4ARVA

Yersinia kristensenii phytase apo form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
409
structure length
409
Chain Sequence
GYTLERVVILSRHGVRSPTKQTQLMNDVTPDKWPQWPVKAGYLTPRGAGLVTLMGGFYGDYFRSYGLLPAGCPADESIYVQADVDQRTRLTGQAFLDGIAPDCGLKVHYQADLKKIDPLFHTVEAGVCKLDPEKTHQAVEKRLGGPLNELSQRYAKPFALMGEVLNFSASPYCNSLQQKGKACDFATFAANEIEVNKEGTKVSLSGPLALSSTLGEIFLLQNSQAMPDVAWNRLSGEENWISLLSLHNAQFDLMAKTPYIARHKGTPLLQQIDTALVLQRDAQGQTLPLSPQTKLLFLGGHDTNIANIAGMLGANWQLPQQPDNTPPGGGLVFELWQNPDNHQRYVAVKMFYQTMEQLRNADKLDLKNNPARIVPIAIEGCENEGDNKLCQLETFQKKVAQVIEPSCHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHYTASE
publication title Degradation of Phytate by the 6-Phytase from Hafnia Alvei: A Combined Structural and Solution Study.
pubmed doi rcsb
source organism Yersinia kristensenii
molecule tags Hydrolase
total genus 143
structure length 409
sequence length 409
chains with identical sequence B
ec nomenclature ec 3.1.3.26: 4-phytase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4arvA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4arvA02
5HTKA 4E3WA 1DKOA 1NT4A 1C7ZA 2BIFA 3IT3A 4ODIA 1E58A 3NFYA 3FJYA 4D4KA 2P9YA 2H4XA 2H52A 2P2YA 4IJ5A 1SK9A 2F90A 3QPWA 3QPUA 3NTLA 3D8HA 3MBKA 3D4IA 1RPTA 4PZAA 3QPVA 2DWPA 3HJGA 4JOBA 4EMBA 3GW8A 1DKMA 3C7TA 2EKBA 4QIHA 3MXOA 2ENUA 1DKQA 4ARSA 4ARUA 4PZ9A 5PGMA 2WNHA 3FDZA 2YN0A 3O0TA 4GPZA 4D4JA 3IT2A 1H2FA 2GFIA 2P2ZA 2OWDA 5AJXA 1UJBA 1BQ3A 1RPAA 2P79A 1BIFA 1RIIA 4HBZA 2H0QA 3KKKA 1V7QA 4D4MA 1T8PA 2HIAA 1DKLA 2I1VB 4JODA 2PA0A 1IHPA 2RFLA 3F2IA 3LG2A 1DKNA 3LNTA 1H2EA 4MA4A 2P78A 4FDUA 1BQ4A 4ARVA 3D6AA 3FDZB 1EBBA 5CX4A 3ZHCA 2A9JA 2H4ZA 1XQ9A 3IT1A 4GPIB 2P30A 4EO9A 5AJWA 5CU7A 4FDTA 4D4LA 1UJCA 3BIFA 1SK8A 1FBTA 4AROA 1CVIA 3E9DA 4PGMA 3LL4A 3DB1A 2P9FA 2P9ZA 1YJXA 1E59A 2P6OA 2P75A 4IJ6A 5AJZA 3GP5A 1QHFA 3OI7A 1V37A 2WNIA 2HPAA 1ND6A 1DKPA 2EOAA 2P6MA 3R7AA 3E9EA 3E9CA 3GP3A 5AK0A 1FZTA 1SKBA 5AJVB 1C81A 2WU0A 3EOZA 3K4PA 4JOCA 2AXNA 1ND5A 4TSRA 2ENWA 2HHJA 3IT0A 2A6PA 5HR5A 2QNIA 1YFKA 5AJYA 1K6MA 1QFXA 1QWOA 2EKZA 3EZNA 3K4QA 2IKQA 5CDHA 1SKAA 1C80A 2OWEA 2YN2A 3F3KA 2P77A 2DWOA 1TIPA 3PGMA 3DCYA
chains in the Genus database with same CATH superfamily
2FSUA 4AFNA 1DPGA 2ST1A 2VQDA 1Y5RA 5TB5A 4WNIA 4QQNA 4FCTA 4FLMA 5AI6A 5F1OA 2WHEA 4Y30A 2H63A 2HJVA 3PT9A 2CJXA 1ZR4A 4FLFA 2HWWA 5HQJA 4MV6A 3HEMA 2RG1A 3Q5DA 2WIAA 3KBBA 2O59A 2ALJA 5A5DA 1PDWA 3IV7A 2O0KA 3K1ZA 4NFHA 5ALLA 2ZZKA 3JQ6A 3RSZA 3SZRA 4XCVA 4AKEA 3U39A 2UVPB 4FZJA 4E5PA 5T3UA 2YWBA 2BJHA 1IU9A 3MOGA 1DRVA 4W1SA 2NQ8A 2VXCA 3MEQA 4GBJA 4CBVA 1BNCA 2CHQA 1R4AA 1KI4A 1J2TA 2J45A 3BMOA 5J2TF 1ESEA 3TWOA 4WJKB 3UK0A 5KJ6A 4MPJA 4UCFA 4B4KA 2ZTVA 2O1SA 1ZN7A 2PMEA 1S4QA 3EZLA 4FMPA 4ARZA 1C3LA 1G5IA 1YS4A 2BAGA 2W2TA 1SBQA 5JAPA 3EC7A 3AR2A 1E9BA 1FJHA 4KXVA 4QHSA 4AJNA 2XHZA 1NOJA 5IZCC 4EG7A 2K7FA 4U7WA 2R96A 4EGQA 1XWFA 4H1TA 4NEGA 5J4VA 3KLMX 4FEGA 2SCUB 1PJ4A 4EAQA 3GFTA 1XLTA 4YJHA 4IV0A 4ILKA 5K8JB 2OCXA 3R0XA 5FXMA 1ZUHA 1E1QD 2V9PA 4DTIA 4MQEA 4EGSA 4CLOB 3E82A 1VCNA 1VSTA 3K5PA 3CLVA 3NBQA 3HCCA 3OE1A 1JJFA 4NJEB 3SQWA 2LPMA 3D6VA 2GEVA 2QUIA 1O6GA 2IUTA 2TS1A 4RSGA 2XKAA 3ZWAA 1II8A 1J9ZA 2C4KA 4X92A 5B3LA 2VL7A 1FDUA 1I9CA 3C5WP 1HDGO 4B4VA 2CCJA 2XBUA 4RSHA 4EO9A 4BRZA 4GXQA 5KOHB 4QU0A 1E0JA 5JPIA 3QEMA 4P34A 1DUVG 2EF1A 2E4VA 1I9GA 3ORRA 4GE3A 4AM8A 3JAWA 4EX7A 5CCXA 2H8KA 1YE3A 3OHPA 5IBCA 1X42A 2JATA 2A0XA 4J0EA 4ZO7A 4ZCIA 3T15A 3U13A 4PGMA 4L5JA 3WQBA 2GLTA 3FI0A 4INAA 3WLRA 4G56A 1KZGB 3UUFA 3BHIA 2NT4A 1GPUA 2AMFA 5DW3A 2HV9A 1XAGA 4MHOA 2YRWA 3W3AD 1MU0A 4DA4A 5EWLB 3WC4A 1XDUA 2A2ZA 3TI7A 1EB9A 2PV0A 3W1WA 5JCOC 1AMUA 4MMYB 1H9CA 3OT1B 4NFLA 3SBXA 1UKEA 1GAEO 3WDMA 1Y9DA 1MBZA 1K0UA 1SOAA 1AQJA 2UXDB 4PCUA 2VP5A 3D3NA 1F9AA 3HU1A 1YZQA 4PSUA 3VO1A 4TRMA 2VNSA 4GLJA 4Y2TA 5KVQA 1TMOA 1FTGA 1R0YA 1JR3D 2GCPA 2IYQA 3K0KA 5EP1A 4CF7A 5JYEA 1QOPB 1Q57A 4AUKA 4KQEA 4Y2YA 2OCDA 3JARA 3U7QB 1L1EA 5C8YB 4NFYA 2EX4A 2NQ2C 4LDRA 1U9YA 1KJWA 3JALB 1EFCA 2PK3A 4O4HB 5A6SB 3T95A 5LUBA 2XTZA 1R6AA 3KUKA 1JH8A 1UPXA 3Q40A 3TKAA 2PNJA 5EXPA 1C14A 2EVWX 1R0SA 3G5MA 3MWDB 4AF8A 1NP7A 3DJYA 3LYUA 3QKIA 2FG6C 2HSDA 5DM60 1NOIA 1I30A 2C07A 2ZBRA 4KBGA 1A5AB 3U7EB 1LBEA 2ONYA 2F55A 3S4YA 1IMJA 4YJ2A 1DOAA 3NDBB 2XCTB 4MQLA 2R5WA 5JDIC 1DFHA 2C9CA 1LV7A 2Z57A 3NBZC 4DQUA 2W2LD 3A4VA 1P4AA 5LC1A 2EP7A 2NW6A 2O23A 1PJ2A 5JR3A 2DFLA 3CA8A 5BYBA 4BJ3A 4BC0A 3H9GA 5IFKA 1E7RA 5IG2A 1HZZA 5AI5A 5FTWA 2PG3A 1U0TA 4HF7A 4CGZA 4MEAA 1OFTA 4FOSA 4HQKA 1OYYA 2NPFA 3W9SA 2C5BA 1U2QA 5JXJA 4EY8A 3ICPA 4Q3OA 5SY4A 1KQGA 1C30A 2DTEA 3JZMA 4Z1MD 4HH3C 1C9DB 2DUMA 3M82A 4N7RA 2O2XA 1U90A 3LI2A 1QOZA 2CEKA 4A0GA 2QMOA 4B8YA 3RSQA 3EJWA 3LY7A 1P0MA 3V6LA 1I01A 3ZXXA 1A8IA 1HFWA 4LPKA 2IEBA 1QRSA 2W0SA 4BUCA 4EZBA 3URKA 4G67A 1JHMA 3KETA 3ZYZA 1ZR2A 5D5PA 5M04A 2E4WA 1HWYA 4QHYA 1OH5A 2BGRA 3DWIA 1MZVA 4KN5A 2QTGA 3DMYA 4V0KA 3AVTA 3FCOA 1OH7A 4LFAB 2JGIA 1E2LA 3T7IA 4Q3EA 4DB4A 2R8EA 4NAUA 2NX2A 4WVFA 2MSKA 4D9KA 2YICA 4IXMA 3AR5A 3L6RA 5AJUA 1T0UA 4YREA 2WTUA 1J1ZA 1K9VF 3PHJA 3RE1A 5CT4A 2H1FA 4R2JA 2CMDA 3V9AA 4EY3A 1FVOA 3A14A 3ER6A 5CK5A 3TNYA 4RGBA 1XZ8A 2C78A 3ZVLA 3J80A 2VATA 1XG5A 2ZAOA 1YVUA 1CQJB 2ZIAA 1E18A 3I2YX 4Z0NA 3DZGA 4WOCA 5JJIA 4B2LA 4EHNA 1A97A 4FFLA 3IKMB 4QPPA 4KEAA 4V1CB 2WD7A 1YZFA 1W52X 3EISA 1OWOA 1E6UA 4P53A 3THOA 3W9UA 5B53A 1LVGA 2J6BA 1K63A 4U6SA 2R8RA 1WY5A 3UJ9A 3MPUA 4BEVA 2BEJA 1U6JA 2PKQP 4ZT7A 4QXRA 2FHSA 1T5OA 1SPXA 1EG7A 4AQDA 1RQGA 1ZK0A 3K92A 2LCIA 1GNRA 2Y27A 3KTAB 4Y1RA 5FOVA 3GN2A 4ZEVA 1ETUA 5KKNB 4MGIR 3DCNA 2KQUA 3H2KA 3PZRA 1T9CA 2R84A 1FMLA 3KPJA 4MROA 2DX7A 3UH1A 2K2QB 2P9EA 3KOWA 3SOZA 5FI5A 4D9HA 3V8RA 4ZJPA 1KDOA 2BPOA 4JY7A 2NZUG 4IBOA 1F3OA 2JA2A 1MX5A 4C05A 3GT0A 9LDBA 3SGLA 1XXHE 1AMOA 1E6WA 3ZIAD 4HDKB 2WNSA 5BR4A 4B76A 2QPOA 1JFFB 3NHUA 1Z0UA 4O1MA 3VA7A 2HLPA 3AQIA 1CS0A 3Q9UA 4IRXA 2BH2A 1KQPA 4B4DA 4LJSA 5J40A 3PJRA 1IVYA 2BELA 2OB2A 2ZIVB 1MF7A 4UM5A 3UHFA 1NXPA 4C2UA 3FYSA 1OU0A 4P7JA 3MSXA 2OV3A 2ZBEA 3OFJA 4JP5A 2IOQA 4NS1A 5K6TA 3O7WA 5K0JA 1E9RA 3D4IA 1Q1ZA 4TKUA 2W8BB 2X0EA 4YMUA 3JYHA 1FVHA 1TVKA 4EH1A 4HB0A 2GNOA 2ID8A 4FSHA 1V8PA 4HPJB 2IYVA 1GTVA 1X1QA 1MW9X 2XUFA 2YZ7A 2G88A 3TNLA 4C20A 2FSGA 5CITA 5SZKB 4F91B 1AZLA 2AOTB 3IAS1 2QQ0A 1I0ZA 4LGMA 1GQQA 1LSSA 1NP3A 2Q99A 3N6XA 1UFRA 3PSHA 4P32A 4QOJA 1G0OA 3QVLA 4LFCB 1Z0JA 1VG8A 4IDFA 4MZDA 3T5BA 4E3ZA 2WA1A 3UYLA 1V4VA 1K75A 4QDXA 3TRFA 3ABOB 4N3GA 2H1OA 4JVMA 3R24A 1MB2A 1OF1A 5FUXA 4IFBA 4V0NA 2HCBA 3WB0A 4V2UA 4MCIA 3C6QA 2CDBA 4BLPA 5I7FA 4AU1A 3FZGA 1K5HA 2A5DA 3OKFA 2JBWA 4K87A 2YY5A 3VGJA 3CF4A 3HY3A 3NXSA 1MFZA 4F5WA 2QSJA 3VQTA 1RWXA 2FG5A 3UICA 1MO5A 4CMHA 4GLBA 4DE5A 3W2FA 5G1OA 1M0SA 4BO0A 4DRZA 2AI2A 1GZUA 3VU0A 4O4LF 5DBOA 3AEUB 5HG0A 2IC5A 1I6WA 1XA4A 3R3WA 1DO0A 4YXWD 5FRDA 2OESA 2P78A 4N5IX 4KRYA 1U0SY 1XROA 1HNNA 1OJLA 5T57A 2YJ3A 3TTXA 3GJYA 2CLEB 4LOAA 1QG0A 4UUPA 1Y8QB 3TQQA 3G1WA 5FTJA 3T7DA 3WI7A 2G9UA 1JEQB 4FMDB 5JZMA 4L5YA 3K9HA 3UJPA 3H8JA 3WADA 3C6YA 3AHIA 2RI1A 2HRRA 5EJGA 4JZKA 1KXZA 2PRYA 3FMVA 2JVJA 3K6RA 3Q3JB 1E89A 3SX2A 3H5AA 4PFQA 4GR4A 4AMVA 4CV0A 3KB8A 3OAAA 4JWTA 4DY4A 4FP9A 2R00C 2AE2A 4ZCPA 2L42A 4R31A 1J8YF 2ODAA 1JSRA 3NHKA 2IDJA 3A9VA 3DTNA 4Y2HA 3T4UA 3UUEA 1T5LA 3IXLA 3ZWMA 1ND6A 4JOSA 4KYTA 1D9ZA 1XCBA 3KK0A 4IZIA 1VPLA 2FEAA 4J03A 4WE3A 5B3AA 2IDZA 4BKMA 4BP1A 1V2HE 2J9RA 2WAYA 2GDJA 3WGQA 4WZZA 1SMKA 3W5JA 2HY7A 3KZMA 1PNOA 4WEOA 2C4NA 4QDOA 1SUSA 4YCAA 1IY2A 3QSGA 5HNKA 4DCGA 3BWBA 4LYAA 2QT1A 4R1MA 2ATXA 2C29D 2Y4NA 3U56A 5T4BA 3G0DA 1J39A 2DFDA 2IE0A 3FNHA 4E5KA 5JMOA 3AJ9A 3H1FA 5FI1B 4J0KA 2J41A 4K9NA 4H7JA 2TSYB 3KOYA 3REGA 1IBKB 3W77A 1JKFA 1P7CA 1Y5LA 2K6GA 3GQBA 3PGMA 4K05A 4RH1A 1VKRA 4RETA 4BNXA 2GBGA 3KKLA 3DBHB 3KZOA 2JH8A 3KD2A 4MKHA 5AKZA 3HA5A 1JHYA 1V95A 2WP8J 3H3XA 3ANXA 3ZE7A 1Q11A 3INTA 1XLWA 4IMIB 1M33A 4IDDA 2G4CA 1E9EA 1DX4A 4LE2A 1G17A 3ADKA 3OJ0A 4OXIA 2XNHA 1RAIA 2P5UA 1Y8RA 4IQ8A 3THYA 4KR3A 3PENA 4LN1A 2WUVA 1OOEA 2AMJA 2ZQZA 1J8MF 2P3QA 3HZHA 2JIQA 3R7DA 3TNJA 4BP8A 4YMGA 4YJKA 4I5EA 4A2PA 4WBXC 3ABQB 1E2GA 1FF9A 1K7YA 3QHAA 1KFCB 3LUCA 5TJ9A 4EYGA 5LM3A 1OLUB 2YXPX 5F12A 1V71A 5GZ6A 3CW9A 1NFRA 3NGXA 3OFKA 2AEEA 2FEMA 2P0YA 4JGGA 3TLGA 4GE0A 1E64A 4OSEA 4B4UA 4CV2A 2Q9UA 4RC9A 4ZTZB 2FSFA 3OEWA 4LZJA 3R8CA 3VR1A 1LI7A 4ZOQI 3BCHA 1IOVA 1II0A 3IP9A 2IY8A 2J6HA 3EVGA 4E31A 1XDZA 3KL2A 2PUGA 4W9NA 4X97A 3TFQA 4NHEA 3IQZA 1TYEB 1IB0A 4FZVA 4GMGA 3EVBA 4MAAA 4PGAA 4E14A 2OAP1 1JHAA 1YUBA 5M5BA 2UZ1A 1P3DA 2HTEA 3IULA 3UXYA 4F8YA 5I9IA 2HB6A 1OB5A 4EZIA 1PJBA 1TIKA 3EYWA 3JD0A 5E7QA 5AVZA 3UC5A 2VQEB 2HDHA 4X9XA 3P4UA 5TVKA 3RYTC 4G0XA 3AHFA 4GRDA 4H7DA 3PG5A 3AG5A 5D87A 3TS1A 4V02A 4LJ9A 2P6UA 5IW8A 1E94E 3TVYA 2PQMA 3D02A 2EARA 1EGAA 1HDEA 3ONVA 3PJEA 3BWEA 1OU4A 2JHCA 1CE8A 5C3UA 1L5FA 1M75A 3AERA 3SBOA 3CZRA 4KRGA 1NVEA 2PIAA 4NENA 3VR4A 4W7SA 3ZGNA 3MCVA 4BB0A 1UBSB 3C6ZA 3OBBA 4YAGA 5BMVF 5CB4B 1Z56C 3OURA 1DAOA 2MYPA 1FUKA 3IMKA 3QX8A 1FFDA 1MTZA 4KBYA 3OPYA 4LK3A 4RJKA 1I4LD 2GCOA 5KQMA 1USWA 1YKFA 3IKVA 3EIEA 4EBBA 3JV7A 3PJFA 3KD3A 5K5EA 3F71A 1KQNA 1W581 2IY9A 1JIUA 4UDXX 1XRSB 1OFIA 2QROA 2Q1WA 4XR4A 1D04A 1R0WA 1E3JA 4N01A 2HJWA 3DT9A 3QKTA 5G02A 3IAS6 3CH7A 3SE7A 4BBZA 5IJXA 3NV7A 1YZ3A 4YAUA 5CNKA 3TTTA 3ELYA 1CRZA 1D2MA 1AQUA 2I4NA 1CF2O 4DZZA 3WK4A 1VL2A 4CR6A 4TXMA 3LUKA 1J90A 1UBTS 1FX1A 1BXRA 1DELA 3L7NA 1YQGA 5J47A 1XRPA 4O2AB 1NOKA 1XZPA 3OM9A 4IYRA 1A69A 1T8YA 2QJTA 3C15C 2QUAA 3CF0A 1RYBA 3QE4A 4Z0TA 5DNCA 1M2WA 1Y6JA 2QNBA 3QFTA 5FFMA 5TPZA 1E0KA 4JT8A 3VYWA 2OHOA 5K3FA 4WXHA 3GNQA 4BNFA 1Z6YA 2FRDC 4QYWA 1IEWA 3W6PA 3MGAA 3FY4A 4N5LA 4MHSA 4WUTA 3D8TA 2OZVA 3CSDA 2QD2A 5B7QA 1YZHA 3BSFA 2XYPA 1NUSA 4OGFA 4LEIA 2ZI6A 3TVTA 3RR2A 1XQWA 1EGMB 2PZBA 1T6ZA 2JANA 2N1BA 3LX5A 1IN1A 5SV2A 1JNYA 1B3BA 1EH5A 5KUTA 1M6NA 1LBTA 2FW7A 2KX7A 1JBQA 3O31A 3UGKA 4CCSA 9ABPA 3STWA 3SVZA 1L7QA 2Q0SA 1VIDA 3UHAA 1O6BA 4PZ9A 4JC0A 4ZZ1A 2I3AA 1IUOA 3CVOA 2R11A 4DCMA 5KYYA 3TUJC 1FYDA 1K66A 4IDEA 2RHDA 3WX0A 4IJQA 4JL5A 1KEEB 3RVKA 3PRYA 4WV3A 5KREA 2RBGA 1YQEA 1J0XO 4I4CA 3FSGD 3CR3C 1PI3A 4M7RA 1B6SA 4E2YA 4NCXA 4D4IA 4BQIA 5BR1A 4MMXB 2PUFA 3CHYA 1D6MA 4ZWNA 2RKBA 5IWAB 3WL4A 1MN6A 3ITEA 3WLPA 3IXQA 1EK2A 1FQWA 3FX2A 1JWAB 3G7SA 4WA7A 5DSXA 2B92A 2PTHA 4A23A 5IJZA 3DYBA 2WYUA 1KKMA 2DKNA 3EPPA 4EPTA 5JTTA 3JQRA 5EP2A 3DP7A 3DULA 3LPNA 1KQFA 1DWQA 2A59A 4RF5A 1GSAA 1LK5A 5DRYA 3TZCA 4AXXA 3EXFA 4M9SA 1I80A 1Z33A 3FOBA 4O2BA 1Q83A 2MSNA 2CE7A 3Q3EA 1GNLA 1L5OA 5TMEA 4PCVA 4DUZB 3NQ41 5C5EA 5JPCA 1K8XB 3OX1A 5IPFA 2EP5A 4KV9A 1NUAA 1Y4AE 1TVMA 1B2RA 2OK8A 3WGVA 3ZGZA 4FD2A 4QDKA 5LOVF 1U7OA 2H5EA 2YWDA 2ZB7A 4R01A 4XYEA 3ZWBA 2HMVA 3AJ8A 1Y33E 2VF7A 3BK7A 3F4KA 3QIVA 5D8DA 2LKCA 5EE3A 5TNXA 1OTYA 5EKSA 1GU0A 2Q9CA 3MTDA 4EUEA 4P2GA 4LOIA 4AP5A 4NZYA 3EVFA 2OORC 5KTKA 1TT7A 3WGYA 1ZMXA 3GARA 3OX4A 3L7KA 1RABA 4DMCA 2I34A 3HNOA 5JYDA 4QKQA 3AEZA 4IIXA 3I9NA 3IO5A 1YONA 4MX8A 4Q4DA 2GFHA 2X6QA 1IN5A 1BOOA 4XVCA 1I7DA 4MUIA 4X41A 4YY3B 3GR6A 2C20A 2O2CA 2QMEA 3I42A 2XV1A 3NETA 5C5IA 1UDBA 4DV5B 4YRAA 3FPAA 1H3FA 1VIVA 3VR5D 2OA0A 1D2CA 1DMRA 4IZ6A 4B9EA 3NONA 1HYGA 3FFAA 2ARKA 5F9HA 3WBJA 1BX0A 2EJBA 2OUIA 1NJ5A 1QB7A 2Q0XA 3ETLA 4N76A 4K3VA 4Y6GB 2W58A 2VP3A 3VZDA 1TYCA 4RLQA 4RMJA 3W5CA 1O3YA 2XD9A 3H8SA 1NJGA 2VP4A 4KPUA 1WZNA 2YN2A 2ZYHA 4CGYA 1GP2A 3SMQA 4WQMA 3H5RA 3RM3A 4ZI7B 2JZCA 3BMNB 2AIRA 5LA6B 5KCZA 1H0KA 4RD1A 3H9UA 2C4UA 1EMDA 1YR2A 2R00A 4XIGS 3OIYA 4OHRA 5TDHA 4F1JA 5F98A 2HW8A 4KDRA 3EUEA 4H3HB 2VKQA 1CR6A 1TJNA 1XTRA 2VAXA 4HNAB 2FN9A 4IMJB 4XCXA 3SHQA 3KSUA 3W04A 4EQZA 3R23A 4J49A 1AKWA 3ZWXA 4LCJA 3UJ8A 4E88A 1DX6A 4OYRA 3TCXB 3WK7A 1BKYA 4EM6A 3BN3A 2EZTA 2DFTA 4ZYLA 1UCFA 5DGDA 5TEWA 3JD3A 1TYZA 1Y7TA 3IEXA 1KI8A 1YVPA 1XT6A 1EIWA 5FO0A 1YBAA 2EFHB 2EKBA 1W44A 2DPLA 5LN1A 3EXIA 1IHOA 2C83A 3O8DA 1UAYA 3DMDA 5HE8A 4H4DA 5LP6A 3ASZA 1PL8A 3W2HA 4NYIR 1LTHR 4AULA 3OZBA 4FU0A 2E4ZA 2BMDA 1NT2A 3GMIA 2WVJA 2HADA 3HP7A 4MQ6A 5JG7A 2WU4A 3A8TA 1P2UA 1ZJZA 3UT6A 2H1IA 3ZQ4A 5CDUA 2GK6A 3V4OA 4PZ0A 1FUUA 1N57A 1N0HA 3IQDB 4MB6A 1K8ZB 4MA0A 2EDAA 3ZHYA 4CNBA 5TEVA 4D4HA 3WNBA 4J2TA 2F8TA 3ZU2A 2HYIC 2WJVA 5B3JC 4IOJA 3W6OA 2ZWPA 2DCMA 3SFVA 3VR0A 3O93A 1Z0IA 1XDBA 1TQDA 4F3KA 3HO6A 2A57A 1FE8A 1P4GA 3NDIA 3J81A 3I39X 5B2ZA 3ST7A 5A05A 4MVJA 1JLSA 1RFLA 4BHTA 3IMFA 1XD2A 1JDPA 1YI0A 2AFHE 3QLEA 4IIHA 4V2IA 5JWRA 5DNYB 1VL5A 2W6MA 1VI2A 4OX9B 1AF4A 5SYNA 3NHFA 4QLAA 3RYCB 1Z22A 1Y9JA 4PO9A 4DIUA 1XQ9A 4HUQB 1L6RA 1Q7CA 5AKHA 4MUEA 4QPDA 2FWJA 2L19A 2P35A 5AJWA 4RD4A 5DHTA 3H8WA 5HJ2A 4D9FA 4FB5A 3S55A 4QG3A 1DC6A 2FOIA 1EX1A 3AMVA 2IODA 2PVSA 4H7KA 4FYYA 4Y7DA 4BL5A 1KEUA 1RYMA 2DZDA 2FSVC 2ZSFA 3K1YA 3ZE2B 2I6GA 4A8JA 4AJEA 4EG4A 5MF6A 1XCLA 3DVSX 3FTNA 4GOND 3TI9A 9LDTA 2ZT7A 4RM2A 5EE0A 1P9OA 1L7XA 2VNKA 1YDEA 3HXTA 2P9ZA 1JG6A 4WZBA 4XB1A 4XE5A 1GTJ1 5IYZB 4NIMA 5ENZA 2X0IA 2HI0A 5B58C 1Z4IA 4UKDA 1NQXA 4EI7A 3C3PA 1IY9A 1B6RA 4HEQA 1UPCA 4DJAA 2G25A 1U65A 2H18A 2AQKA 2GPNA 5AIAA 1X9HA 5ESXA 2C3UA 3OT4A 1X7YA 3P0RA 2IHBA 5HCNA 1B1AA 2CLOB 3S2FA 3TX6A 5EQJB 3PXCX 3ZK8A 2WIDA 3MCUA 3NATA 4GYKA 4IJMA 4NV0A 3GDWA 3VO8A 4DSOA 1R12A 5JISA 1SNYA 5JIBA 2A92A 1IPFA 2HL6A 4LBZA 2Z3WA 1RWKA 1UFVA 3S1AA 3O2NA 1PWEA 4CTNA 1B93A 2CUZA 3WQSB 2XI4A 4AK9A 3WXMA 1T4DA 2VSQA 3NIDB 1FLNA 4FDVA 3V2UA 1JG2A 4GGOA 4RK7A 3AJRA 4X20B 4DWOA 4CN8A 3SX4A 3OCJA 1PS0A 3VZBA 5GY7A 3N5KA 1U8EA 2DBYA 2AR7A 1EUCB 2DTXA 2Y0EA 2OBYA 4IJ5A 4YPFA 2X1HA 2OHIA 1L5QA 2W2PA 4TWRA 2GXSA 4ZO9A 2O3QA 4LY9A 4E2WA 3GAFA 2Q5CA 1QS0B 1NKSA 3RGGA 5IXJA 2HMWA 2BT4A 2O7RA 2VUTA 4G1UC 4CIBA 2CD9A 3K9GA 4B6RA 2Z8YA 2PKYX 1B42A 3G8DA 4RHYA 3HL0A 1KZYC 1H8ED 5GP1A 1FQKA 4AWBA 3UQYS 4BB5A 5LD2C 2UVPA 3GI1A 4JC5A 1CUEA 1RNLA 2YWXA 3TE6A 4DNFA 1RKBA 1XB2A 4LXYA 4EA8A 4UTVA 3KPWA 3HEAA 4F4IA 2O8DB 2OZLB 1W2GA 1E8MA 1VLQA 1D1QA 2QTNA 5DSTA 3AF1A 3MOIA 3CLRC 3ESAA 5FV7A 3W5SA 2GSWA 1JJBA 2ZVPX 1NSYA 3OTGA 5H59A 1A1VA 1FTYA 1MXFA 2AFVA 1MORA 3LWZA 1NV9A 5IABA 4BE7B 2X6RA 5AW3A 3SDSA 3EEFA 3W3AA 1AZTA 1VBNA 1MIOB 4FN5A 4GLOA 4MW6A 2CUKA 4UPEA 1UFKA 3WV4A 1KK1A 4OMFG 3A25A 3QY9A 1H2BA 4RGYA 3VZSA 5C37A 2GBLA 5CCBA 3ZLJA 2SCUA 1UJMA 2QM0A 3BAZA 3UPUA 5A9SA 2C2GA 4LMRA 4QLOA 4R2KA 3M6XA 1J1IA 4IGAA 3MJHA 4AP6A 1B3RA 1TAUA 1JR3A 3G02A 1G3RA 1U81A 1X87A 4PTYA 5FWXA 4XM0A 1N4AA 3WRYA 4CLOA 1E3MA 4NJEA 2VZLA 1OPRA 3R3VA 2ZBUA 2RAUA 4HADA 1L5LA 1PQYA 5JH7F 3GPIA 5JNUA 4NJMB 3GUVA 4QNMA 1PCXA 2HA0A 1DUIA 3AI3A 3DDNA 3H7AA 2HWYA 4RACA 4CM5A 3LZ6A 1OXUA 3CNQS 5KOHA 3TIVA 1FW8A 5JXGA 2GVZC 3V48A 4WKOA 3UV6A 1DJQA 3BE8A 5BT8A 1O87A 2P4EA 1H69A 4Y2PA 1U80A 2O0HA 3BF7A 4ENQA 1N9GB 1P19A 5LZ4A 1R37A 5HIKA 3EARA 1O97D 3R3SA 3H42B 3RVQA 1NZJA 2BHNA 3HHEA 4Y1FA 2X58A 4KQKA 1SIBE 4U9UA 4S05A 5AJZA 5K51A 3JQGB 3QIAA 2C9YA 1YC5A 1AY0A 3NIGB 4KDCA 3L06A 4UZEA 5EWLA 3RU3A 1U28A 5K3SA 2WIJA 3R6LA 3VU3A 4RTSA 3H9CA 2O7NA 3CUUA 1NC1A 1T25A 3OT1A 3V42A 1FMJA 4L78A 4I3HA 2AKYA 3WWPA 2BZGA 4D57A 821PA 4RU1A 3EFHA 2PMCA 3C3WA 4IIUA 1B41A 3HSKA 4UBIA 2PQ0A 4I3FA 2J0SA 3WK9A 1NW4A 1QTIA 1AU9A 1N8TA 4J29A 2IYLD 4L51A 5DVZA 2HJHA 3RAFC 4XA8A 2G9ZA 3H2ZA 2ZPTX 2J4DA 5AUQA 5H9WA 3IEVA 3GFFA 3U7QA 1QR6A 3FB4A 1MEEA 3JALA 4O4HA 5A6SA 2HWUA 3FPHA 4O6VA 3RU2A 3AJAA 3LYHA 3R1IA 2ODQA 3OQPA 3ES9A 3T9DA 3MWDA 3U48A 3EQ7A 1ZO8A 4KQGA 5BN5B 4MJLA 1DRUA 4XUDA 4R9UC 5T4EA 3VZCA 2RI0A 1P62B 3K70D 1E58A 1GFSA 3SF8B 3WO0A 4YT4A 1KMQA 1U7WA 2XIJA 3KO8A 3RUIA 4AN4A 2JLVA 5JMTA 4ZAVA 2AL7A 1HLDA 2VDNB 1AJEA 1H1LB 4LYGA 5DH9A 1MRNA 3CURA 4O4IB 3WFZA 3ZCSA 5CFPA 3LVBA 2ZJ4A 3TO5A 1HETA 1ZGJA 4CT4B 1AO0A 5EIEA 3RVOA 1O1YA 4BAZA 2ZUCA 3O9ZA 4MRPA 1WX1A 4R0NA 4XRGA 3OZCA 5ALIA 2C7PA 1M2OB 4M1TA 3WYAA 2P11A 1V39A 4HEA1 3UAGA 5AVQA 2DPMA 3RUAA 5GVSA 4M1SA 3BRCA 4AMUA 1X7HA 1J70A 2Q28A 3HNRA 2G1KA 5DM70 5C0OE 3SYRA 4YT5A 4IG9A 4Z7JA 2O8BB 1MB9A 2HU8A 4Z49A 4CLXA 5JC1A 4C0BA 2OBFA 4F6RB 2WYOA 4MRMB 1IOWA 3STVA 3EASA 3O75A 2VAVA 1RZVA 1ZA2A 1FRQA 2DU8A 4GX5A 3SJBA 2OWDA 1WXGA 4BVLA 3CLUC 3QXHA 5ESWA 1BJKA 2WDPA 3ADCA 1W0KD 5MDHA 1GPDG 4DG8A 5LKRA 1A82A 2DBZA 3OC6A 1DKLA 3PA8A 2ZCJA 5E6UB 5JFGA 2EW8A 4PM4A 2WMYA 3FVWA 4DQKA 2WF8A 1JXMA 4WN3A 5F7XA 4XPIB 1MEOA 1VPEA 1M76A 4QO8A 5ADVA 1PNQA 3TOVA 2R4TA 1A5TA 3UBMA 4MR7A 2WWXA 4U2FA 1HMYA 1PIWA 3A1DA 3KU1A 4Y1GA 4YRJA 2RD2A 1Q1AA 1QE0A 2KJQA 2ZR0A 1NBIA 1P0FA 5E4TA 5K6RA 4IDQA 1SCAA 2XR1A 5EE9A 3HH8A 3ZIAA 5K01A 1GXSB 3IT1A 3WLHA 2EFYA 3RWBA 1GGEA 4DF3A 4C0WA 3PHLA 4JBIA 1AE1A 2A0WA 1BX1A 1LPPA 2X1MA 3BGIA 1J21A 3HU3A 3QV2A 3HO1A 4BEWA 4JJ6A 4NV3A 5DCYA 4LF9B 3AR8A 1TYAE 1CQJA 2ZIXB 3LXRA 3PGJA 3URMA 2VCHA 3TECE 5J23A 2YR0A 3KFVA 1MGPA 3MTBA 1W8DA 2YFKA 4V1CA 1V48A 3SJ7A 1U2EA 5ECYA 2WWIA 4ZV9A 3A4NA 1L4LA 5KYTA 3X2EA 3WRXA 4B3RB 1IN8A 1OZHA 3FI9A 1JVSA 3D0QA 3PNOA 3QX9A 3SLKA 1Y0BA 3B82A 2AE1A 3A27A 4QUGA 4MYDA 3G7UA 4ZVRA 5L7YA 2P6MA 4C43A 5CB0A 1LFAA 1Z5WA 3RABA 3ZZTA 2COKA 1M1YB 4M8IA 5HGJA 3DVQX 4RDXA 3KTAA 3KEGA 3T6KA 1NFFA 1GUAA 4OHKA 1X7DA 4D6PA 2H2GA 1YL6A 2C42A 4KIFA 1VBMA 3CJRA 4OMDA 2V7QD 1R6VA 3FZQA 4X24A 3QKRB 3BXOA 2D5IA 4HNSA 3WMFA 1YRYE 1A7KA 1SUDA 2WOOA 2XB4A 3RS7A 2XEDA 4TL7A 3BWDD 3MRTA 2X41A 4ZHQB 1QFMA 1DG3A 1J5XA 2Q3MA 1MQ8B 1FMCA 1JFFA 4HDKA 4MQBA 3TL6A 5DBGA 3CVVA 1PR0A 2ZRKA 3IUJA 3Q2OA 1JHDA 5AM2A 2D59A 2V1XA 1KR5A 1ZIOA 1T1IA 4MKZA 5HF5A 1GPJA 2IHYA 3ND8A 4MP3A 3G6KA 1O9HA 1ORIA 1WSDA 3HUUA 1W35A 2AZDA 2ICAA 3D6TB 3V6MA 3V1TC 2QQ5A 2JDID 2C9BA 4LY6A 5J4KA 1XZKA 4YXWA 3ZOKA 1R00A 5AXAA 4CQJA 5KYUB 1EK5A 2QPAA 4QUBA 1V45E 4JQCA 5DTIA 3QITA 1KVRA 2D0OB 2HCTA 2ZZNA 4BNDB 5D3QA 1SKYE 4MO9A 2W8BA 2YJ6A 3FJ1A 2DH5A 4QD3A 5EJ8A 1RYDA 5HUJA 3W5BA 4S1WA 3I5YA 3K15A 2WIGA 2FUCA 3S1SA 4RKYA 3B5JA 1Z0FA 1PJ8A 4CIYA 1KVTA 2B6HA 2FLKA 1FP4B 2GS9A 1U0JA 2XHEA 3F96A 1U9IC 5IUNC 2AOTA 3ROTA 4LXTA 1AXGA 1L8OA 2A86A 3ODGA 5IM4F 3A70A 5IFLA 2HA2A 3CWQA 3FWYA 1SWVA 4GR5A 1V3QE 2XVZA 1RC1A 3PGKA 1JIKA 2FE1A 2RBEA 3IP5A 4FWBA 4JT4A 4O1IA 3ZS8A 5KU7A 1PNVA 1ZKMA 1AUOA 2NTEA 4HDQB 4HO1X 3WJ1A 2ZRNA 6REQA 1M6EX 1R4MB 1ADYA 5LCXA 2IYFA 2PSJA 3HNPA 1B0ZA 4HB3A 4NF2A 3Q98A 2V7GA 1EM8B 1VHLA 1I5EA 3EWAA 4L22A 2I6SA 2Z4RA 3HDQA 2ZRIA 2JZNA 4JVSB 3O4JA 1F2VA 5E1BA 3IPCA 4I8IA 5B1EA 2BP7B 3B12A 4N3CA 4F85A 2ZJBA 3BZBA 1UKAA 1D8AA 1A8HA 4D3XA 5FOQA 1JJAA 1AUVA 3FD8A 3PUJA 3P2MA 5JNVA 1Z0ZA 1LWNA 2O2YA 3AEUA 1OX4B 4BNLA 4KIUA 5CXUA 3T9AA 4UXJA 2O8CB 1IATA 2VEDA 1OWLA 2V7TA 4GDFA 1TGVA 2D3TA 2HCFA 3C3BA 1P6XA 1ZVMA 1WL8A 1GNSA 2V3VA 3QOWA 1P0CA 1F38A 3IOEA 3NKVA 4US1R 3AF6A 4I5DA 3D6MA 1CFZA 4FDTA 3H86A 5A2QA 1JEQA 2B36A 4I5FA 4YPOA 3EDQA 4Q9LA 1E2BA 2APJA 2QL5A 4OXXA 2CMKA 3DMNA 2LXNA 3E0XA 3I2GA 2JBAB 1XE3A 3E2IA 4TMVA 1QG6A 3M8KA 2WD8A 5F7OA 5I01A 2ZSDA 1C1YA 1V7CA 4A0RA 1P5ZB 1BJRE 1JQ3A 4K6CA 4KAAA 3UVEA 4OLHA 4M1KA 1DC7A 1JHQA 4LJ4A 4BNUA 3CT4A 5E0KB 4YV0A 2Z2ZA 1Z4JA 2ZS8A 5AKXA 3WLKX 4INOA 3WIVA 2QTLA 4L76A 4BVJA 1Q3HA 1LLFA 3B20A 5LYJB 2C1ZA 1Q7RA 4G5RA 2XGJA 5ALVA 4KNWA 1G41A 3PEEA 4Y2SA 1TUEA 4V38A 3H84A 4PGFA 4JUBA 4IXNA 3BDIA 3GOHA 5LMCA 1X6VA 1CUAA 4HMQA 3SKVA 1UP6A 1AKTA 2O3SA 1BTOA 1RMYA 2ZDQA 5DTQA 1HY3A 4DZRA 2QN3A 4QUEA 4RIFA 3ZY5A 1GZVA 1GCIA 4H77A 1CVRA 1KMHA 4IGIA 3BORA 4Q1AA 1CPYA 2H5LA 3R3ZA 1DDIA 1NKTA 1H3NA 1IIRA 4XJVA 4P08A 2MYTA 1ECPA 3EVEA 3RC1A 4K2AA 4CM6A 1HQCA 4U7FA 5FOTA 1PEKE 3IMEA 3LK6A 1O95A 1BS1A 1X38A 4OH7A 4Z0PA 3LCRA 4FOPA 4GF5A 2YN4A 4YRZA 1I2AA 3CRZA 3KE9A 1ZN8A 3EXHC 2WTXA 3NKLA 1KJNA 4R1OA 4XH9B 5D6NA 5AM0A 4KAFA 1QDUA 2F9LA 1OTXA 3EODA 1QRDA 4J4BA 1XRQA 4LZWA 4TYQA 3VKWA 4CL8A 5B4UA 3GLHE 3SC6A 1L4KA 1P39A 2JCSA 3VHXB 5F5XA 1NBAA 1ACLA 4P80A 4NXMB 1G59A 2Z8ZA 2UZ4A 2FOXA 3NGMA 4G5GA 4PX9A 4URFA 2ZJZA 3O3OB 1OAKA 3WB9A 3N2GB 3WK6A 3OQ6A 5FULA 2BOVA 2WNHA 4NARA 5FBQB 1ML3A 2Z2XA 2PD3A 5FJIA 3WL3A 4C6HA 1K06A 2OOKA 1U4NA 4BN5A 3N2IA 1U8FO 3LC1O 1XN4A 2FY8A 4U8GA 3VC1A 5IKMA 2GK3A 2C3PA 1Z25A 1JFVA 1UT8A 1PYDA 3D7KA 1QBKC 3CE9A 3KDPA 1BKSB 1JUDA 3D6UA 3M6AA 4DJFC 3PKJA 2M6KA 5AVYA 3U4QB 3D0OA 1VFNA 2TMYA 2GCGA 1NIPA 1DIOB 1XZGA 1X80B 2ONKA 3DP9A 4RV9A 3VI4B 3GCZA 4BZPA 1F48A 1JZSA 2X4GA 1CT9A 5AT1A 2DF8A 4AECA 4RDCA 2Y2VA 1CFJA 2OP1A 3K35A 3SF0A 5B57C 3MAGA 3TR0A 4UCXA 4YN3A 3KOMA 1WMDA 3U7IA 2X40A 2YJTD 2AJTA 3ZWDA 1B23P 2JVKA 4I50F 2FP3A 2AZMA 2Z1NA 2HK9A 2CHFA 4R98A 4WY5A 1U7ZA 3SHOA 3RROA 5LQMA 1GV1A 3GJSA 3NW9A 4NU6A 4AWAA 2AHRA 3O26A 5FWNA 5K6AC 2PRZA 1GTMA 4TSKA 3I2IA 2R85A 1EDZA 3OZ7A 4URHA 5KJCA 5BWLA 3PX2A 3LYLA 3L6CA 1CHNA 2ZIEA 3P9RA 3EEYA 1HSOA 4JLNA 3FLAA 5JAQA 4AO6A 5CU7A 2C4TA 2WW8A 3KR0A 3BERA 1IK4A 4M1OA 4MS3B 4BKOA 3N0VA 3CG0A 1CTQA 1T26A 3MCTA 1YRBA 1P1CA 3NBFA 4QBFA 2R2AA 4TYMA 4DIFA 1ZXLA 5ECWA 5J2TB 3BILA 4PHGA 4R81A 1S2OA 3FLBA 4DIBA 3M70A 3NBYC 2AJLI 3AUXA 3FHOA 1CJUC 2FZCA 4LGCA 4AW9A 1CZKA 5ADWA 5F21A 3D8RA 3ZDRA 3DE0X 5KTSA 5CB4A 1X74A 4BBJA 1QHFA 4P86A 2WJHA 2LNDA 3DBOB 1MR3F 1ZVJA 2ZJ1A 1LF0A 3QRWA 4MMZB 1SOVA 1QLHA 1OXKB 3UF0A 3KKQA 1OWPA 3E9EA 2CK3A 1U9CA 5FOSA 1ENOA 2BRUA 2OAQ1 3C3YA 2AH5A 4TGLA 2AMVA 2I33A 2BH9A 1LQ2A 4LMBA 1N0UA 1PBNA 1JDNA 3ZZ1A 4AKHA 5KNCA 2O5RA 3LBAA 2ZUWA 4NBKA 3AZPA 4X63A 3C4QA 3PUIA 5TR9A 3GROA 1ZNZA 4I8XA 1ZBQA 3IAFA 3KZ1E 3QF4B 3TQTA 1YZTA 3GL9A 3FSGA 3BDVA 4LUCA 3UKDA 3I37X 2DXIA 3U5ZB 1WUJS 4H6PA 3WKDA 1WDWB 1UQUA 1AK2A 5LZ5A 3TTUA 1YA4A 1NBMD 2ZXEA 3WV5A 5EQDA 5A4DA 5EJ9A 4UFOA 3ZZNA 3EA5A 4FHZA 5FUBA 3SHTA 4XPZA 3ZN2A 1GUYA 2EJWA 3F9IA 3WGOA 3FTDA 5FIUA 4YAIA 4PRYA 1WOMA 2JJMA 1P2GA 2VHJA 1CNMA 4QXAA 4TQUS 2FR1A 5TMPA 3RU9A 3O8OB 4M88A 2RGUA 3GJXC 4TTJA 4CJXA 4OQZA 1BEZA 2OKGA 1KYYA 4J0GA 2A9PA 3J81k 4L4UA 4C0HA 3JVEA 4OAOA 4ALNA 1TB4A 4KU4A 2VDPB 1CDEA 1L7OA 1YS9A 2Z83A 1GITA 5CB8A 1QKIA 4D9MA 4I4NA 1OBCA 3JYOA 1MAWA 3C5EA 5K3EA 1QQAA 1OXSC 1SVOA 3TM4A 4QFMA 1U3GA 1TQHA 4JMPA 4UJ5A 2VWPA 3Q12A 4GI7A 5GJWC 5CFRA 2AG6A 1QG2A 1OFGA 4TX1A 1L0BA 4HLUA 3Q7QA 4JDPA 4V39A 5CA0F 2BEUB 1KY2A 1U7HA 4LTMA 4QOGA 1KYZA 2E4YA 1SU6A 3HCNA 3IALA 3L3BA 2PZLA 5IKEA 4NZZA 1PDVA 3AUAA 1G4AE 1KEEA 3C5CA 2ODBA 2DGDA 5THKA 3ZGOA 3Q3GE 3ZBQA 2C9DA 1U4SA 3EDCA 1YRWA 4WLVA 2JLUA 5E3IA 2C5EA 1VKNA 1ZGGA 3ADPA 2YJNA 2Z5VA 4MOWA 5E9QA 3U1VA 1KFEB 2B8JA 2JIDA 2XOKA 4GM1A 3JYNA 4TT3D 5DULA 4FYWA 1RM0A 5AVUA 5HS4A 2FTKE 4AN0A 1ISSA 4L9AA 5JASA 4ZJYA 4PLFA 3VR5A 1LRLA 2H2AA 4MUXA 5CLHA 1Z17A 2YXEA 5BWMA 1B1CA 1ORVA 1ZD5A 1WSBA 4C5CA 2C61A 4DHEA 1OBVA 4OL9A 1H2YA 1G8GA 1NTRA 4GIBA 1A8QA 3R6DA 1U9IA 2V0NA 1YKGA 2LTAA 1AXRA 2PWPA 4V0ME 5CGQB 3ZY4A 1K4YA 4X7MA 5BWCA 2FPMA 2HZ7A 4OGKA 3DOFA 3I6ZA 4EVIA 5C8ZA 2W48A 1TZBA 3QUTA 1NPTO 3L01A 3L7OA 3R3HA 4DWVA 1AQLA 3GG9A 4B3JA 3O8LA 1ZVQA 2NXCA 3D2AA 1GFZA 4OQDA 4DM3A 1NDQA 4WAUA 1A96A 2BDEA 4BFWA 4F2WA 1OLOA 4ZZ0A 4IF4A 4OAPA 2JZOA 2Q3HA 4INZA 4L4RA 3E6AA 4MWTA 4WASA 1R9JA 1RW4A 5FNVF 1SRQA 3JQBA 4ACAA 3T1NA 3ZTWA 2VSFA 4UQLA 2UVDA 1R18A 3PQ4A 4IJ6A 3EW9A 4PRLA 4Q4HB 4HTFB 1RHUA 4X5OA 1FFEA 1Z62A 2CDRA 5C4IA 2XF2A 2ETVA 2J0VA 2PSEA 2Q5FA 1K6JA 1Z38A 4LDPA 5EEHA 4PN7A 1NW5A 5IMBA 4PZUA 1W25A 2XJ4A 3TSZA 1NRIA 4Y0VA 4ZP1A 4I6JA 5COAA 1NVXQ 3ND9A 4DC0A 3SC3A 3KXLA 2XSZD 1J2YA 1PR4A 1TJ3A 2W00A 1PFYA 1JWLA 2BMFA 4GWGA 2GTPA 1SIOA 4L27A 1M8GA 3VAYA 1FSGA 4Q5IA 3LKZA 1VJTA 4AUNA 3JXEA 1G7RA 5AUNB 4UUBA 4WCFA 1ISFA 1LSOA 1N0WA 3MTAA 3Q5EA 1PR5A 5LJLA 2NZVG 1CF9A 3R5FA 1YIDA 2ZATA 3K6KA 4IIEA 4C6SA 1KOJA 1J8FA 1HDCA 2IOYA 3FDIA 3HY4A 3AHHA 3P71T 3QE0A 1DHRA 5HM8A 3L05A 3EPLA 1P17A 1OGYA 1VGVA 3FCYA 2XMDA 1KSHA 3BD9A 1QBGA 4ZI7A 2UYYA 5LA6A 4QVGA 2JD1A 3KTFA 4EEXA 4QZVA 4WFKA 2PMWB 1HT2E 2FPPB 1KORA 2O3UA 3BQ9A 4QUIA 4H3VA 5K0CA 2XTMA 1GCGA 3F5DA 4HNAA 4PV7A 2IWHA 4X94A 3IUSA 1P44A 3UNXA 3STUA 3OO1A 1JZQA 3PFNA 4BWFB 3ORYA 3S2YA 3LUPA 3EVDA 3LY9A 4WNCA 3UATA 1HEYA 3TQOA 4MP8A 2G6BA 1U3CA 1EYZA 1M10A 4FK8A 2FR0A 1NYRA 1XD8A 3AESB 5KPJA 1SOUA 2DWPA 2X0NA 2WIBA 1ZCAA 4H3KB 4DIOA 1N6PA 3EG5A 1I4TD 3BA6A 3QBDA 4ND7A 2O2IA 2Q4DA 1Y6FA 4WCVA 1J2EA 2HRQA 3HB7A 3KHKA 3RVRA 1YRAA 4KIJA 2GT1A 4OX9Y 5ARCA 4DIEA 4CIDA 3VPAA 1EWYA 3GGGA 1T5HX 4YUVA 1BQ3A 2G80A 3D3JA 1T1RA 1V16B 2G0NA 2ANCA 2HRBA 3ICVA 3U3MA 1FYFA 1WMAA 3M9XA 3DKIA 4GM4A 4KQ9A 1P33A 3ZHBA 5CEEA 3OOJA 4X61A 4BTLA 2AG0A 4FDMA 1GM5A 1F8FA 3RU7A 3VO2A 4LOKA 1BGXT 5ED0A 2X1VA 1WXXA 1J56A 5KQRA 4B0PA 4IVNA 4BMXA 3FPLA 3TEFA 1A5SB 1DBQA 2YVKA 2B30A 2FKNA 4EW6A 1QCDA 1QNLA 1Z6XA 3JWJA 3BMQB 1FVXA 4I9FA 3O6VA 1Q1EA 4BZXA 5BSTA 1DKRA 4HUQA 2D5BA 1ZH6A 3ABSB 5LNK1 3HN6A 1H4SA 2NV2B 4U7PB 1ZSNA 2Q6VA 3MTIA 1TZKA 4DDKA 3FPBA 4PO3X 3QNMA 3UJBA 4AICA 5M29A 2BUBA 2BFNA 2J3KA 4FMCF 3M9LA 2Q45A 5ESRA 1LLQA 3TCKA 3A3YA 5KU1A 5ITWA 4WA8A 4M1MA 4BWGA 2QX8A 2EIXA 2PX5A 2VJDA 4JSYA 4KK4A 2QLBA 5HDBB 5IYZA 2GEUA 1KDTA 2OCIA 3QYPA 4LV5B 4CW7A 2BONA 2F1IA 2XWBF 4OJNA 2XRFA 2QTHA 2HMUA 3IEIA 4O4JF 4X66B 4V03A 1PEAA 1JPUA 1JQAA 3KP1A 4M55A 2QE6A 1QOQB 1SZCA 3DYIA 5K4GA 3MOSA 4FR0A 4YMWA 2VQ3A 4M0EA 3DKPA 1DJLA 3ZWCA 3THWB 1VP3A 4O4LB 3OTWA 4JCCA 4DNOA 1XZAA 1XTPA 3MIZA 4FIDA 4URYR 3HHPA 3WK5A 1V5EA 1FDVA 3OEHD 2ZXFA 2EJTA 4BV9A 2HEGA 2VHYA 3P0EA 1N7IA 2ZRBA 2BKEA 4A0FA 3DLIA 3G1UA 3DV0A 3DBRB 1UZAA 4RANA 4R6XA 4YACA 2ZCVA 2ZTMA 1JW9B 3RIXA 4X20A 5HP4A 4LXHA 1K89A 2DQZA 4LJ7A 1GKUB 3UWPA 2XMBA 4FX2A 1Z73A 3QHPA 3GIWA 3LPCA 2G4VA 3CPHA 4GSKA 4HLNA 3MYRA 4RTOA 4DR6B 2PBLA 4KQMA 1A2KC 5K2MA 1QIJA 2QGZA 2VHEA 1EUCA 5CDYA 5I8WA 1K2VN 2BCJQ 5HBGA 3L6BA 3OUUA 1RXIA 2MSCB 5BQPA 2B25A 4OMUA 3QBEA 3L0PA 3NHYA 1QS0A 4XSGA 4MDFA 3BWXA 3MT7A 4QJ5A 4RF4A 3VNUA 3MTQA 3AETB 3WWOA 4GI5A 4KREA 1EB8A 1Z63A 2PGNA 4IKPA 3BJIC 1ESZA 2MINB 2BJWA 4Z9BA 1RTTA 1ODJA 4OI0A 1CIJA 1X92A 2G1UA 2I6QA 3EDRA 2IU3A 3MGBA 4ARUA 1PV4A 2O8DA 1OY1A 2OZLA 1R8QA 5J2UF 1YV9A 2PL3A 1N5DA 2GHIA 2YN0A 5FLEX 3SFTA 2PLRA 2IZ1A 3I76A 2Y67A 4ER3A 4P0PB 2Y4OA 2Y3IA 4WK6A 4YAJA 1EJBA 5FI3A 5EINA 4OQMA 3TNDA 4B6GA 3KQYA 2C4VA 3OOEA 4WX2B 4L57A 5J5CA 2XYRA 2EYQA 1IULA 1MIOA 1NKVA 1UM9B 1YZVA 2LDBA 2HA3A 4MUYA 2GN9A 2VRNA 2VG8A 5DIZA 2IHJA 2VPIA 2QD3A 4NFSA 1EP3B 2SICE 3Q3IA 5EGSA 2Y1CA 3MD9A 2HXYA 4WFIA 2QUKA 3GJZA 2A1UA 5DX8A 2G5PA 2NP6A 1GRNA 1EVLA 4G84A 3QJGA 3R5HA 1FXWA 4NCJA 5CIQA 2CLHB 4N6OA 2OZKA 4HGNA 1EBBA 3FLEA 4JLPA 5J63A 1CUXA 1EWKA 3UAZA 4A27A 1XR3A 4LSZA 5H8WA 2BGKA 1EAYA 1XVAA 3PXUA 4NJMA 4WPGA 3NMUF 5LJIA 1GARA 1NUUA 2DJIA 2ZU0C 3O4RA 4F3CA 4GI3A 4JLMA 1W1IA 4HTAA 2AFRA 3FNBA 3L41A 3N2KB 2O3RA 2RGAA 4F5YA 1Z35A 3AM4A 3KOXA 5CFOA 4I99A 4XGIA 2ZUFA 4KGXA 4P82A 3TMKA 3ZE6A 2D7DA 2WKRA 2R7KA 2IW1A 1NHWA 4ZVNA 3GPLA 3A2KA 4ZTBA 3I58A 3KALA 1NNI1 1TM4E 2GHRA 2JL1A 5M3BA 1N9GA 4XWKA 5L4SA 5AP9A 4BJ6A 1V8FA 1VSQA 3VH1A 1QO9A 3SYMA 3FMFA 3ISJA 4URWR 3UAVA 4YMHA 3JQGA 1MB0A 3NWJA 4ETNA 2R7NA 3ZH2A 1PJZA 2HNAA 1E2PA 4EW2A 4RPJA 2FPRA 3X2FA 1E9FA 3QH4A 4UNNA 3SDBA 5B7GA 4QUHA 4WWHA 1J8VA 2MYNA 4BPRA 3E84A 4MITA 4LC1A 3OQ1A 4A16A 1MVNA 4NAVA 4ENRA 2RHRA 4I1YA 5JSQA 2D2XA 1E1YA 2LP4Y 4TLDA 3GH1A 3ZR4B 1CR2A 3AW8A 2I0FA 2LVBA 2XUOA 2Q27A 3NASA 4CE6A 3NUQA 2WF9A 5AW2A 1BN6A 4UBJA 1PGQA 3OCYA 4Z86A 5KKCA 4DKJA 3VPBA 5BN5A 2B4QA 4FBLA 4UTRA 2X0JA 3AF3A 2JJ2A 4ODIA 3V1YA 1XAHA 2PU5A 4QTZA 4HPXB 1MHPA 1QH9A 2XUDA 3SF8A 3RTAA 4FB4A 3LRXA 4AAYA 4RHXA 1C8LA 2HJRA 4OQPA 5ALJA 5AKLA 1F8GA 5BMVB 1ZINA 1H1LA 4O4IA 1GADO 4MAFA 4YEDA 1PHPA 3A6ZA 1PV2A 4KFRA 3HYSA 4TMFA 4LRWA 1HKHA 1I5RA 2PGAA 2WPDD 3BF8A 2BEWB 4XQCA 3N2ZB 3CUKA 2EATA 1THGA 3QHQA 1K8RA 4TWBA 2VDQB 4OL0A 4ZV4A 3HCDA 2VHWA 2PT6A 1M2OA 1SRRA 3H8VA 5LNK6 5JMWA 1T9ZA 1XQ1A 3IBTA 4FYHA 4D79A 1C50A 1DKQA 2BD0A 3QOFA 2XUKA 3AI7A 1T6XA 4I8DA 4X60A 2XVAA 4ZXFA 2Y9MB 2R6ZA 4LZLA 4FZ3A 2EYUA 2O8BA 5IDXA 1O8CA 2VQSA 2P0AA 3HUDA 4F6RA 1G8AA 3ZEIA 1E2QA 4MRMA 5EJ7A 3HFRA 3K09A 3RLIA 1EESA 2NOAA 4MQFB 1UK8A 4KR0A 4WD3A 3W0LB 1RKQA 3NYIA 4RSMA 3I6QA 2WBLC 2IPAB 3Q88A 4UE6A 1E20A 3E2PA 4E46A 1GV0A 1KI3A 1V0JA 4UHDA 2QW0X 4KHPB 4IIGA 2XCLA 2FEKA 3KWLA 4J6FA 2PT7A 4IQGA 4PU0A 5E6UA 1E9VA 1W5TA 3WDLA 3GFVA 4P5EA 3ZUGA 5BP7A 1E3IA 1GTRA 1U1FA 2DR3A 4RFSB 3C1UA 2PJUA 4XPIA 1L3BA 2B5WA 1ETHA 2C98A 3FOFC 2ZAIA 2IHZA 3HG7A 1RD4A 1R6TA 3EIQA 4TS4A 1PGNA 2I4RA 2BDUA 1JQBA 1DBSA 3HKCB 4XQGA 3RUHA 1AUXA 4DSZA 4UU8A 1HLFA 1WXFA 2O0MA 1XVUA 3DOHA 3EF3A 4P84A 1GXSA 2HA4A 1NSTA 2Z2JA 3V4FA 2OHHA 1I13A 2I9PA 3H5NA 3CMMA 4P83A 1FS5A 3QU4A 4ZRMA 4IX1A 5ICCA 1E7WA 1X39A 2DH6A 2EZ4A 2WSBA 1UJCA 5A4AA 4G3XA 4DSUA 4JV5B 1HKUA 2PKCA 4EG5A 2NXEA 3RC7A 1FP7A 4C1BA 4YP5A 4ARCA 3GFOA 4B7CA 2H07A 1ZA1A 2QDXA 4ZAXA 4OO3A 1QX3A 2VRWA 4HLDA 3ZXUB 4BGUA 1N5KA 3GP5A 4JASB 3FZNA 2QXUA 2DY1A 2QGNA 4Q9AA 3ZWYA 1WXDA 3HUFA 2OQ2A 4XKJA 4ILEA 2WI8A 4RKEA 4A0HA 4OHCA 3K9CA 1AHPA 1LZKA 4Y2RA 5FWAA 1CP2A 4NPAA 1M1YA 4ALJA 5HF9A 4C0XA 1O4VA 2NZJA 3G8BA 4ZVVA 3VJMA 4S1OA 4TTPA 2C5LA 1DAEA 4L50A 1G8HA 3SSAA 2Y1WA 4A2WA 2OBXA 3CKKA 1GUFA 3W90A 4IWNA 2MIIA 3D9QX 4MI1A 3WB1A 3R9WA 1IM2A 3CEHA 1QCYA 1X1TA 3D3KA 4NONA 5F2OA 3WYFA 1IZ7A 3QKRA 1QIHA 3UIEA 1K7CA 4IQ4A 4XLTA 3SJAA 1T6BY 4P93A 4RHFA 3LBIA 4MB2A 3OC0A 2F3UA 4GC5A 3G5AA 1JAZA 1RYEA 1CUYA 1ONPA 1U3TA 2AJ8A 2RKWA 1PK7A 4IMRA 3VMMA 2P4HX 4BLOA 4HSGA 3D6HA 4G8BA 3NJ4A 4PHHA 1C1DB 1H0HA 1TZMA 1YNSA 3RJ9A 3DEKA 3I28A 3UENA 3WZ2A 5LOVB 1EX9A 3EVZA 2CXUA 3N0XA 3V8BA 1VCIA 4IR7A 3H18A 3ZGYA 4YUAA 4G0OA 5KHOC 5TS3A 4DRXB 1M5UA 2CD7A 5DV9A 2I66A 4Y0NA 5KYUA 4OM7A 5LIRA 2DSNA 2QJRA 2XIQA 3PFBA 3TJMA 1AGRA 2VJLA 3PQ2A 4BNDA 3OPYI 1ECFA 1PTJC 1JXQA 1WXHA 5EHQA 4YR7A 1C3VA 4H18A 3QVTA 4IDAA 2W6CX 3E27A 3KLOA 3ZDYB 1SQ0A 2IZOA 4CKWB 1A88A 5CBPB 2EFGA 1UAAA 3RBVA 1GG8A 4RJLA 3BM5A 3K0HA 3M6MD 3DCIA 1RJ9B 1FP4A 3MJTA 1UXGA 4G86A 1E5XA 1UDXA 4QPZA 3TPCA 1UIRA 4TZTA 2NVBA 5CRIA 2G63A 4Y8VA 4IUCS 4C4ZA 4JEHA 4ZQHA 2VPXA 4EHBA 4KDEA 2PJRA 2JCBA 1YFJA 4BWYA 4J7CA 7GPBA 1MB4A 1R4MA 3HYNA 2NUTA 3U4HA 4D9CA 1XRMA 1EM8A 1ZD1A 3ZCRA 4YONB 4WLEA 4KPYA 1ZW1A 3P1JA 1WCYA 4TYWA 3DAOA 4FUTA 1UMDB 3OCCA 4OBEA 1YWGO 4NMXB 4R8VA 4E22A 2BP7A 3E7FA 1BC5A 4A8HA 2ZSUA 1K9SA 2QSYA 4RVSA 4F92B 4HHEA 1CDZA 4AS2A 2GMWA 3PEFA 1VGRA 1CUJA 3DL2A 1OX4A 2FUKA 2C0CA 3HC7A 4YRDA 5EFZA 4ZQIA 2ONJA 3ZQ6A 2W2XA 2O8CA 1AH2A 4QU9A 1ZLXA 2YNMD 1IEQA 1NVTA 3BBPA 3NZEA 3FKSA 4QICA 3FPSA 5CX4A 4KITB 2PKRA 4BASA 4RVOA 2RCYA 1D1SA 1D7AA 2VJCA 2W2VA 3WZLA 1Y98A 2YY6A 5JNTA 4KQHA 1YRHA 1TX4B 4LZPA 3SSMA 3KSAC 2R44A 4UCQA 1K8QA 1ZD4A 3IQWA 2I4TA 4J4TA 1NW6A 1K4KA 5AK4A 5FPQA 5U9CA 1RQ7A 4JDUA 3NOQA 2A1TR 3TOCA 3F7MA 4B87A 1E1MA 4F9FA 1M73E 3SN6A 3LH5A 3V9PA 4BLQA 2JLYA 4WZ6A 1W36B 2GYYA 3NYRA 1GUBA 4K1XA 1WW8A 3SPXA 3SQMA 2EW2A 1GGJA 2GZAA 4WADA 3RS8A 1M5TA 1MUUA 1QQTA 4KSBA 4KC0A 4X8OA 1JHVA 1SA0B 3ASYA 1BCSB 3U7RA 1OMOA 3OKCA 5LYJA 4ASUA 1SBHA 5U4XA 6GPBA 1I2ZA 4WJLA 3SC4A 5HDQA 5K3OA 2HO5A 1MOPA 4UZFA 3AM1A 2OV8A 1L5YA 4EZEA 3L7JA 2FXIA 3EW7A 2YV4A 1ND5A 4XDYA 3MCAA 4XQ0A 1J6UA 3TBFA 3H9EO 3Q87B 2A4MA 4KH0A 3RVDA 2WU8A 2EKZA 4I9UA 4CI0B 1OROA 2HLNA 2I2XB 4JVNA 4PG7A 4Q12A 1AZWA 5COBA 4UNPA 5CEFA 1K7XB 3ROFA 2DWOA 4MJ3A 1FNBA 2CCGA 1WNFA 2F17A 4F4CA 3ZPXA 3H4MA 3B1XA 5KVVA 4WFQA 2Q6KA 4KFSA 4Y6RA 1TAHA 1UK7A 3II6X 4RE5A 3NHZA 4IDGA 2Q21A 4BAGA 2HYDA 2CEAA 1SUEA 3T3HA 3U80A 5A0FA 4IHJF 3A06A 5ERGB 3AOEC 2GF2A 4IV8A 3KAQA 3UO8B 4F9TA 2GZ3A 5K0NA 2QVXX 2WWRA 2KI5A 3WK8A 2POCA 3VHXA 1EGVB 3F8TA 4C4TA 3AEQB 3MWGA 4MXDA 3DFUA 1Y6RA 3N8GA 3C8HA 4M49A 3PRHA 1XI2A 3N2GA 3R6TA 4IF6A 1E3DA 3BHJA 2GXUA 4GR9A 4IH4A 5BRAA 5K0TA 1FNDA 3HXOA 1KAOA 3HN7A 4JGBA 3I5AA 2PAFA 3DOCA 2NO6A 3R6WA 4OI4A 1D07A 5MN4A 2JF0A 5JO0A 4XDHA 2BKUA 4FFDA 4I2VA 3I3OA 3QEAZ 1X80A 4DLAA 3LW8A 5C51B 2FWIA 2FXVA 4PZPA 3RK1A 5A04A 2V58A 3FSEA 2X23A 5FBWB 4CTOA 1QGUB 2CJWB 1F0KA 1I3LA 1ECGA 1KHTA 1T2CA 4NAHA 1N8NA 4QSMA 1PTKA 1AXEA 2AOVA 2ZRDA 1PJRA 1GEGA 2ZUSA 4KIWA 1R50A 1OQAA 1DTWB 3HDHA 2CL6X 4K0KB 4GLLA 4RY0A 5AKEA 2H2DA 3I12A 3PQEA 3QENA 4U3JB 3V7NA 1EVEA 2OHXA 3T5GA 1YDFA 1NXSA 1O9GA 1YOVB 3I5MA 4W1QA 4M4SA 4OK6A 5KCMA 2OCAA 1FPMA 3R0VA 3RS2A 1KQOA 3U7FB 3UPTA 1NBMA 1SM4A 2BZSA 3O90A 3ORSA 4GKBA 3OJLA 2P7IA 4MS3A 5DBFA 3P8ZA 1ZOIA 2X5KO 4AROA 1FRNA 2FSIA 4ZZIA 4UD6A 5J2TA 2Z3ZA 1D4ZA 1QZXA 2ZRMA 3G9XA 3KHUA 4Q7KA 3SI7A 2BCGY 2Z3VA 4MGKR 4XVRA 5FLXA 4RTQA 1VHQA 1JVNA 3W7VA 3SVLA 2ZE8A 3P5SA 2B99A 4OP1A 4CCYB 1VYUA 4OM8A 1KO8A 4QRIA 2ZREA 4JJGA 4V3BA 2MCFA 4D5EA 1P45A 5CYFA 1XHEA 1L5VA 1FB5A 1ZJWA 1FFSA 3IFSA 5K3DA 3L8CA 3ZCVA 3RAPR 3LE8A 1LLCA 3A1EA 2OSBA 3QVXA 4HB4A 5E38A 3EUWA 3CVJA 2OC9A 5BQXA 3GYGA 4IIJA 1JS1X 3MGGA 3IEUA 4FFVA 5FQNA 4A82A 3H6GA 3EEBA 3QYJA 3GJ3A 4MVJI 5B55A 5HXAA 5IMSA 1PUXA 5CXXA 2FX2A 3K0FB 1Y3DE 3H2JA 2FW1A 2BFWA 3HA3A 4P3OA 4TSRA 1UP7A 2EGUA 2QB5A 5JRZA 4DV0B 5KEIA 2HF9A 2IS2A 2D5LA 4M60A 5JH7B 1YR7A 1SQGA 1RM4A 2Z5GA 4KXNA 5IBPA 5LKAA 5JE8A 1HOTA 4GX1A 4IJWA 4CRWB 3UOGA 2X0KA 4G2TA 4BIIA 1S2NA 2GZ1A 3GH3A 3OU7A 2RSLA 2V6BA 3MWLA 3ICWA 4HNVA 5HZKA 4UEJA 2CW5A 3HWSA 4WXYB 3SLGA 3QFHA 1H94A 1GZSA 2AG5A 5BYAA 5HRCA 3BEOA 5BSGA 1KJQA 4EHFA 2V7WA 3FDJA 4AS3A 1ECJA 3NEJA 4KLZA 4WZAE 3O8OA 1OHHD 2FSHA 3E23A 1FDSA 1U02A 2OFXA 3L5KA 4WMLA 1H4QA 3PJGA 3RUEA 2JGJA 3W6ZA 3X1YA 3F6PA 4QO7A 2QP9X 3PP8A 4BP3A 4OBBA 2HQOA 4S2EA 1JYFA 4LV6A 1KH2A 1BDHA 3I2FA 1FRZA 1NULA 2RH8A 3BQMB 4HAUA 1IHXA 4LJKA 3RIHA 3V80A 3GLIE 1Q7GA 2AB0A 4M0PA 3Q6IA 3QVGB 5E3JA 1VKHA 1EK0A 2FJUA 4HAYA 4M0KA 4NG4A 5AKKA 2JKYA 5E1MA 3M6VA 4BGIA 4B6OA 2BEUA 3H0CA 4MQ4A 4MTCA 4RY9A 5H3LA 4AJIA 2EGHA 1KVQA 4IHQA 4QGHA 1IG3A 3KXDA 3AU9A 3LSTA 1VHJA 3H6HA 3M5PA 1DLIA 3R7SA 1U0OC 5I45A 2R8YA 2IL1A 4LC0A 3O8CA 1C7FA 1Y3BE 4ZXPA 2OLKA 3PDUA 2GEDA 4BJ5A 5LQUA 4DJJA 3WOHA 1Q14A 1PWZA 2IV3A 3R5KA 1U0FA 1N0VC 3BQNB 3DDHA 4N40A 4XLLA 3R20A 1ZAYA 1M1NB 2XSZA 2YCLA 3F5MA 1XMOB 3LRPA 1S7CA 1KBZA 4Z4HA 5ERYA 3F90A 3GZ4A 2UUBB 1D4OA 5JBQA 4RDHA 2W98A 2NUPB 4EECA 1OAOC 1V8OA 2YVLA 3R2JA 4NY1A 4WKBA 3HLTA 5KNBD 1YJ8A 1CDOA 2AJDA 2XDAA 2X1LA 2A3RA 1FUYB 3B9PA 3TLAA 3M1YA 2RGXA 2XZPA 4O5AA 2GETA 2GF9A 3WHIA 5DNWA 2ZJ5A 2XBMA 3JWGA 1MJGM 1ESNA 4IKEA 3LWDA 4BQOA 2AZ4A 1IQRA 1VLMA 2F1HA 3R0QA 4QAQA 2VCEA 4L72A 3GRAA 4OGWA 5EAIA 4EG6A 2VUIB 1YI1A 3D3QA 4EPYA 2QMZA 1PT9A 2C7RA 3HO8A 4Q6BA 4UNQA 2ZB2A 1IVSA 2WHPB 2C9MA 1XVIA 2YDXA 1QHGA 3LYAA 5DXJA 2B4TO 1OIWA 1XNHA 2XWJI 2JASA 1N3BA 1B74A 4GSYA 4WKCA 5JD5A 1B8PA 3CFYA 4Q4HA 3AB8A 3EDYA 4Z3OA 3OI7A 3CNOA 4L08A 3WQRA 3LL7A 5AM4A 3ZLVA 4OJYA 4E4TA 1UPAA 1FPQA 2BI4A 1L7RA 1MJ5A 3UKJA 1O77A 2JH9A 3BFKA 3GP3A 4D97A 4ZGWA 1V4BA 1AS3A 4C5AA 1QPBA 2GOYA 5JYCA 2FZ5A 3DBLB 3G88A 2ZBFA 4P4TA 2L82A 1P9LA 3EGCA 3BT7A 1Z6ZA 2XCOA 3I32A 2FFHA 2Q4BA 8ADHA 1R9NA 1ESDA 3USES 4D25A 2AX4A 3IUPA 4GEKA 2R48A 4Y9UA 3AYXB 4IILA 4UM7A 5B64A 1T9GS 1GPH1 1HYQA 4BLVA 4EUSA 1JIJA 1JMKC 1ZVKA 4JKOA 1HO3A 2J0UB 1JIVA 3Q1LA 2GN0A 5T7BA 1TPZA 4EA9A 3DXXA 1SCKA 2ANBA 2AJCA 2CUTA 1S2GA 1K27A 1NVBA 2HT6A 1IFXA 2PBZA 3FGZA 4FBMA 4H1VA 4PHCA 3ZBPA 1T0JB 4LA4A 3CRMA 4MGYR 5CT8A 3P9NA 4FR5A 3ZU5A 5CXQA 4LF6B 1MA0A 1LB1B 3FUXA 2WRZA 2FPPA 2VIIA 1JE0A 3O1IC 4TXHA 3HU5A 4AKTA 2O07A 3I6MA 3KR9A 5TPWB 1KZ1A 5KTNA 4M8SA 4REOA 3RB8A 3KDSE 5LP1A 2RHOA 1CW2B 5ALQA 1QPZA 4JC8A 1U0EA 2XB2A 1G66A 2ZSIA 3EX7C 1JLMA 2NZ2A 4MARA 2W9XA 2J6IA 3AESA 4BE4A 4OD0A 4XWAA 1MO4A 4BAUA 1B4DA 1VKZA 4PSVA 3WQQA 3G0HA 2ZULA 4ND4A 3CF2A 2C58A 4LS3A 2IWRA 1MCZA 4FMBB 2R60A 3BL6A 4JYCA 2YS7A 3A1NA 1GQOA 3CNNA 3B85A 1EUYA 5IEBA 1Y1TA 4LW8A 4RK0A 1LGYA 1RXSA 2G07A 2VHVA 3ASVA 2DSTA 4XM1A 5BSKA 1E5DA 2PSHA 4PC2A 4IXWA 5C5CA 4QBHA 1V3TA 1U0RA 1C9JA 1V16A 3RV3A 4RLHA 1JSZA 1D5CA 1G19A 3H87A 4TMTA 3TK1A 3UHOA 4KDFA 1E3WB 3EZ7A 1RAAA 3REQB 3V32A 2VDUE 1QGYA 4B44A 1XCPA 5CG2A 2FZVA 5DYYA 2VAMA 2DFKB 3M1IA 3MG9A 1LPAB 4FFOA 4KXQA 4U5XA 1X7GA 4REQB 5D01A 5DOVA 4IDOA 1NP6A 4QFDA 1VYTA 1SU8A 3AF5A 3OEHA 3BMQA 2C5FA 3D5EA 1XPRA 3BMCB 3E8XA 3ZHCA 4TVKA 1AN9A 1E96A 1T34A 1JH9A 5K0BA 1PSZA 1AT1A 1ORRA 2PL9A 4NYJR 5KJEA 1QU3A 3DV2A 3PD7A 1B2LA 5G2OA 3FFWA 3G9QA 4FYXA 3BWMA 4C2AA 4DJEC 4HRXA 3BIFA 2O4UX 4RCYA 3L82B 1WEKA 3TKYA 4EJSB 1AC5A 3PNYA 3Q7EA 4M1QA 3QQPA 3RJ5A 2JLXA 2BE7A 1RWMA 2COEA 4ON9A 1EP2B 1KS9A 1U8YA 2OE2A 3G6WA 1I24A 1RLUA 2AEJA 1A9YA 3AGQA 3DXFA 4WXEA 5DHPA 1Y4SA 1GD1O 1E6LA 1NQWA 2WLTA 3G0CA 3MUNA 2BBTA 4YMVA 5EQFA 4AUEA 2JI9A 1MC1A 3OOYA 4BDTA 3BD7A 1A4UA 2VJBA 3VR2D 3BWYA 4ZQGA 3F9CA 1W4BA 3ACBA 3PSAA 5FTMA 4E07A 4L5IA 3GA0A 1HQDA 4ML3A 5ALDA 1TF7A 5ADHA 3EEQA 1Y1SA 2ZETA 3M4ZA 3GEHA 1G38A 4S3MA 2JIZD 4FC7A 3KG2A 4HXEB 4JBXA 3DR5A 2C9ZA 3NRCA 4GEGA 3HYLA 2VUSA 2GRUA 2VXYA 4R2HA 1E9SA 3MQ4A 1Y8AA 3U3RA 3ZK7A 4D43A 5A4IS 2WF6A 4TYNA 3E9QA 4LG1A 4EKIA 1E98A 3I30X 3RFFA 1ZNXA 1EX6A 4O4LA 2W43A 3LDHA 4Q47A 2YVAA 3Q11A 2FK7A 5TXGA 3ETJA 4GU5A 4IVPA 1CLEA 4LMAA 3ND7A 3SG0A 1GU1A 1H6AA 3GFBA 4DSNA 3LT2A 5FA8A 1DAFA 2J08A 2EIHA 4U02A 3QBTA 4J1TC 3FOAA 1TOAA 4L4YA 3MK31 5JNRA 1WV0A 3AR4A 4UUMA 3DBRA 2E1RA 4EB8A 1WVIA 2R6FA 1F8XA 1Z88A 4PY2A 3CXUA 5L4LA 1FY2A 5EMJA 1VJDA 1I5OA 1BD3A 2GN8A 1JA1A 4GPBA 1UPFA 1ZM4A 4HMOA 4UC0A 4CHTA 4LXQA 2PUJA 2DC1A 3RRZA 4V1CI 221PA 3RGWS 1ZG3A 3HS3A 1DS6A 3O9MA 4OTZA 3T35A 4QT4A 3GEDA 1HDRA 1NW7A 5HKLA 1A9OA 2IZ5A 3B6JA 4QTYA 1ZPDA 4KXFB 4NBRA 4YFYA 3AETA 5I3ZA 1VZ3A 4TMWA 4UBOA 1VMAA 4Z7OB 1Z8HA 1F2TB 1TQ2A 2OT3B 1BDJA 3C7TA 2MINA 1VKJA 1WU8A 5E7JA 3OJOA 1Q95A 3ZLTA 1S3FA 3L5OA 4KWIA 4M87A 4B45A 5AQ1A 5BPHA 2IV7A 2C03A 3B6EA 3ZDXB 4IS3A 5JW6A 2PUWA 4QGBA 4TMZA 4YCBA 4II2A 3P9CA 2FEPA 4FCWA 3ZI4A 4YO8A 5C52B 4X54A 2GFIA 4H0FA 1SIUA 2JW5A 3ML1A 5EJAA 1SVNA 1QPGA 1U6IA 1BIFA 5FOXA 2YW2A 1YK0A 1ZNQO 1KO5A 3AY0A 4G8CA 5JNWA 1RCFA 1V7QA 1UM9A 2DQ4A 1VJRA 2X8WA 3D7NA 4MKRA 4ND6A 4O8ZA 4ZRDA 1RXYA 5DX0A 3RSHA 2I1VB 4CKBB 2JLCA 5KIAA 2ZRPA 3GOQA 3NBKA 4JQYA 2ERYA 2Y6UA 3CC8A 1EU1A 3D8NA 1R3DA 1HI9A 5AH0A 4MUNA 4AJ4A 4B48A 2QY9A 3PFGA 3EY9A 3ZDFA 4QJIA 3PNBA 3GAAA 3BKWA 3MWJA 3FMOB 3LHKA 1P4HA 3VAAA 2WIFA 5DBHX 3HR7A 2A94A 3MD0A 2BWJA 1ZP6A 1X9IA 2P30A 3K16A 2PUHA 2BV3A 2R8XA 3PDJA 5IKPA 1LV8A 1RXVA 2R6GA 2FDRA 3JPWA 2JHFA 3CEMA 2R6CA 1BW9B 3PHCA 3UM9A 3N2KA 2B69A 3MINB 2X2OA 3IA7A 1Q0QA 4UHEA 5I7VA 3VPCA 2I80A 4QECA 1RHMA 4Y2UA 4ALIA 2FMHA 2OHVA 1JIIA 2VZ9A 4EGFA 4WLUA 5HIAA 3WAGA 4LYYA 3E9RA 2JFHA 3VPSA 2Z98A 4MV8A 2VKTA 4RESA 1DFIA 2NTJA 3TRIA 1EUDB 1KY4A 2IHKA 5EIOA 1P0IA 1DAGA 1K7FB 4FHCA 3EG9B 1NBWB 5GMOA 1V11B 2REOA 4J0JA 4P4UA 2E48A 4CDMA 3K53A 4NTZA 2D74A 1X1EA 1XYVA 2V0CA 3C39A 3Q7IA 4YV2A 4LQLA 4I50B 1FZTA 4HWPA 3NHBA 4K9MA 3HR8A 4YFVA 3AY6A 1MV5A 4LHXA 5LQJA 2Q1TA 3I2HA 2H4YA 1O7JA 2J5BA 2NU6B 3HBFA 1KU0A 2BY4A 5DF1A 3RAGA 4RJ2A 1M74A 4JMLA 3KLBA 4MV9A 1OYVA 2E4UA 3EZNA 3DL4A 3GNTA 4S12A 5GGYA 4A3SA 2VJQA 5JEDA 3CZ9A 1XOIA 4YRLA 1YRQA 1ISJA 2G1JA 1A2OA 1NY6A 1VE7A 3NUZA 1UBUS 5DGHA 2PSDA 2D0DA 1FLVA 5EHXA 1WB9A 5H82A 3WAJA 4D6XA 3LCMA 1NMEA 4UBKA 5JATA 2HLDA 4DUPA 3I6IA 2BFOA 3ZU6A 3T7AA 3TD6A 4Z7QB 2BW0A 1Q0TA 3D6NB 4E2ZA 2BGUA 2OO5A 2W2MA 4F3YA 4I9GA 5ED4A 4RGVA 3F1LA 1GPNA 2BEWA 2C0QA 1U2DA 1KVUA 3CW2A 3IUYA 5DFAA 4NEHB 4FJ0A 2DULA 4NU0A 5E4YA 5KYGA 2ODTX 1UBHS 3KOZA 3P2YA 4P3NA 4W5OA 4BFLA 1GL7A 4QJBA 4TWIA 1WPGA 2K5UA 4ERXA 1H1DA 2XGOA 3VMFA 2UYQA 3NRBA 3AVYA 1N25A 2ATVA 4NOMA 1QZUA 1YBVA 1YH3A 4UTOA 4DV2B 1NVKA 3KDAA 4F46A 2Z43A 2W90A 3ZG6A 2DP4E 2XAUA 2IU6A 4MQFA 2CLSA 3R7WB 2IXDA 5IZ4A 3G8CA 4YRMA 2WIKA 4X6XA 3CZ5A 4TKVB 4G63A 5TF0A 1L5GB 3SS7X 4C76A 5TMDA 1TADA 4ZYTA 5KTYA 4AJ9A 1LX6A 2DWQA 3VI3B 2DHCA 3H11B 4PZEA 3FVRA 3MMXA 1TYDE 5SY6A 2OVFA 3T06B 2JFBA 1P6UA 3F3SA 4GOLD 4PLVA 4RFSA 4E6PA 4EI2A 1WMSA 2VNHA 4KI7A 4XGQA 2RARA 1STOA 3O1HB 3KKMA 2PU7A 2QE7D 2PFKA 3RYFB 5BQ3A 3QBVA 1RRMA 3AFIA 3KHTA 4WTOA 3O8RA 1UFQA 1H5QA 2YQ4A 3KWMA 4JITA 3UTCA 4CMGA 3HKCA 5KNDD 5HIIA 3G13A 4GZ3A 3LHFA 2O4CA 1QF9A 2ORVA 2P8SA 4BQEA 3L4KA 5SZJA 3PDIB 1A9XB 2JHPA 3OPMA 1Z12A 2IU4A 3T7TA 1F14A 4IVRA 1TM3E 2TRSB 3TRJA 1RWBA 1XKXA 2E87A 3O2JA 1DIAA 4QEKA 4GP7A 3RUDA 3TX2A 3ZHQA 5CA0B 1PS8A 3ZGXA 4BMDA 4DARA 2H1SA 1W9HA 5EXDA 3VVCA 3GCXA 3V4RA 1G9XA 3NAZA 5CH3A 2RONA 2XQIA 3L4BC 1E1NA 4MPRA 1P5FA 4DJ5X 4XQ9A 5DGTA 5ALGA 1IM8A 1FC0A 3MWFA 1YZNA 1BHQ1 1UADA 2GEBA 4Q18A 1N2HA 2OXCA 3NPAA 4P5PA 5AVKA 5GQSA 5KTPA 2DFPA 4Y9RA 3AFHA 4CKXA 2A33A 3GJ5A 3JYPA 1GGKA 3EH1A 4RTPA 2HWKA 5IJAA 2RK6A 4ZT5A 1CUSA 1GILA 5C7IO 3I5UA 1C41A 4Y1EA 3CO0S 5EHGA 2FRVA 1VG9B 2IIBA 3BXZA 3TXXA 1Y9AA 3QM1A 3EGIA 1RP1A 4RMHA 4ZKDA 1JN0A 3M6WA 1R0CA 3GUHA 3ER8A 1J2UA 4N6GA 2BZ0A 4Z4IA 5DLEA 2G8NA 4EP1A 3BCRA 2R47A 3EQ9A 3MXTA 2O52A 1A98A 2AWNA 2H7CA 3JU3A 1ZXBA 2BR5A 2OWEA 2X6TA 1H2ZA 3QWIA 2AHOA 1QYIA 2F43B 1UUFA 2EFDB 2WHYA 3OU2A 4FNAA 2QTRA 2RGCA 4GNKA 2WAAA 4E51A 4LRTB 1C1DA 4ZU6X 5LOVA 1ARZA 2IPMA 1LLDA 3UCFA 1CY8A 2H4XA 2J48A 3RT9A 4NYMR 1K4MA 1EXMA 4NZMA 2HIMA 2IVFA 3UJ7A 1A3CA 5K1ZA 2P3SA 1KFJB 1QM5A 5FNVB 5H3CA 1PFUA 1OT3A 2DBVO 3C5VA 1YAHA 3PT5A 4KWHA 5CUQA 5D1HA 4B34A 2HBYA 1HE1C 5C1OA 3R44A 2PN1A 1JQEA 1AQ6A 2HSGA 2FK8A 2I7DA 1KA9H 3AFGA 1W4RA 2CYAA 2XUHA 4F7DA 3CRQA 5CBPA 5B1DA 4CKWA 4HZGA 3KZNA 4QARA 2OUKA 3BKXA 5TSDA 3LCCA 3VX4A 1MABB 2CMHA 3T1VA 2C5SA 1GDHA 1SXQA 3THXB 2E2WA 3OQOA 5THXA 4TV9F 3AEKB 1I2MA 1N2OA 3DE5X 3L8YA 3OWXA 4NEQA 5F7ZA 1FYEA 3CJTA 4MV0A 1D9XA 3NBUA 4LF8B 2LCFA 1CJKC 1FLDA 3C41J 3L7IA 1KMIY 2VPQA 2PZMA 1JFRA 1ICIA 5G0VA 3VKUA 2YX1A 5AW7A 4DV6B 1MC5A 4J7UA 1LPOA 1SCJA 1A9RA 1NUQA 2GN1A 2HLHA 3EUFA 2C5HA 3L1UA 2XRYA 3PXAA 4FSXA 5LXTF 2OQRA 3U44B 1AZSC 2RGRA 1UMDA 3CTMA 3BED