPA 3COWA 2Q7DA 3R6WA 2WM2A 4JELA 3NHKA 4A8TA 4KBFA 1XNQB 2AZDA 3C87A 3E8SA 4YI3A 3W7AA 1IUPA 1QHXA 1KOGA 1QZUA 5BPHA 2AHRA 4DWVA 1RRKA 1E77A 4FOLA 3T38A 3I64A 4F5YA 3BHJA 3N2GB 3ZXSA 1BRTA 3EZ9A 1KAOA 3UXMA 4BVLA 1N1MA 3OMWA 3O8NA 4LGYA 4UUPA 1A5BB 2BFDA 1ZAKA 2VEDA 4JJ7A 4RD6A 5H81A 4ZEWA 2OAP1 3P2KA 4Q7JB 4Y7CA 4WK2B 4IDAA 1KYVA 1Z2OX 4EPVA 1D4AA 3IA7A 4L8FA 5IUJC 5KTRA 4JZKA 1L4GA 3NTVA 3OCWA 2XYQA 2OHJA 1RRVA 3QOYA 2VKTA 3QPAA 1NXVA 2Y92A 1KJNA 1S3SA 1YOVA 2JHGA 3MTQA 2DH5A 1QIHA 2FSVC 5CLHA 1TMGE 3I52A 1VSUA 5KYWB 4J9UE 1NVTA 1PL0A 4XPZA 4B7UA 3O3OB 3IO5A 4KZKA 3L04A 1A5SB 1YDGA 3OA0A 3JQAD 3OFSA 2J85A 1JHUA 3H8SA 5FFNA 1PX2A 2FX2A 4LSZA 1PQ4A 4EIWA 1DZIA 3GWZA 3RHFA 5A7FA 4RH3A 5FLKA 5C53B 1U5BA 2ID8A 4M7WA 3D6HA 4FILA 3ZLUA 4CQLA 4ZMSA 5KWJA 2FPSA 1EWYA 3QV2A 5L95A 1GTL1 1QG4A 2OB2A 1W85B 2JKVA 4CIWA 3U7GA 1OXVA 4QYSA 3RK0A 2EC5A 2J3JA 1Z56C 4WXPA 1CDEA 1XA4A 3PFIA 3QPWA 3URMA 1JI3A 1TGVA 2RB5A 1PZFA 4O3FA 3EOAI 4KUEA 3L07A 5ER9A 4CTOA 2NO7A 4YMVA 4Q3LA 1GP2A 4MB6A 4ZAZA 2PM8A 1C9NA 3IV9A 4HDMB 4GZ5A 1OPXA 2J7KA 2DFLA 1Z5WA 1V9CA 3ZHYA 4YIHA 4XSHA 4QOFA 2BFFB 4YJDA 2PD3A 3SEQA 3VI4B 4YCMA 1CJCA 2ZRJA 2O2CA 1GNSA 3EDCA 3KYCA 4K0KB 2FRXA 2ODBA 2XJ9A 3FYSA 3KZNA 3HEMA 5C8YF 1I0IA 2X7XA 4OCZA 3WISA 1TB4A 3UJPA 1Z7BA 2PYIA 5EQDA 4WESB 2ACVA 2YFQA 3OM9A 2GTIA 2GZ1A 5DTJA 4RUKA 4GYYA 4DCPA 1NVVQ 4MSUA 3RC2A 3IS3A 1NU6A 4Q24A 3NOVA 4ZYWA 3B3AA 2IT1A 5A2GA 3RIEA 2GJ8A 4JU9A 4MR9A 3RRMA 4J43A 4F93B 4JI7B 5FNVB 2N9UA 4MUEA 2ZZMA 3Q7SA 3TOVA 3CVWA 5K99A 1J21A 3WL8A 2VRNA 2ZYDA 4U7DA 3IKTA 3QYAA 1T91A 4DYVA 1T0IA 3VO1A 3KM0A 2ZTSA 4JN6B 3W2TA 4CMKA 3U44B 3EUFA 3T8YA 4DIBA 2D5IA 3V2UA 5A5VA 1KA9H 3HRHA 3OLYA 1DPFA 1BFKA 1OU0A 4OFZA 4Y1RB 3X1XA 3O6VA 1W75A 2PLAA 4G1VA 1OAOA 4L8YA 4CKBA 5IDQA 1F6DA 4KQWA 1V5WA 4LOLA 2PX5A 2WYVA 2B61A 2QUHA 1S7CA 1J7KA 2YXNA 3UQZA 3ZV4A 2OO5C 2VTVA 2WB4A 3EWIA 1RXYA 1WXHA 2GBCA 1ZM3A 4CLEA 2RAVA 4OD0A 3WKEA 2I6SA 1YUNA 2RBEA 2Q5HA 3O9VA 4HZUB 4IFIA 4XEHA 3KQKA 5B4UA 1G21E 3JYLA 3FNEA 4EOGA 1DKMA 2FQ1A 3PWSA 3FXAA 3ZCPA 3DULA 3K2BA 1DAHA 1UBOS 2RHCA 1LJ8A 2ZG6A 4CIDA 2KMLA 4GX1A 4ZU1X 5LMZA 4K9QA 2J9YB 3N53A 1L4MA 1X3SA 2QP3A 2GPJA 3SJZA 4BMPB 2KPOA 4RIEA 4U02A 3GLFE 2GK7A 3HBAA 1J00A 3I9V1 4FGKA 4L5AA 4L9WA 4H9GA 3C1UA 1UPXA 3KLPX 1F4PA 2R7AA 4P0QB 2CBZA 3GLHA 3OE1A 3LPCA 1N6PA 2R7NA 4ZQEA 4ZKDA 5G3YA 4HQKA 2NSJA 3H84A 4GU5A 1PYOA 3IJ5A 2O5EA 2ONCA 4Y6OA 3V6LA 4QPJC 3RC7A 2KX7A 1P1BA 4YTEA 4F4HA 3S8YA 2DPYA 3MTIA 1N36B 3A14A 3N39C 1M6WA 2ETVA 2JD2A 3NHLA 1JEOA 4L02A 1EDOA 1M74A 5A3JA 1MVLA 2B5OA 5D85A 3KT8A 1NUTA 3K1ZA 4HTFB 4MW4A 4U8GA 3S1AA 2NUTA 2GHIA 1Y63A 2EEZA 1BKDR 3NG1A 4KZPA 2B4YA 1C3EA 4UULA 3LUAA 1L1RA 1KFEB 2H1VA 2HSGA 4LSWA 4KPFC 3RYFA 1E3WB 3VBCA 1K8QA 1QGYA 2PT6A 3K4PA 1NF9A 3BIWA 1VYHA 2GD1O 1RHMA 1UDRA 2Q46A 3C3XA 3BD6A 2FZ4A 1ULUA 1UEIA 4UNNA 3NUGA 4DHEA 2WT4A 4CQNA 3CRZA 3DBRB 2ZJYA 3EGWA 4US1R 2OYCA 3SY8A 3UWMA 2B1IA 1PYDA 5T4EA 3CLTC 3R09A 1S3GA 1PDOA 1IXYA 1F7UA 4BFCA 4W9RA 3DM5A 2ZIGA 3D02A 4HWPA 4K87A 3BHIA 4JEUA 3NU1A 2IELA 4FZ5A 4WZZA 3KALA 4D8VA 3A2LA 3N75A 2XKKA 2JHCA 2VHZA 1CUYA 3V8QA 1SQ5A 1U65A 3IULA 1AA6A 2OC4A 4CEHA 4LSGA 2W5UA 2O8NA 5CH8A 2JIZA 1I7PA 4LCJA 4OHWA 1DAGA 1WQ4A 3EAGA 3I05A 5DP2A 1R27A 1ZD1A 4MUXA 2FG5A 2ORED 4WOPA 4ADSG 3S40A 1D2EA 4CF3A 3QVTA 1N5MA 3AXTA 3U4AA 1NBHA 2GASA 2A1IA 2Q2OA 2B78A 3K32A 3AO0B 4U2BA 3AL2A 5J40A 1BX1A 2VZ9A 3REGA 3ZDBA 2R68A 5LUBA 4WASA 3QA3E 4A2QA 4CDRA 4ENTA 2HO5A 1SPBS 5JEEA 1HTBA 2HTFA 4C20A 2OKCA 1F2UA 3OZSA 3WGQA 4LY0A 3UICA 3ON5A 2C98A 1VJDA 3S5UA 1I3OA 5EGNA 4BP3A 2UZ1B 5CAEA 4RTKA 5JASA 4RF5A 1CJVC 3RSOA 3TJZA 2B37A 1ZRNA 3ZI0A 1SXPA 1QRRA 2Q6IA 5BW5A 4XTCS 1EVQA 4F4DA 3PXEA 4CVNA 2FMTA 4WBSA 5IRCD 2ZWAA 4YCDA 1MIOA 4CEIA 1GV0A 4IDQA 4MW1A 5P21A 1X94A 4JKIA 3RVKA 4C43A 1AKWA 3BH7A 3LGXA 2OBNA 2AFRA 2BD0A 2PSDA 2IGBA 3DMFA 5K01A 4W1SA 1N9ZA 5AOCA 5F5LA 3SF8B 4KPUB 4JENA 3DDCA 4DR7B 3FF1A 2G70A 2EJBA 1RZUA 2HCFA 4D3ZA 2GYVA 2X5JO 1QV6A 1ZOSA 2IHTA 1OVMA 1U8YA 2M6SA 1T8SA 3QVLA 4GX0A 1L8OA 3MRXA 3OX2A 2X76A 4I9HA 1QVVA 4PIPA 3UMSA 2QBYA 5HMLA 1H2ZA 3UT0A 1Z2NX 4MKRA 1RWWA 2XV1A 4BNNA 4EPWA 5GADl 1GCIA 1O58A 2FWRA 2VWGA 5MN5A 4JB8A 5ES3A 3L7IA 3JYOA 1A50B 3LQ4A 4TMWA 2WM9B 4MP8A 5FR2A 1KS2A 1SURA 3RRZA 3P2IA 2AC7A 2I0FA 2JFWA 4KLCA 4MTCA 5F76A 3OG9A 4FLMA 4QTXA 2ZI3A 5DTIA 4KPUA 3D7SA 3OQHA 1FYEA 3RTDA 3R24A 5SYNA 3WBJA 1ZSVA 5A7GA 3UWOA 4M1OA 3VYWA 1QAQA 2X4LA 3FGZA 3L7NA 2NU6A 2CUNA 3H3FA 4RIGA 1I7SB 3I5XA 1XCLA 3MS4A 2A5YB 3REOA 4OBBA 1IUOA 4OREX 3RFFA 1ZIPA 4YAGA 4XCXA 3RH0A 2BE7A 2X9NA 2ZUDA 4IJQA 5L4SA 4L4SA 1KI6A 4HH3C 5IVKA 3WLEA 4AJLA 2FWBA 1VP9A 3K8YA 1S2DA 1OMOA 3U39A 4FDTA 1PGNA 2JFHA 5AUOB 2I2FA 3KJZA 4IYRA 5JXGA 3M3HA 3QMWA 3QXHA 3B7PA 3L92A 3CBQA 4J03A 2AN4A 1AGXA 4GSKA 1LZLA 1HG1A 3PUIA 5CXQA 2E48A 1UWKA 3V7WA 2HKIA 4XB6B 1VPTA 2BGJA 4FLEA 4FZJA 4KI0A 2FUCA 3NORA 4US0R 4GI7A 1SKYB 3FCEA 4CM4A 1W1WA 1CVIA 2VDOB 4I55A 3NM6B 3K92A 5KOJB 4FE4A 4ZHQF 2XNHA 1CQZA 2PZKA 2HFKA 4FGZA 3PDJA 4AYWA 2ZCUA 4TXHA 3KOOA 1XEFA 4DZTA 3I61A 3SC2B 1QRTA 3F7TA 4CDNA 3W6UA 3VR4H 2OHGA 1SKAA 3EW9A 4IZ6A 4YWHA 4U7GA 2FKAA 2B9EA 2JZOA 3M1IA 2H07A 2BZGA 3MA0A 3DEYX 1P2FA 1YSCA 4V0KA 4J6EA 4WKOA 3DPIA 1PLKA 3V1LA 4D6PA 5HK8A 4Q4CA 1MUUA 2J0EA 3W9YA 5GWXA 1V47A 1E6MA 1JIIA 3HXLA 1POWA 3CINA 5DXJA 3TINA 1ZN7A 2J6CA 2XTJA 3NNNA 5CFNA 3V00A 1F14A 3WHKA 3TMKA 4U6NA 3ET4A 3BPSA 2OECA 2WUFA 4JIGA 3KTFA 4IHAA 2COKA 3JPWA 3PD1A 3DOUA 2NM0A 4Q12A 3CH7A 3SFTA 4IP0A 3SD7A 3KQHA 4CCSA 1V1JA 3L84A 2I6UA 2H65A 1SEVA 3DM9B 1JS1X 5EHQA 1F12A 3CH6A 3UXYA 4LRUA 2Q5IA 3PJFA 4IRMA 2FN4A 2PSFA 4ZZ0A 2YY7A 3EIQA 4I99A 1HTWA 4YP7A 2B82A 1HEIA 3DLHA 4ZQHA 2ZJAA 1RAGA 3ORHA 3VYTB 2NU9B 3DH0A 4IDCA 4U7WA 1BHJA 2Q6TA 2VPIA 1ISMA 1MX1A 1TEHA 3BF7A 3FZEA 4RFSA 5HKLA 4QEDA 3TLMA 9MHTA 4DTCA 3IMKA 3Q2IA 4FYWA 1GQFA 4FLFA 4RYDA 3WIDA 1TI7A 2H2FA 4M7PA 4C0QC 4RK6A 1JWLA 4JXJA 5HE8A 1ORRA 1EFTA 1IBKB 4DZZA 4TKMA 2PO7A 3PFKA 3B78A 2VDRB 1AUXA 1UBJS 2VHWA 3JVDA 4UHBA 5FJJA 6YASA 4ZXPA 3EQ6A 3ACCA 3K5PA 4NL4H 1JMVA 1YAJA 3P9CA 4I1SA 1ANKA 1L7VC 4LGVA 4DIEA 1GU1A 5DNDA 1DSSG 4Q19A 3VR1A 2Z5GA 1ZC3A 2Q5OA 4EMUA 1P1FA 1RPZA 2W7TA 3R9XA 1YRBA 2VRBA 1MKYA 2CMKA 3EVGA 3TFOA 4R1TA 1C8BA 2V74B 4K81B 3CG4A 4Q9LA 4YMLA 5JSFA 4W5NA 4F1WA 4DQUA 3NVDA 5I9BA 4EAAA 1ZYUA 1V8OA 1GLNA 1V5EA 3LX8A 4X1IA 3Q2KA 4CYMA 3KDPA 1CQWA 2FZWA 4JR0A 2JFFA 5KIAA 4MYHA 5CFRA 1E66A 4BO6A 2IY8A 1ZLXA 4OHUA 3V5NA 3ZVMA 1TC2A 5JD4A 1AMOA 3MRTA 4FPXA 1NMYA 5GINE 4P58A 2NU8B 3WL5A 2PRKA 3HWX1 4E32A 4AN4A 1FF9A 1EWTA 2HPZA 5E6RB 4FBLA 2HW8A 4FI3C 1YR8A 2VDJA 3FCUB 3QPDA 2PFKA 1N2IA 2DAPA 3DMGA 4RZHA 3DV2A 2X86A 3OCUA 5LQRA 3T5GA 3RYHB 1E9VA 1L5NA 4ACBA 3IP5A 4X6XA 2NNWB 4NOKA 4RKRA 4H3KB 4DA8A 4C4SA 3OFKA 1Z0JA 5AKEA 1NW9B 3CS3A 3L01A 1UJ4A 1SBYA 3V7FA 1WLYA 3ZY4A 4YRSA 1SNYA 2QTNA 2DHQA 3UY4A 2EF1A 2JNWA 3HY6A 3QG1A 2LPMA 2VF5X 5FPKA 5JAZA 1O8CA 1EVEA 1TUGA 2XTNA 5BQ5A 1VBFA 2XW6A 2ZRHA 4L6AA 3VZCA 5FUBA 2YBDA 3O4VA 1AKUA 1NJ1A 3F98A 4IDFA 3GYGA 1OIVA 1WO8A 1XD2A 2J4FA 3NC0C 4H1UA 4XSGA 4P3OA 5CH3A 2CUKA 2RHDA 3L05A 3SQDA 3A37A 2UUOA 5BN1A 1E5VA 1V4NA 2PZAA 4DDKA 3GX1A 4QPCA 2M1ZA 1U0RA 3OKPA 1T0HB 1TLLA 2BKLA 3HXTA 3ONFA 4IQGA 4JX8A 3O8QA 4KN8A 4PTYA 1H5NA 3PXDA 4WQMA 4QSHA 2A35A 3RYIA 4JA2A 1QGAA 3I9JA 3HP4A 3HM9A 3HI4A 1E5TA 4ZV4A 3S44A 2ZT5A 2CJWB 2LWIA 2PS1A 2WPDA 4LDAA 4PW0A 1X80B 1DT5A 2RK3A 3QUBA 1CRZA 2RGGA 3DMRA 1U2GA 1GA1A 5CA0B 5IM4A 1KY2A 2J9FA 2CVPA 1FMCA 1Z08A 2CD7A 1CIJA 5E6SB 1CUBA 4J2HA 1AN0A 1XRLA 3CW2A 2ORYA 4CBVA 2X9LA 3AEKA 2X8WA 1PE0A 3PWZA 2WY2D 8ABPA 1IG0A 1ENZA 3W3AA 3KDAA 1YHZA 4M0EA 1Z4LA 1Y3CE 2ZIAA 3MT9A 3WIUA 2QE7A 4DUYB 3NT5A 4L0QA 3IE1A 1JHZA 2DFKB 1GGFA 3VH3A 1PFWA 1G9SA 2HA5A 4AWAA 2G09A 1S2OA 2GERA 3WG9A 3GVPA 5EIWA 5GPBA 3RIMA 3LO8A 1IBCA 1AF4A 2JDIA 1HKUA 2AJDA 1QHIA 5B2ZA 1TYEB 1U8FO 4G3XA 1DC7A 3FOZA 3OOSA 3PNBA 1U8AA 2QTTA 4XDZA 3NHAA 1ZWKA 1IHUA 2D06A 2PKWA 2H1WA 2HNKA 3DCYA 3S3TA 1JR3A 4DLPA 2QVZX 2JFYA 3VR3A 4UE2A 3G0OA 3I9LA 3LE8A 3SXUA 5F9MA 4LDQA 1JZSA 4K9RA 4PSAA 1Z25A 3UAZA 5EIEA 3B5JA 3M2PA 4PAGA 2JIPA 1O9BA 2GXUA 3G8BA 4UHJA 4X95A 4JX9A 2H2IA 4FYMA 2HMTA 4FZ3A 4FZRA 1EZ4A 1KGDA 4NCHA 4RA6A 3S0JA 2J30A 3FMGA 3GEHA 3PUJA 4RXMA 2QAGC 3WHLA 3TGWA 1E9AA 4IJ5A 3UMBA 5AVOA 4K8RB 5CM9C 4JB2A 4L9RA 3PRKE 4KE9A 1O94D 2IUTA 2QT1A 4IDGA 4TWBA 1AA9A 4EYOA 2JHAA 5DISB 1KO1A 1E7RA 1PFUA 1FVFA 4TGLA 1QDLB 1K75A 2NZUG 3CSUA 4QBGB 1T1RA 3H05A 1ZH6A 1YS4A 2HA3A 3GR6A 1GTRA 2KJQA 3LUPA 4LMBA 2QTMA 4M8KA 1CR2A 2BCEA 4PRZA 5DJ5A 4XASA 4RORA 4DNQA 3VKFA 1YACA 3BZUA 4M83A 4XYGA 1TKRA 2GFHA 1RWXA 3ELDA 3SP1A 3TIXB 3WDSA 1NWHA 2ZYTX 5FOWA 3NMUF 3E4DA 3FSJX 3OQJA 3IESA 3FPAA 1KC3A 2A0UA 4Q3EA 2JG3A 4PO1A 3MQ4A 5TR9A 1LPBB 1K8YB 1B14A 4PYQA 3TXAA 4UTVA 1WW8A 2JGNA 2P4UA 5FYDA 1TO1E 3FFAA 3HJUA 3PQDA 5TS3A 2WIJA 1U3FA 1O0BA 2YMQA 3EY4A 3GB9A 2QY9A 2ZIXA 1KKUA 3PE4A 1LEHA 2V0CA 4MV7A 4GICA 4TYWA 3M4JA 1H4SA 2VP5A 3C7DB 1Y1SA 1HFKA 4CMBA 2OBYA 3L1VA 5JZVA 1TTHA 4KN5A 3CNEA 5AM5A 4QFBA 4UHKA 3VVCA 4OQPA 3JVUA 1QIMA 1V25A 2G25A 3FFXA 3Q0IA 4TX1A 3RG8A 1XD9A 4FYIA 1XDWA 3I39X 2EZ9A 1EFLA 1PU2A 2DUWA 2F55A 4YJ3F 3ZCSA 3IP1A 5COAA 3V42A 5A0VA 2MCFA 4OHBA 2Q2WA 2JBHA 3OOJA 3Q41A 2I1VB 5ICFA 3SKYA 4PSUA 1T24A 3EAFA 4QRDA 1HGXA 1VLVA 3FVQA 4HEJA 4EVRA 3DWEX 1YB2A 1JUDA 3KEGA 5CVJA 3UHPA 2YUTA 4N5DA 3M9WA 3DWIA 4F11A 4UAVA 1T2EA 2ZRKA 5DKFA 2A94A 4I8DA 4PLWA 1IJEA 5L45A 3U40A 1KAGA 3GGOA 3RRNA 3VJKA 5E7MA 3EE6A 3TTTA 1TECE 3M0EA 2MU1A 4J90A 4L3VA 4UEKA 3WWPA 3RO7A 1LJUA 3G5AA 2VP3A 1P1IA 1JH8A 1QUFA 1XKQA 1LJLA 1UMCB 2BLNA 2I9PA 2K5UA 2Y1KA 1I1HA 3RVJA 2WU8A 3ZDXB 3P5SA 2JAXA 2WE7A 1G7TA 2UYHA 1BQ4A 3AZPA 4GOOD 2OXCA 4A4DA 3E05A 2QR5A 1VYVA 2HMSA 3WLOA 1ONBA 3B3JA 2AVNA 5EJIA 1XP5A 4G5SA 2DFTA 2RI1A 2WWWA 4DYHA 4DV7B 2H1OA 4A1FA 2ZRBA 3ZWBA 2ADMA 4OGFA 4GPIB 4ZYYA 2QVBA 1A9YA 3VNBA 3EOZA 2C9MA 4UTZA 3TQTA 2RBKA 3M5PA 2XUIA 1Z5OA 2Q4BA 4RJTA 3TECE 1LXCA 1CJUC 1HT3A 5HG0A 1PZGA 2YICA 4TWAA 3RVMA 4DB4A 4OB8A 1XU4A 3VPGA 5A5FA 1WXIA 3T7JA 2WMYA 1F06A 3HYLA 3GEDA 4RVNA 4WD3A 1IY8A 3D8HA 4V38A 1RLJA 2PT5A 2Q6LA 5AHRA 2IS4A 2E6UX 3DV9A 4IWNA 5C0OE 2PBFA 1YR7A 3MM4A 3PBKA 1EQ2A 2JFBA 2MMGA 1DWPA 1XELA 5HVNA 3IOCA 1F8UA 3TVTA 4YWJA 4YJ3A 3TZKA 2PUBA 2QJOA 1OASA 3JQ7A 5HILA 2XYGA 2B3TA 1DUVG 3LDHA 4XIGS 2GXQA 5JQGA 2IU6A 4EUFA 4I1IA 2H0AA 4PG7A 2XPCA 4Q1BA 3QEMB 1UT5A 5AP9A 1Z6XA 1OLOA 3L0ZA 1TNDA 1SHZA 2ZJ7A 5FCDA 3DFMA 5IBQA 3WO1A 2C5BA 2QS9A 3ZEIA 3E3NA 1QFMA 3TQCA 3GDGA 4MVJE 2G5CA 1U28C 3BQNB 1ZK1A 2A4KA 3LC7O 2RKWA 4RZIA 2IBMA 1SIWA 3DXFA 1OYYA 3SSOA 4MWEA 1UKVY 4TTRA 4YLEA 2G9NA 4AJNA 4DMFA 1YULA 3DE3X 4QJ3A 1K5PA 5AW1A 1T2AA 2IYTA 1NYRA 2R5FA 2QLLA 5JD3A 4BO2A 1YCDA 2P11A 3PD0A 1GILA 2ZR9A 4JZYA 1U6KA 1TXGA 5HBRA 2V5UA 2OQVA 3LL4A 2YHIB 1J1ZA 4JUFA 4X1KB 1P17A 2WA1A 5F1YA 5INTA 2BGGA 3HWWA 2Q29A 4IVNA 4TVKA 4XD2A 4DSUA 3EB9A 4CKXA 3PUXA 1H6BA 1NUAA 3N3AC 1AC5A 4S1VA 4M87A 2FPPB 1ZRMA 4J3JA 1LBSA 3UTDA 1G64A 3R7FA 4XAQA 1EWVA 2V45A 3QVGB 2O3TA 1TO6A 3ANYB 4TT3A 1KAMA 4KE8A 2VN8A 4E7OA 2CHFA 3VV3A 4M1WA 3AMVA 2ATCA 4ZCIA 4MW9A 1E0DA 4EG8A 2ZTLA 2B34A 5F78A 1YB6A 3ILSA 5D3MB 1GL9B 1Q14A 3SM9A 4A8PA 4L95C 4ETNA 4XFKA 1UBTS 2YVQA 3D7NA 5HGXA 2JW5A 3KQNA 3O73A 3OIUA 4G0ZA 5CT8A 2HK8A 2QNRA 2GK3A 2EFEB 3OF2A 4UXHA 4Z1MD 1E69A 5KQGA 1W44A 4OM7A 1RSZA 3AF3A 5LL6P 2Q7OE 2RAUA 3T7KA 1ZM4A 2TMYA 3RQSA 1I6MA 2A5FA 4RKQA 1PR9A 3RE1A 3DAPA 2GD6A 4V1CB 4FT2A 4UHFA 3UWKA 1AS2A 1E18A 3BFKA 4HWGA 5FL7A 1TPYA 1RRCA 1WSAA 1ADGA 2QLBA 2HO4A 1W5AA 2FEAA 2RARA 1VFPA 4MA4A 3B6JA 1V9SA 4N7BA 3DXYA 3I8SA 4TT3D 5AM4A 5TSDA 2QD5A 2BHRA 4AKGA 4LJ9A 1W9MA 1R6AA 1CULC 3EG9A 4H6VA 2DF8A 3AKCA 1OFUA 2W6CX 3A3PA 4EHDA 1V7QA 2VQEB 1FS5A 1FX0B 3ESAA 1K3UB 2OXTA 1VJRA 3LZCA 3K4QA 3WWDA 3M1AA 1TT5B 1E1NA 1GZHB 1PVOA 1LY1A 2H7VA 1PFYA 3I9FA 3LPNA 4PO3X 4UNSA 2R11A 3R0ZA 1OFHA 2FPKA 4JUDX 5IBRA 4TQ9A 5IJWA 5ECDA 1MT3A 2WAOA 2DHCA 3OSUA 3Q85A 3BFPA 3CEJA 1DIAA 1G98A 2IV2X 3A31A 5BURA 1DEAA 1WVIA 5D3KA 1DIRA 2ETXA 3EISA 2O8DA 4BQNA 3AI1A 3IR6A 1Q1QA 3H7AA 4F96A 1OFIA 1TJPB 3WJ7A 3JWIA 4JV5B 1CZOA 4MUFA 5DTEA 1DKOA 4A0QA 5LKAA 5LP6F 4H7KA 2GCGA 3AU8A 1UBHS 2NO1A 3IOYA 5CIWA 2WG2A 4R6WA 2JHPA 2ZBFA 4IOJA 3W7VA 2B8NA 3R7LA 3ZZUA 1DBIA 1TK3A 4W6QA 4P3YA 1RKVA 4RPJA 1ONPA 3DW1X 3GT3A 1K63A 2H85A 1ZXBA 2WJGA 4CIXA 1J9GA 5B6PA 2E4YA 3ETJA 2EDAA 3ELWA 1UBMS 3EDRA 1L9XA 1OREA 2PNFA 1P7WA 3JYHA 3UAYA 4CQMD 4U9IS 2UZ1A 4YGXB 1Y82A 5DLQC 4CR7A 3NIDB 3OT5A 1K4YA 4WCFC 5FPPA 3KAJA 3SC2A 1EUYA 3MRSA 3DE0X 4BV9A 1E6EA 1EE1A 1HBJA 3KOYA 1ZH2A 1IEWA 5LZ9A 3HS3A 1DLJA 4HAUA 3UPUA 5HYVA 4KPYA 3L1KA 2A59A 4Y3UA 4HDNB 2WDZA 1O6FA 3I04M 4DKXA 1IXKA 3AR4A 3SZ3A 4ACAA 3Q7RA 1Q3HA 4RIIA 1TC1A 5AW5A 3WBKA 1KNQA 1R1DA 2XQGA 2Q1YA 2GN1A 2J3QA 1EB8A 1FUKA 3CG0A 2X7JA 3E9RA 3TI7A 1QV9A 4YRCA 5FOQA 1L1EA 1ZA2A 5L3QB 4KNYA 1CWUA 1JR3E 1LSJA 1PL6A 1TEXA 3HBJA 4KQJA 2QLFA 4BVEA 1W8IA 2QAIA 3ZJYA 2ZVQX 1SCUB 4TM8A 5LWHA 1BW9A 4DR3B 4HEA1 4OSOA 1VSQA 3IEPA 3F47A 1KHTA 3NRCA 2CJPA 1DAFA 1MJGM 1DV2A 1GRVA 1NL3A 1DCFA 2OHIA 4BNIA 5HJ5A 4FFOA 4M36A 4G0MA 2WSLA 2QAGB 4JWTA 1FQKA 4D9KA 4C4OA 2Z9DA 3NATA 3OM1A 3ETLA 4PYRA 5HA5A 3SE0A 1RQRA 1G8AA 1FSZA 4JLDA 2H7XA 3NBKA 4CM4B 3IBFA 4KR2A 1PWZA 4NXNB 4MS3A 2C92A 4C14A 3MWEB 4N18A 3RAEC 2EFDB 3FYUC 3HZZA 2XYHA 3U9TA 5IT9A 3G8YA 3RYCA 2V9ZA 4MS1A 2Q3JA 3ZWPA 2BF7A 2WD9A 2J4CA 1UBSB 2P9EA 3ADKA 4MKFA 2VRCD 4EJFA 3F7NA 4B75A 3SVTA 1AHHA 2JD0A 3GH3A 1CUSA 4NY1A 3ZN2A 5JYBA 2IHZA 3KJGA 3CU5A 3HPRA 5D3ZA 4ZEXA 3TOSA 4ZK2A 5JNVA 5LMUB 3SOZA 1DCKA 3GZTB 1DE0A 1VECA 5I7SA 5GONF 1PJBA 1JU4A 2FW8A 4DBLC 3NAGA 1Z4KA 1CCWA 1DEXA 3SHWA 1E5DA 1ADYA 2CY0A 4M49A 2OD9A 3C5WP 3SF8A 3AJRA 3GNLA 1UBUS 4LZNA 3ZXIA 1PZNA 1PZEA 2PZFA 1T34A 4OXYA 3BTOA 1ABBA 3GEMA 2BBWA 2OAEA 3I3SR 3QVSA 4JYZA 3ZE9A 3D6UA 1H2WA 2I6QA 1AZLA 4WVFA 4TV8F 4LSMA 3LWBA 1XEWY 2RONA 2VNIA 3GRUA 1BSVA 1J8YF 2O4UX 3E4CA 3FHLA 4ZANA 5AK5A 3CVYA 5KYGA 1ISHA 4E5DA 3HCDA 2WTAA 5BVGB 1HH4A 1F5NA 2XZTA 2Z4RA 2C7BA 4IRUB 5EG5A 4ZIRA 4ZZ1A 3HBMA 1U2QA 3STXA 1NC1A 2E85A 3LQKA 4UU8A 4MCAA 5JIBA 2EKQA 3ABSB 1MIOB 2ODEA 3LP8A 4OQYA 5A5DA 5K8VA 1M2FA 1SWWA 2WSBA 4B2IA 1CV2A 2NZVG 2ZOSA 3HDHA 1N0UA 2X0RA 1E3LA 1VA4A 1C3LA 1N2JA 1RKUA 1QHSA 2V7EA 4FD2A 1ISJA 4O1MA 3TM4A 5JT1A 4N76A 1DBVO 1GTMA 4LX0A 2G5PA 4PZYA 1A4XA 4HNUA 4Y1RA 2BEWA 1BS9A 1SKYE 3JARB 2ZYRA 3ED5A 4WZBE 4P4GA 3DNFA 1KEUA 1SUCA 4DJJA 4UUAA 3K71B 3Q0EA 4Z3DA 1BEUB 3LDUA 1JB1A 1KMQA 3CB2A 2YOFA 4GKVA 2MJLA 3CJTA 2R6AA 5CFQA 4NAVA 2IH2A 4WV3A 4PG5A 2JC3A 2GOYA 2J59A 3TLAA 4F56A 2YWCA 2GBFA 2IP1A 2EYUA 4FEYA 5L4LA 1BX3A 4MPJA 1WPXA 4L1KA 1F2TA 7YASA 1RYYA 1SZJG 2BGRA 1EWKA 5DW0A 3VTAA 3SOPA 4A82A 4O1HA 4HN9A 4Y6SA 3G89A 3IURA 5EE0A 2H2AA 1YJAA 4UE6A 2ZTMA 2IV7A 2OHFA