4ARVA

Yersinia kristensenii phytase apo form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
409
structure length
409
Chain Sequence
GYTLERVVILSRHGVRSPTKQTQLMNDVTPDKWPQWPVKAGYLTPRGAGLVTLMGGFYGDYFRSYGLLPAGCPADESIYVQADVDQRTRLTGQAFLDGIAPDCGLKVHYQADLKKIDPLFHTVEAGVCKLDPEKTHQAVEKRLGGPLNELSQRYAKPFALMGEVLNFSASPYCNSLQQKGKACDFATFAANEIEVNKEGTKVSLSGPLALSSTLGEIFLLQNSQAMPDVAWNRLSGEENWISLLSLHNAQFDLMAKTPYIARHKGTPLLQQIDTALVLQRDAQGQTLPLSPQTKLLFLGGHDTNIANIAGMLGANWQLPQQPDNTPPGGGLVFELWQNPDNHQRYVAVKMFYQTMEQLRNADKLDLKNNPARIVPIAIEGCENEGDNKLCQLETFQKKVAQVIEPSCHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Degradation of Phytate by the 6-Phytase from Hafnia Alvei: A Combined Structural and Solution Study.
pubmed doi rcsb
source organism Yersinia kristensenii
molecule tags Hydrolase
molecule keywords PHYTASE
total genus 143
structure length 409
sequence length 409
chains with identical sequence B
ec nomenclature ec 3.1.3.26: 4-phytase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4arvA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4arvA02
3NTLA 2H4ZA 3DB1A 3E9DA 3MXOA 3QPVA 2H0QA 1C80A 2H4XA 3IT0A 2ENWA 5CU7A 1DKNA 1BQ4A 4JOBA 3DCYA 1BIFA 3PGMA 1IHPA 1FZTA 4MA4A 4JOCA 1TIPA 1DKOA 1K6MA 1ND5A 2RFLA 1CVIA 2PA0A 3IT2A 1SKAA 3IT3A 4FDUA 1UJCA 2DWPA 5CDHA 4EO9A 3E9CA 3EZNA 2A6PA 4D4LA 5PGMA 3KKKA 4AROA 5HR5A 2P79A 2P2ZA 3LG2A 1DKMA 4QIHA 2WU0A 4IJ5A 5AJVB 1V7QA 3K4QA 5AJZA 3FDZB 4HBZA 2P77A 3QPUA 4GPZA 4ARSA 3ZHCA 1RIIA 4D4JA 3HJGA 1RPTA 1BQ3A 1UJBA 4ARUA 2P78A 1SKBA 4D4KA 2P2YA 2HPAA 1V37A 4E3WA 1YFKA 3F3KA 5AK0A 2IKQA 5AJWA 3C7TA 3GP5A 1DKQA 4ODIA 1SK9A 1QWOA 3GP3A 2QNIA 3LL4A 2OWDA 2HIAA 1YJXA 2GFIA 2P6MA 2EKBA 3O0TA 2H52A 4JODA 3FJYA 4FDTA 4TSRA 2P9ZA 3GW8A 5HTKA 1QFXA 1C7ZA 1C81A 1H2EA 2P9YA 1H2FA 2YN2A 5AJXA 1FBTA 1T8PA 2EKZA 3OI7A 1QHFA 2WNIA 1DKPA 3R7AA 2F90A 4PZAA 3QPWA 2BIFA 2HHJA 3D4IA 3IT1A 3F2IA 1SK8A 2A9JA 2EOAA 5CX4A 4IJ6A 4D4MA 2I1VB 4PZ9A 4EMBA 1XQ9A 2OWEA 1DKLA 2YN0A 3MBKA 2P30A 2WNHA 3NFYA 2P6OA 3EOZA 2P75A 3FDZA 4GPIB 3E9EA 3D8HA 1RPAA 3LNTA 4ARVA 1E59A 1EBBA 5AJYA 2P9FA 2DWOA 1E58A 2ENUA 3D6AA 3BIFA 4PGMA 2AXNA 1NT4A 3K4PA 1ND6A
chains in the Genus database with same CATH superfamily
3DJYA 3G68A 3EJ6A 2HGSA 2R47A 4OQMA 2W2VA 5CW2A 3TQSA 4ZCRA 5AVTA 3PSHA 2XMSA 4XB1A 4BLPA 4JJFA 3P97A 4ND8B 3JQGB 1BQ4A 4JVMA 4U8GA 4P31A 1J2RA 2DOKA 2QF7A 4PW0A 1ZD5A 3FNIA 3OOHA 2C84A 3UYKA 3LLMA 1KE1A 3ZK8A 3UJ9A 1QF6A 2IU3A 1QOZA 4H3KB 2ZTLA 3BWEA 1SBYA 2QRNA 3E8SA 2C1XA 2I4IA 2YMLA 4IKPA 1WCYA 3B82A 4QTYA 3MJTA 1J09A 1Z8DA 2HCFA 1SUAA 2V45A 2JCXA 3DTVD 4HUQA 4M7WA 1OH5A 2G77B 2QMEA 4O4IA 1RCTE 3DH0A 3AEQA 4OGWA 4YWJA 4XYBA 4B9EA 5JLJA 1BO6A 1K8YB 4YCLA 4KYVA 9GPBA 3GRAA 1U2GC 5IZCA 1M6VA 3EBPA 5KKNB 1R1DA 1V7QA 1WB4A 3N9IA 3RUPA 1MT0A 3A36A 4CM1A 2ZUEA 4F3KA 5IHXA 1U6JA 1Y9DA 2CLKB 1UP6A 3KKOA 3NNDA 2C8JA 5KYXB 2ZR8A 2I7TA 5EIHA 1KP3A 2CDBA 1SG6A 4MHOA 4KE9A 1KOJA 1YB1A 1A9TA 2GPNA 5K0ZA 2JLCA 5CVUA 1DBQA 1U0TA 1L8LA 1HKHA 3OKAA 1G41A 1TCVA 2B8WA 3DA8A 3PRYA 2VSFA 3PS9A 3SYMA 1W36C 1GADO 3ESYA 2W6JD 5KJEA 2QHXA 2YUTA 3AVQA 4UQPA 5LQCA 4OQEA 5CIWA 2WWVD 1VHDA 5FH9A 4AUNA 4DSAA 3H86A 3BWBA 2C9BA 3CCCA 4FX5A 4IX9A 2IYZA 5HILA 5T4HA 2QRMA 1EDZA 2Z8XA 4ONEA 3U3RA 3CY6A 1OYWA 5DWQA 2Y71A 3EG9A 1GCIA 3AP1A 2XHZA 2O1EA 1RS0A 1BX3A 3VC7A 5IJ0A 4MV0A 2P41A 3K9GA 3S7TA 3ZIUA 3ZU5A 2MT9A 1VIVA 3WA6A 3PUWA 1XZKA 1ECJA 3CWZA 2J3KA 2IJGX 1X7YA 4AROA 4WMLA 3TUZC 1PDOA 1UMDB 1UJ6A 4MR9B 4MPJA 3IMCA 1MTOA 5CB0A 2PKQO 2VRNA 3WDMA 4U2CA 5JASA 3IAM1 4UPEA 3MHPA 3O8OA 3ZGYA 2YYYA 2VZEA 3BMOA 3CNOA 3QLVA 4JASB 2AVDA 3JPYA 1PNQA 4R4JA 4OBBA 4PZ0A 5HRAA 2RK4A 4KFRA 1ZZGA 2FQYA 5EJ5A 1LLDA 2HSZA 1JQJC 3JASA 4H7PA 2AT1A 3BCSA 4NMMA 1L1FA 1H2YA 1K9SA 4LHEA 3JYHA 1JN0A 1XLVA 1KMIY 2CLSA 4FMBB 3JSXA 2WNHA 3LY9A 3PVCA 3WKBA 3V1UA 4L22A 3OZSA 2VHQA 3COPA 1JB9A 1XJCA 4XQGA 1U63A 4XQ9A 2J1LA 2PGJA 2VHTA 3DOIA 4IIJA 4OJYA 1DFIA 1QRSA 5AVRA 3NTXA 3TVDA 2B20A 5E9AA 5HBGA 3N75A 3D2LA 2E7ZA 1BOOA 1V4VA 1KEEA 2G1PA 1DI0A 3KYCA 2I3GA 3GEPA 4ZT2A 1XDUA 2ZDHA 1B74A 4LDAA 4CE6A 4KUEA 2B83A 4RYLA 3WIBA 1P6XA 3OT1B 3KWLA 4AJKA 3AKDA 1KKUA 1WDKA 1FW8A 2AXNA 2G1AA 2RHMA 3DE4X 4W8HA 1U0FA 2P67A 3AO0B 3DMTC 4BL5A 1WPQA 2GM5A 3D8TA 3BXOA 1H5QA 2QPAA 1Z6QA 3CA8A 2X9VA 4QBTA 4BQNA 1Z2EA 4LZLA 3C6XA 2GARA 4EARA 4XM2A 1JDTA 4AF8A 1H2ZA 3LHSA 4CU5A 1ZXBA 3H3XA 5AUQA 4AN0A 5FTLA 3BPSA 2AJLI 2J67A 1Y8ZA 8GPBA 3JD3A 2C4UA 2O23A 4BUCA 3FTEA 3V1MA 1TLTA 3E1GA 1K63A 3X2FA 4U3JA 3ZWWA 3PBKA 3DULA 4HTFA 2LXNA 4F71A 4EO9A 4NYMR 4QRDA 4YAUA 1DXHA 4CKWA 3VHRA 3K94A 4D4LA 3UOGA 4BBAA 2ZIXA 4OKNA 4FINA 4C05A 1KRWA 1E64A 1B4DA 3HYTA 3ZVNA 4YIKA 1NVGA 3D8RA 1MVOA 1Z5VA 2X4DA 1T9HA 3K1JA 2OXFA 5BQFA 3A9RA 3GJTA 4NEQA 3JQ7A 2C8LA 4PPGA 1ZMOA 1E0KA 1M6EX 1P2UA 3GAAA 1QFMA 3EUAA 4KQ1A 4M6WA 4N5MA 4Y9UA 5G4LA 3QUTA 4UM5A 4X71A 3WGKA 1DC6A 2G88A 4IHJB 2I9KA 4D8TA 1L1EA 3X2EA 5DBGA 4RDXA 1Z7WA 4V24A 3PNLA 4GX2A 1AOXA 3GRFA 3A3YA 4GMKA 3C8UA 4ZDWA 5LIRA 1KNQA 3ZWAA 2DP4E 4IJQA 4BDSA 1DEKA 2FSHA 3U49A 1BX1A 2VSYA 2A0YA 2VWHA 3I32A 1LBTA 3SX0A 5E6UA 5IKOA 3VNBA 1OLXB 4BNIA 2A94A 5AI4A 4CNQA 1QHXA 3CUSA 3QA9A 3H5NA 2FKAA 4KN8A 3RSSA 3TIIA 2JAHA 3L05A 3NBQA 2P90A 4MW7A 3MWDB 5AOBA 3RVMA 1M54A 1UMBA 4RAOA 5DI3A 4LF7B 3AVYA 1G2QA 1T34A 4JVOA 2H3HA 1W1WA 5HKKD 3LUPA 3FPHA 4I5DA 3UCEA 4J1QA 2Y0PA 2NVWA 5F33A 1B41A 3A6FA 3BERA 1QORA 3SQXA 1A4UA 1NQUA 4ESVA 1SM4A 2I6FA 4RA9A 1ZX1A 3CF0A 4IILA 5JTTA 2QL9A 1N7GA 5DW0A 3B53X 2D00A 4QYXA 1EFPA 1D9XA 5CPFA 3SZOA 4BCCA 4DC1A 4YPOA 4WA7A 2DJIA 1P29A 1NVAA 4H7JA 3WGTA 3T34A 2QEQA 4Q02A 1REQB 1U9JA 1J1IA 5FNZA 1O96B 3ENNA 1JTVA 2LCFA 3X1YA 1Q91A 1CJKC 1PGQA 4WLUA 3WSTA 4EB8A 4B82A 2I6SA 2XNHA 1GRQA 4YCAA 1E9EA 3FOCA 4OG2A 4X3OA 4DQUA 1KJZA 2UUAB 8ATCA 1O9GA 1L5LA 4R1NA 3TD9A 4V1CI 1OLOA 4P84A 4A15A 5HBRA 2UYHA 1H9AA 3RO7A 1TAGA 1F8XA 2ERXA 3JAKB 4M0PA 3RS8A 4DRXB 2V5VA 5JD6A 1LU9A 2P9CA 1ZY2A 4F3NA 3FYTA 4OM8A 2CHFA 1UT6A 3E2IA 3CQ9A 3LAWA 4IZIA 1VKZA 1YQEA 2EZTA 1YQGA 3PXDA 1JKFA 3QPDA 4AECA 2DYKA 3CF4A 4B84A 3WSVA 4CMJA 5KNBH 4JQYA 2E82A 2YHIA 3SIXA 3ZCRA 2Z4SA 5FOVA 3LRPA 5DM1A 3FHOA 2PR2A 5E6RB 1JZQA 4G0VA 3I9KA 3LQ2A 5TMPA 1NGSA 1R0KA 3B51X 5GJVC 4AX4A 2JIPA 3PIDA 2Q28A 1LPBB 2FFRA 4V0KA 4ZO6A 1TW3A 3N07A 2RI0A 1QWSA 2V9ZA 1B8VA 4DXHA 3EPJA 2W42A 3HU1A 4HI0E 4HG2A 4NBNA 5MN4A 4BFWA 1E99A 4PPFA 2X19A 3GGGA 4S1PA 2R6AA 4DPMA 3Q8WA 3L9WA 4NCKA 3KXKA 2QORA 5L3RA 4XWOA 3U09A 4I5IA 4U02A 1BW9B 3NOVA 5DIFA 2WD8A 2HGZA 1RHKA 3AERA 2C2GA 2XXAB 3CW9A 4ER3A 1KI1A 3LQ1A 2OCLA 5CPBA 1Q50A 1GGVA 5LDDC 4DIDA 3E3LA 2NG1A 4ZVRA 5KC9A 1Q6YA 1PFVA 2R7KA 3QU5A 1EI9A 1TUEA 2ZRCA 4FZJA 4ZQFA 2P77A 3R7SA 5LB4A 4ERNA 1BVHA 3REQB 4PHHA 3H5IA 3CX7A 2CF6A 1OVGA 2ODQA 1N2JA 1PYGA 2Y1WA 2GBLC 2TMDA 4UKDA 1G3QA 3CLKA 4P80A 4WECA 2F1JA 1DC7A 4F4DA 2PWPA 4M36A 4XJTA 4PSAA 5F35A 1T0PA 1XK7A 1ATZA 2GXSA 4W82A 4B7XA 2FQXA 3NTVA 3P9RA 4I36A 4M8IA 4UFOA 1OXXK 3BL5A 4J7CA 3VR3A 1PEYA 4CIWA 3VC2A 3VVMA 1K6JA 4IQ4A 4QQRA 4IDGA 4CM9D 1AQNA 2RGXA 5CVTA 4QODA 4M9XA 3EXAA 5IM4A 3DLCA 3GT4A 3SEZA 3NV7A 2HCBA 3WK5A 2R60A 2C29D 5I4IA 2PMCA 3BIWA 5K2MA 3N05A 5DHRA 1JKXA 2NO7A 4TKZA 3PFKA 5TXGA 4DCJA 5A2GA 4ZTUB 1T6NA 3ILYA 1TU0A 2CNDA 2IXDA 4Q9JA 1W6UA 1RTTA 3O0DA 4LRTB 5AYVA 5EXTA 4L02A 4OMCA 1E4YA 1OFVA 2XYHA 1T0BA 2NSJA 2FPWA 1KFKB 7GPBA 3HM9A 3QSGA 4HPXB 4BO8A 8OHMA 4N9WA 1Z5OA 4P34A 3HXQA 1EP9A 4ZT4A 1QO7A 1CIPA 4UE3S 3GAMA 1MKYA 3OM0A 5EWLA 3E3OA 5DYGA 3LQRA 3B1WA 2FY8A 1ATIA 1ZWKA 1DKLA 1Z36A 4S0ZA 5KNCH 3MNFA 4LV6A 3AW8A 2AFIE 2VYVD 3VO9A 3IL2A 5IN4A 2F9MA 2REBA 1XQ1A 5JG7A 4DUYB 1MQ9A 2R87A 1TA4A 2G17A 4QHSA 4DRYA 4DQXA 3E9EA 2DPMA 4FFBA 3U3KA 2WSLA 2YHAA 3M2TA 1CV2A 4BZXA 2EG9A 4WCFA 1TUIA 1WXQA 2VA9A 3M70A 3SC4A 3I28A 3S5UA 2Q21A 4LGYA 5LQDA 2A3RA 1Z25A 3DVAB 5ADWA 4PNZA 4IIUA 4PRLA 2JIOA 2QK4A 4J1TC 3TW0A 3UHOA 4FLEA 3UV7A 4FDVA 4JHLA 4UDXX 1GAXA 2EL7A 1Y9JA 4FYJA 3JQCA 2OCIA 3QX8A 4MGKR 4ND8A 4FN5A 3F9IA 3ZC3A 1UF9A 4DMGA 5IKPA 1U5CA 5LA6B 4ZAZA 2WTMA 3AY3A 4UU1A 5EXSA 2FSIA 2ZWIA 3I2YX 2ZRPA 3C6ZA 2UUBB 4BV8A 4YXWD 1VLVA 4UVGA 3AIIA 5LA6A 5CD9A 3W3AH 1HE2A 1PHRA 4S12A 4MRMB 2HT6A 1ORWA 3OJOA 4G5SA 1HNNA 5H0IA 2QQFA 5JCPA 3GOHA 2QG6A 5BORA 1LNSA 2AK2A 2WWHA 2HQ1A 3WLOA 2Q5CA 2LKCA 3AB8A 5BPHA 1QSGA 4CM4A 4KPGA 3AV0B 4Q3KA 4YNBA 2W43A 4ZVVA 1R5NA 2O19A 3IKMB 3LPCA 2XRZA 3H9JA 4HO1X 1YBFA 1KFEB 1YT5A 1YULA 4BCBA 3FOEC 4L9AA 1GTJ1 4AS3A 4FWTA 1UMKA 4R7GA 1Q7CA 1VKHA 3OOEA 3FN4A 2HPZA 4FW9A 5GWXA 3NM6B 2VJBA 3EBLA 4BLRA 2W9XA 2VRCD 2G36A 4X1KA 1HX7A 1XTQA 5T6MA 3FUVA 2JFNA 1P2BA 3PUVA 4CF5A 4RTNA 5HWSA 2FEXA 3RYIB 2NTVA 4V0LA 3RS3A 1C0PA 4IR7A 2Q8NA 3L04A 1O03A 4UCXA 2ZVDA 3C1AA 4OJKA 4X7MA 2H65A 4BDTA 4F0JA 1U7DA 1GUBA 1GAWA 1JWLA 2GXUA 1QK3A 1N33B 4OJTA 1FP6A 4CN9A 3KPUA 3OJWA 4C01A 4MYDA 4W5OA 1GGHA 2Z09A 5EE9A 4RH0A 4CUKA 3VTZA 3IR6A 3JQAA 2YVLA 2F3PA 2CLOB 3M4YA 5KC8A 3J7TA 3LHFA 3KVOA 4AY2A 3WXBA 2F55A 2GFIA 2FOXA 4RENA 2QUKA 3A6JA 2C5LA 4W8OA 2ODPA 4BRZA 1EHYA 5HIMA 3JVEA 4KZKA 4ZYLA 3QTTA 5EE0A 4IPTA 2AUNA 4TMZA 3M6IA 1QPBA 2EGHA 2JIRA 3AWIA 4FZRA 5THXA 3LBAA 1TO6A 4WT7A 1ECCA 1RFGE 2X8JA 4HDNA 3C6KA 4BOYA 5IWCA 2R7LA 4NZ9A 1KWKA 2A5JA 4H1UA 2GZRA 4X95A 2ZANA 1W44A 3F2VA 1PK7A 2REXB 3QVWA 3RHTA 1ZK3A 1E2FA 4BIIA 4U5QA 3HXOA 2GXQA 2IEDA 5EL0A 2YV4A 3R0VA 5K0SA 1IOLA 1J00A 3JQAB 4D9MA 4AU1A 4KYUA 4EG8A 1L7AA 1DCTA 4F8JA 5G41A 2AC2A 1AHHA 2BKLA 3OU2A 1KI7A 3CNEA 1COWD 5HCUA 4D46A 4OA8A 3RTCA 3K8ZA 2FLWA 3DXZA 4PCLA 3IEIA 2JARA 2V4UA 4IFTA 4MWBA 3U3OA 1LVUA 1TTTA 3PKJA 1NW9B 3WO1A 4BIMA 3OUUA 2Q2WA 2ZIUB 1Q19A 2WIFA 5SZKB 2ZTVA 4L4ZA 3UO8B 1TZCA 3GRPA 4YMLA 4O02B 4RS3A 2W6NA 1VM6A 4N39A 4HSGA 3AEKA 1UKYA 4MK4A 4AMVA 1WF6A 1JGTA 3SE0A 1E58A 1YB4A 3TE6A 4OGFA 3K0CA 2QUJA 3CWCA 3DZCA 2P27A 2ZOSA 1KI3A 4WE3A 5CURA 2PUCA 1GLNA 3CB4A 3M49A 4NYJQ 4QOFA 4YQZA 1IN1A 1YF3A 1CRPA 4FOPA 3DEAA 3TUIC 3OKCA 3T4XA 1O6GA 4H6PA 3T5CA 2RAUA 4ZDJA 2FPOA 3BUSA 3G5AA 4COOA 1E6KA 4EJSB 2JAQA 3A70A 5AIAA 4XYMA 4EGCB 1FZTA 3SQDA 2GBCA 4HOYA 3K5PA 1PTJC 4KFSA 3TLAA 4DR1B 4C6RA 1ORRA 1D04A 3PQ6A 3ZR4B 1EVEA 4DMFA 4E32A 2D1RA 1N36B 3S2ZA 4O63O 4AI6A 1E9DA 3ZN2A 1SBCA 4IS3A 1AKRA 3JARA 4FIZA 4BLTA 5JBNA 4GIBA 4OHPA 1KETA 4F2HA 2N3ZA 3NXSA 4L4YA 1W7AA 4X20A 1RHUA 2WWYA 2WYUA 3MTIA 3FGZA 4IXWA 1OU4A 1T5OA 1R27A 5DYIA 3VPSA 4B43A 3ZCPA 1RAAA 1NHWA 1BH6A 1Z3IX 1N25A 1HF3A 3HKBA 3OO1A 4H2DA 4F72A 3OQIA 3ZVKA 1JHAA 1UKAA 1QYCA 1FVHA 1NPTO 5EYPB 5KYYB 4L4SA 3B78A 3H16A 1H6AA 1UBSB 5EIFA 1P1CA 2DEUA 1EFCA 4AB1A 4MV5A 1SXJD 1U9ZA 1NTRA 3DBIA 4TM7A 3K70D 1RT9A 3N8HA 5EZ6B 3PDJA 3H2IA 2R5WA 3TIFA 5AJTA 1M0WA 1EG7A 2GA9A 1D5WA 1ZW1A 3QUSA 4CGZA 3HLKA 1LWNA 3PWKA 4Q4HA 2AYZA 3NAMA 1NOJA 1TTHA 2O3TA 2DQ4A 4LCEA 4CR8A 1WAMA 2XLBA 4BE9A 4CLHA 4CDGA 4BUZA 1R5BA 3QKRA 3U60B 3HN2A 2BFAA 2I0FA 2WUVA 1LK5A 5A71A 3CZRA 1H4QA 1Z5NA 1PD0A 1Z6AA 2GEUA 3L92A 3OSUA 2GO1A 3KZNA 1R37A 2YWRA 3NHWA 4FDTA 4D9BA 3TL2A 3VTFA 4DUPA 2HIMA 3L0ZA 4IWNA 3JRXA 2PLAA 1WPRA 2EJVA 3LIPA 3QE2A 3T1NA 3NUZA 3DG9A 2VSXA 2AMLA 3EWIA 4J49A 4ESHA 3NC1C 2QMZA 2WA1A 3MLBA 4I81A 4GDFA 3K2QA 2UXCB 2C77A 2IODA 3M83A 4D79A 5CA1B 1DJOA 2GAFA 2FMIA 5HKBA 5JJIA 2XNCA 3H2GA 1KDVA 2PSFA 3WYEA 3DQPA 5BWLA 2O1WA 4KQ9A 4G9EA 3MELA 3V3KA 2ISCA 4UE6A 2R6R1 1MP0A 1UODA 2G40A 4Q24A 2Q3MA 4EB6A 3PPYA 4JI2B 3QLEA 4PHGA 3O7MA 4FDMA 3IE0A 3W3ZB 4Q1FA 3CRW1 4K1XA 1VE9A 4KBFA 5I7UA 2PMKA 3ASZA 5DGXA 5BSGA 1Z7BA 1UMCA 3Q5EA 1HTWA 3AF2A 4QNNA 4DLKA 1SD5A 2QMUA 2BI8A 3UFXA 1H69A 1G1AA 4MB0A 1KPIA 3GJ5A 3V1TC 4CIYA 3OC6A 1P1KA 1CUAA 5ALIA 2V5AA 3TM5A 1ID1A 3DM9B 3WLHA 4RDHA 2X4IA 4DJTA 2QRLA 1WTCA 1H2AS 1MAVA 1ZXXA 3CVWA 2CFOA 3SHWA 3E81A 2ISSD 3LPLA 1XIVA 4EKDA 4GD3Q 1WXWA 1YRWA 1ZONA 3MXOA 4J4HA 3AKYA 1IZ9A 4Y0AA 1KQPA 1J97A 3NCHA 4L0CA 4MQEA 1FFEA 3NGXA 1N7HA 3STXA 2D5AA 1KJNA 4EZIA 4S0XA 4YI3A 2W8ZA 4ALIA 5EOVA 2K7ZA 1T9BA 2IIQA 1ZSNA 5ER6A 3UAXA 4CMBA 2QVCA 2M32A 1W36B 4HAZA 4AWXA 2E1PA 1E89A 3D8NA 2Z4TA 3RBZA 1H0HA 3H8SA 3EQ6A 3WYBA 3ZWYA 2X0NA 3RIGA 4AKTA 4CODB 1S5PA 4D6XA 1FDVA 3REFA 1CE8B 4MKGA 5ALMA 3G7NA 4Q9IA 1DBWA 5BVHB 4RANA 4H3SA 5HDQA 4KQ2A 1XPOA 4P2GA 3QVMA 4M0DA 4POAA 1KEEB 4RZXA 4RK1A 4I50A 5H68A 3MJVA 4F6RA 3AETB 3AYXB 2IZ7A 4CIAA 1YKGA 3AR6A 5G53C 1RLOA 2P0AA 3R24A 2PHZA 4FCTA 4WLEA 4ZVLA 4BNTA 3WL8A 1JHUA 3SFTA 3I1FA 4B8YA 3MYRA 5F3RA 2XSZA 4D0NA 4J75A 5IAOA 1ULAA 3VNAA 2GZDA 3BRQA 4CTNA 2RHDA 2XA2A 5EAIA 1ILWA 1I4WA 2HM7A 4QDOA 4TV9A 2Q2QA 3ZBPA 4JYPA 1IVNA 5B1DA 5CYGA 3HDTA 3GG2A 2EIHA 5HXAA 4D98A 4AN4A 3F5MA 3FM9A 1WUKS 2VYFA 4DIOA 1SUFA 2J0EA 2ZJ7A 4MQBA 5MN5A 2H9IA 4D74A 3L79A 3A25A 5A4DA 4GLOA 5JCOC 1L5GB 1C14A 1RC0A 2ZBPA 1XVIA 4FFRA 4L8FA 4E5YA 3MJ4A 2ETXA 4Q3NA 4WHMA 4PYRA 3E3NA 4X85A 3WGGA 1IHXA 4GPBA 4B75A 4OJQA 2GK3A 1NXXA 2DTDA 3FWNA 3OOSA 3CKMA 4J0KA 4QOIA 3D8SA 1IC6A 2OAGA 2EC5A 2IEZA 4OX9B 3ZZ1A 2Q9CA 3HFGA 1JJAA 3O2JA 4L9RA 1GLVA 1PBNA 3K7EA 4GMGA 3A6PC 1T9KA 2LDBA 3VPHA 2IZ5A 3MAAC 4RWZA 3PFCA 1PL6A 1T6YA 5FPHA 1XCBA 1WY5A 2CJYA 2GJKA 3N7UA 1CUWA 1CRLA 1QUFA 3VYRB 1T29A 3RT1A 5B36A 1N34B 4R8MA 1NC1A 5G4KA 4MEAA 1JDBC 2B0CA 4HPWA 4GM0A 2H4WA 4OHXA 1U0RA 3ENKA 4LRQA 4B2LA 1BMDA 3HA2A 1ZD4A 2ZJ4A 1N5KA 1PNOA 4GP6A 4NJEA 2D1SA 3D6JA 1Q15A 4JSTA 1UJ5A 1FS5A 4PIVA 4QU5A 4QTUB 5L7WA 4OL0A 3OZFA 3PYLA 1YK0A 3H1BA 5DN6A 4E5NA 4Q4CA 1A50B 2VTVA 3B3QA 3IP7A 4RBNA 2WOJA 2VZ0A 3QHQA 3BGSA 1N6NA 4C4TA 4OAPA 1YQDA 1STOA 2X23A 2DQYA 1PZNA 2P7IA 1UBOS 2FJUA 4HJRA 4AF6A 1XZHA 821PA 4ZYTA 4WY5A 4N3CA 1ZJWA 3CC8A 5ALYA 4DDWA 4LMRA 4BQQA 5CCDA 1IH8A 4D44A 1W29A 4F7DA 3OU6A 2J08A 5AXDA 5IDVA 1QOQB 3ZK7A 2YWGA 4ARZB 4EPXA 5CLFA 1OH6A 3FWKA 1HE5A 5D3QA 4AX8A 2VEOA 1QP4A 3TAHA 1I2DA 3LSYA 1R9JA 4W99A 4JP5A 1PGPA 3S7ZA 4UU7A 4BY9E 4H3VA 3MVEA 4RV4A 1IY9A 5EKTA 1BX0A 2IDZA 4ETMA 1GP2A 4L16A 2EYQA 4GZMA 4J90A 4MW4A 4NZOA 3ZWPA 3EARA 1HYQA 1VSVA 5JJLA 1E1MA 2XTZA 1UM9B 1TZJA 1BXRA 1VB3A 1QZZA 4MULA 3LX4A 1LRJA 1FMJA 1YQUA 221PA 4DLUA 4RV9A 4RZHA 1J39A 1HRKA 1UP4A 1JYEA 1O9HA 4HBZA 3TR5A 2WB2A 1T4BA 2R68A 1ZUWA 4QTZA 2DFNA 2H63A 4LW8A 5A4JA 4HNSA 4BVEA 3DLIA 1BG6A 3NBAA 3J81A 2QTRA 1AK2A 4RW0A 5FBRB 3INNA 3FAZA 3OH8A 3W8EA 1P5JA 3I39X 3EMBA 3CISA 4NEGA 4TMFA 5A3QA 4KWTA 1U4SA 1U8XX 1GPYA 2ZBDA 4KXVA 1UDRA 1L7QA 2VF4X 2IPXA 5LBTA 3FLAA 1R5OA 3F3KA 3QZUA 1AM4D 4OLAA 1E1KA 4UXIA 1WIWA 4UEWA 4ZU6X 1T2DA 4KQKA 1DQRA 2RGEA 3B6JA 1O94C 2VK8A 5HP4A 4R0MA 4AN1A 5JRZA 1NONA 2XX3A 1P0MA 1XEXB 3ZHSA 2JGKA 5I7VA 1SKMA 5JANA 4K6FA 1X39A 3RVPA 2C5HA 1GUZA 1N2ZA 2FAXA 1TF2A 1TKRA 2JVJA 2M6SA 3LPNA 4QATA 4DIUA 2BEWA 1IG3A 2J3QA 2P9YA 4PBSA 1X9GA 3FPKA 4D3DA 5FWXB 4HSEA 4ENUA 3AL2A 3NT4A 3VSEA 1UPAA 2VNSA 2YV2A 2ZVJA 2AG1A 3IHKA 4EL5A 3K09A 3NBUA 3AEXA 9MHTA 1S3FA 4ND5A 1VI6A 4WOKA 4PYJA 5FTKA 2XAUA 3CWQA 4G0PA 5CAEB 3EZ9A 1MW8X 5KKCA 3IUQA 4IH9A 4XQEA 1XALA 1Z0DA 2QTLA 2VA8A 2Y92A 3DE2X 5AW4A 3UJAA 2NSYA 3EIXA 2FP3A 3EGVA 4GOXA 4TQGA 1MX5A 4EK9A 4X93A 3WLLA 3WR5A 4M22A 2AZXA 1E2NA 3C97A 9LDTA 3V4PB 3URKA 3FY4A 4G0OA 5JLAA 1OFUX 5FPTA 1U0NA 6LDHA 3TL6A 2ZXEA 4NYIR 3A0RB 1S4MA 1Y5NA 3HP4A 1AA6A 4XYGA 1SAYA 3UTCA 2ASVA 3NT2A 1O95D 1NI3A 1RWPA 1NRJB 1XU4A 2JD0A 1RU3A 1D2MA 2ZUVA 2XQJA 2P9FA 3IJ5A 3LO8A 4UCWA 3IDSA 1JI0A 3FJ1A 3T9BA 4YP7A 4IXDA 3UJ7A 4CF4A 1XFAA 5A3JA 3VGJA 5FDFA 4QHTA 1CJBA 2BDTA 2GSWA 2NX2A 2V6FA 4O4LF 4F5YA 4JI8B 1ENYA 3MK31 3MSCA 1Z35A 4MXDA 5DNVA 2QXYA 4JL5A 5AQEA 1PJLA 2YXDA 4EZBA 3Q8MA 5BNTA 4FFOA 5JRJA 2E1RA 3NTRA 1GEGA 2VATA 5ADVA 1TJ3A 4RTSA 3BWMA 4E08A 4EJFA 4P3XA 2I8CA 4YLGA 1MAHA 1JPNA 1G8MA 1YDHA 3K31A 1JDBB 3KEFA 4OREX 3LMKA 2CDCA 2NLOA 3UXHA 4JU8A 4TN5A 3FKSD 3WL6A 3N74A 5EZYB 4BZQA 3IJEB 4Y2QA 3LC1O 1JEOA 4CG0A 5I01A 3OVMA 1GPKA 1UC8A 3PD0A 4KQHA 4L8VA 4KXUA 3EUFA 1NW3A 4J7XA 2HLPA 5AKEA 4NDNE 3IVCA 4Q37A 1SXJE 4EOGA 3ITNA 3TBHA 4Q3DA 1N92A 4AJOA 1XZDA 4DA8A 2E89A 3UAZA 1U1FA 5J43A 2HX1A 5JW6A 2OFFA 3E18A 1VHTA 4R83A 2O2JA 3LVBA 3QMMA 3I53A 3MRSA 4YRRA 2ZB7A 4D43A 4M3NA 5JXWA 1X7WB 1AHIA 3QLTA 5BSMA 1PCXA 3PNOA 3DV9A 4JQSA 1ABBA 3EMDA 3DDHA 1IBLB 4UVIA 3DVAA 4WN3A 5MGBA 1X0XA 4F4IA 4JVLA 1IVSA 4CQLA 2IYSA 5BR7A 1CX9B 1UEXC 4LHXA 4JUIA 4G2NA 2IZ6A 3EQ2A 1KL7A 3N8IA 4F5DA 2KSQA 4V0QA 3C5HA 3OU7A 5EE1A 3SMQA 4FSDA 4LXIA 1EUZA 3H1PA 2YRFA 3KJGA 4CEJB 1TLFA 1ZM4A 4OQ4A 3FDIA 4Z0PA 3IP1A 3SE7A 1EIWA 4QJ3A 3IPAA 1VDMA 3QX7A 4I9GA 3KFVA 4M8LA 1KEWA 2FPSA 4JKYA 5LA6F 1QV9A 3A4MA 3TLEA 5C7LO 3RYCA 3HBNA 1XD2B 1NI4B 3M4NA 4ZOLF 3GRUA 4L07A 3IAUA 4MRAA 4ZCLA 1V7PC 5BOSA 4HY3A 1L5RA 3GYBA 4FUQA 4GQBA 1VJTA 3KQNA 3PLNA 2ET6A 1IHUA 1Z8NA 2OKGA 1ZO8A 4NE9A 5DXJA 1HQCA 2ZBQA 3V1KA 3ZWVA 4CMAA 2Q5LA 2RG1A 1LQ2A 2OYSA 4Y2VA 2C99A 1MAUA 1QZTA 3D5EA 4MJLA 1WCV1 2WJJA 2QM8A 3B3JA 1P80A 1MH9A 2XMBA 4RIIA 5C7IO 1K7YA 2JBHA 3A9VA 4J7AA 4ZVOA 5BUZA 1W9MA 5KSWB 4PRZA 1DIOB 1MHPA 5IARA 3PCRB 2IHTA 2HKIA 2O7QA 3NTQA 4PX5A 5EJIA 3VR4A 3L46A 1I3MA 1QHYA 1ZMRA 4A82A 4DDTA 3ORYA 4PM4A 4UM8B 4RMIA 3HABA 1DSSG 3K6RA 1AU9A 3HJRA 3V3TA 4BX3A 1SIUA 1QE0A 1JHMA 1D1QA 2BFCB 3ZHVA 2XJ9A 3KB6A 1G8KA 2VTEA 2MCFA 721PA 4UAVA 4R9NA 1DT5A 5EKXA 1SQSA 4RMGA 1EP2B 2JEYA 3ZBTA 2JKZA 1NUPA 1OQAA 1Y5RA 2WAMA 2NV2B 4YRLA 1JEAA 1NI5A 1HH4A 3TCNA 4AMGA 2P62A 2HEIA 4JOSA 3REOA 3BM5A 1Q1EA 5L6LB 5DLDA 4Q1BA 4HXFB 1GNQA 4NNPA 4D0SA 4ZOLA 3WC4A 4NBVA 2C2KA 4X97A 3RG8A 4ARZA 1DMRA 1K4MA 2OQVA 1OXVA 1JA1A 5KYUA 3RF6A 3FNEA 2JG3A 4UZSA 4Z4CA 5DVZA 1FA9A 4PAGA 1KDYA 1I4TD 3AL3A 4MYUA 2V7TA 3IS3A 2WIKA 4PS0A 4TUYF 3D02A 3KELA 3UB4A 2BLLA 4RELA 3KX2A 2C3YA 3M33A 3IP9A 2PWAA 5CHEA 3NATA 4BV9A 1SURA 3JQQA 1A8IA 1H9BA 3WRVA 2GTHA 4K7JA 1CUIA 1DEXA 2YCBA 3PQFA 4ACBA 3ADDA 2P2CA 3ZJYA 3WKCA 2CJPA 5LN1A 2QQEA 3V8QA 1X1AA 2GZ2A 2VPQA 4GO1A 4J9VA 4C3UA 1H66A 4RY8A 3LI2A 3R3VA 2PVCA 2ZI3A 4LYAA 5FCDA 5FXMA 5SYAA 1JR3E 1E1DA 2O2HA 2QMQA 3FCXA 1LPPA 4NQZA 4PLPA 4EPTA 1F38A 2VNAA 1QONA 2ZSAA 4GPZA 1C4OA 2X8LA 4C89A 4L5YA 1FDOA 1UKCA 3C16C 1KS2A 3DMNA 3EFHA 1QRRA 1Z88A 2QKYA 4PR3A 5DNDA 3H4VA 3T7KA 5FL3A 3V2UA 1U28C 3JASB 1RKBA 2G82A 1GDHA 2HHLA 2O54A 4FYXA 3HVIA 1G6HA 1H65A 1WVMA 5EZSA 3N87A 5CIQA 4HQKA 1XMIA 3JRWA 5KDDA 4Q66C 2BM0A 1LXCA 2FOIA 1Z0KA 3QKWA 2BFNA 4OXXA 4W1PA 5A4AA 4BQSA 2ZYGA 1X8JA 3PLRA 5AK5A 4F3YA 3DXXA 1O8BA 4RHCA 3F9RA 4WFIA 2X5KO 3EZLA 3ZE0B 5L7YA 5GM1A 2HU5A 2OOSA 2QIPA 5AKKA 1WP9A 2P11A 4CR6A 2PKXA 6ADHA 1CG6A 1D4FA 1Y37A 2PZFA 4OK3A 5L3SB 2YASA 4RMJA 4IXTA 3VR2A 3JAMA 2P4QA 4PQEA 1M34A 3TLGA 2UZ0A 4QJIA 4OV6B 3HXPA 4BO4A 4B3SB 1YQXA 2Q5OA 3K35A 4KHPB 4JP1A 1FDSA 3ZCTA 2GJAA 2ZE8A 3NVMB 3OPYA 4L1KA 1AQ6A 2WM3A 1FFYA 3S81A 3B8EA 1ZBDA 3VUEA 5AKZA 1M2KA 5JAOA 4AKIA 3K96A 1Z45A 3DZDA 4UDYX 1ODSA 3KD3A 3BGDA 4I8DA 2QLJA 1EWQA 1LS1A 2X2FA 1PNVA 1U5BA 1QLJA 2P5YA 1NQVA 2NTEA 3ZCUA 3DMRA 3F3SA 3IKVA 4NBRA 5HIJA 2Y6UA 2RBGA 3MGKA 2DQKA 3P4YA 1YS2X 4LV5B 3RSZA 4NZMA 1E7YA 5C1BA 4BNKA 5LMNB 1D4ZA 2OCYC 2FWIA 1TVKA 1CJTC 2OGWA 3I9V6 3L7LA 4D42A 1JFVA 3U3DA 2VQSA 3S29A 1OUMA 4G25A 4FNMA 4KSCA 1X3SA 1RWNA 3ET4A 3O8QB 1JEDA 4XUDA 3UOWA 3AT1A 4LAFA 4B4VA 1AKQA 3PHGA 2A30A 5A7GA 4ZARA 5CEEA 2ZRDA 1SC9A 4Z0NA 2D8MA 3LYHA 3ZBQA 4EHIA 5C5IA 2N1BA 2H1LA 2I7VA 2J3DA 3RFFA 3G82C 4YTEA 1NUHA 2WHPA 1E7RA 1Y8RB 1AX9A 4MJ3A 1S89A 3VX3A 1U5AA 3AM5A 4CL3A 3IE2A 5G1OA 3FPGA 3EB9A 3FOBA 2AK3A 5BQXA 3GLHA 4WESA 2AD5A 1AZWA 1DBRA 1OIWA 1VMKA 2EF1A 2YN4A 3AIKA 3DB1A 3KFXA 1E2HA 3NM4A 2FSFA 4QPCA 5JS6A 1GPWB 1FNSA 2R6DA 1QU3A 1I3LA 4QHYA 2PZAA 3RFTA 5K8IA 4PSDA 4YFVA 2H51A 1GSIA 1WR8A 2VWPA 3EVEA 3H9UA 4LE1A 2JH3A 1HZJA 1YOVB 3HSKA 3ER8A 2A5FA 1JR3A 3CUWA 4EA6A 1A7KA 1LC0A 3RAEC 2I4MA 5CW1A 1CIJA 3KTFA 1DQPA 2E49A 4TN1A 5I51A 1Q92A 3BXPA 2Y27A 4KH0A 1E69A 2JGFA 1V4BA 1XNHA 2D1FA 3JCZA 4PEVA 4UTRA 1SXQA 3KKLA 3L6EA 3IEVA 1W0KA 5MFZA 2FVXA 3FLBA 2VDQB 4NV1A 1TMYA 2O2YA 2XTNA 1HY3A 1WMSA 1N6PA 2X22A 3DS8A 3FPEA 5K0EA 4ZO9A 3AI2A 3AUSA 1S3SA 4IVRA 1RJFA 4FJ2A 3L7YA 1PR9A 2G07A 1EHCA 2V6IA 2PX2A 3EWSA 4IP0A 4JA0A 4MQ6A 5K3EA 2W58A 4KQ6A 5CA0B 1RPTA 1VYTA 1WLYA 3ILSA 3MGCA 1N7JA 1J0XO 3A6DA 3AR5A 4ZRNA 1GKLA 1K3UB 1HV8A 3VOAA 2HW8A 3ZEAA 3HI6A 3LDUA 2G83A 4P35A 2OV8A 4HGYA 1LWOA 2ZVQX 4LZOA 3JU3A 3QFTA 4CMCA 1Q7EA 2ZDQA 2YV3A 4KQIA 1PEDA 4UEOA 1DIBA 5JNWA 1HR0B 2BKAA 4I55B 3AR7A 4WK6A 4P58A 1RWXA 3COJA 1UXGA 1ZRSA 3IPYA 4MR7B 4HQOA 2IX9A 3R8CA 3WNDA 2FX3A 3CVVA 3MSXA 3ED5A 3M2PA 2RG7A 3PGXA 3V2IA 4D56A 2O59A 5IJZA 2OFOA 2IH5A 4KFTA 1SBNE 3HUTA 3TPCA 1I33A 1V3UA 4I55F 3W5DA 1S4QA 3EGIA 2BR5A 3L4BA 4HDAA 5KI6A 2R1UA 2JGEA 1AE1A 2PNFA 4MR9A 4MWCA 3EAFA 1BMFA 1EAMA 1JRLA 3B85A 1G4HA 3HC7A 3LF1A 4XA8A 5ELLA 5FBHA 2AV6A 5JO9A 5TPWB 2PNJA 2ZKLA 1PUJA 2XMGA 5F23A 3KVRA 3ZGNA 1F2DA 4B8ZA 3RJ9A 4BNNA 3TNJA 3ZU4A 4OLBA 3WYCA 1QJCA 2EOAA 5EJ8A 1FNNA 1WB5A 3AHDA 4UM9B 2HYIC 1WUHS 2C0QA 5KYYA 1S9HA 4NCHA 4PQRA 5GZ1A 4Z53A 4RPGA 3EIOA 2A78A 3VDMA 3FSGD 4YGYA 2ZJFA 1B43A 3DDWA 4RKFA 4KNYA 1KPHA 2YWDA 3R3WA 1U98A 2IU4A 1YMUA 1YGPA 2W71A 1D6NA 3Q7IA 2NU6A 4B73A 2B2XA 3PNPA 5A3SA 2PT5A 3BJEA 2HSGA 1WXGA 3V7FA 4AZVA 1VIAA 4LRUA 1L2TA 2NZWA 3T61A 4CI0B 1WKBA 3HB9A 3HEBA 5IXJA 5L53A 2FV8A 1H2HA 2Y3IA 3H2ZA 1MNAA 2XQKA 1VLJA 3A4TA 2ENUA 2FPUA 4RVOA 3V80A 4KAAA 2GD1O 2UYQA 2VQEB 4KRYA 1E3JA 3DB2A 3SYKA 4MGHA 3VR2D 1PV4A 1UXJA 2NTNA 2QL7A 3ZV3A 1H9CA 5TB5A 3I1JA 4OI2A 1NBAA 1G8HA 1I13A 1G9SA 1XPJA 2QQ0A 3GFBA 1X7XB 2F62A 2WZBA 1A27A 2WD7B 4J2HA 4QDUA 3D3JA 3T9DA 4BC0A 5EI5A 5A02A 1LBIA 2OLJA 4WOCA 2XNKA 1M8GA 3TLXA 3UJ8A 3X44A 4EYOA 3FYCA 2VNHA 1EJ0A 2ZBFA 3DMYA 3OFKA 3OJ0A 3OIYA 2PX5A 3K1ZA 4K6KA 3K9FC 3FFTA 2IYFA 2PDAA 3N2GA 4KKVA 1OFIA 2YFKA 5J2UB 2ADOA 2P68A 3L4SO 3M81A 1SKYB 1ZKMA 2DLDA 2ZWPA 4OHOA 4AFNA 1R74A 4LOHA 3HCWA 1KOLA 3RUDA 1ILEA 2BE9A 4OFXA 4WKCA 2IQIA 2WWIA 3HJTA 5DTJA 4CCAA 4XWKA 2QSZA 1RXSA 2D74A 2XVXA 4UNIA 5BR4A 3EOAI 3CF2A 3ZEIA 5K0TA 4LSZA 1NVKA 1AKMA 1ZH8A 1KBQA 3KYDA 3Q8LA 1SC6A 1USGA 1GCGA 3DCJA 5HJEA 3BCRA 3WQSB 5A6SA 2AWOA 2IV7A 5LFAA 4A36A 4LJ4A 5EGSA 3N59A 1E5QA 4A10A 1BQ3A 3UBTA 2XRMA 1M0SA 1JV2B 1BHO1 3O7WA 1AY0A 2MR6A 3D31A 1MHTA 5IYZF 2JLQA 2Z58A 2F43B 5D86A 3P45A 4GOLD 3T35A 4RMHA 4INOA 3SC3A 4BPBA 2R2GA 4K9RA 3G88A 1IUOA 3OT5A 4R9UC 4S3MA 4UM7A 4WKOA 2CK3D 3GXOA 2IC5A 4KLCA 2VQ3A 3STVA 3N6VA 3N0VA 4B0PA 1MIOA 1S8FA 1FMCA 3TR0A 3NM5A 3A1UA 1PZEA 3B3AA 2P8SA 4DWVA 3EAGA 1LF0A 2ZKIA 5A1JA 4P3NA 5FUXA 2ZJ8A 1KH2A 3NXKA 2XY4A 1W0JD 2AJTA 4ZHQA 3AVXA 1TYBE 4B6GA 1C8BA 4XIGS 1PN3A 3GW8A 3QBDA 3LWDA 1NPDA 4PX2A 5KAMA 4YUVA 1FTGA 3X43A 4ZKDA 1GZ5A 1NQWA 1J25A 2RKOA 5B55A 5B58C 5K8TA 5K45A 4C7OA 2RIRA 3HJFA 2ZIVB 2Q3BA 1BCSB 4NU5A 4CLRB 2ZS7A 1GU1A 5JQGB 1XGKA 4K6OA 3Q2OA 4QOSA 4JEUA 1Q7GA 3EVTA 3H2KA 1W0KD 3CGWA 3TQFA 3WS7A 4P6VF 1PE0A 2PGLA 3Q1KA 1E62A 2PKQP 3KEGA 3OD1A 2QRUA 5D00A 1QMGA 5DH9A 3OFND 5EIOA 3R7LA 3DLBA 3Q9UA 3QVUA 4LOAA 3O26A 3JD2A 1KMQA 3ND5A 4LC0A 1XAHA 4YRQA 3V1YA 3RJ5A 3DCNA 3DUFB 4BNGA 2CD9A 5KQSA 3RRBA 4R40A 4CQMA 5JVDF 4QUIA 1ZA2A 4ZV4A 1W5SA 5EEGA 5HW0A 3U6KA 3BMCB 4XVUA 1A8HA 3L06A 2G3YA 5ICEA 1K9VF 4V0MA 1BKYA 4I2VA 4OK5A 3ZHZA 3ROGA 5A62A 1D2EA 3DL4A 1C7JA 1GAQA 2B8EA 4I9HA 3ZKWB 1J2TA 1SXIA 1DQZA 1Y3BE 3KQWA 2FK8A 1XP5A 4DA0A 1DXYA 3WRXA 2DX7A 4URVR 1Q2UA 3H42B 4JROA 3FCCA 5JVDB 1CKEA 3CV3A 1NMXA 4OXNA 3WISA 2AQ8A 1DLJA 4CRWB 1S2LA 2QJOA 4Q3EA 1UAAA 2RHCA 3HKEB 1RBYA 2Z04A 5E4TA 3SFVA 1KH1A 1KQGA 4GG1A 1Z6PA 2OHJA 1IWPB 3BWXA 1BMFD 1RI5A 3OQJA 4QYTA 2XZOA 3SYNA 1GTRA 1HG0A 2WE7A 4IAOA 4L0MA 2PA0A 1I5EA 2QY6A 1ZS9A 4DXAA 2OGSA 2XI4A 2UDPA 4KQWA 1Y82A 3H5LA 1LNZA 2R8RA 3MXTA 1YS9A 5TPZD 3RARA 3UT5A 5LB2A 3QBTA 1G0NA 1P8AA 3JYNA 4TYNA 3UPDA 2GRUA 2CVFA 2J9YB 4RADA 3HVUA 2X1VA 3NHLA 5B6JA 1TZ2A 4GPTA 1UZAA 3TLMA 3EGEA 2RBKA 2J3LA 4KP7A 4NATA 3NYWA 3V8PA 4ZQBA 5FIUA 3O6VA 3U26A 6REQA 4RJJA 2N47A 5FPSA 3CMCO 2DWCA 1PU2A 1YDEA 1F3OA 2JRLA 3Q3GE 1KVQA 2BE7A 3ENWA 3O4FA 1G42A 4OSPA 1UJBA 1UM8A 4LBYA 4TS3A 1QHHA 5FV4A 1DG9A 3DE6X 5JBIA 3TLCA 1JR2A 4QC2A 5JMPA 4RHEA 3EYWA 5AM0A 1CY2A 4Z49A 4RHUA 4HYTA 4LE0A 5K8LA 4IICA 4O4LB 3F6EX 1WNFA 3QG5A 4DLLA 3E82A 4J2TA 1C7IA 2NU8A 1FUEA 5KO2A 3J7AC 2MJLA 4FHCA 4HKTA 4XW2A 3QPCA 1G1MA 2K2WA 1BA3A 1NMYA 1B8UA 2NWQA 3C6QA 4DMRA 1C7QA 5IS2A 2FW8A 5HJ2A 1RYBA 2C57A 3PGLA 1GNPA 1DQNA 4W8GA 1VMIA 3U7QA 3WWOA 3PI6A 2M1ZA 1V96A 2RJNA 2EARA 4EKEA 1H0SA 1HEUA 4J0GA 3VBCA 1G64A 3I0NA 3VSBA 1J99A 1RWMA 1T8PA 2PLNA 2QN1A 2Z9BA 4KLNA 1VECA 2H11A 1W88B 1NNI1 1QTIA 3AEZA 2CBZA 4MX8A 3JAWB 3QVOA 2I3AA 3RBVA 1OWOA 3WP0A 1XWIA 2II6A 1VL6A 1SKYE 3F2IA 3QIVA 2B1QA 3KQQA 2KHZA 1RCUA 2QI9C 1BGWA 4WXEA 1DV2A 3D54D 2MIIA 1OXTA 1WMEA 1W4BA 4RZUA 1OWLA 3SPXA 5DO9A 4NONA 3P71T 1M5UA 4H60A 2IF2A 1CQZA 1PWXA 5ULLA 2AL7A 2W8BA 3MBKA 2JLWA 4KDCA 1CS0A 2FETA 3BMQB 2BHRA 5BN3B 1N1EA 3NNSA 4RORA 2JD2A 2O3JA 1KJYA 5I7AA 1XRSB 2QYSA 1J20A 1RBZA 2KJQA 1P33A 1F5NA 2QS9A 2QZZA 5LJIA 3W3AA 4R2LA 1I7NA 2LP4Y 5CCEA 4L95C 4MVJE 5JHHB 1YBMA 3OFSA 3M6VA 1E3WB 3PI7A 2XSZD 4Q47A 5E6UB 1ZI9A 1KJ8A 3NBXX 2HK8A 5K99A 5CDSA 3BXEA 1X86B 4UBJA 1VTKA 1LY1A 3D3NA 2SKEA 1UBTS 5L7TA 5EKUA 1T1SA 2HREA 4YONB 1OU0A 2KBFA 3AP2A 1URPA 4JV5B 1N8TA 2F64A 1WQ1R 4PTLA 5ENVA 1XXHA 2Q1SA 1IHYA 4YHBA 4ZMSA 3ROFA 3RWBA 2NOAA 2Y1XA 1U1EA 4KXLA 4JVNA 3WGQA 3IQZA 5IEJA 4BPRA 7ABPA 4C29A 4UHHA 1Z06A 2XB9A 3E84A 4WLVA 4MRMA 2WQ6A 3GX1A 4CEHB 4GH5A 2LCIA 5FHRA 2WIGA 5J3JA 4LPSA 4J0DA 2X4GA 2LRHA 4IDEA 5YASA 5BRAA 3NAZA 2CLIB 1ZH2A 4HEHA 2TYSB 4I3FA 4X20B 4D3FA 1X80A 4JKOA 5AH0A 1GPUA 3HMKA 4GUDA 2NGRA 4XLTA 2CFRA 4GPEA 2IYEA 1JH8A 1VXRA 3FZGA 3V7NA 3KJZA 2PUAA 5C35A 1IBCA 1NNUA 3ZTYA 4GZ5A 4DSTA 1ZI6A 1WXDA 2JFFA 3LKBA 3O47A 3HA7A 3SR3A 3T15A 3ZX4A 3PGJA 1QTQA 3PE6A 4YMUA 1FPQA 2PXCA 1KK3A 5LZ8A 5FUQA 1O96A 4LC9A 3COVA 4NV0A 5EMMA 1FRZA 3LIIA 3ZHYA 1WZCA 1AKNA 1IU9A 1E6CA 1XD8A 3LWZA 4JNCA 3ROPA 2AFIB 1XCPA 4FLFA 3TL3A 5TMEA 4QSHA 4LEIA 2H8GA 1NFQA 3PQ4A 4PLYA 2FPPB 4JX8A 3OFVA 4KE6A 4OQZA 3AR9A 4JJAA 1UWCA 2ZIZA 3NUGA 3G0DA 4QFBA 5EPUA 3UC5A 5HSGA 1YIDA 1FS4A 1I3NA 1O3YA 2KWIA 3VR6A 2R6ZA 1KAOA 3I0ZA 3DZGA 1X70A 1KBOA 2HI0A 3F6CA 4WLOA 2Q0HA 2OQ2A 2WIJA 3MUEA 4BASA 2XWSA 3SR4A 4JENA 4B4WA 1PQ4A 4A16A 3PWZA 1E6EA 2QYHA 2O3SA 4TUYB 2CE2X 4CW7A 1THMA 1ESNA 1XXHB 2GCOB 4QGAA 4DQLA 4PAWA 3W8DA 2QJRA 4N65A 3TG8A 2R8ZA 3G23A 1V45E 1WDWB 3EG5A 2X3UA 2VSQA 1A9XA 3JQ9C 1QC5A 1QO0A 3RUCA 2ZJBA 4MUFA 3G8YA 4PLCA 4EGSA 2JHPA 3ME5A 2ZUDA 4DBZA 2ISQA 3AHIA 1JYSA 3GRZA 1GTZA 3G2LA 4DPLA 4EUEA 5I9IA 5TEWA 4MPDA 2YYZA 1JFSA 2Y0CA 1PVOA 3T06B 3CW8X 4HLUC 1QCCA 2VQ6A 1J0BA 1E63A 3N7TA 3JQBA 3OC0A 2HWYA 3PIIA 4N6OA 1I2CA 3ECCA 5TY0A 4AZWA 3NORA 5TQJA 3ADCA 3C70A 4Q18A 4C03A 2CN1A 5J9FA 2OXEA 3GLQA 2OFPA 1E3SA 1U8YA 2P5UA 1RAHA 1QGAA 4GBJA 2HRCA 4TV8A 4YYZA 3DPUA 3AEYA 2Q7DA 3V46A 3U19A 3FDZA 1NWCA 4M1OA 2XGGA 4LJ7A 3TR6A 4CZ2A 5CB8A 1UFOA 2H4FA 3A4VA 3IDZA 4YCDA 1E8NA 1G4AE 3PCTA 1N6OA 2X86A 2XMQA 2YZ7A 4Q6BA 4YN3A 3VHXB 1GPMA 2Q1XA 3GFPA 1BXZA 2I6XA 2HR1A 2AFRA 4KX5A 4C7BA 4B7ZA 2OG1A 1AA9A 1B93A 2YXNA 3EXIB 4WBSA 3AY0A 4HWPA 3TFWA 1Z8FA 4FI3F 4CG3A 2VTBA 3BHJA 4D9GA 2V96A 1VLZA 2PMDA 2GWHA 1U8FO 1A9SA 2IFTA 5CU7A 1E1CB 1RZUA 3L0PA 3MWFA 2R1ZA 1WM1A 2YBDA 3PHHA 5EJ9A 1NL3A 3I8SA 3KVNA 5TF4A 3FH0A 3GEIA 2PBZA 1WU8A 4Q9KA 2NU9A 4MKHA 5JXGA 1V2GA 4OIFA 2ACWA 3C1OA 4E12A 4IWYA 1KZGB 2W93A 4YR7A 3N2EA 2IPOA 2IYXA 3GNQA 2B3DA 5ESXA 4A8TA 1TM1E 1AMOA 2DPXA 1FYDA 1OHHA 5JCZA 3P0EA 4UE2A 5DTEA 4Q7KA 1I1HA 4ZU3A 2Q1WA 2CJXA 1EH5A 1UPUA 2PGDA 5EN4A 2XB8A 5CB4A 5C37A 1TC2A 2SCUA 4NH0A 4ZYVA 1ZLYA 3SMVA 3KUDA 2X8AA 4L5AA 3KAJA 4CKCA 4M9SA 3FKJA 2HADA 5A5GA 5D1NA 1L5SA 2WAAA 2QROA 3F5FA 1RRFA 1MC1A 2PJZA 4LDQA 1RIIA 4EJ0A 3FOZA 4PLFA 3OEWA 3P4UA 4QD3A 5HCNA 4GQAA 3BXZA 5I5GA 4LFAB 2DT8A 2C2HA 4LOIA 5G1NA 4AZ0A 4WX2B 3Q98A 4K1LA 4BN0A 4Q1VA 2ZBGA 3Q6NA 4YWHA 2Y1GA 4ZALA 1NQXA 1OSNA 1Y34E 1WPGA 2EXXA 3R7NA 1YC5A 1JDVA 2XUDA 2FDXA 2ZI6A 3TZLA 1B14A 1QK4A 3BXGA 1YQWA 5KJ6A 5LM3A 5KTTA 3JTEA 1UPFA 5EA2A 3T3DA 1EFUA 3AUAA 2YDXA 4HHEA 5TS2A 5AM2A 4DYDA 3OX3A 3CRNA 3GPCA 2EKBA 3BK2A 5HKAA 2C95A 2JL1A 2NVOA 3GLKA 1N7IA 5HOEA 2ATEA 4YJ3A 3V34A 5CG2A 3RABA 2GYWA 3K0BA 4J03A 3CRRA 4LGMA 2B0JA 1JAZA 1UBNA 4B3MB 2PD3A 4EVIA 2R8EA 2E0IA 1SHTX 2CNNA 3TMAA 1SUEA 1GQSA 2JFXA 2BEUB 2HBZA 2VFAA 4KAFA 2GPAA 1SXJB 5H1YA 5LNK6 5K4AA 5AW6A 2G1KA 1AQLA 1IONA 3T1TA 4XWGA 1NE7A 2XXBA 1L8AA 2XBUA 2R5FA 4OP2A 4WZ6A 3UGQA 5KHOC 1LQUA 4FILA 1FX0B 1KYIA 1USUA 4ZJUA 4XSGA 2HA0A 2XTJA 1BMQA 2OZLA 2YN0A 3LPDA 1O2DA 3OOJA 2YJNA 4ENWA 4O2RA 3LUFA 4BMOB 3ONDA 2ZVPX 3PDWA 2GX6A 1KIMA 4O4IB 4MEBA 4LOKA 4PONA 4CV3A 4FKZA 4YJFB 1F2UB 1KU6A 1P2GA 1U0OC 4M87A 1JKJA 3R4VA 4OFZA 1EGHA 1IATA 4G0ZA 1V1JA 3MW8A 4ID9A 3RRZA 1GPJA 2CLCX 1ISSA 4D45A 3O2QB 1JS1X 1QG6A 1OX5A 1SU6A 5C51B 1ICIA 1POWA 1WHTB 3DEZA 5DE3A 5DDIP 5AW0A 5A7HA 3ZE2B 3O8NA 3RU7A 2H2DA 3X1ZA 2QDXA 3U44A 3D7RA 5BSTA 3VDQA 1YOBA 4K8RB 3AVPA 2CNWD 4RU1A 3ZW9A 3FLMA 3WG9A 5IYZA 3T1YB 5TGZA 5LZ4A 3KXLA 3PGMA 3PXEA 3QYPA 5FUWA 4DC9A 4HX5A 4M2LA 1B6SA 1SC4A 4N0QA 1VCMA 4LJYA 5IP5A 5KWEA 1MABA 5C1IA 3EQ8A 4CLDA 2NZYA 1DTWB 1SIBE 2IUSA 5CM2Z 5K3CA 2W2XA 3LFUA 1EX7A 1ZNXA 1NP6A 2AQKA 3UQYS 2PGAA 2FTKE 2XA9A 5E1OA 1ZESA 5EP4A 1J5EB 1MRNA 2I5PO 3LA8A 4E2ZA 1EBUA 3B70A 5B30A 2R4UA 4G23A 3GK3A 1L4EA 1W5TA 2KLHA 2GNOA 3HJHA 5KNBD 4HDKA 4HEJA 4PQGA 1JEJA 3FBGA 1KZ7B 4WUVA 2UVPB 1TK3A 1ZPDA 3VU3A 1JLRA 2P9HA 3BD6A 4J0FA 1W5BA 4JBIA 4YRFA 4WADA 1JKIA 2RHOA 5IDYA 4EPYA 1IB6A 3TS1A 1J5XA 3HQ4O 1B2RA 3SOZA 3VZPA 2HRRA 4WNAB 3IXQA 2B99A 3A1DA 2QLNA 3O4GA 4BQFA 4Z7JA 5LVAA 2FZWA 2PSSA 4RE5A 3UWSA 1J7KA 3LCVB 3WICA 1O5OA 1MGOA 2QZPA 3SZGA 1HURA 4KPUA 1L7EA 1PFQA 2PKWA 3EXFA 5HNKA 5FADA 4NBTA 3WGVA 3ZVLA 1GZ7A 2UZIR 3ZZUA 1YRYE 5BN1A 2E6KA 2RB5A 5IKXA 5DGTA 3KQHA 2HDOA 3M8KA 2PT9A 3BSWA 3TTUA 4ENQA 2QRHA 1KMHA 1LV7A 3VOSA 3ODPA 2AFIA 2G0NA 4N7MA 5HKLA 4CMIA 5JUWA 3UK6A 2GD0A 2UV8A 2GASA 4GSLA 2H4HA 2XUGA 3MT0A 5KDLA 3EWAA 4RVUA 5TT1A 2ZRFA 4ZI3A 1NOKA 2DETA 4IEEA 4D25A 2A35A 1E2DA 5AOAA 1T26A 2XPCA 3FROA 4H18A 3TGWA 3BFPA 4IDHA 2D2IA 4YT5A 1M66A 5TLSA 1O89A 2Y8EA 4HDOB 1G9TA 2H2WA 3UW1A 3CX3A 1V2HE 4AZ3B 3IIIA 4QT0A 1FRNA 2ZWOA 4XUCA 4FB4A 2EEPA 4G2TA 1IAQA 2I6TA 4HLQB 2O8FA 2EZ8A 2POCA 2Q50A 3RU9A 1ML4A 1VJ1A 2RH9B 1IK6A 2QVXX 3N2ZB 5K3FA 3QHAA 3TI9A 1MD9A 1N2BA 1YR8A 3PITA 3JATB 3R5SA 4YJHA 3LOPA 5B4TA 4IEFB 2FCRA 4IOKA 3GBVA 3HO6A 5CK5A 2PN1A 1Z34A 4D26A 2DU8A 3W7AA 1JEYB 2CLLB 3TH5A 3WQBA 4RZSA 3SF8B 4WGGA 5HGJA 5KVQA 3IPXA 2J9GA 1G17A 3RIXA 1KAHA 4MRVA 4FUTA 2QW8A 4FFVA 3NVDA 2WFMA 4YFYA 1OCEA 2FPMA 2VHJA 4YR9A 4M88A 1FFXB 4YJDA 3N0WA 1E2LA 4E6PA 5HQ3B 5FUMA 1EK0A 1LTKA 1MEJA 3PE3A 4FJ0A 4U0JA 2GCNA 1G2PA 1X7ZB 1LBEA 3C39A 2ENWA 1E2JA 3V6LA 3TB4A 3FNRA 1FXWF 4TX1A 3ZIDA 4US0R 3KEMA 3P52A 4RSRA 2GR9A 1DE0A 2HOQA 3BL6A 2R66A 3DVSX 4N7RA 3U13A 3W8FA 1ESZA 2VCHA 4R8VA 1NI4A 3JPWA 1I0LA 3GMTA 1QIEA 2WVHA 4A0GA 4NCNA 2A9FA 4TMYA 2PJUA 3DZ8A 1SRRA 4JT9A 1FFGA 2LUOA 3GEMA 2JEZA 1L7BA 5HR5A 1TEXA 5FWYA 2FFAA 4EW2A 2HJHA 1BSVA 2I4LA 2CYBA 1P5FA 3C5VA 6Q21A 2WICA 4G5FA 3EFOB 5DSXA 3WY9A 4HH4A 5FTNA 3G9XA 4DB4A 1GVHA 3DEHA 4B3JA 1HDOA 4X84A 4LNAA 1X1DA 2PYDA 2W2KA 2NO0A 3DE7X 4NYJR 2BF7A 4LWQA 3GG9A 4RVNA 3W5BA 1P9WA 2HYDA 3U7QB 2XCSB 3MTEA 5D5QA 5THKA 3KZKA 4MYSA 2DHCA 5FAKA 3BB3A 5H3HA 2CCGA 2WUEA 2Q3JA 3TMKA 3HRIA 3S70A 4DG5A 4OHYA 3OO0A 4LJ8A 1H8EA 3M7IA 4LBZA 3RB8A 4MMXB 2ZSUA 4UNQA 2YCLA 2G0TA 1DTSA 5EVCA 4TS9A 4UDNA 5K0LA 4EBFA 2UUCB 5JI2E 4O4HA 3NKVA 1AH2A 3HXTA 1YA4A 2RHRA 2H2FA 1VJ0A 5G4KB 3K1AB 4AY5A 2Q7XA 1XHLA 1G20A 3I09A 3RREA 5JISA 5JC1A 3NDPA 2XNJA 1V26A 4JLUA 3TPZA 5EJ7A 1V16A 2X6TA 4UMFA 1XEAA 3U3XA 1ZQ9A 2IY7A 2B4KA 3H9GA 2JGDB 4HB3A 2XBLA 1EX1A 5TQ2B 4OGLA 4QOGA 3JXEA 1R18A 4FYIA 1A8UA 2GPSA 4LXXA 2WPNA 5LP6C 1ETUA 3OQMA 3N0XA 3P9CA 4HDRB 3EF1A 2R00A 4HDSA 3U4DA 2IVZA 2A9KA 1G9XA 1KYWA 3THRA 1VSQA 4J07A 3LFHA 4NAUA 1P2SA 4OCZA 1VE5A 4O5OA 4BP8A 5J47A 1NC3A 1MORA 3UJCA 2C9CA 5SICE 3T3EA 3JQPA 5JSKA 3TQOA 4GT1A 3CSSA 3CUKA 3RNOA 3I3OA 4XX0A 4R8KA 4L9SA 3K6JA 5LWQA 4Z5XA 2TRSB 4M1QA 4DMLA 3RSGA 3PJFA 3TIXB 3CUTA 1ZSYA 4J0JA 1C0IA 1Q7BA 2V8OA 2Q4EA 5ITWA 2VLBA 3DBRB 1BGXT 2HA7A 3OMXA 1A04A 1CUUA 1II8B 1C3VA 1Z3CA 3A26A 1LX7A 4NJMA 4O2AF 4CMGA 1Q84A 2H6EA 2VPTA 3DOCA 3QVVA 3GUZA 1LF5A 4HAYA 2VCEA 4WTOA 3F96A 4XARA 4N12A 2DWOA 2RCNA 4YP0A 5TV2A 4OO3A 1PK8A 3UJBA 2O0MA 3WQQA 1T15A 1CULC 4EEKA 1X3LA 2D7CA 3OZ7A 3DAGA 4F45A 2CZGA 3PQCA 4FT2A 2WC1A 3E9DA 4PS1A 1LD3A 4PGGA 4U9HS 5AKXA 5J63A 3IAM6 2A1IA 4QNMA 5BWBA 3K9WA 2XUZA 1G20E 4PG7A 2JGNA 2HA6A 3D4PA 1LDMA 2A9VA 2OUIA 4HAXA 3QLVC 3QWHA 4JZKA 1VBFA 1NASA 4OB7A 3HWSA 1DKOA 5BPFA 2C3OA 2PSHA 4AKSA 4DABA 4BLQA 5JRDS 1TQ6A 3G3EA 1LDEA 3QWFA 1OREA 4C6TA 3FZEA 2FVYA 4R5HA 3W2HA 1I1QB 4DGSA 1QQAA 1E7QA 5EP1A 2HTFA 3G6WA 5EXPA 4ZZIA 5BP7A 1PFYA 3ADKA 3FSJX 4UAUA 2J41A 4UW9A 1Z82A 3ACDA 5JCOA 4REQB 4P0TA 1ZUHA 1YI1A 4UBKA 2A9RA 1M3SA 3IO5A 5LZ9A 1C0LA 1EAYA 2OYRA 3UKOA 2PZJA 2EKLA 1JFFB 4B9AA 3FSEA 2C82A 2H59A 3CNLA 3EMVA 1EX9A 3Q88A 3KSZO 1YRLA 1ONNA 1XNRB 1UBKS 4M46A 4P7KA 1PZMA 3WLQA 3ZCVA 3ZIAD 1DDGA 5TVKA 1JLMA 3CONA 4YAWA 1CE8A 4V1CA 2Q1UA 3MJFA 2W11A 2QP4A 3HUUA 1GUYA 4JB3A 2G1JA 3F78A 1RRKA 3KOYA 4TYQA 2RONA 2YQZA 2FEPA 3G1WA 2O7VA 2P2YA 3BJMA 3PCXA 4KAJA 4X3CA 4ENSA 1PW5A 3AQ4A 4FD3A 1UT8A 5CBPB 1O0SA 1B3BA 2P5TB 3G0CA 1PFKA 1JI3A 2JGDA 3IESA 1Z29A 4OYYA 1KBZA 4F92B 3GUCA 4PYKA 2FEMA 3DKKA 2IYYA 2PQ2A 1ZISA 4IJKA 4BJ5A 5BRNA 4M21A 4NE2A 1R8YA 2Z9DA 2VDNB 4PYNA 1NQAO 4RO0A 5JAHA 1BH2A 1E1NA 1ZA1A 1ZM3A 2J3IA 1VHQA 2HWXA 4ZOBA 4AT1A 1MDBA 5JZMA 2HIGA 4FCVA 1YQTA 1E4VA 1FQWA 2OCGA 2H1RA 1E4OA 1FU4A 3FG9A 4JFAA 5DLPA 1AO0A 1DQSA 2R96A 3JQAD 3NAGA 3DC7A 4FR5A 3USES 4XX1A 4JGBA 4MWTA 5A6SB 4KPFC 2PUBA 5F77A 1QBGA 2DUJA 3H84A 3OLQA 4YASA 3U1TA 1F17A 2VBIA 3DF7A 1GIAA 2MSCB 2OHXA 3ZCSA 4EVRA 1EUQA 5CYPA 3T5AA 5LQJA 2HNKA 2OVBA 4NSNA 1N6KA 4JCCA 1F5SA 2I33A 2JGRA 1X2BA 3DBLA 1AS0A 4IKOA 4B3XA 3HXKA 3BYZA 2VYNA 4QSMA 3KKEA 1FMTA 3GWZA 3C4QA 3DQQA 2ATXA 3KR9A 1OA1A 4KV9A 1XK6A 3U4GA 4NXNB 3K70B 3DP9A 2XCIA 2BFCA 2XEXA 3ABRB 2GVZC 3EDYA 3MCWA 2XOKA 3P2OA 3PJGA 3TOXA 5CEFA 1FLDA 3JQEA 1R00A 2FPLA 4RLFA 4B4DA 1E2PA 4CDNA 2IY9A 4DM3A 4EG6A 4ESEA 5C8DA 1T1EA 1W47A 2Y77A 3O84A 3E7PA 4NENA 3RFUA 3ZDQA 4B7AA 4LBWA 4LF6B 4LFBB 1QE3A 1KHHA 1RPAA 1ULBA 1YFZA 4O0MA 1VLMA 4W6ZA 3P9IA 1AXGA 3SFZA 4DUGA 1P60A 2HQRA 1RYFA 4Q4AB 3ZWKA 3M3DA 2OV3A 4QFDA 5AK3A 4BNJA 4U5XA 4CL2A 2OB1A 2NYAA 1L6RA 3BIFA 3GN2A 2IBSA 1NF3A 4B2IA 3DFUA 4C0AC 1MB9A 1O0BA 1VP9A 3L0OA 2AFVA 2QG9A 3FTPA 5IK2A 2QZJA 3A58B 1G18A 3O8DA 4PZLA 2WSSA 1IQPA 1N3YA 3AFMA 1LJUA 3L8HA 4S2EA 1F1BA 2NUAB 3TRJA 4WBNA 5IT5A 4M0MA 1SVMA 4G1BA 1GPLA 3B7GA 3O91A 4WLNA 4WKBA 1M7HA 3AH8A 3DOEA 4E5VA 3HU2A 5DBHX 2X14A 2KB0A 2VJQA 3DDZX 4FFWA 4Q48A 3RYFA 3W6NA 2NYUA 2J87A 5ES3A 1OOEA 1ZIYA 4P8RA 1BVRA 1XBTA 3NHMA 1UBMS 1X42A 5ALKA 2A6PA 2VDWA 3DTNA 3SX2A 3WRWA 4D4IA 4CMEA 1N3IA 4EW6A 6CHYA 3COWA 5KYGA 4P3YA 2BFDA 1LLCA 2JIZA 3EZ2A 4KLAA 5T57A 2GMWA 2QVYX 1GN8A 2CDRA 5DBOA 5JE8A 2HHHB 2HU7A 2Z08A 3OURA 1R16A 3IEXA 3BZUA 4Z3OA 2QRVB 3GT3A 1ADFA 2OZPA 2ZIXB 3W79A 1YU6A 2PZ8A 1TT7A 2FJPA 4KIGA 4M9ZA 1V5FA 3DWFA 2EZ4A 4RGYA 3QKTA 2GRAA 2IITA 2BBSA 4BWVA 3HJGA 2GN6A 1Q0HA 3B7PA 4LMAA 1U0GA 1BJKA 4HGNA 3TMYA 3LT2A 2HZBA 5E6SB 3VBEA 1Y1PA 1EJBA 4QPJC 3EMKA 3WMFA 4FTWA 4EYEA 2GN0A 3H9CA 3TN7A 4G8DA 3Q7EA 3AZQA 3JD0A 4MQUA 2QD1A 5CHYA 3VH4A 5TGTA 5DEIA 4FEAA 5BVHA 3NWEA 3P9PA 2WNSA 1WEHA 3QU4A 4MVCA 1VJGA 3GA7A 4CYMA 5K0BA 2DBRA 3GP3A 3QRWA 2HQOA 3I58A 4MPTA 5THQA 4NU0A 2JJMA 3KQKA 2VF8A 1N8NA 2FKNA 5KTSA 1O08A 2D54A 1M34E 4QJ5A 5CIYA 1DIHA 1X9IA 4HYEA 1YUNA 3ANYB 4B6QA 2Z6QA 3GLTA 5B6IA 3GZNB 1ISJA 5JD5A 2IYOA 3I64A 4YRCA 1WVIA 4TKLA 2EHJA 3LKZA 4QUDA 3WHIA 4CCYB 4HNQA 2YY5A 4G4SP 2G6TA 1QANA 1PK9A 3PYMA 5KPDA 3KVYA 3QIAA 2FZGA 4FHDA 4I6GA 2HHJA 1NKSA 3VKWA 2QAGA 1ZU5A 4BFVA 3S8EA 3EGWA 2FPIB 1VJRA 4PLHA 2ZSKA 3RUHA 4EO7A 1H2RS 1JDPA 3ZGXA 1WZNA 2ID8A 1KK2A 1ODFA 3C14C 2DQSA 4AS2A 3AONB 3SXUA 2G5PA 3FB4A 3KYBA 3QVJA 2LIPA 3ETLA 3IX7A 4CEHA 4C4PA 1Y4DE 2C7BA 3P9SA 4TKMA 4PAMA 1MT3A 2IDMA 4NICA 3GF4A 2BJVA 3LW7A 1DX9A 1FU8A 1IYZA 3MF4A 5ED0A 3K0AA 3BB4A 3UH0A 3HHEA 4MVJG 2JJYA 3MJEA 4BNDA 2PUJA 3FMFA 2FK7A 3FNBA 1JHOA 2VZ9A 4KWHA 3ICPA 1C3OB 2ZXFA 4Y9SA 4YS6A 5IVDA 3W05A 4CL8A 1UXOA 5IFKA 4L28A 1R10A 2F67A 1TXGA 2ZJAA 4X7BA 1J06A 3VYVA 3VO2A 4RA9B 1OGYA 3TGPA 3ZDZB 1W96A 1GXSA 2VUHB 4HLDA 1HKUA 5KNDH 4LECA 2CEKA 1M8FA 4DN6A 1ULZA 5BWCA 4V39A 1TPZA 1QGZA 4A6XA 1FSFA 1N8KA 5IRCD 1FU7A 3E5NA 1N2CB 4AY4A 5IBPA 1RSZA 3RVSA 2DBVO 4U2BA 5C8VA 2N46A 3ZDDA 3IIKA 3WLFA 4IIVA 3SVLA 2GUWA 5F7OA 3ZXYA 3RR2A 3TXAA 2BBWA 1J0EA 3Q4GA 4PWZA 1PR1A 3N1UA 4PANA 1W30A 3U2QA 3LLSA 4D4GA 2JI8A 3BKXA 1SUIA 4C5CA 5JEDA 2J0QA 4P33A 1QVZA 2QUBA 3HCCA 1V6AA 3UV3A 3N5CA 3B1XA 1RNLA 5IULC 3IBCA 4R69A 3I62A 5HX7A 1KFCB 5G0SA 5EIXA 2QP3A 3RYHA 4Y2RA 5ESWA 3OZBA 3MPUA 2X40A 2QLLA 4MW5A 4IV8A 2VSNA 1JL3A 4OAOA 1HBJA 3SEFA 4U7HA 5H9VA 3TM4A 3ZKAA 3OZGA 2LBPA 3QW2A 4O4IF 4C4RA 2OQIA 2YQ4A 4Y2PA 3HBFA 5JJCA 1G8AA 5KQGA 5E3HA 3KETA 2WSBA 1NNEA 1T8SA 1KARA 2P78A 3A3NA 3HYNA 4LYYA 1U3TA 3FFAA 4NKRA 5IAKA 1FK8A 2XGMA 5F21A 1EFAA 2V6MA 4Q1EA 3RS2A 4BNHA 4RXMA 5H4HA 4EY3A 1KPGA 1KKMA 3EXEA 1SEPA 2B78A 3TYXA 1EQAA 2X2EA 5REQB 4KV7A 1R9MA 3DLTA 5LUBA 5HM6A 1ZR4A 4Q0MA 4LK2A 1SCUA 5ECGC 5K4HA 3BX1A 2FSPA 4G97A 4PIPA 1QH8B 3ROTA 4B6RA 5HVNA 1I4LD 3K3PA 4UM9D 2ZB8A 4C08A 2V3WA 4GM4A 1DXQA 3OHSX 2FR8C 4JODA 1NF9A 4L73A 3GFRA 2JGJA 1N6LA 1B7GO 3CF6R 1MJHA 4C3ZA 4MTCA 3GFFA 3BE8A 3CRZA 3HBAA 1AZLA 4KHZA 1NU6A 1USIA 1VRVA 4UPDA 3DP7A 3PLAE 3U3ZA 1V43A 1P1BA 1M9NA 1QB7A 1H4VB 3KTAB 4NOKA 1JB1A 1AURA 5AK4A 5JFGA 4JYCA 3VR5H 1W35A 2VOEA 1VCNA 2BGMA 2BIFA 2OOKA 4I5GA 1KFJB 2IUTA 3WIOA 2Z57A 4C76A 5F3DA 1M1XB 1H22A 3GDWA 4B3FX 2A58A 3D1JA 4BMCA 4O2BA 1IXRC 1Z2DA 1DG3A 1RCFA 1PS0A 4QBHA 2PBFA 3WYNA 1L4FA 4MEJA 2LWIA 4YBZA 1E1CA 1VGQA 5FO0A 2WJHA 4IUYA 2B1IA 2VP9A 4XDZA 4ZAYA 4Q21A 1C5KA 3T7JA 3W5UA 1JFTA 1CTQA 3NFYA 4RHXA 4X1YB 3UHPA 1MX9A 4HD8A 3WIEA 3DL2A 2ORIA 1PAUA 1TTQB 2A14A 2C92A 2RE8A 3KFLA 3CH5A 2O8FB 4D9NA 4J2OA 1A9PA 3AJ9A 1B1AA 3MCZA 1O4VA 3G2OA 2VHXA 4QPZA 3QVTA 3RM3A 5I47A 1RBQA 1DG1G 3LCCA 5AM1A 2VXBA 4RABA 4NJMB 4EM6A 1YA6A 2OR3A 3CPJB 5D5PA 3F4LA 2PMFA 4GMDA 4MQ5A 3NS7A 3O8OB 1F2VA 1J23A 3FZYA 1P7CA 2BGKA 3DDNA 5HRCA 4C43A 4IHKA 2YC2C 1Y48E 5F73A 1U0EA 3HWRA 3PUIA 3G0OA 1ZSVA 2I3DA 2VPWA 1HDYA 4DLVA 5JSHA 3IIEA 3VAAA 3CXUA 1H3FA 2AHOA 2IHNA 4DLNA 2X9QA 4O3MA 5BW8A 1C8VB 4I3HA 3U5TA 5EIEA 3F6YA 1GNVA 3BRCA 1KC3A 4I14A 4I8IA 4WN9B 1ZYUA 5JT1A 1NNSA 1OX4B 2CF5A 2OL4A 2P35A 1A2OA 1QH1A 2IP2A 2VT2A 4LNUA 1XRQA 1EFRD 2GDZA 2HRQA 1TQ4A 3LBHA 2V0GA 1XZNA 3IB3A 4NTZA 2ZAIA 2C2MA 1HC7A 1QKJA 1D2CA 3LUAA 4H0FA 5DM2A 2QX4A 2XUKA 1MQAA 3MZ0A 3UGJA 4P4LA 1QU2A 4G5RA 4BO7A 2VR1A 1KTIA 5AHOA 2V74B 2W2TA 3C5CA 4L0QA 3ROQA 5CNIA 4YMGA 4CETA 5JH7B 4BC1A 1ZNZA 1GZUA 5EWMA 1A9ZA 1YIOA 4Z3DA 3U17A 3X3HA 4DC0A 3AGQA 4MA5A 1U3WA 4ZGBA 4UARA 2R86A 2D0OB 4FC6A 3GRVA 1RE0A 2INGX 1YD7A 4JC5A 2P1RA 5IWAB 5DM4A 4Y8VA 2OY0A 5LSAA 1NP3A 1MOPA 4N3GA 2VDJA 3KU1A 4M98A 2WILA 1A3CA 3ZU6A 3SZMA 1SA0B 5BQ3A 1CNFA 1QP0A 3P32A 1E0AA 1SULA 3VZBA 1RACA 8ABPA 3CLTD 4JD5A 2QNIA 2SNIE 2RGBA 2XCQA 1CDDA 2NYVA 3DVQX 4UAJA 5CLHA 4PFSA 4RD3A 4BKRA 1WLSA 4GVPA 2BHNA 5LP6A 1OWNA 2C97A 3RVJA 3JQGA 3N2IA 4NVRA 4AJ9A 3OI7A 1BEUB 3R6GA 1ZK0A 4G4IA 5JHGB 2DFVA 4TXLA 2X6RA 1X14A 3KHTA 1QNLA 5LKAA 1CSEE 2JAOA 3HR7A 3ORSA 3ZTTA 1AF7A 3SEQA 5AUNB 1LI5A 4QVGA 4QT4A 1GARA 1ZCAA 1EHIA 4DCNA 4QUKA 3GFSA 1AKWA 4EF4A 2GYVA 4K0RA 5JROA 4CLEA 4FD2A 1ZCZA 2ZJ3A 5KCMA 2GKOA 2AZDA 2EVWX 4H7IA 2A92A 1MJFA 4C4AA 3K9CA 3ZW8A 1RPNA 2ZRNA 4YJFA 1KH3A 5GM2A 1B0AA 1NYTA 2NVUA 2WWRA 3KHUA 4JX9A 2OYCA 4G37A 1EDOA 3QPBA 3G5UA 1V0JA 4FNAA 4EPVA 4GKBA 3OM1A 4UHCA 1I10A 3V2GA 2RGNC 4MUNA 3VXKA 4JCOA 3HVHA 1YS6A 2H5EA 4PPQA 2JKVA 5B3KA 3W1WA 2CNBA 1OZHA 1Z2AA 4EHKA 4I46A 5K7SA 4BAUA 3T4PA 3IDAA 3Q9SA 4JC8A 3SWWA 3BMNB 3ZXSA 5L4LA 2EJTA 3FFWA 5B57C 3C74A 4G56A 4IG9A 4RZQA 2PFSA 1ZN8A 2W6OA 1AKUA 1O95A 3IDFA 4MHTA 2VF5X 1CDOA 2BTOA 2H4ZA 4CN8A 1LPNA 3BMNA 1OLXA 1CS0B 3PDIA 1DKNA 1MO2A 5B6PA 4I66A 2V4MA 1NDUA 2PBLA 4JSRA 3OZCA 4MUMA 1AN9A 3BCUA 2JLXA 2O50A 3LUCA 2F4VB 3D43A 3AY6A 4JR2A 2JGLA 4ZKEA 1GL6A 1MQSA 3OCWA 1IZYA 1ZIXA 2AG8A 2H48A 1E2GA 3OX4A 4GW3A 4ZC1A 3WQRA 5BWOA 2Z56A 4DXDA 4Z4FA 5C8ZA 3CLUC 3QF7A 3DKIA 4K86A 4IIXA 2CLFB 1N77A 2XGSA 1IXSB 5D85A 3L1KA 3ZWDA 1S2OA 1P4AA 2ZQYA 2BP7B 3VJKA 1VYHA 4ZYZA 5KNDD 3HCFA 4OMFG 1ZNYA 4R54A 4Y6PA 4EJ6A 2DPGA 3CT4A 3S1SA 3GD5A 1SG9A 1JX6A 1QZ3A 1Z0FA 2BBTA 3H2SA 1OE0A 4TTVA 3ZD6A 4H4EA 3F6RA 2XEDA 3Q2IA 1Q22A 3DFZA 4G6ZA 4QBIA 5J2TB 1EINA 2FUG6 4OXRA 5EXDA 3QYJA 5HE9A 2ZYRA 1N9KA 2WAYA 4PC7A 1AZSC 1T9GS 2MSDB 1ZNWA 3BS4A 4QDXA 1EG2A 1QO9A 3GN1A 1JJFA 4Y2SA 3V32A 4E3WA 1JIUA 4M1EA 1BEEA 3K53A 3ELBA 4X1YA 3ZY6A 1U2TA 4NFSA 4BKQA 5KYVA 4KYTA 3RUAA 3KWFA 3PUZA 4WD3A 5B7PA 5CBPA 5HKKA 1VCHA 3O8RA 3O3NB 3RHZA 3UG7A 2EERA 3VNSA 1G3IA 2PRJA 3C7AA 1ZL2A 2D06A 2FMFA 3VPGA 3WGHA 5CFZA 2H1OA 1J4AA 4N5NA 1GQ2A 3ESZA 5KWJA 1EZ4A 2YFQA 1WXEA 4M9UA 1PSDA 5IXYA 1ULTA 4TXHA 4B71A 1QQTA 3NRJA 5F5NA 1YZFA 3Q7QA 5KZMB 2FPKA 2CVPA 3O4VA 3ZNPA 3NP7A 1U7UA 3ZJVA 1HT1E 1EFLA 2OAEA 3NHBA 2HH9A 3V7UA 2WZDA 4BV3A 1R66A 1LV8A 1B16A 1Z18A 3WOHA 3OPVA 1IPEA 1DTWA 2NO4A 3L18A 1EXNA 5D01A 1HT0A 4WI1A 2A9QA