4AS4A

Structure of human inositol monophosphatase 1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
274
structure length
274
Chain Sequence
DPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cloning, Expression, Purification, Crystallization and X-Ray Analysis of Inositol Monophosphatase from Mus Musculus and Homo Sapiens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE 1
total genus 90
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4as4A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4as4A02
2CZIA 1LBYA 1DK4A 1EYKA 4AS5A 1NV4A 3BIHA 4I40A 2F3BA 1FBGA 2DDKA 3IFCA 5IZ1A 1NUYA 5IZ3B 1CNQA 2JJKA 3QMFA 3KBZA 1VDWA 4GWXA 1FJ9A 2WBBA 4N81A 1XI6A 4MJOA 4GWZA 5EQAA 2VT5A 5DW8A 2CZHA 1YXIA 1FBPA 2FVZA 4GWUA 1FSAA 3RPLB 2PCRA 1IMEA 5ET5A 1G0IA 1FPDA 1FBDA 1IMFA 2QVUA 1EYJA 4AS4A 1INPA 1Q9DA 4GBWA 4GX3A 1IMAA 3A29A 5J16A 1DCUA 1IMDA 2QFLA 1FPGA 2WBDA 4GWYA 5FBPA 2HHMA 1NV6A 3BIGA 1NV3A 5F24A 2FIEA 1SPIA 1NV2A 4HXVA 3RPLA 1FPLA 1NUXA 2R8TA 5T3JA 5EQ7A 3KC0A 5ET6A 5ET8A 1FPFA 4I3YA 4FBPA 2Q74A 1FPBA 1FPEA 1K9ZA 2BJIA 2CZKA 3FBPA 1RDZA 4PTKA 2FIXA 2Y5KA 1FPIA 1NUZA 1RDYA 3D1RA 3KC1A 2FHYA 5EYHA 1FBFA 3T0JA 2OWZA 3ROJA 5ESYA 4O7IA 2QVVA 1AWBA 1LBZA 2P3NA 4GWSA 1FBHA 4HE1A 1FPKA 1FPJA 1NV5A 1YZ0A 1FTAA 1FJ6A 1NV1A 4I3EA 1NV7A 1NV0A 2F3DA 1DBZA 3B8BA 5EQ9A 1K9YA 3RYDA 1BK4A 2WEFA 5A5LA 1JP4A 1FRPA 2GQ1A 1QGXA 5LDZA 2P3VA 2Y5LA 2Q8MA 4G61A 4GX6A 5IZ3A 1FBEA 1D9QA 1G0HA 1RDXA 1LBXA 4H45A 1KZ8A 3LUZA 1YYZA 1KA1A 3LV0A 4HE2A 1LEVA 4GBVA 4GWWA 4QXDA 4KXPA 2OX3A 2QVRA 1EYIA 5EQ8A 1KA0A 4H46A 1IMBA 5ET7A 1IMCA 2FBPA 1FBCA 1LBWA 3IFAA 4GX4A 5I3SA 1LBVA 5EYGA 4HE0A 4IR8A 1NUWA 1NI9A
chains in the Genus database with same CATH superfamily
2XXHA 2HFBA 1EYKA 2AL4A 1H45A 4I40A 3OXNA 2LAOA 4FIMA 4IO6A 4IY5A 4OVPA 3U94A 5I56A 3LBSA 1BLFA 3QXMA 4K3FA 1YXIA 4LUBA 4N07A 4MHFA 1Y3QA 1VR5A 1FTKA 4FJPA 5BUUA 4DXBA 3MPLA 2QS4A 4IY6A 4NN3A 3IORA 1NNTA 1FW0A 4M4GA 4GOTA 3UN6A 1B05A 1TFAA 4QFLA 1QJMA 3O6HA 3SEUA 3OMBA 1D9VA 3OSRA 3K1NA 1PBPA 3GYYA 5ESYA 2Y84A 5I59A 4N13A 1NH7A 2DOJA 1LFGA 2O7IA 5K2YA 1MXUA 3TUSA 3EHTA 1JVXA 3QAXA 5AA3A 2FA7A 4PF6A 1JP4A 4MH5A 2I3WA 4ZZEA 1B0LA 4F3SA 3MJNA 1G0HA 1LBXA 4U2RA 4KHZE 3G3JA 3HPIA 4MEVA 5L9SA 4R75A 1I6BA 4FORA 1IMCA 3CHGA 3FZVA 1SVXB 2XXUA 4R2BA 4F1VA 2NWJA 3L6GA 2IA4A 1IZ1A 5CRYA 5I3SA 2Q89A 1XHYA 3UA8A 1SW2A 2D21A 5DEXA 2YPNA 4O8MA 5H8SA 1BIYA 4NF4A 3PPOA 3TTKA 1F9BA 3RGYA 4LA9A 1B46A 3BKIB 1I69A 3RUMA 5CM6A 4OENA 2PCRA 5ET5A 3OELA 2M8CA 3TTNA 4NWCA 1B9JA 2B3FA 1OIBA 3O2AA 5I57A 4ZZAA 4H6DA 1YCJA 2QJEA 3PUVE 5F24A 1S9TA 1NV2A 2F35A 2R8TA 4EUOA 2XX7A 4NEDA 1B4ZA 2Q74A 3ODBA 3U92A 2VD3A 1QKBA 3T9XB 3TYHA 1Y4TA 1PB7A 1JEVA 4MNIA 4ONYA 3MWBA 3TCFA 1A99A 1GR2A 3AXFA 3VFJA 1M5BA 2Y7WA 4HE2A 1FQEA 4WKMA 3I3VA 4QXDA 4YB7A 1SW4A 3W9VA 1MPCA 2PYYA 3UIFA 2DWJA 4ELOA 1AOVA 2F8DA 4Q5TA 1NNFA 3MPKA 1B5JA 4H1XA 2XXIA 4KYEA 3PUZE 5H8NB 3UK4A 3DP4A 3MZ9A 5I59B 4Z0IA 3DP6A 5IZ1A 3CSGA 4P0GA 3KBRA 5HM4B 4PFIA 4NF8B 2ZZXA 3OEKA 2OWTA 1ZMGA 3G3HA 3H6VA 3A09A 2UYEA 5TU0A 1LFHA 2F34A 2DXRA 2XXVA 3TZAA 4F29A 4N6PA 1S7YA 1IIWA 1IMDA 2AL5A 5DVJA 1DSNA 3PMWA 2WX9A 3H6TA 5F7VA 1QUJA 4GWYA 5AA4B 4U4XA 2Q88A 5FHOA 3UGWA 2OK2A 2QL3A 4DCYA 3FBPA 4JWOA 4ND9A 3TAJA 1I6QA 5TP9B 4JXIA 2I58A 4X48A 2DE3A 1NV0A 2DQVA 2OLBA 2WEFA 3JYRA 2MKZA 2Q8MA 4IO5A 4G61A 3JZJA 5EYFA 5LOMA 4PFBA 4ZE8A 4R2FA 4TOZA 2FBPA 3TDJA 4H8IA 4NAPA 3TELA 4QSEA 3FUZA 2RF1A 3IFAA 3CIJA 4GX4A 2V3QA 2ESNA 4JB7A 1SBPA 4U21A 1LFIA 1ZIUA 1XVYA 2KLFA 4BDMA 3BIHA 5AA4A 2ZZVA 1ANFA 1ZU0A 3IOUA 3QMFA 4MLQA 1MG1A 2VP1A 1D9YA 2F78A 3OENA 1ZLQA 2CZHA 3RQTA 4OVTA 3O29A 3M3FA 4YMBA 4G68A 3KN8A 2QVUA 3K4UA 1AL3A 2QS2A 2GH9A 5H8HA 1JW1A 1N76A 4XF5A 2WBDA 3FXQA 4H8JA 3BIGA 3PPQA 4N4UA 4ZEDA 2VGQA 2ZNSA 4I3YA 1K9ZA 1FTLA 4U1OA 3HSTA 3MUQA 4P8BA 4OHNA 2RC8A 3PV0E 3CFZA 2OWZA 3FVOA 2UXAA 5DYHA 1MY3A 3H03A 4KPTA 5AA1A 4OQOA 1FTAA 2VHAA 4Q8RA 1FCKA 1XVXA 3MZBA 2O69A 1B7ZA 3KJ7A 1FBEA 1RDXA 4PGNA 5I5PA 3LUZA 4DI3D 3S2VA 2A5SA 3M3LA 3OO8A 3IB2A 1QKAA 3EHUA 1FBCA 2ZYMA 4MBPA 5H8HB 5KDTA 3RT6B 3TCHA 4XKPA 1A54A 1SD3A 1MQDA 4ELQA 3G3GA 3GBBA 1RYXA 4H5FA 1CNQA 2NXOA 3JV9A 4F18A 3EF7A 5I2KA 1Y9UA 4MNPA 3SKPA 4GWUA 4C0RA 1B51A 1NH8A 3M8UA 4YZZA 1IMFA 3KN7A 4GWOA 3DLNA 1B4HA 1ZTYA 3OO9A 5J16A 2V84A 3SETA 3IAZA 4IO7A 5IGAA 3USDA 1VFEA 3E4RA 2F5XA 4FE8A 3VE1B 5CMBA 2DE4A 1B58A 2GFEA 1XC1A 5EQ7A 3I5OA 5TPAA 3PTYA 1MPDA 2V3TA 4GFRA 4JWYA 2B65A 1D3KA 2X7QA 3WAFA 5I2NB 3ROJA 1UTBA 4O7IA 2VD2A 2XXQA 1GGGA 1AWBA 1MY0A 4O3CA 2ZXTA 2PT2A 4POXA 4MF3A 1YZ0A 4F3PA 3BBRA 4OEUA 3RTWB 1PBQA 2PT1A 3SEWA 4HS7A 3QSLA 1BTJA 2P3VA 3IOTA 1EZOA 1IEJA 1H76A 2YJPA 1OLCA 5B70A 3TCGA 4KXPA 2VOZA 4PGPA 4AQ4A 1POY1 4ZEIA 1DTGA 2GHAA 3C33A 1QW0A 3CG3A 4NF5A 1LBVA 4IR8A 3EQ1A 2ONRA 4DE8A 4AS5A 3O28A 3T22A 4NF8A 4RK9A 1VDWA 2OBGA 3T66A 3BFTA 2F7BA 4IB2A 3Q25A 4PAKA 4L17A 1YTVA 3G3FA 1Y1MA 1G0IA 3MVYA 4G8MA 5CMKA 5TPAB 1H44A 1Q9DA 1Y4CA 4P1EA 4JSDA 4GIZA 1LCTA 5DT6A 3IOWA 3VLUA 1N84A 2H9BA 3F11A 3BFUA 3LR1A 2G93A 3CFLA 3OO6A 3Q26A 5ET8A 2ZNTA 3LSWA 4NWDA 1R6ZA 3TODA 4GVOA 2PMSA 5DVFA 4YU0A 4R9FA 4LQ5A 2H5YA 3MP1A 1FQBA 4O94A 5A5XA 1NV1A 3KOTA 1A8FA 3K1PA 2D3IA 3MZ1A 1K9YA 2ZMBA 3PMVA 3RYDA 2Z8EA 3FXBA 5LDZA 4GL8A 4I1DA 4PAIA 3MYUA 1YYZA 3FV2A 3FD3A 3HCQA 4Z7EA 1IITA 3G3IA 4KCDA 3V83A 1IMBA 1Y1ZA 1Q1KA 3HN0A 4BLAA 4DCXA 4UA8A 1MDP1 2RKMA 3TTRA 2V3UA 1JNFA 2P1SA 3C34A 3DP8A 5KCJA 4KFQA 4WEPA 4I8CA 4RA1A 3ZSFA 2CZIA 4YKKA 4GQOA 1ZJLA 1NNKA 4O3BA 2X26A 4GWXA 1B3GA 1VSOA 2QMWA 2HAUA 4G8HA 5CMMA 3ZS6A 2O6AA 1P1UA 5FHNA 4AB6A 1XT8A 4OEVA 4KQPA 3LUYA 3FGSA 4OFLA 2DWHA 5A5XB 2CZLA 4QHQA 3VLWA 4QRZA 3FXRA 2Y7KA 4YB6A 2RC7A 2H25A 3PPRA 4U23A 4NF5B 4RPOA 4G8NA 2XXYA 2UVJA 4FBPA 3CVGA 4NQ8A 2QRYA 3MVZA 4X1BA 4ZE9A 3OSQA 2Y5KA 4G77A 4GRKA 1GTKA 4QSDA 3PPNA 4KYSA 5I57B 1NV7A 3B8BA 4DLDA 2F36A 2P2AA 4OERA 2GQ1A 4E0WA 4ZECA 2OJTA 1VFDA 4XTCQ 1B5HA 4JBZA 5IZ3A 2Z8FA 4XEQA 2XXRA 4OVRA 2Y7RA 3PUYE 2HQ0A 3KSXA 3N26A 4PETA 4U1ZA 5L9MA 5ET7A 5I7IA 1N0TA 4OETA 4PFYA 3K02A 1B3EA 1NL5A 3ISPA 1OVBA 3S9LC 2VPOA 3N6TA 1MQGA 2PVUA 4R6HA 1FQAA 4N6KA 1M5CA 4NG7A 1A8EA 3RLFE 2F3BA 4ESWA 1VE4A 2I4CA 4FAJA 4H65A 1NUYA 2I48A 4FEDA 2ONKE 3TEPA 5J1DA 1N7XA 4HCWA 1XI6A 3H06B 3S4UA 3THIA 4F2QA 3SEVA 1M5FA 4PP0A 1FSAA 1IXCA 4JWXA 5ISUA 1LAGE 3V89B 1FTOA 2VPNA 3P7IA 3MVXA 4WEDA 2WYKA 4TQUQ 2Q2AA 4P1LA 2HHMA 2F97A 1N3XA 3H7MA 1URDA 1MM7A 1Y20A 1JQFA 4QSCA 1Y3PA 2UYFA 1O64A 4IGTA 3IK6B 1XS5A 2OZZA 3NOHA 4PFRA 1NUZA 2QSXA 5IZZA 2FNCA 2DSFA 3T93B 1P1WA 1LBCA 2XXKA 4LQ2A 2XWIA 3H4ZA 5FTIA 4BDLA 2UVHA 1USYE 3V5AA 1BK4A 2OPDA 1GVCA 1R9LA 3RNNA 4ZEKA 1B5IA 4PQJA 3H3GA 4KCCA 3EKIA 1LCFA 1A40A 4PCDA 4F19A 2RCAA 3K00A 3U65A 2KQZA 2DWAA 1DPEA 3TTMA 4E0XA 3SERA 4H5GA 2RC9A 3K6WA 4PBHA 1O63A 2XXWA 2XD3A 2YLNA 1OLAA 4QFOA 3IB0A 4R9GA 4ECFA 4TLMB 1PEBA 3C31A 4JVIA 3SESA 1YPNA 3IOVA 4N81A 4NF4B 4OMBA 3K6UA 4X1DA 5IAIA 1FBPA 1B2HA 5I2NA 2QMXA 2Z22A 1KWHA 4F39A 1UIVA 4LVQA 5I84A 4GLIA 5CBRA 3C9HA 2QFLA 4R74A 3B6TA 1ZBMA 2DVCA 1NUXA 5T3JA 1CB6A 1FQCA 5DTBA 1XOCA 4I62A 1B3FA 5L9OA 1B7HA 4NX1A 2BJIA 2DYXA 4PTKA 3OO7A 5JEIA 1RDYA 1D4NA 2FHYA 5AA2A 1FBFA 3LSFB 5IM2A 3VXBA 3O66A 2XWVA 1R1NA 4OFJA 1IUDA 5I58A 3A3UA 4I3EA 2DE2A 3G7WA 3VXCA 4EQ9A 1PB9A 3E78A 3PGFA 4KD5A 1OQGA 2PFZA 4OVSA 1YAEA 4N15A 4MIJA 1B1HA 4EQ7A 4QFKA 2Z23A 4NF6B 1PDAA 3E9XA 1B40A 4IGRA 1JVYA 4IO2A 4N91A 1LLSA 3B50A 1LBWA 1H43A 1FTJA 2DWIA 2DVZA 4PDDA 2IEEA 4YKIA 1FBGA 2DDKA 3S9EA 1LSTA 3DM0A 5IZ3B 3GZGA 5FTHA 2RCBA 2XHDA 5EQAA 1I6AA 3R26A 4RYAA 4DZ1A 1FTMA 3O97A 4BDQA 2XD2A 1UTHA 2OPEA 1MY2A 5KDTB 1JEUA 1IMAA 3B6QA 3TMGA 4NF0A 4THIA 1UTHB 3C36A 3MW0A 2W7YA 3W15C 3QUJA 1B0HA 1WDNA 2DXYA 5M2VA 3ILTB 5TP9A 3KC0A 3IX1A 2V25A 4MNCA 1FPEA 1OMPA 4NMYA 2FIXA 2E1SA 2HEUA 1TWYA 2I0BA 4POWA 4YB5A 1LBZA 4XKNA 3K01A 2CEYA 4QFPA 2XXXA 2F7AA 3TQWA 2F3DA 1DBZA 4ELPA 4PFTA 3ECRA 5CC2A 1FQDA 3IL1B 3KG2A 2F6GA 4OFOA 1JW5A 3SEYA 3OEMA 4P3LA 3U1OA 1LEVA 4GBVA 1LAHE 2QVRA 4I9DA 1USYH 1M5DA 3FJMA 3IB1A 3W9WA 4EF2A 1GV8A 1EZ9A 2PBWA 1US4A 4GXSB 4R72A 3CSBA 4HE0A 2Z8DA 4DDDA 2I6EA 3Q28A 1JW4A 3MVWA 1WVJA 3H6UA 1NFTA 5H8QA 4MMPA 2O84X 3CR9A 3PD8A 2L5VA 3HHGA 5H8FB 4GWZA 3EHSA 1WODA 2AYSA 1IMEA 1A55A 1EH3A 4Q0CA 4ELRA 1FPDA 1MPBA 4JDFA 4NF6A 3VV5A 3VDFA 4GX3A 3PD9A 4M1VA 2GRVA 4QBAA 4LN5A 1AMFA 3RPLA 1P99A 4GF8A 4Q30B 2Q8JA 3O6GA 1MXXA 1MH3A 4PF8A 1SYHA 2ALUA 4IO3A 4XIGQ 1N04A 2CEXA 2R6GE 1T0KA 3IJXB 1MY4A 1B7UA 1Z7ME 2Q2CA 4G4PA 3IO4A 3CRBA 2P3NA 1Z7NE 1FJ6A 1II5A 2Q9TA 5EQ9A 2DP8A 3FVKA 5A5LA 2B4LA 3HV1A 5EHSA 4R73A 1FRPA 5BWJA 3S9MC 3K6XA 1D9QA 4OWDA 3GXAA 5I56B 2RINA 3CG1A 1Y3NA 5EQ8A 3R7XA 4F31B 3D4CA 1CE2A 3FASA 1P1NA 1MXVA 3H6WA 2ZYOA 5H8NA 4LONB 3SEXA 4RXLA 3RN8A 4FATA 1OQHA 2XA5A 3VVEA 1N3WA 1DPPA 1DK4A 1NV4A 3TTLA 5CI5A 1MQHA 4XFEA 1SQYA 5FHMA 3Q27A 5F1QA 2ZZWA 4ESXA 1SI0A 4FECA 5LTCA 4PE3A 2ABHA 2QPQA 5I2KB 3N5LA 4PFUA 3UORA 4RJZA 2BJJX 3E13X 1INPA 4DI4B 3MC2A 4EDPA 3PPPA 3KFMA 1QULA 3WAEA 1J1NA 1DOTA 3FXUA 1HSJA 4U4SA 4X8RA 5ET6A 3KZGA 4JSOA 3QUFA 1EU8A 1RDZA 4H67A 2PX1A 4YKJA 5KCJB 5AE4A 5JTYA 1MQIA 4GWSA 4BDNA 4O3AA 5JTYB 3E3KA 1LB8A 5CMCA 2ONSA 2HZKA 3B7DA 1B3LA 1KZ8A 4PAFA 4H0WA 1MQJA 3LV0A 4YMAA 4N8GA 2REGA 1NKXA 1QUKA 4ZEBA 1KA0A 3VVFA 3N6UA 1Q35A 3FJGA 4XKRA 1NMUA 5K2XA 4ZDMA 3T96B 5EYGA 3KOSA 1P1QA 1B52A 2A5TB 4N17A 2THIA 4UABA 4PBQA 3R6UA 2XX9A 1IXIA 2WKYA 4MJOA 5KZTA 2QS1A 2XWKA 2VT5A 2FVZA 3I6VA 3EPEA 1MXYA 3T9UA 3T9VA 3FJ7A 3EN3A 4AS4A 2NOOA 4UACA 3IO6A 3UP9A 4KR5A 2R71A 1FPGA 5B7DA 1LAFE 1LB9A 4YAHX 3E79A 3CFXA 3FIRA 2PFYA 4F3BA 3QYTA 5JK4A 4LATA 4GL0A 3U72A 1RKMA 2HAVA 2HPGA 3LC8A 4GXAA 2Y7IA 4HE1A 1FPKA 3MQ9A 4DXCA 1B6HA 2QS3A 5AA2D 1UIUA 1DMBA 3U8QA 3ZKLA 2HXRA 3DELB 4GX6A 1SDXA 4H45A 1HSEA 4PFWA 1A7LA 1R9QA 4GWWA 1URSA 5ICTA 2OX3A 2ZNUA 1EYIA 1EZPA 4H46A 1PC3A 5ITPA 4GD5A 4R6KA 1NUWA 4OXVA 5AA2B 3RT8A 2DS9A 2R9JA 4MAGA 2G29A 3TQLA 5I58B 4QFNA 3SZPA 2JJKA 2ANJA 3C32A 4NTLA 2WBBA 3QK6A 4RNSA 3K6VA 3B6WA 4LZ7A 2WYPA 3M3KA 3C35A 1MH4A 1FBDA 3PUXE 2O51A 4N6DA 1SYIA 2O7UA 4OANA 2GHBA 1MRPA 5HBCA 4F1UA 4C1TA 4C1UA 1TFDA 3TFLA 5FBPA 1SW5A 1NV6A 1HSLA 3PUWE 1SPIA 4P11A 4HXVA 1FPLA 4KYDA 1FPFA 3A3CA 4KI0E 2CZKA 3ZKKA 3RTFB 3V8XB 5EYHA 2B4MA 1MS7A 5ITOA 4MCOA 1P1OA 4OVQA 1UQWA 4X04A 3OOAA 3O9PA 1ELJA 4OTEA 2ZYKA 1UTBB 4MFIA 4DIGA 3MP6A 2F7CA 3S9NC 3SDFA 5ICQA 2OWSA 4NE4A 3LSLA 3OD7A 3U93A 4NGUA 2XX8A 3G3KA 3L6HA 1IQ7A 4MX6A 4ISUA 4PE5B 1MY1A 4OYVA 2HXWA 2XXPA 3N94A 3K1MA 1QUIA 5H8FA 4F2OA 1B3HA 4QF9A 4P0IA 1S50A 2Y7PA 4PC9A 3IFCA 5L8DA 3PU5A 4X9TA 1L5TA 3C4MA 3GBAA 1AIVA 2I4BA 3ILUB 5DW8A 4IO4A 3RPLB 3CI8A 4LP2B 4G68C 1URGA 1DTZA 2ZYNA 3VLVA 4P56A 3A29A 1US5A 1LGBC 1ATGA 4TLLB 1BP5A 4HW8A 3MBPA 2FIEA 3K2DA 1MXWA 1FQFA 2NVUB 4F3GA 4G2ZA 3IR1A 3VVDA 2OCUA 1SW1A 1MXZA 3D1RA 3IJOB 5H8QB 5IKBA 1ZKBA 2NUVA 2E0SA 1B1XA 5EHMA 3K0VA 1O7TA 4MLVA 1AH5A 1FPJA 1NV5A 3QIMA 1IXGA 4P47A 1MM6A 4NHBA 1TXFA 2P0SA 2X7PA 2B3BA 1QGXA 5CBSA 2Y5LA 2HCAA 3GLBA 2XWOA 1RYOA 3KN3A 1M5EA 4EXKA 2I49A 4YICA 2CMOA 1KA1A 3RPWA 3KEIA 2O1LA 5DEXB 4YKPA 3MP8A 2FYIA 1N7WA 4WXJA 3O6IA 3RY3A 4EF1A 3HHFA 3ONMA 4F1YA 4N8YA 5HPQA 2H4IA 1PB8A 4BDOA 1LBBA 4DXUA 1LBYA 4OVJA 2O1MA 4HCYA 1IXHA 3KBZA 2XXTA 3TPAA 4AB5A 4XXUA 1FJ9A 4BDRA 2UVGA 1OVTA 3HFUA 3T1BA 3KSJA 3LSXA 2V93A 3KJTA 1EYJA 4RY1A 4GBWA 1SI1A 1DCUA 1BKAA 4RK2A 1NV3A 2KR0A 2HZLA 3FATA 3MSTA 2I3VA 4O7MA 2I0CA 3FVNA 4EXLA 2H98A 1FPBA 3PMXA 2O68A 1FPIA 2REJA 4JVCA 3KC1A 3T9HB 2D5WA 3T0JA 1H3DA 5ELVA 4G68B 2QVVA 1JETA 3FVGA 1FBHA 2AIXA 1MDQA 4HTGA 1LAXA 1B32A 4OZ9A 4JVDA 4LZ5A 4XKQA 1POTA 4OESA 3KGCA 1NNPA 2V4CA 4OA4A 3Q29A 4U22A 2A5TA 4LZ8A 2UVIA 4ZEFA 2H99A 4RPNA 1QVSA 4PDHA 3HO7A 4P9KA 3MAMA 4F22A 4FEBA 3TKDA 4EQBA 2F6PA 4R6YA 3FV1A 3D4GA 5DVIA 1NI9A 4ZS9A 1TT1A
chains in the Genus database with same CATH topology
2DVZA 2CZIA 4NG7A 4PDDA 1LBYA 1DK4A 1EYKA 4N17A 4AS5A 4MAGA 1NV4A 3BIHA 4I40A 4O8MA 2F3BA 1FBGA 4X04A 4XFEA 4HCYA 4PC9A 2DDKA 2ZZVA 4UABA 3IFCA 4PBQA 5IZ1A 1NUYA 5IZ3B 1CNQA 4MMPA 2JJKA 3SZPA 3QMFA 3KBZA 1VDWA 4GWXA 5J1DA 4OVPA 1FJ9A 2L5VA 4F18A 4HCWA 2WBBA 4JVIA 2ZZWA 4PFIA 4X9TA 4N81A 1XI6A 4N6KA 4MJOA 2ZZXA 3HFUA 5LTCA 4GWZA 5EQAA 4PAKA 2XWKA 3T1BA 2VT5A 5DW8A 2WYPA 2CZHA 3E79A 1YXIA 4MNPA 2QPQA 1FBPA 2FVZA 4GWUA 4OVTA 4PE3A 5CM6A 1FSAA 3RPLB 2PCRA 1IMEA 5ET5A 4MHFA 1G0IA 1FPDA 1FBDA 4YZZA 1IMFA 2QVUA 1EYJA 4AS4A 2VPNA 1INPA 4N6DA 1Q9DA 4GBWA 4GX3A 1IMAA 3A29A 4OANA 4P56A 5J16A 4DI4B 2WYKA 4M1VA 4NF0A 4P1EA 1DCUA 1IMDA 2QFLA 4F1UA 4XF5A 5IGAA 4QBAA 1FPGA 2WBDA 2WX9A 4NN3A 4GWYA 5FBPA 4LN5A 4P1LA 2HHMA 1NV6A 3BIGA 1NV3A 5F24A 2FIEA 2F5XA 1SPIA 2KR0A 1NV2A 4HXVA 2HZLA 3RPLA 4X8RA 1FPLA 1NUXA 2R8TA 5T3JA 2DE4A 4N4UA 2PFYA 3MSTA 5I5PA 5EQ7A 4O7MA 3KC0A 5ET6A 4PGNA 5ET8A 3PTYA 1FPFA 4I3YA 4FBPA 4PF8A 2Q74A 5JK4A 4NQ8A 4MNCA 1FPBA 1FPEA 4NX1A 1K9ZA 2BJIA 2CZKA 3FBPA 1RDZA 4PTKA 2FIXA 2Y5KA 2CEXA 2HPGA 3NOHA 4PFRA 1FPIA 1NUZA 1RDYA 4JVCA 4P8BA 3D1RA 3KC1A 4XEQA 2FHYA 5EYHA 1FBFA 2B4MA 5IZZA 5IM2A 3T0JA 3GYYA 2OWZA 3ROJA 5ESYA 4O7IA 2QVVA 2XWVA 1AWBA 4MCOA 1LBZA 2P3NA 2XXKA 4GWSA 2XWIA 4O94A 4OVQA 1FBHA 2CEYA 4HE1A 1FPKA 1FPJA 1NV5A 1YZ0A 1FTAA 1FJ6A 1NV1A 4I3EA 1NV7A 2DE3A 2Q9TA 1NV0A 4MNIA 2DE2A 2F3DA 1DBZA 3B8BA 5EQ9A 4P47A 1K9YA 4NHBA 3RYDA 4JVDA 1BK4A 2WEFA 5A5LA 2B4LA 3E78A 3FXBA 4PF6A 1JP4A 1FRPA 2GQ1A 1QGXA 5LDZA 2P3VA 2MKZA 2Y5LA 2Q8MA 2PFZA 2HZKA 4G61A 2HXRA 4OVSA 4N15A 4PAIA 4GX6A 2XWOA 5IZ3A 4MIJA 1FBEA 1D9QA 1G0HA 1RDXA 2V4CA 3MYUA 1LBXA 4OVRA 4H45A 1KZ8A 3LUZA 4P3LA 4PAFA 4YICA 1YYZA 1KA1A 3LV0A 4HE2A 1LEVA 4N8GA 4OA4A 4PFBA 4GBVA 4GWWA 4QXDA 4MEVA 4KXPA 2OX3A 4DI3D 2QVRA 1EYIA 3W9VA 3EKIA 4NGUA 5EQ8A 1KA0A 4PETA 4H46A 4PGPA 1IMBA 5ET7A 1IMCA 2FBPA 4N91A 3CHGA 4MX6A 4PCDA 3W9WA 4F1VA 4PDHA 4NAPA 4P9KA 4F19A 1FBCA 5I7IA 3U65A 3B50A 1LBWA 3IFAA 2KQZA 4GX4A 2V3QA 5I3SA 1LBVA 3ISPA 4N8YA 4PBHA 2VPOA 5EYGA 4HE0A 4IR8A 1NUWA 1NI9A 2XA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZI A;  1LBY A;  1DK4 A;  1EYK A;  4AS5 A;  1NV4 A;  3BIH A;  4I40 A;  2F3B A;  1FBG A;  2DDK A;  3IFC A;  5IZ1 A;  1NUY A;  5IZ3 B;  1CNQ A;  2JJK A;  3QMF A;  3KBZ A;  1VDW A;  4GWX A;  1FJ9 A;  2WBB A;  4N81 A;  1XI6 A;  4MJO A;  4GWZ A;  5EQA A;  2VT5 A;  5DW8 A;  2CZH A;  1YXI A;  1FBP A;  2FVZ A;  4GWU A;  1FSA A;  3RPL B;  2PCR A;  1IME A;  5ET5 A;  1G0I A;  1FPD A;  1FBD A;  1IMF A;  2QVU A;  1EYJ A;  4AS4 A;  1INP A;  1Q9D A;  4GBW A;  4GX3 A;  1IMA A;  3A29 A;  5J16 A;  1DCU A;  1IMD A;  2QFL A;  1FPG A;  2WBD A;  4GWY A;  5FBP A;  2HHM A;  1NV6 A;  3BIG A;  1NV3 A;  5F24 A;  2FIE A;  1SPI A;  1NV2 A;  4HXV A;  3RPL A;  1FPL A;  1NUX A;  2R8T A;  5T3J A;  5EQ7 A;  3KC0 A;  5ET6 A;  5ET8 A;  1FPF A;  4I3Y A;  4FBP A;  2Q74 A;  1FPB A;  1FPE A;  1K9Z A;  2BJI A;  2CZK A;  3FBP A;  1RDZ A;  4PTK A;  2FIX A;  2Y5K A;  1FPI A;  1NUZ A;  1RDY A;  3D1R A;  3KC1 A;  2FHY A;  5EYH A;  1FBF A;  3T0J A;  2OWZ A;  3ROJ A;  5ESY A;  4O7I A;  2QVV A;  1AWB A;  1LBZ A;  2P3N A;  4GWS A;  1FBH A;  4HE1 A;  1FPK A;  1FPJ A;  1NV5 A;  1YZ0 A;  1FTA A;  1FJ6 A;  1NV1 A;  4I3E A;  1NV7 A;  1NV0 A;  2F3D A;  1DBZ A;  3B8B A;  5EQ9 A;  1K9Y A;  3RYD A;  1BK4 A;  2WEF A;  5A5L A;  1JP4 A;  1FRP A;  2GQ1 A;  1QGX A;  5LDZ A;  2P3V A;  2Y5L A;  2Q8M A;  4G61 A;  4GX6 A;  5IZ3 A;  1FBE A;  1D9Q A;  1G0H A;  1RDX A;  1LBX A;  4H45 A;  1KZ8 A;  3LUZ A;  1YYZ A;  1KA1 A;  3LV0 A;  4HE2 A;  1LEV A;  4GBV A;  4GWW A;  4QXD A;  4KXP A;  2OX3 A;  2QVR A;  1EYI A;  5EQ8 A;  1KA0 A;  4H46 A;  1IMB A;  5ET7 A;  1IMC A;  2FBP A;  1FBC A;  1LBW A;  3IFA A;  4GX4 A;  5I3S A;  1LBV A;  5EYG A;  4HE0 A;  4IR8 A;  1NUW A;  1NI9 A; 
#chains in the Genus database with same CATH topology
 2XXH A;  2HFB A;  1EYK A;  2AL4 A;  1H45 A;  4I40 A;  3OXN A;  2LAO A;  4FIM A;  4IO6 A;  4IY5 A;  4OVP A;  3U94 A;  5I56 A;  3LBS A;  1BLF A;  3QXM A;  4K3F A;  1YXI A;  4LUB A;  4N07 A;  4MHF A;  1Y3Q A;  1VR5 A;  1FTK A;  4FJP A;  5BUU A;  4DXB A;  3MPL A;  2QS4 A;  4IY6 A;  4NN3 A;  3IOR A;  1NNT A;  1FW0 A;  4M4G A;  4GOT A;  3UN6 A;  1B05 A;  1TFA A;  4QFL A;  1QJM A;  3O6H A;  3SEU A;  3OMB A;  1D9V A;  3OSR A;  3K1N A;  1PBP A;  3GYY A;  5ESY A;  2Y84 A;  5I59 A;  4N13 A;  1NH7 A;  2DOJ A;  1LFG A;  2O7I A;  5K2Y A;  1MXU A;  3TUS A;  3EHT A;  1JVX A;  3QAX A;  5AA3 A;  2FA7 A;  4PF6 A;  1JP4 A;  4MH5 A;  2I3W A;  4ZZE A;  1B0L A;  4F3S A;  3MJN A;  1G0H A;  1LBX A;  4U2R A;  4KHZ E;  3G3J A;  3HPI A;  4MEV A;  5L9S A;  4R75 A;  1I6B A;  4FOR A;  1IMC A;  3CHG A;  3FZV A;  1SVX B;  2XXU A;  4R2B A;  4F1V A;  2NWJ A;  3L6G A;  2IA4 A;  1IZ1 A;  5CRY A;  5I3S A;  2Q89 A;  1XHY A;  3UA8 A;  1SW2 A;  2D21 A;  5DEX A;  2YPN A;  4O8M A;  5H8S A;  1BIY A;  4NF4 A;  3PPO A;  3TTK A;  1F9B A;  3RGY A;  4LA9 A;  1B46 A;  3BKI B;  1I69 A;  3RUM A;  5CM6 A;  4OEN A;  2PCR A;  5ET5 A;  3OEL A;  2M8C A;  3TTN A;  4NWC A;  1B9J A;  2B3F A;  1OIB A;  3O2A A;  5I57 A;  4ZZA A;  4H6D A;  1YCJ A;  2QJE A;  3PUV E;  5F24 A;  1S9T A;  1NV2 A;  2F35 A;  2R8T A;  4EUO A;  2XX7 A;  4NED A;  1B4Z A;  2Q74 A;  3ODB A;  3U92 A;  2VD3 A;  1QKB A;  3T9X B;  3TYH A;  1Y4T A;  1PB7 A;  1JEV A;  4MNI A;  4ONY A;  3MWB A;  3TCF A;  1A99 A;  1GR2 A;  3AXF A;  3VFJ A;  1M5B A;  2Y7W A;  4HE2 A;  1FQE A;  4WKM A;  3I3V A;  4QXD A;  4YB7 A;  1SW4 A;  3W9V A;  1MPC A;  2PYY A;  3UIF A;  2DWJ A;  4ELO A;  1AOV A;  2F8D A;  4Q5T A;  1NNF A;  3MPK A;  1B5J A;  4H1X A;  2XXI A;  4KYE A;  3PUZ E;  5H8N B;  3UK4 A;  3DP4 A;  3MZ9 A;  5I59 B;  4Z0I A;  3DP6 A;  5IZ1 A;  3CSG A;  4P0G A;  3KBR A;  5HM4 B;  4PFI A;  4NF8 B;  2ZZX A;  3OEK A;  2OWT A;  1ZMG A;  3G3H A;  3H6V A;  3A09 A;  2UYE A;  5TU0 A;  1LFH A;  2F34 A;  2DXR A;  2XXV A;  3TZA A;  4F29 A;  4N6P A;  1S7Y A;  1IIW A;  1IMD A;  2AL5 A;  5DVJ A;  1DSN A;  3PMW A;  2WX9 A;  3H6T A;  5F7V A;  1QUJ A;  4GWY A;  5AA4 B;  4U4X A;  2Q88 A;  5FHO A;  3UGW A;  2OK2 A;  2QL3 A;  4DCY A;  3FBP A;  4JWO A;  4ND9 A;  3TAJ A;  1I6Q A;  5TP9 B;  4JXI A;  2I58 A;  4X48 A;  2DE3 A;  1NV0 A;  2DQV A;  2OLB A;  2WEF A;  3JYR A;  2MKZ A;  2Q8M A;  4IO5 A;  4G61 A;  3JZJ A;  5EYF A;  5LOM A;  4PFB A;  4ZE8 A;  4R2F A;  4TOZ A;  2FBP A;  3TDJ A;  4H8I A;  4NAP A;  3TEL A;  4QSE A;  3FUZ A;  2RF1 A;  3IFA A;  3CIJ A;  4GX4 A;  2V3Q A;  2ESN A;  4JB7 A;  1SBP A;  4U21 A;  1LFI A;  1ZIU A;  1XVY A;  2KLF A;  4BDM A;  3BIH A;  5AA4 A;  2ZZV A;  1ANF A;  1ZU0 A;  3IOU A;  3QMF A;  4MLQ A;  1MG1 A;  2VP1 A;  1D9Y A;  2F78 A;  3OEN A;  1ZLQ A;  2CZH A;  3RQT A;  4OVT A;  3O29 A;  3M3F A;  4YMB A;  4G68 A;  3KN8 A;  2QVU A;  3K4U A;  1AL3 A;  2QS2 A;  2GH9 A;  5H8H A;  1JW1 A;  1N76 A;  4XF5 A;  2WBD A;  3FXQ A;  4H8J A;  3BIG A;  3PPQ A;  4N4U A;  4ZED A;  2VGQ A;  2ZNS A;  4I3Y A;  1K9Z A;  1FTL A;  4U1O A;  3HST A;  3MUQ A;  4P8B A;  4OHN A;  2RC8 A;  3PV0 E;  3CFZ A;  2OWZ A;  3FVO A;  2UXA A;  5DYH A;  1MY3 A;  3H03 A;  4KPT A;  5AA1 A;  4OQO A;  1FTA A;  2VHA A;  4Q8R A;  1FCK A;  1XVX A;  3MZB A;  2O69 A;  1B7Z A;  3KJ7 A;  1FBE A;  1RDX A;  4PGN A;  5I5P A;  3LUZ A;  4DI3 D;  3S2V A;  2A5S A;  3M3L A;  3OO8 A;  3IB2 A;  1QKA A;  3EHU A;  1FBC A;  2ZYM A;  4MBP A;  5H8H B;  5KDT A;  3RT6 B;  3TCH A;  4XKP A;  1A54 A;  1SD3 A;  1MQD A;  4ELQ A;  3G3G A;  3GBB A;  1RYX A;  4H5F A;  1CNQ A;  2NXO A;  3JV9 A;  4F18 A;  3EF7 A;  5I2K A;  1Y9U A;  4MNP A;  3SKP A;  4GWU A;  4C0R A;  1B51 A;  1NH8 A;  3M8U A;  4YZZ A;  1IMF A;  3KN7 A;  4GWO A;  3DLN A;  1B4H A;  1ZTY A;  3OO9 A;  5J16 A;  2V84 A;  3SET A;  3IAZ A;  4IO7 A;  5IGA A;  3USD A;  1VFE A;  3E4R A;  2F5X A;  4FE8 A;  3VE1 B;  5CMB A;  2DE4 A;  1B58 A;  2GFE A;  1XC1 A;  5EQ7 A;  3I5O A;  5TPA A;  3PTY A;  1MPD A;  2V3T A;  4GFR A;  4JWY A;  2B65 A;  1D3K A;  2X7Q A;  3WAF A;  5I2N B;  3ROJ A;  1UTB A;  4O7I A;  2VD2 A;  2XXQ A;  1GGG A;  1AWB A;  1MY0 A;  4O3C A;  2ZXT A;  2PT2 A;  4POX A;  4MF3 A;  1YZ0 A;  4F3P A;  3BBR A;  4OEU A;  3RTW B;  1PBQ A;  2PT1 A;  3SEW A;  4HS7 A;  3QSL A;  1BTJ A;  2P3V A;  3IOT A;  1EZO A;  1IEJ A;  1H76 A;  2YJP A;  1OLC A;  5B70 A;  3TCG A;  4KXP A;  2VOZ A;  4PGP A;  4AQ4 A;  1POY 1;  4ZEI A;  1DTG A;  2GHA A;  3C33 A;  1QW0 A;  3CG3 A;  4NF5 A;  1LBV A;  4IR8 A;  3EQ1 A;  2ONR A;  4DE8 A;  4AS5 A;  3O28 A;  3T22 A;  4NF8 A;  4RK9 A;  1VDW A;  2OBG A;  3T66 A;  3BFT A;  2F7B A;  4IB2 A;  3Q25 A;  4PAK A;  4L17 A;  1YTV A;  3G3F A;  1Y1M A;  1G0I A;  3MVY A;  4G8M A;  5CMK A;  5TPA B;  1H44 A;  1Q9D A;  1Y4C A;  4P1E A;  4JSD A;  4GIZ A;  1LCT A;  5DT6 A;  3IOW A;  3VLU A;  1N84 A;  2H9B A;  3F11 A;  3BFU A;  3LR1 A;  2G93 A;  3CFL A;  3OO6 A;  3Q26 A;  5ET8 A;  2ZNT A;  3LSW A;  4NWD A;  1R6Z A;  3TOD A;  4GVO A;  2PMS A;  5DVF A;  4YU0 A;  4R9F A;  4LQ5 A;  2H5Y A;  3MP1 A;  1FQB A;  4O94 A;  5A5X A;  1NV1 A;  3KOT A;  1A8F A;  3K1P A;  2D3I A;  3MZ1 A;  1K9Y A;  2ZMB A;  3PMV A;  3RYD A;  2Z8E A;  3FXB A;  5LDZ A;  4GL8 A;  4I1D A;  4PAI A;  3MYU A;  1YYZ A;  3FV2 A;  3FD3 A;  3HCQ A;  4Z7E A;  1IIT A;  3G3I A;  4KCD A;  3V83 A;  1IMB A;  1Y1Z A;  1Q1K A;  3HN0 A;  4BLA A;  4DCX A;  4UA8 A;  1MDP 1;  2RKM A;  3TTR A;  2V3U A;  1JNF A;  2P1S A;  3C34 A;  3DP8 A;  5KCJ A;  4KFQ A;  4WEP A;  4I8C A;  4RA1 A;  3ZSF A;  2CZI A;  4YKK A;  4GQO A;  1ZJL A;  1NNK A;  4O3B A;  2X26 A;  4GWX A;  1B3G A;  1VSO A;  2QMW A;  2HAU A;  4G8H A;  5CMM A;  3ZS6 A;  2O6A A;  1P1U A;  5FHN A;  4AB6 A;  1XT8 A;  4OEV A;  4KQP A;  3LUY A;  3FGS A;  4OFL A;  2DWH A;  5A5X B;  2CZL A;  4QHQ A;  3VLW A;  4QRZ A;  3FXR A;  2Y7K A;  4YB6 A;  2RC7 A;  2H25 A;  3PPR A;  4U23 A;  4NF5 B;  4RPO A;  4G8N A;  2XXY A;  2UVJ A;  4FBP A;  3CVG A;  4NQ8 A;  2QRY A;  3MVZ A;  4X1B A;  4ZE9 A;  3OSQ A;  2Y5K A;  4G77 A;  4GRK A;  1GTK A;  4QSD A;  3PPN A;  4KYS A;  5I57 B;  1NV7 A;  3B8B A;  4DLD A;  2F36 A;  2P2A A;  4OER A;  2GQ1 A;  4E0W A;  4ZEC A;  2OJT A;  1VFD A;  4XTC Q;  1B5H A;  4JBZ A;  5IZ3 A;  2Z8F A;  4XEQ A;  2XXR A;  4OVR A;  2Y7R A;  3PUY E;  2HQ0 A;  3KSX A;  3N26 A;  4PET A;  4U1Z A;  5L9M A;  5ET7 A;  5I7I A;  1N0T A;  4OET A;  4PFY A;  3K02 A;  1B3E A;  1NL5 A;  3ISP A;  1OVB A;  3S9L C;  2VPO A;  3N6T A;  1MQG A;  2PVU A;  4R6H A;  1FQA A;  4N6K A;  1M5C A;  4NG7 A;  1A8E A;  3RLF E;  2F3B A;  4ESW A;  1VE4 A;  2I4C A;  4FAJ A;  4H65 A;  1NUY A;  2I48 A;  4FED A;  2ONK E;  3TEP A;  5J1D A;  1N7X A;  4HCW A;  1XI6 A;  3H06 B;  3S4U A;  3THI A;  4F2Q A;  3SEV A;  1M5F A;  4PP0 A;  1FSA A;  1IXC A;  4JWX A;  5ISU A;  1LAG E;  3V89 B;  1FTO A;  2VPN A;  3P7I A;  3MVX A;  4WED A;  2WYK A;  4TQU Q;  2Q2A A;  4P1L A;  2HHM A;  2F97 A;  1N3X A;  3H7M A;  1URD A;  1MM7 A;  1Y20 A;  1JQF A;  4QSC A;  1Y3P A;  2UYF A;  1O64 A;  4IGT A;  3IK6 B;  1XS5 A;  2OZZ A;  3NOH A;  4PFR A;  1NUZ A;  2QSX A;  5IZZ A;  2FNC A;  2DSF A;  3T93 B;  1P1W A;  1LBC A;  2XXK A;  4LQ2 A;  2XWI A;  3H4Z A;  5FTI A;  4BDL A;  2UVH A;  1USY E;  3V5A A;  1BK4 A;  2OPD A;  1GVC A;  1R9L A;  3RNN A;  4ZEK A;  1B5I A;  4PQJ A;  3H3G A;  4KCC A;  3EKI A;  1LCF A;  1A40 A;  4PCD A;  4F19 A;  2RCA A;  3K00 A;  3U65 A;  2KQZ A;  2DWA A;  1DPE A;  3TTM A;  4E0X A;  3SER A;  4H5G A;  2RC9 A;  3K6W A;  4PBH A;  1O63 A;  2XXW A;  2XD3 A;  2YLN A;  1OLA A;  4QFO A;  3IB0 A;  4R9G A;  4ECF A;  4TLM B;  1PEB A;  3C31 A;  4JVI A;  3SES A;  1YPN A;  3IOV A;  4N81 A;  4NF4 B;  4OMB A;  3K6U A;  4X1D A;  5IAI A;  1FBP A;  1B2H A;  5I2N A;  2QMX A;  2Z22 A;  1KWH A;  4F39 A;  1UIV A;  4LVQ A;  5I84 A;  4GLI A;  5CBR A;  3C9H A;  2QFL A;  4R74 A;  3B6T A;  1ZBM A;  2DVC A;  1NUX A;  5T3J A;  1CB6 A;  1FQC A;  5DTB A;  1XOC A;  4I62 A;  1B3F A;  5L9O A;  1B7H A;  4NX1 A;  2BJI A;  2DYX A;  4PTK A;  3OO7 A;  5JEI A;  1RDY A;  1D4N A;  2FHY A;  5AA2 A;  1FBF A;  3LSF B;  5IM2 A;  3VXB A;  3O66 A;  2XWV A;  1R1N A;  4OFJ A;  1IUD A;  5I58 A;  3A3U A;  4I3E A;  2DE2 A;  3G7W A;  3VXC A;  4EQ9 A;  1PB9 A;  3E78 A;  3PGF A;  4KD5 A;  1OQG A;  2PFZ A;  4OVS A;  1YAE A;  4N15 A;  4MIJ A;  1B1H A;  4EQ7 A;  4QFK A;  2Z23 A;  4NF6 B;  1PDA A;  3E9X A;  1B40 A;  4IGR A;  1JVY A;  4IO2 A;  4N91 A;  1LLS A;  3B50 A;  1LBW A;  1H43 A;  1FTJ A;  2DWI A;  2DVZ A;  4PDD A;  2IEE A;  4YKI A;  1FBG A;  2DDK A;  3S9E A;  1LST A;  3DM0 A;  5IZ3 B;  3GZG A;  5FTH A;  2RCB A;  2XHD A;  5EQA A;  1I6A A;  3R26 A;  4RYA A;  4DZ1 A;  1FTM A;  3O97 A;  4BDQ A;  2XD2 A;  1UTH A;  2OPE A;  1MY2 A;  5KDT B;  1JEU A;  1IMA A;  3B6Q A;  3TMG A;  4NF0 A;  4THI A;  1UTH B;  3C36 A;  3MW0 A;  2W7Y A;  3W15 C;  3QUJ A;  1B0H A;  1WDN A;  2DXY A;  5M2V A;  3ILT B;  5TP9 A;  3KC0 A;  3IX1 A;  2V25 A;  4MNC A;  1FPE A;  1OMP A;  4NMY A;  2FIX A;  2E1S A;  2HEU A;  1TWY A;  2I0B A;  4POW A;  4YB5 A;  1LBZ A;  4XKN A;  3K01 A;  2CEY A;  4QFP A;  2XXX A;  2F7A A;  3TQW A;  2F3D A;  1DBZ A;  4ELP A;  4PFT A;  3ECR A;  5CC2 A;  1FQD A;  3IL1 B;  3KG2 A;  2F6G A;  4OFO A;  1JW5 A;  3SEY A;  3OEM A;  4P3L A;  3U1O A;  1LEV A;  4GBV A;  1LAH E;  2QVR A;  4I9D A;  1USY H;  1M5D A;  3FJM A;  3IB1 A;  3W9W A;  4EF2 A;  1GV8 A;  1EZ9 A;  2PBW A;  1US4 A;  4GXS B;  4R72 A;  3CSB A;  4HE0 A;  2Z8D A;  4DDD A;  2I6E A;  3Q28 A;  1JW4 A;  3MVW A;  1WVJ A;  3H6U A;  1NFT A;  5H8Q A;  4MMP A;  2O84 X;  3CR9 A;  3PD8 A;  2L5V A;  3HHG A;  5H8F B;  4GWZ A;  3EHS A;  1WOD A;  2AYS A;  1IME A;  1A55 A;  1EH3 A;  4Q0C A;  4ELR A;  1FPD A;  1MPB A;  4JDF A;  4NF6 A;  3VV5 A;  3VDF A;  4GX3 A;  3PD9 A;  4M1V A;  2GRV A;  4QBA A;  4LN5 A;  1AMF A;  3RPL A;  1P99 A;  4GF8 A;  4Q30 B;  2Q8J A;  3O6G A;  1MXX A;  1MH3 A;  4PF8 A;  1SYH A;  2ALU A;  4IO3 A;  4XIG Q;  1N04 A;  2CEX A;  2R6G E;  1T0K A;  3IJX B;  1MY4 A;  1B7U A;  1Z7M E;  2Q2C A;  4G4P A;  3IO4 A;  3CRB A;  2P3N A;  1Z7N E;  1FJ6 A;  1II5 A;  2Q9T A;  5EQ9 A;  2DP8 A;  3FVK A;  5A5L A;  2B4L A;  3HV1 A;  5EHS A;  4R73 A;  1FRP A;  5BWJ A;  3S9M C;  3K6X A;  1D9Q A;  4OWD A;  3GXA A;  5I56 B;  2RIN A;  3CG1 A;  1Y3N A;  5EQ8 A;  3R7X A;  4F31 B;  3D4C A;  1CE2 A;  3FAS A;  1P1N A;  1MXV A;  3H6W A;  2ZYO A;  5H8N A;  4LON B;  3SEX A;  4RXL A;  3RN8 A;  4FAT A;  1OQH A;  2XA5 A;  3VVE A;  1N3W A;  1DPP A;  1DK4 A;  1NV4 A;  3TTL A;  5CI5 A;  1MQH A;  4XFE A;  1SQY A;  5FHM A;  3Q27 A;  5F1Q A;  2ZZW A;  4ESX A;  1SI0 A;  4FEC A;  5LTC A;  4PE3 A;  2ABH A;  2QPQ A;  5I2K B;  3N5L A;  4PFU A;  3UOR A;  4RJZ A;  2BJJ X;  3E13 X;  1INP A;  4DI4 B;  3MC2 A;  4EDP A;  3PPP A;  3KFM A;  1QUL A;  3WAE A;  1J1N A;  1DOT A;  3FXU A;  1HSJ A;  4U4S A;  4X8R A;  5ET6 A;  3KZG A;  4JSO A;  3QUF A;  1EU8 A;  1RDZ A;  4H67 A;  2PX1 A;  4YKJ A;  5KCJ B;  5AE4 A;  5JTY A;  1MQI A;  4GWS A;  4BDN A;  4O3A A;  5JTY B;  3E3K A;  1LB8 A;  5CMC A;  2ONS A;  2HZK A;  3B7D A;  1B3L A;  1KZ8 A;  4PAF A;  4H0W A;  1MQJ A;  3LV0 A;  4YMA A;  4N8G A;  2REG A;  1NKX A;  1QUK A;  4ZEB A;  1KA0 A;  3VVF A;  3N6U A;  1Q35 A;  3FJG A;  4XKR A;  1NMU A;  5K2X A;  4ZDM A;  3T96 B;  5EYG A;  3KOS A;  1P1Q A;  1B52 A;  2A5T B;  4N17 A;  2THI A;  4UAB A;  4PBQ A;  3R6U A;  2XX9 A;  1IXI A;  2WKY A;  4MJO A;  5KZT A;  2QS1 A;  2XWK A;  2VT5 A;  2FVZ A;  3I6V A;  3EPE A;  1MXY A;  3T9U A;  3T9V A;  3FJ7 A;  3EN3 A;  4AS4 A;  2NOO A;  4UAC A;  3IO6 A;  3UP9 A;  4KR5 A;  2R71 A;  1FPG A;  5B7D A;  1LAF E;  1LB9 A;  4YAH X;  3E79 A;  3CFX A;  3FIR A;  2PFY A;  4F3B A;  3QYT A;  5JK4 A;  4LAT A;  4GL0 A;  3U72 A;  1RKM A;  2HAV A;  2HPG A;  3LC8 A;  4GXA A;  2Y7I A;  4HE1 A;  1FPK A;  3MQ9 A;  4DXC A;  1B6H A;  2QS3 A;  5AA2 D;  1UIU A;  1DMB A;  3U8Q A;  3ZKL A;  2HXR A;  3DEL B;  4GX6 A;  1SDX A;  4H45 A;  1HSE A;  4PFW A;  1A7L A;  1R9Q A;  4GWW A;  1URS A;  5ICT A;  2OX3 A;  2ZNU A;  1EYI A;  1EZP A;  4H46 A;  1PC3 A;  5ITP A;  4GD5 A;  4R6K A;  1NUW A;  4OXV A;  5AA2 B;  3RT8 A;  2DS9 A;  2R9J A;  4MAG A;  2G29 A;  3TQL A;  5I58 B;  4QFN A;  3SZP A;  2JJK A;  2ANJ A;  3C32 A;  4NTL A;  2WBB A;  3QK6 A;  4RNS A;  3K6V A;  3B6W A;  4LZ7 A;  2WYP A;  3M3K A;  3C35 A;  1MH4 A;  1FBD A;  3PUX E;  2O51 A;  4N6D A;  1SYI A;  2O7U A;  4OAN A;  2GHB A;  1MRP A;  5HBC A;  4F1U A;  4C1T A;  4C1U A;  1TFD A;  3TFL A;  5FBP A;  1SW5 A;  1NV6 A;  1HSL A;  3PUW E;  1SPI A;  4P11 A;  4HXV A;  1FPL A;  4KYD A;  1FPF A;  3A3C A;  4KI0 E;  2CZK A;  3ZKK A;  3RTF B;  3V8X B;  5EYH A;  2B4M A;  1MS7 A;  5ITO A;  4MCO A;  1P1O A;  4OVQ A;  1UQW A;  4X04 A;  3OOA A;  3O9P A;  1ELJ A;  4OTE A;  2ZYK A;  1UTB B;  4MFI A;  4DIG A;  3MP6 A;  2F7C A;  3S9N C;  3SDF A;  5ICQ A;  2OWS A;  4NE4 A;  3LSL A;  3OD7 A;  3U93 A;  4NGU A;  2XX8 A;  3G3K A;  3L6H A;  1IQ7 A;  4MX6 A;  4ISU A;  4PE5 B;  1MY1 A;  4OYV A;  2HXW A;  2XXP A;  3N94 A;  3K1M A;  1QUI A;  5H8F A;  4F2O A;  1B3H A;  4QF9 A;  4P0I A;  1S50 A;  2Y7P A;  4PC9 A;  3IFC A;  5L8D A;  3PU5 A;  4X9T A;  1L5T A;  3C4M A;  3GBA A;  1AIV A;  2I4B A;  3ILU B;  5DW8 A;  4IO4 A;  3RPL B;  3CI8 A;  4LP2 B;  4G68 C;  1URG A;  1DTZ A;  2ZYN A;  3VLV A;  4P56 A;  3A29 A;  1US5 A;  1LGB C;  1ATG A;  4TLL B;  1BP5 A;  4HW8 A;  3MBP A;  2FIE A;  3K2D A;  1MXW A;  1FQF A;  2NVU B;  4F3G A;  4G2Z A;  3IR1 A;  3VVD A;  2OCU A;  1SW1 A;  1MXZ A;  3D1R A;  3IJO B;  5H8Q B;  5IKB A;  1ZKB A;  2NUV A;  2E0S A;  1B1X A;  5EHM A;  3K0V A;  1O7T A;  4MLV A;  1AH5 A;  1FPJ A;  1NV5 A;  3QIM A;  1IXG A;  4P47 A;  1MM6 A;  4NHB A;  1TXF A;  2P0S A;  2X7P A;  2B3B A;  1QGX A;  5CBS A;  2Y5L A;  2HCA A;  3GLB A;  2XWO A;  1RYO A;  3KN3 A;  1M5E A;  4EXK A;  2I49 A;  4YIC A;  2CMO A;  1KA1 A;  3RPW A;  3KEI A;  2O1L A;  5DEX B;  4YKP A;  3MP8 A;  2FYI A;  1N7W A;  4WXJ A;  3O6I A;  3RY3 A;  4EF1 A;  3HHF A;  3ONM A;  4F1Y A;  4N8Y A;  5HPQ A;  2H4I A;  1PB8 A;  4BDO A;  1LBB A;  4DXU A;  1LBY A;  4OVJ A;  2O1M A;  4HCY A;  1IXH A;  3KBZ A;  2XXT A;  3TPA A;  4AB5 A;  4XXU A;  1FJ9 A;  4BDR A;  2UVG A;  1OVT A;  3HFU A;  3T1B A;  3KSJ A;  3LSX A;  2V93 A;  3KJT A;  1EYJ A;  4RY1 A;  4GBW A;  1SI1 A;  1DCU A;  1BKA A;  4RK2 A;  1NV3 A;  2KR0 A;  2HZL A;  3FAT A;  3MST A;  2I3V A;  4O7M A;  2I0C A;  3FVN A;  4EXL A;  2H98 A;  1FPB A;  3PMX A;  2O68 A;  1FPI A;  2REJ A;  4JVC A;  3KC1 A;  3T9H B;  2D5W A;  3T0J A;  1H3D A;  5ELV A;  4G68 B;  2QVV A;  1JET A;  3FVG A;  1FBH A;  2AIX A;  1MDQ A;  4HTG A;  1LAX A;  1B32 A;  4OZ9 A;  4JVD A;  4LZ5 A;  4XKQ A;  1POT A;  4OES A;  3KGC A;  1NNP A;  2V4C A;  4OA4 A;  3Q29 A;  4U22 A;  2A5T A;  4LZ8 A;  2UVI A;  4ZEF A;  2H99 A;  4RPN A;  1QVS A;  4PDH A;  3HO7 A;  4P9K A;  3MAM A;  4F22 A;  4FEB A;  3TKD A;  4EQB A;  2F6P A;  4R6Y A;  3FV1 A;  3D4G A;  5DVI A;  1NI9 A;  4ZS9 A;  1TT1 A; 
#chains in the Genus database with same CATH homology
 2DVZ A;  2CZI A;  4NG7 A;  4PDD A;  1LBY A;  1DK4 A;  1EYK A;  4N17 A;  4AS5 A;  4MAG A;  1NV4 A;  3BIH A;  4I40 A;  4O8M A;  2F3B A;  1FBG A;  4X04 A;  4XFE A;  4HCY A;  4PC9 A;  2DDK A;  2ZZV A;  4UAB A;  3IFC A;  4PBQ A;  5IZ1 A;  1NUY A;  5IZ3 B;  1CNQ A;  4MMP A;  2JJK A;  3SZP A;  3QMF A;  3KBZ A;  1VDW A;  4GWX A;  5J1D A;  4OVP A;  1FJ9 A;  2L5V A;  4F18 A;  4HCW A;  2WBB A;  4JVI A;  2ZZW A;  4PFI A;  4X9T A;  4N81 A;  1XI6 A;  4N6K A;  4MJO A;  2ZZX A;  3HFU A;  5LTC A;  4GWZ A;  5EQA A;  4PAK A;  2XWK A;  3T1B A;  2VT5 A;  5DW8 A;  2WYP A;  2CZH A;  3E79 A;  1YXI A;  4MNP A;  2QPQ A;  1FBP A;  2FVZ A;  4GWU A;  4OVT A;  4PE3 A;  5CM6 A;  1FSA A;  3RPL B;  2PCR A;  1IME A;  5ET5 A;  4MHF A;  1G0I A;  1FPD A;  1FBD A;  4YZZ A;  1IMF A;  2QVU A;  1EYJ A;  4AS4 A;  2VPN A;  1INP A;  4N6D A;  1Q9D A;  4GBW A;  4GX3 A;  1IMA A;  3A29 A;  4OAN A;  4P56 A;  5J16 A;  4DI4 B;  2WYK A;  4M1V A;  4NF0 A;  4P1E A;  1DCU A;  1IMD A;  2QFL A;  4F1U A;  4XF5 A;  5IGA A;  4QBA A;  1FPG A;  2WBD A;  2WX9 A;  4NN3 A;  4GWY A;  5FBP A;  4LN5 A;  4P1L A;  2HHM A;  1NV6 A;  3BIG A;  1NV3 A;  5F24 A;  2FIE A;  2F5X A;  1SPI A;  2KR0 A;  1NV2 A;  4HXV A;  2HZL A;  3RPL A;  4X8R A;  1FPL A;  1NUX A;  2R8T A;  5T3J A;  2DE4 A;  4N4U A;  2PFY A;  3MST A;  5I5P A;  5EQ7 A;  4O7M A;  3KC0 A;  5ET6 A;  4PGN A;  5ET8 A;  3PTY A;  1FPF A;  4I3Y A;  4FBP A;  4PF8 A;  2Q74 A;  5JK4 A;  4NQ8 A;  4MNC A;  1FPB A;  1FPE A;  4NX1 A;  1K9Z A;  2BJI A;  2CZK A;  3FBP A;  1RDZ A;  4PTK A;  2FIX A;  2Y5K A;  2CEX A;  2HPG A;  3NOH A;  4PFR A;  1FPI A;  1NUZ A;  1RDY A;  4JVC A;  4P8B A;  3D1R A;  3KC1 A;  4XEQ A;  2FHY A;  5EYH A;  1FBF A;  2B4M A;  5IZZ A;  5IM2 A;  3T0J A;  3GYY A;  2OWZ A;  3ROJ A;  5ESY A;  4O7I A;  2QVV A;  2XWV A;  1AWB A;  4MCO A;  1LBZ A;  2P3N A;  2XXK A;  4GWS A;  2XWI A;  4O94 A;  4OVQ A;  1FBH A;  2CEY A;  4HE1 A;  1FPK A;  1FPJ A;  1NV5 A;  1YZ0 A;  1FTA A;  1FJ6 A;  1NV1 A;  4I3E A;  1NV7 A;  2DE3 A;  2Q9T A;  1NV0 A;  4MNI A;  2DE2 A;  2F3D A;  1DBZ A;  3B8B A;  5EQ9 A;  4P47 A;  1K9Y A;  4NHB A;  3RYD A;  4JVD A;  1BK4 A;  2WEF A;  5A5L A;  2B4L A;  3E78 A;  3FXB A;  4PF6 A;  1JP4 A;  1FRP A;  2GQ1 A;  1QGX A;  5LDZ A;  2P3V A;  2MKZ A;  2Y5L A;  2Q8M A;  2PFZ A;  2HZK A;  4G61 A;  2HXR A;  4OVS A;  4N15 A;  4PAI A;  4GX6 A;  2XWO A;  5IZ3 A;  4MIJ A;  1FBE A;  1D9Q A;  1G0H A;  1RDX A;  2V4C A;  3MYU A;  1LBX A;  4OVR A;  4H45 A;  1KZ8 A;  3LUZ A;  4P3L A;  4PAF A;  4YIC A;  1YYZ A;  1KA1 A;  3LV0 A;  4HE2 A;  1LEV A;  4N8G A;  4OA4 A;  4PFB A;  4GBV A;  4GWW A;  4QXD A;  4MEV A;  4KXP A;  2OX3 A;  4DI3 D;  2QVR A;  1EYI A;  3W9V A;  3EKI A;  4NGU A;  5EQ8 A;  1KA0 A;  4PET A;  4H46 A;  4PGP A;  1IMB A;  5ET7 A;  1IMC A;  2FBP A;  4N91 A;  3CHG A;  4MX6 A;  4PCD A;  3W9W A;  4F1V A;  4PDH A;  4NAP A;  4P9K A;  4F19 A;  1FBC A;  5I7I A;  3U65 A;  3B50 A;  1LBW A;  3IFA A;  2KQZ A;  4GX4 A;  2V3Q A;  5I3S A;  1LBV A;  3ISP A;  4N8Y A;  4PBH A;  2VPO A;  5EYG A;  4HE0 A;  4IR8 A;  1NUW A;  1NI9 A;  2XA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...