4AS4A

Structure of human inositol monophosphatase 1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
274
structure length
274
Chain Sequence
DPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cloning, Expression, Purification, Crystallization and X-Ray Analysis of Inositol Monophosphatase from Mus Musculus and Homo Sapiens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE 1
total genus 90
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4as4A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4as4A02
1NV4A 2FHYA 1YYZA 2PCRA 2HHMA 1FPGA 2QVVA 1FSAA 3LUZA 1FPFA 1NV5A 2FBPA 3IFCA 1FRPA 5ET7A 3KC0A 1FBDA 1NV6A 5DW8A 1EYJA 1XI6A 4N81A 1RDYA 2QVUA 4O7IA 1FBGA 1FJ9A 1G0HA 4GWZA 1D9QA 1VDWA 1FBPA 1NV7A 2FIXA 4QXDA 3QMFA 2Q74A 1IMFA 5ESYA 5EQ9A 5EYHA 1DBZA 1NUYA 2OX3A 4GBWA 1IMCA 2F3BA 1FBEA 2OWZA 1RDXA 5IZ3A 5FBPA 3A29A 1KA0A 2WBBA 4G61A 3RPLA 2P3NA 1FTAA 1NUXA 3IFAA 1BK4A 1KA1A 5EQ8A 1LBZA 1FPIA 1LBVA 1IMDA 1FBFA 2DDKA 2JJKA 2CZHA 4I40A 1NI9A 3RYDA 1INPA 3B8BA 4HE1A 4GWYA 3KC1A 5I3SA 1YZ0A 1AWBA 1G0IA 1DK4A 5ET6A 1FJ6A 4GWXA 2BJIA 1IMEA 1NV3A 2Y5LA 4FBPA 3LV0A 5ET5A 1FPKA 1DCUA 4AS5A 5EQAA 5J16A 1NV0A 2R8TA 3T0JA 5A5LA 2FVZA 1YXIA 1FPDA 4KXPA 5LDZA 1EYKA 1NUZA 4HE0A 4HE2A 4PTKA 2WEFA 2VT5A 2Y5KA 2FIEA 1FPEA 5F24A 1NV1A 1FPBA 1CNQA 4I3YA 2CZKA 1LBWA 2WBDA 2F3DA 1IMBA 1FBHA 5T3JA 3D1RA 2Q8MA 1FBCA 5ET8A 5EYGA 3KBZA 4GWWA 1QGXA 4I3EA 2GQ1A 4AS4A 1Q9DA 3FBPA 1FPJA 4GBVA 5EQ7A 1FPLA 5IZ3B 3ROJA 1NUWA 2QFLA 4GWSA 4GX4A 1LBYA 2P3VA 4GX6A 3BIGA 1RDZA 1K9YA 1NV2A 1EYIA 4H46A 3RPLB 4H45A 4HXVA 4GWUA 2QVRA 1JP4A 3BIHA 4MJOA 4GX3A 4IR8A 5IZ1A 1K9ZA 1KZ8A 1LEVA 1SPIA 2CZIA 1LBXA 1IMAA
chains in the Genus database with same CATH superfamily
2Y7PA 4EQ9A 5ICQA 2P0SA 3MBPA 3PPNA 1Y3NA 2F78A 2Y7KA 3E3KA 3GLBA 4H5GA 5I56A 5AA4B 3GZGA 1D9QA 1GV8A 5AA2D 4QXDA 3MP6A 2PMSA 4G77A 4PF8A 1OMPA 2ZNSA 4PBQA 3IAZA 5DYHA 3PU5A 4F3BA 2XXUA 4QFNA 3GXAA 1LBVA 1IITA 1ZU0A 2YLNA 4FIMA 1AIVA 1IXCA 1QUKA 1A7LA 1MY4A 1OVTA 4HTGA 4AS5A 4FAJA 2XWOA 3CFLA 4MX6A 3C36A 3KSJA 2OWSA 1FPEA 5F24A 5HPQA 3G3IA 2ZYNA 3K0VA 3D1RA 5H8HB 2XA5A 3O28A 1LAFE 5EQ7A 5A5XB 4GX6A 2UYFA 1N3WA 2HXRA 1B3FA 2OPEA 3THIA 4P0IA 1NFTA 2D21A 5IZ1A 4NF4B 3FXBA 4BDNA 1DOTA 1LBBA 3TQWA 3KC0A 1B4HA 3QYTA 3SEVA 1L5TA 1D9VA 3U72A 3L6HA 4O7IA 3A09A 3SEYA 4KR5A 2Z8DA 1FBPA 1PB8A 4JSOA 1BTJA 3ZSFA 5DVFA 4OFLA 3LSWA 4H1XA 4MNIA 4NF8B 1NH7A 4U1ZA 3K4UA 2UVJA 1MS7A 3FVGA 3M3LA 1FBFA 1B3GA 3KN7A 1B1HA 1H44A 1ZTYA 2IEEA 4R73A 3SEXA 4R6YA 3Q27A 4LZ5A 2RCAA 1YXIA 1FPDA 4ELRA 3TCGA 3QAXA 2B4LA 2H98A 3H4ZA 1TXFA 4I3YA 3O2AA 3IJXB 1AH5A 3LSFB 3H6TA 3VDFA 3EHSA 3CFXA 2XX8A 1LBYA 3FV2A 5AA1A 2ALUA 5CMCA 4KI0E 1DTGA 4C0RA 1EYIA 5KCJB 4IO6A 4DXBA 3I5OA 3FJGA 4MJOA 4OVTA 3B6QA 1P1NA 3T9XB 4GL0A 4LQ2A 2CZIA 1NV4A 1XOCA 3BKIB 4FEBA 1FSAA 4U23A 1NV5A 1NMUA 3SEUA 1JVYA 1ELJA 2IA4A 4F3SA 1BP5A 1NNFA 2Q89A 4YZZA 4XIGQ 5TPAB 4JWYA 1Q35A 1NV7A 2ABHA 3FXRA 1Z7ME 2G93A 4NF0A 4P56A 1B32A 1JEVA 4ONYA 4X9TA 1II5A 4IO7A 2F7BA 1Y3PA 3S9LC 3V89B 3DP6A 1YPNA 2THIA 4E0XA 4RY1A 2NXOA 2WX9A 3Q26A 1VR5A 3S9NC 3HSTA 4GWYA 4DCXA 5B70A 4MBPA 3LSXA 1DK4A 3HFUA 2ZNTA 1VE4A 4FBPA 3LV0A 3HO7A 4N91A 3MSTA 3OD7A 5K2XA 1US4A 4U2RA 3OMBA 4XKRA 4AB5A 1PBQA 2HAVA 5HM4B 4X8RA 4RPOA 1BLFA 4F39A 3RLFE 2WYKA 4KYDA 5EYGA 3IB1A 1AL3A 4PCDA 3PMWA 4MHFA 3PPQA 4KD5A 3F11A 2ZZWA 4KQPA 4PFRA 2UVGA 1FQBA 3GBBA 4N8YA 3PPPA 4MF3A 1GTKA 1LAXA 1SDXA 4HW8A 2PX1A 3FXQA 4JXIA 3TAJA 3KOTA 2QPQA 4EQBA 3TDJA 3LUZA 3UA8A 2PFZA 2XXYA 3MZ1A 2QSXA 5ISUA 3CVGA 4ZEKA 3CG3A 3TPAA 3CFZA 2F97A 5DTBA 1G0HA 4F1YA 2CMOA 2DP8A 2VGQA 5K2YA 4OESA 2FIXA 2DWIA 4PFUA 3IOWA 5ESYA 4X1DA 3RQTA 2I3VA 2OX3A 4GBWA 3KJTA 4H65A 4OVRA 1Y3QA 3H7MA 5F1QA 1KWHA 4LP2B 3DELB 1SQYA 4HE1A 2NWJA 1SW2A 1LSTA 1G0IA 1D3KA 4OEVA 1EZOA 3IO4A 4EF2A 1BIYA 1RYXA 2AL5A 4JSDA 2Y5LA 3FXUA 4BDLA 2OJTA 4N07A 4KFQA 2GFEA 2PYYA 2GRVA 3B50A 2PFYA 2P1SA 2XXIA 3DLNA 2KQZA 1FPBA 1CNQA 3C4MA 2O7UA 5L9OA 2H5YA 1B40A 1Y1MA 1SBPA 2Y7IA 1P1OA 3K1MA 1FPJA 2G29A 1FPLA 4AB6A 4QHQA 1MQIA 4BDMA 3T22A 3BIGA 1RDZA 4PFYA 3TELA 2QS2A 4EDPA 4PBHA 3MP8A 3IX1A 1SPIA 2H99A 3IORA 2XXXA 4THIA 4ESXA 1FTMA 4PFBA 4PC9A 3U94A 4P47A 2ANJA 3TTLA 1DPEA 5ET7A 4MEVA 1LFIA 2D5WA 4LONB 5BUUA 2R9JA 4P1EA 3H6WA 2A5TB 4ZS9A 3G3HA 2OWTA 4GF8A 3U8QA 1IIWA 3CIJA 4GD5A 2Q74A 2KLFA 2NOOA 1B5IA 3TZAA 2OWZA 1MXXA 3M3KA 1EZ9A 4C1UA 3MVXA 3T9UA 1B52A 1LBZA 1IQ7A 2RCBA 1YCJA 2GHAA 2VOZA 2X7PA 4BDRA 3KC1A 1YZ0A 1B5JA 1MH4A 4EF1A 1N76A 4G68B 3U92A 2VPNA 4FECA 4YMAA 1XVXA 4XEQA 4PGNA 2L5VA 1A8FA 1MY2A 1XVYA 4LZ8A 3KBRA 4YB6A 4R9FA 5AA2A 3SEWA 2QS3A 4IO4A 4Q0CA 1XT8A 4DXCA 3KSXA 2DVZA 2O51A 3JZJA 5I2NB 3FZVA 4YKJA 1Q9DA 4GRKA 3EKIA 1NNKA 3TMGA 1UTHA 2Y84A 4I8CA 3FJMA 1O7TA 4F18A 4YAHX 3KOSA 2DXRA 4RPNA 2YPNA 5DVJA 1B3LA 4Q8RA 3CI8A 4R9GA 4O3AA 3C35A 3K6VA 5DW8A 1FBGA 4NG7A 4GWZA 3KN3A 4N6DA 2V84A 3LUYA 4WEPA 2REJA 4ZZEA 2DSFA 3A29A 5AE4A 5ICTA 4OETA 4PFIA 1I6QA 2OBGA 4PGPA 1R6ZA 1FPIA 3OO7A 4G68C 2QMXA 3MJNA 3PMVA 4I40A 3RYDA 2DYXA 3QXMA 2FYIA 2W7YA 2XXTA 4GWXA 3OEMA 2XXWA 1URDA 3T0JA 5CC2A 3G3FA 4KXPA 5LDZA 3C32A 1Z7NE 4N6PA 4R75A 2Y5KA 2X26A 4DI3D 4GOTA 1WVJA 1CE2A 3RGYA 3QIMA 4Z0IA 4N15A 2I48A 5I58B 2WYPA 2P3VA 5IGAA 1R1NA 2B3BA 4YB5A 4H46A 4H45A 4GWUA 1B9JA 3BIHA 2Q2AA 5CMKA 3FASA 2DE2A 4HCYA 1RYOA 4MNCA 3G7WA 3VVFA 4MIJA 4XKPA 4KYSA 1EYJA 3PUXE 1SVXB 3PTYA 2Z23A 1S9TA 2XWKA 3C9HA 4PP0A 1POY1 3V5AA 5LOMA 5H8NB 4XKQA 3E78A 1P99A 3OSRA 1RKMA 4F3GA 1UIUA 1MXVA 3OENA 4QSCA 1LCTA 3DM0A 5CMBA 2ONRA 1POTA 1IZ1A 2P2AA 4RJZA 4QFKA 4YMBA 4XTCQ 5KCJA 2VD2A 2ZYKA 1QVSA 3RN8A 3VLUA 1B46A 1OIBA 1N84A 1EYKA 4HE0A 3KFMA 2WEFA 2DWJA 1M5EA 1LLSA 1IEJA 2CZKA 3PD9A 2Q2CA 4E0WA 5ET8A 4GWWA 4JWOA 3MPKA 1GGGA 3OO8A 4GBVA 1NH8A 2E1SA 1NUWA 1FQEA 1MM7A 4FORA 1B7ZA 1FW0A 4NN3A 2B3FA 1LB9A 5H8NA 2DOJA 4FATA 4PETA 1Y20A 2QS1A 2HZKA 1LFHA 3E79A 1GR2A 3LBSA 2RF1A 4MLQA 3JV9A 3S4UA 4NTLA 3CSBA 4MCOA 4JB7A 1M5BA 5IM2A 2O7IA 4F3PA 3BFTA 4YKIA 3FVKA 1B1XA 4F22A 1IMFA 1QUIA 3Q25A 3TFLA 3O97A 4G61A 3EHUA 4F1VA 2DWHA 4QBAA 2PT2A 3K6WA 1BK4A 3MVWA 1B6HA 5EQ8A 2LAOA 1IMDA 3CR9A 1NI9A 1MQDA 1P1UA 5I3SA 4OVQA 4YB7A 2AYSA 4PDDA 3H03A 3MPLA 3C31A 5M2VA 5CBSA 3TTRA 5ET5A 2HCAA 4PE5B 5I2KB 5TP9B 1N7WA 4ZEIA 1SYHA 1MRPA 1B0LA 5L8DA 2O1LA 2YJPA 4POWA 2QS4A 2KR0A 3MYUA 1XHYA 2FIEA 1VFEA 4DLDA 3U65A 2OPDA 3R6UA 2R71A 1LBWA 1ZIUA 1FBHA 4WEDA 3W9WA 4OEUA 5HBCA 1MQJA 2VPOA 1NKXA 4KCDA 5I59B 1IXHA 2XWVA 1AOVA 4GVOA 4X48A 1HSLA 2BJJX 4KHZE 3E13X 2QVRA 5DT6A 3G3JA 3PUVE 2RC8A 5KZTA 2FHYA 1MY0A 5CBRA 2DS9A 2HHMA 4LUBA 4ZECA 2FBPA 4PFTA 4OVPA 4Z7EA 1FQFA 4G8NA 3JYRA 3TEPA 2OCUA 1DMBA 3VXCA 3DP4A 2QRYA 3KN8A 1EZPA 1UTHB 4L17A 3UORA 4FJPA 2Q9TA 4R2BA 3T93B 4QFLA 5IZ3A 2HZLA 1JQFA 4HS7A 1NUXA 4JWXA 1VSOA 1SI0A 1D4NA 3RUMA 3MP1A 5EYFA 1FTOA 4NE4A 5I2NA 3ECRA 3IL1B 3W15C 4ELQA 2RC9A 5FTHA 1B0HA 4DXUA 5KDTB 4O3BA 3ZS6A 3CSGA 1FPKA 2XXVA 4YKPA 3SETA 4F29A 4QSEA 3M3FA 3TTNA 4F2QA 5L9SA 4PTKA 4F31B 5I56B 4H0WA 3PPRA 4DE8A 1MQGA 1ZJLA 5TPAA 4EUOA 3VVDA 4KYEA 5T3JA 2HQ0A 5IZZA 3PUYE 2O84X 4N13A 1SW5A 3MW0A 3PV0E 4LN5A 4RNSA 2FNCA 5ELVA 4YU0A 2ZZXA 2ZZVA 3O29A 2ZNUA 3RPLB 2XWIA 3HN0A 1FTLA 2DE4A 3TYHA 1MY1A 5IAIA 4XFEA 2AIXA 3SESA 1LBXA 2CEXA 4OVSA 2QVVA 1FPFA 4U4XA 2QL3A 1Q1KA 1LAGE 3T96B 3HV1A 1IUDA 3GBAA 3VFJA 1I69A 5B7DA 5EHMA 3IOUA 5EYHA 4PAFA 3MZBA 4OXVA 1OLCA 1T0KA 1OQGA 2PT1A 4X04A 4R74A 1N7XA 3VLWA 5IKBA 2V4CA 4UACA 1Y9UA 3L6GA 3B8BA 3O66A 4KPTA 1WODA 5FHMA 2A5SA 4NF6B 3K6XA 4IO3A 4MH5A 4U1OA 5JEIA 3LC8A 2RINA 5CI5A 1NV0A 2R8TA 3O6GA 4NGUA 4IY6A 4YKKA 4NEDA 4OHNA 3ONMA 1SI1A 3H06B 3H6UA 4OFOA 4RYAA 1DTZA 5KDTA 3IK6B 4U22A 4IB2A 2OZZA 3SKPA 4U21A 1NV2A 3GYYA 2PBWA 1H43A 2X7QA 3OEKA 3BFUA 2Z8EA 4O8MA 3QUJA 1IXIA 3B7DA 3T66A 2PCRA 2Y7RA 4PQJA 4FEDA 4ZE8A 1I6BA 4O3CA 1PDAA 3PUWE 1GVCA 3OXNA 4GQOA 2CEYA 1RDYA 4Q30B 3QMFA 3USDA 2RKMA 4PAIA 3EHTA 2HXWA 1DBZA 2V3TA 5BWJA 3PMXA 1FQCA 3KG2A 1MDQA 2P3NA 5CM6A 1D9YA 4C1TA 4FE8A 3MWBA 1LFGA 3K02A 3OO9A 5I59A 4NHBA 4LZ7A 1MY3A 4HCWA 4JVIA 4ISUA 3W9VA 4N17A 3ILUB 3O9PA 1PB9A 3ISPA 4XXUA 1H3DA 3BBRA 1NV3A 4NMYA 1UQWA 1N04A 1NNPA 2B65A 2REGA 4ZE9A 3IB0A 1HSJA 1MXYA 1JEUA 1JW5A 4OMBA 4OFJA 5I5PA 3IOTA 4IGRA 3RPWA 2ZYMA 2Q8JA 5DEXB 1M5DA 1Y4TA 1IMBA 4NWDA 3PPOA 4P3LA 3N94A 1QGXA 1ANFA 4AS4A 5IZ3B 4KCCA 3NOHA 3PUZE 2H25A 4RK2A 2DXYA 3R26A 2I0CA 4OA4A 1Y1ZA 1JP4A 2XXHA 3QK6A 1SW1A 1OLAA 4DZ1A 3U1OA 4G8MA 3MC2A 1FRPA 4U4SA 1A8EA 1FBDA 4F2OA 1EU8A 1URGA 3VV5A 4PE3A 1H45A 4ZEFA 4I9DA 2V3UA 2RC7A 5EQ9A 2XD3A 1FQAA 4N8GA 2F3BA 1EH3A 2F7CA 1RDXA 4YICA 3A3CA 4XKNA 2O69A 1KA0A 2B4MA 4ECFA 3TUSA 2Q88A 2UXAA 4OVJA 4GL8A 2I4CA 4UABA 3UN6A 4RXLA 3PGFA 3VVEA 3K1NA 3K00A 4WXJA 2XHDA 3SZPA 3RT8A 5ITPA 1PEBA 4I62A 2QMWA 2Z22A 5A5LA 4BDQA 1MQHA 4M1VA 1LB8A 4DCYA 1NUZA 4PF6A 1MPDA 2VT5A 5H8FB 2F5XA 1PB7A 3T1BA 2Q8MA 1USYH 1M5CA 4EXLA 3HCQA 2WKYA 2XX9A 4OANA 1WDNA 5JTYA 4RK9A 3I6VA 4PDHA 4JVCA 2V93A 1DSNA 2NUVA 5CMMA 1JW4A 2A5TA 3MVYA 4Q5TA 1K9YA 2H9BA 3RNNA 3IO6A 1ZMGA 4TLLB 1K9ZA 1IMAA 4QFOA 1YYZA 4OERA 3RT6B 1BKAA 3T9VA 3OO6A 2I4BA 3IFCA 1A99A 3G3KA 3EQ1A 1B51A 3KGCA 1XS5A 3D4GA 4DI4B 3N6TA 4N81A 2QVUA 2D3IA 5A5XA 2XXQA 2DWAA 4MAGA 3TTKA 2HFBA 3FATA 3CRBA 5ITOA 5FBPA 3MVZA 1FTAA 4ESWA 1YAEA 3R7XA 3UK4A 3TQLA 2HPGA 2GH9A 1B7UA 1O64A 1N3XA 3SDFA 3UGWA 1R9QA 4R72A 4G68A 2ONKE 4H8JA 2F6PA 4O7MA 3EPEA 3AXFA 2QJEA 1TT1A 2FVZA 3S9EA 3N26A 4GXSB 5F7VA 3ILTB 4PFWA 1DPPA 3K6UA 1NV1A 1B3HA 5AA2B 2I6EA 2WBDA 3S9MC 3S2VA 1A54A 1XC1A 1FBCA 2GQ1A 4JDFA 1MH3A 1VFDA 4BDOA 2R6GE 2QFLA 5TP9A 5I2KA 3VLVA 1FTJA 4R6KA 4DDDA 1SW4A 1FQDA 4GWOA 2VD3A 1CB6A 2HEUA 4HXVA 2F7AA 4K3FA 3P7IA 2I49A 4N4UA 3V8XB 5H8FA 4IR8A 1QULA 1JVXA 4R2FA 1UIVA 3A3UA 1QJMA 4IGTA 3TCFA 3Q29A 3PD8A 1USYE 1PC3A 3TTMA 4ELPA 2XXKA 1O63A 4MMPA 1FJ9A 1YTVA 5CRYA 5DVIA 1VDWA 1MXZA 1TWYA 3QSLA 4F1UA 1MXWA 4BLAA 1TFDA 1TFAA 3RTFB 1IMCA 1US5A 1S50A 4TOZA 3VE1B 1IXGA 4P8BA 5H8HA 1MG1A 1AMFA 2F8DA 4OWDA 3MAMA 3OELA 3K01A 1Y4CA 2CZLA 3FIRA 1UTBB 3N5LA 1LAHE 2BJIA 1IMEA 4NF4A 4ND9A 5EQAA 3ZKKA 5L9MA 2H4IA 5H8QB 1H76A 3HHFA 4NWCA 1NNTA 4ZEBA 2O6AA 1B7HA 4IY5A 4I1DA 4IO2A 4ZZAA 1PBPA 2F3DA 1ATGA 4XF5A 5AA4A 4P0GA 3KZGA 1M5FA 4WKMA 3CG1A 4EXKA 2DE3A 3OSQA 3O6HA 3FVOA 3ODBA 4TLMB 4NF5A 2UYEA 5FHNA 4DIGA 4GIZA 5I57B 4MFIA 3WAEA 3E4RA 3TKDA 2GHBA 1MXUA 2VHAA 1JETA 2ESNA 3LSLA 4IO5A 4JVDA 4NX1A 2DQVA 3UP9A 2F35A 5LTCA 3KJ7A 1FTKA 4OENA 2F36A 1QW0A 3B6TA 4OYVA 2Z8FA 1MM6A 2FA7A 1SYIA 4GFRA 4NAPA 3CHGA 5I84A 1B3EA 1B58A 1NUYA 1FBEA 2OK2A 1NL5A 4UA8A 5H8QA 1LCFA 2I3WA 1KA1A 3MUQA 5JTYB 2O1MA 2I58A 2UVHA 2XXRA 2O68A 2DDKA 3K2DA 2JJKA 3FJ7A 2HAUA 5H8SA 1INPA 4QRZA 4OZ9A 3IR1A 4G2ZA 3IJOB 1AWBA 3OOAA 4LA9A 1B4ZA 3O6IA 4P1LA 3H6VA 2PVUA 3FV1A 5J16A 4LQ5A 3U93A 1MPCA 4G4PA 1URSA 3T9HB 2ZXTA 4QFPA 1B05A 2ZYOA 3MQ9A 3K1PA 4H5FA 1FCKA 4F19A 5J1DA 3TODA 2XD2A 3DP8A 4N6KA 3V83A 1P1QA 5AA3A 1P1WA 1ZKBA 2V25A 4NF8A 4NF6A 1I6AA 3KBZA 3E9XA 4I3EA 4P9KA 3FBPA 3N6UA 5I7IA 5FTIA 3H3GA 4ZEDA 4X1BA 1ZBMA 2OLBA 4H8IA 5JK4A 1MPBA 3EF7A 4GX3A 1KZ8A 4RA1A 1B2HA 5DEXA 1LEVA 3G3GA 2VP1A 3IB2A 3M8UA 3C33A 5TU0A 4OTEA 1FPGA 2ONSA 4LVQA 3HPIA 4PAKA 2V3QA 3WAFA 3Q28A 1N0TA 2ZMBA 2MKZA 1NV6A 1XI6A 4GLIA 1JW1A 2I0BA 1A40A 3VXBA 5I57A 1LGBC 1LBCA 4GXAA 1QUJA 5I58A 4ELOA 3LR1A 3FD3A 3FVNA 4ZDMA 4TQUQ 2XX7A 3IOVA 2WBBA 3RPLA 4NF5B 3KEIA 3UIFA 3IFAA 1HSEA 3B6WA 3C34A 3EN3A 3QUFA 2CZHA 4POXA 3SERA 3TCHA 1R9LA 1QKAA 4O94A 1MDP1 2XXPA 4MLVA 1J1NA 5ET6A 1FJ6A 4P11A 4AQ4A 1DCUA 4M4GA 1SD3A 1OVBA 4R6HA 4OQOA 4MNPA 2Y7WA 3FUZA 3RTWB 5FHOA 4HE2A 4LATA 1QKBA 2AL4A 4G8HA 3I3VA 1UTBA 4QSDA 2M8CA 1ZLQA 2UVIA 2DVCA 3MZ9A 3RY3A 2NVUB 3FGSA 3ZKLA 4EQ7A 1F9BA 2F34A 2F6GA 1B5HA 3ROJA 4GWSA 4GX4A 3HHGA 1S7YA 3D4CA 4NQ8A 1JNFA 1OQHA 4JBZA 4QF9A 2E0SA 4H67A 5EHSA 4H6DA 1A55A
chains in the Genus database with same CATH topology
1NV4A 2DE2A 2FHYA 1YYZA 2PCRA 2CEXA 2QPQA 4OVSA 2HHMA 1FPGA 2QVVA 1FSAA 3LUZA 1FPFA 4HCYA 4PAKA 2V3QA 1NV5A 2FBPA 4MNCA 4P47A 4PC9A 4OVPA 3IFCA 2PFZA 1FRPA 5ET7A 5LTCA 3KC0A 1FBDA 4MEVA 4MIJA 2MKZA 4MCOA 1NV6A 5DW8A 4P1EA 1EYJA 4DI4B 1XI6A 2XXKA 5IM2A 2CEYA 4N81A 1RDYA 2QVUA 3PTYA 4PE3A 4O7IA 4YZZA 4MMPA 1FBGA 1FJ9A 1G0HA 4NG7A 4GWZA 2XWKA 1D9QA 1VDWA 1FBPA 4MAGA 1NV7A 2FIXA 4NAPA 4QXDA 4F1UA 3QMFA 4N6DA 2Q74A 1IMFA 4P56A 4NF0A 3CHGA 5ESYA 5EQ9A 4PF8A 5EYHA 4N8GA 4PAIA 4X9TA 1DBZA 1NUYA 2OX3A 4GBWA 2Q9TA 1IMCA 2F3BA 1FBEA 4MNIA 2OWZA 4PBQA 4YICA 1RDXA 5IZ3A 5FBPA 2HZLA 4OVRA 3A29A 1KA0A 2WBBA 4G61A 3RPLA 4F1VA 2P3NA 1FTAA 1NUXA 4PFIA 2B4MA 4P8BA 4QBAA 5CM6A 4X04A 3IFAA 1BK4A 1KA1A 4PGPA 5EQ8A 2WX9A 1LBZA 1FPIA 1LBVA 1IMDA 1FBFA 2HPGA 2DDKA 2JJKA 4N15A 4UABA 2CZHA 4I40A 1NI9A 3RYDA 2V4CA 4NHBA 1INPA 3B8BA 4HE1A 4GWYA 3KC1A 5I3SA 4HCWA 1YZ0A 4OVQA 4O94A 4JVIA 1AWBA 4PDDA 1G0IA 3W9VA 3SZPA 4N17A 1DK4A 4O7MA 4P1LA 5ET6A 3HFUA 1FJ6A 3ISPA 4GWXA 5JK4A 2BJIA 1IMEA 1NV3A 2Y5LA 4FBPA 3LV0A 5ET5A 4PDHA 4N91A 1FPKA 1DCUA 4AS5A 5EQAA 5J16A 2VPNA 4PAFA 1NV0A 2R8TA 3T0JA 4XEQA 4PGNA 5A5LA 2XWOA 2FVZA 2L5VA 1YXIA 1FPDA 4KXPA 4M1VA 4MNPA 5LDZA 4MX6A 1EYKA 3MSTA 1NUZA 4HE0A 4PF6A 4NGUA 5I7IA 4HE2A 3B50A 4PTKA 5I5PA 2B4LA 2PFYA 2WEFA 2VT5A 2Y5KA 2KR0A 4F19A 3MYUA 5J1DA 2FIEA 1FPEA 2KQZA 5F24A 4N6KA 1NV1A 1FPBA 1CNQA 4DI3D 4I3YA 2F5XA 3U65A 4X8RA 2CZKA 1LBWA 2WBDA 2DVZA 2F3DA 4PFBA 3T1BA 4XF5A 1IMBA 1FBHA 5T3JA 3D1RA 2Q8MA 1FBCA 2WYKA 5ET8A 5EYGA 3KBZA 4P3LA 2XA5A 4GWWA 1QGXA 4I3EA 2GQ1A 4OANA 2DE3A 4MHFA 4P9KA 4PCDA 5IZZA 4AS4A 1Q9DA 3FBPA 1FPJA 4GBVA 5EQ7A 1FPLA 5IZ3B 3W9WA 3ROJA 1NUWA 2QFLA 2VPOA 4GWSA 4GX4A 1LBYA 2WYPA 2P3VA 3EKIA 3NOHA 4JVCA 2ZZWA 5IGAA 4PFRA 2XWVA 4LN5A 4GX6A 4NQ8A 3BIGA 1RDZA 4NN3A 1K9YA 1NV2A 1EYIA 2HXRA 2ZZXA 4H46A 2ZZVA 3GYYA 4N8YA 4PBHA 3RPLB 4H45A 4HXVA 2XWIA 4PETA 4F18A 4GWUA 2DE4A 4OA4A 4N4UA 4O8MA 2QVRA 1JP4A 3BIHA 4MJOA 4OVTA 4GX3A 4IR8A 5IZ1A 1K9ZA 1KZ8A 2HZKA 4JVDA 4XFEA 1LEVA 3E79A 3FXBA 1SPIA 3E78A 2CZIA 1LBXA 1IMAA 4NX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV4 A;  2FHY A;  1YYZ A;  2PCR A;  2HHM A;  1FPG A;  2QVV A;  1FSA A;  3LUZ A;  1FPF A;  1NV5 A;  2FBP A;  3IFC A;  1FRP A;  5ET7 A;  3KC0 A;  1FBD A;  1NV6 A;  5DW8 A;  1EYJ A;  1XI6 A;  4N81 A;  1RDY A;  2QVU A;  4O7I A;  1FBG A;  1FJ9 A;  1G0H A;  4GWZ A;  1D9Q A;  1VDW A;  1FBP A;  1NV7 A;  2FIX A;  4QXD A;  3QMF A;  2Q74 A;  1IMF A;  5ESY A;  5EQ9 A;  5EYH A;  1DBZ A;  1NUY A;  2OX3 A;  4GBW A;  1IMC A;  2F3B A;  1FBE A;  2OWZ A;  1RDX A;  5IZ3 A;  5FBP A;  3A29 A;  1KA0 A;  2WBB A;  4G61 A;  3RPL A;  2P3N A;  1FTA A;  1NUX A;  3IFA A;  1BK4 A;  1KA1 A;  5EQ8 A;  1LBZ A;  1FPI A;  1LBV A;  1IMD A;  1FBF A;  2DDK A;  2JJK A;  2CZH A;  4I40 A;  1NI9 A;  3RYD A;  1INP A;  3B8B A;  4HE1 A;  4GWY A;  3KC1 A;  5I3S A;  1YZ0 A;  1AWB A;  1G0I A;  1DK4 A;  5ET6 A;  1FJ6 A;  4GWX A;  2BJI A;  1IME A;  1NV3 A;  2Y5L A;  4FBP A;  3LV0 A;  5ET5 A;  1FPK A;  1DCU A;  4AS5 A;  5EQA A;  5J16 A;  1NV0 A;  2R8T A;  3T0J A;  5A5L A;  2FVZ A;  1YXI A;  1FPD A;  4KXP A;  5LDZ A;  1EYK A;  1NUZ A;  4HE0 A;  4HE2 A;  4PTK A;  2WEF A;  2VT5 A;  2Y5K A;  2FIE A;  1FPE A;  5F24 A;  1NV1 A;  1FPB A;  1CNQ A;  4I3Y A;  2CZK A;  1LBW A;  2WBD A;  2F3D A;  1IMB A;  1FBH A;  5T3J A;  3D1R A;  2Q8M A;  1FBC A;  5ET8 A;  5EYG A;  3KBZ A;  4GWW A;  1QGX A;  4I3E A;  2GQ1 A;  4AS4 A;  1Q9D A;  3FBP A;  1FPJ A;  4GBV A;  5EQ7 A;  1FPL A;  5IZ3 B;  3ROJ A;  1NUW A;  2QFL A;  4GWS A;  4GX4 A;  1LBY A;  2P3V A;  4GX6 A;  3BIG A;  1RDZ A;  1K9Y A;  1NV2 A;  1EYI A;  4H46 A;  3RPL B;  4H45 A;  4HXV A;  4GWU A;  2QVR A;  1JP4 A;  3BIH A;  4MJO A;  4GX3 A;  4IR8 A;  5IZ1 A;  1K9Z A;  1KZ8 A;  1LEV A;  1SPI A;  2CZI A;  1LBX A;  1IMA A; 
#chains in the Genus database with same CATH topology
 2Y7P A;  4EQ9 A;  5ICQ A;  2P0S A;  3MBP A;  3PPN A;  1Y3N A;  2F78 A;  2Y7K A;  3E3K A;  3GLB A;  4H5G A;  5I56 A;  5AA4 B;  3GZG A;  1D9Q A;  1GV8 A;  5AA2 D;  4QXD A;  3MP6 A;  2PMS A;  4G77 A;  4PF8 A;  1OMP A;  2ZNS A;  4PBQ A;  3IAZ A;  5DYH A;  3PU5 A;  4F3B A;  2XXU A;  4QFN A;  3GXA A;  1LBV A;  1IIT A;  1ZU0 A;  2YLN A;  4FIM A;  1AIV A;  1IXC A;  1QUK A;  1A7L A;  1MY4 A;  1OVT A;  4HTG A;  4AS5 A;  4FAJ A;  2XWO A;  3CFL A;  4MX6 A;  3C36 A;  3KSJ A;  2OWS A;  1FPE A;  5F24 A;  5HPQ A;  3G3I A;  2ZYN A;  3K0V A;  3D1R A;  5H8H B;  2XA5 A;  3O28 A;  1LAF E;  5EQ7 A;  5A5X B;  4GX6 A;  2UYF A;  1N3W A;  2HXR A;  1B3F A;  2OPE A;  3THI A;  4P0I A;  1NFT A;  2D21 A;  5IZ1 A;  4NF4 B;  3FXB A;  4BDN A;  1DOT A;  1LBB A;  3TQW A;  3KC0 A;  1B4H A;  3QYT A;  3SEV A;  1L5T A;  1D9V A;  3U72 A;  3L6H A;  4O7I A;  3A09 A;  3SEY A;  4KR5 A;  2Z8D A;  1FBP A;  1PB8 A;  4JSO A;  1BTJ A;  3ZSF A;  5DVF A;  4OFL A;  3LSW A;  4H1X A;  4MNI A;  4NF8 B;  1NH7 A;  4U1Z A;  3K4U A;  2UVJ A;  1MS7 A;  3FVG A;  3M3L A;  1FBF A;  1B3G A;  3KN7 A;  1B1H A;  1H44 A;  1ZTY A;  2IEE A;  4R73 A;  3SEX A;  4R6Y A;  3Q27 A;  4LZ5 A;  2RCA A;  1YXI A;  1FPD A;  4ELR A;  3TCG A;  3QAX A;  2B4L A;  2H98 A;  3H4Z A;  1TXF A;  4I3Y A;  3O2A A;  3IJX B;  1AH5 A;  3LSF B;  3H6T A;  3VDF A;  3EHS A;  3CFX A;  2XX8 A;  1LBY A;  3FV2 A;  5AA1 A;  2ALU A;  5CMC A;  4KI0 E;  1DTG A;  4C0R A;  1EYI A;  5KCJ B;  4IO6 A;  4DXB A;  3I5O A;  3FJG A;  4MJO A;  4OVT A;  3B6Q A;  1P1N A;  3T9X B;  4GL0 A;  4LQ2 A;  2CZI A;  1NV4 A;  1XOC A;  3BKI B;  4FEB A;  1FSA A;  4U23 A;  1NV5 A;  1NMU A;  3SEU A;  1JVY A;  1ELJ A;  2IA4 A;  4F3S A;  1BP5 A;  1NNF A;  2Q89 A;  4YZZ A;  4XIG Q;  5TPA B;  4JWY A;  1Q35 A;  1NV7 A;  2ABH A;  3FXR A;  1Z7M E;  2G93 A;  4NF0 A;  4P56 A;  1B32 A;  1JEV A;  4ONY A;  4X9T A;  1II5 A;  4IO7 A;  2F7B A;  1Y3P A;  3S9L C;  3V89 B;  3DP6 A;  1YPN A;  2THI A;  4E0X A;  4RY1 A;  2NXO A;  2WX9 A;  3Q26 A;  1VR5 A;  3S9N C;  3HST A;  4GWY A;  4DCX A;  5B70 A;  4MBP A;  3LSX A;  1DK4 A;  3HFU A;  2ZNT A;  1VE4 A;  4FBP A;  3LV0 A;  3HO7 A;  4N91 A;  3MST A;  3OD7 A;  5K2X A;  1US4 A;  4U2R A;  3OMB A;  4XKR A;  4AB5 A;  1PBQ A;  2HAV A;  5HM4 B;  4X8R A;  4RPO A;  1BLF A;  4F39 A;  3RLF E;  2WYK A;  4KYD A;  5EYG A;  3IB1 A;  1AL3 A;  4PCD A;  3PMW A;  4MHF A;  3PPQ A;  4KD5 A;  3F11 A;  2ZZW A;  4KQP A;  4PFR A;  2UVG A;  1FQB A;  3GBB A;  4N8Y A;  3PPP A;  4MF3 A;  1GTK A;  1LAX A;  1SDX A;  4HW8 A;  2PX1 A;  3FXQ A;  4JXI A;  3TAJ A;  3KOT A;  2QPQ A;  4EQB A;  3TDJ A;  3LUZ A;  3UA8 A;  2PFZ A;  2XXY A;  3MZ1 A;  2QSX A;  5ISU A;  3CVG A;  4ZEK A;  3CG3 A;  3TPA A;  3CFZ A;  2F97 A;  5DTB A;  1G0H A;  4F1Y A;  2CMO A;  2DP8 A;  2VGQ A;  5K2Y A;  4OES A;  2FIX A;  2DWI A;  4PFU A;  3IOW A;  5ESY A;  4X1D A;  3RQT A;  2I3V A;  2OX3 A;  4GBW A;  3KJT A;  4H65 A;  4OVR A;  1Y3Q A;  3H7M A;  5F1Q A;  1KWH A;  4LP2 B;  3DEL B;  1SQY A;  4HE1 A;  2NWJ A;  1SW2 A;  1LST A;  1G0I A;  1D3K A;  4OEV A;  1EZO A;  3IO4 A;  4EF2 A;  1BIY A;  1RYX A;  2AL5 A;  4JSD A;  2Y5L A;  3FXU A;  4BDL A;  2OJT A;  4N07 A;  4KFQ A;  2GFE A;  2PYY A;  2GRV A;  3B50 A;  2PFY A;  2P1S A;  2XXI A;  3DLN A;  2KQZ A;  1FPB A;  1CNQ A;  3C4M A;  2O7U A;  5L9O A;  2H5Y A;  1B40 A;  1Y1M A;  1SBP A;  2Y7I A;  1P1O A;  3K1M A;  1FPJ A;  2G29 A;  1FPL A;  4AB6 A;  4QHQ A;  1MQI A;  4BDM A;  3T22 A;  3BIG A;  1RDZ A;  4PFY A;  3TEL A;  2QS2 A;  4EDP A;  4PBH A;  3MP8 A;  3IX1 A;  1SPI A;  2H99 A;  3IOR A;  2XXX A;  4THI A;  4ESX A;  1FTM A;  4PFB A;  4PC9 A;  3U94 A;  4P47 A;  2ANJ A;  3TTL A;  1DPE A;  5ET7 A;  4MEV A;  1LFI A;  2D5W A;  4LON B;  5BUU A;  2R9J A;  4P1E A;  3H6W A;  2A5T B;  4ZS9 A;  3G3H A;  2OWT A;  4GF8 A;  3U8Q A;  1IIW A;  3CIJ A;  4GD5 A;  2Q74 A;  2KLF A;  2NOO A;  1B5I A;  3TZA A;  2OWZ A;  1MXX A;  3M3K A;  1EZ9 A;  4C1U A;  3MVX A;  3T9U A;  1B52 A;  1LBZ A;  1IQ7 A;  2RCB A;  1YCJ A;  2GHA A;  2VOZ A;  2X7P A;  4BDR A;  3KC1 A;  1YZ0 A;  1B5J A;  1MH4 A;  4EF1 A;  1N76 A;  4G68 B;  3U92 A;  2VPN A;  4FEC A;  4YMA A;  1XVX A;  4XEQ A;  4PGN A;  2L5V A;  1A8F A;  1MY2 A;  1XVY A;  4LZ8 A;  3KBR A;  4YB6 A;  4R9F A;  5AA2 A;  3SEW A;  2QS3 A;  4IO4 A;  4Q0C A;  1XT8 A;  4DXC A;  3KSX A;  2DVZ A;  2O51 A;  3JZJ A;  5I2N B;  3FZV A;  4YKJ A;  1Q9D A;  4GRK A;  3EKI A;  1NNK A;  3TMG A;  1UTH A;  2Y84 A;  4I8C A;  3FJM A;  1O7T A;  4F18 A;  4YAH X;  3KOS A;  2DXR A;  4RPN A;  2YPN A;  5DVJ A;  1B3L A;  4Q8R A;  3CI8 A;  4R9G A;  4O3A A;  3C35 A;  3K6V A;  5DW8 A;  1FBG A;  4NG7 A;  4GWZ A;  3KN3 A;  4N6D A;  2V84 A;  3LUY A;  4WEP A;  2REJ A;  4ZZE A;  2DSF A;  3A29 A;  5AE4 A;  5ICT A;  4OET A;  4PFI A;  1I6Q A;  2OBG A;  4PGP A;  1R6Z A;  1FPI A;  3OO7 A;  4G68 C;  2QMX A;  3MJN A;  3PMV A;  4I40 A;  3RYD A;  2DYX A;  3QXM A;  2FYI A;  2W7Y A;  2XXT A;  4GWX A;  3OEM A;  2XXW A;  1URD A;  3T0J A;  5CC2 A;  3G3F A;  4KXP A;  5LDZ A;  3C32 A;  1Z7N E;  4N6P A;  4R75 A;  2Y5K A;  2X26 A;  4DI3 D;  4GOT A;  1WVJ A;  1CE2 A;  3RGY A;  3QIM A;  4Z0I A;  4N15 A;  2I48 A;  5I58 B;  2WYP A;  2P3V A;  5IGA A;  1R1N A;  2B3B A;  4YB5 A;  4H46 A;  4H45 A;  4GWU A;  1B9J A;  3BIH A;  2Q2A A;  5CMK A;  3FAS A;  2DE2 A;  4HCY A;  1RYO A;  4MNC A;  3G7W A;  3VVF A;  4MIJ A;  4XKP A;  4KYS A;  1EYJ A;  3PUX E;  1SVX B;  3PTY A;  2Z23 A;  1S9T A;  2XWK A;  3C9H A;  4PP0 A;  1POY 1;  3V5A A;  5LOM A;  5H8N B;  4XKQ A;  3E78 A;  1P99 A;  3OSR A;  1RKM A;  4F3G A;  1UIU A;  1MXV A;  3OEN A;  4QSC A;  1LCT A;  3DM0 A;  5CMB A;  2ONR A;  1POT A;  1IZ1 A;  2P2A A;  4RJZ A;  4QFK A;  4YMB A;  4XTC Q;  5KCJ A;  2VD2 A;  2ZYK A;  1QVS A;  3RN8 A;  3VLU A;  1B46 A;  1OIB A;  1N84 A;  1EYK A;  4HE0 A;  3KFM A;  2WEF A;  2DWJ A;  1M5E A;  1LLS A;  1IEJ A;  2CZK A;  3PD9 A;  2Q2C A;  4E0W A;  5ET8 A;  4GWW A;  4JWO A;  3MPK A;  1GGG A;  3OO8 A;  4GBV A;  1NH8 A;  2E1S A;  1NUW A;  1FQE A;  1MM7 A;  4FOR A;  1B7Z A;  1FW0 A;  4NN3 A;  2B3F A;  1LB9 A;  5H8N A;  2DOJ A;  4FAT A;  4PET A;  1Y20 A;  2QS1 A;  2HZK A;  1LFH A;  3E79 A;  1GR2 A;  3LBS A;  2RF1 A;  4MLQ A;  3JV9 A;  3S4U A;  4NTL A;  3CSB A;  4MCO A;  4JB7 A;  1M5B A;  5IM2 A;  2O7I A;  4F3P A;  3BFT A;  4YKI A;  3FVK A;  1B1X A;  4F22 A;  1IMF A;  1QUI A;  3Q25 A;  3TFL A;  3O97 A;  4G61 A;  3EHU A;  4F1V A;  2DWH A;  4QBA A;  2PT2 A;  3K6W A;  1BK4 A;  3MVW A;  1B6H A;  5EQ8 A;  2LAO A;  1IMD A;  3CR9 A;  1NI9 A;  1MQD A;  1P1U A;  5I3S A;  4OVQ A;  4YB7 A;  2AYS A;  4PDD A;  3H03 A;  3MPL A;  3C31 A;  5M2V A;  5CBS A;  3TTR A;  5ET5 A;  2HCA A;  4PE5 B;  5I2K B;  5TP9 B;  1N7W A;  4ZEI A;  1SYH A;  1MRP A;  1B0L A;  5L8D A;  2O1L A;  2YJP A;  4POW A;  2QS4 A;  2KR0 A;  3MYU A;  1XHY A;  2FIE A;  1VFE A;  4DLD A;  3U65 A;  2OPD A;  3R6U A;  2R71 A;  1LBW A;  1ZIU A;  1FBH A;  4WED A;  3W9W A;  4OEU A;  5HBC A;  1MQJ A;  2VPO A;  1NKX A;  4KCD A;  5I59 B;  1IXH A;  2XWV A;  1AOV A;  4GVO A;  4X48 A;  1HSL A;  2BJJ X;  4KHZ E;  3E13 X;  2QVR A;  5DT6 A;  3G3J A;  3PUV E;  2RC8 A;  5KZT A;  2FHY A;  1MY0 A;  5CBR A;  2DS9 A;  2HHM A;  4LUB A;  4ZEC A;  2FBP A;  4PFT A;  4OVP A;  4Z7E A;  1FQF A;  4G8N A;  3JYR A;  3TEP A;  2OCU A;  1DMB A;  3VXC A;  3DP4 A;  2QRY A;  3KN8 A;  1EZP A;  1UTH B;  4L17 A;  3UOR A;  4FJP A;  2Q9T A;  4R2B A;  3T93 B;  4QFL A;  5IZ3 A;  2HZL A;  1JQF A;  4HS7 A;  1NUX A;  4JWX A;  1VSO A;  1SI0 A;  1D4N A;  3RUM A;  3MP1 A;  5EYF A;  1FTO A;  4NE4 A;  5I2N A;  3ECR A;  3IL1 B;  3W15 C;  4ELQ A;  2RC9 A;  5FTH A;  1B0H A;  4DXU A;  5KDT B;  4O3B A;  3ZS6 A;  3CSG A;  1FPK A;  2XXV A;  4YKP A;  3SET A;  4F29 A;  4QSE A;  3M3F A;  3TTN A;  4F2Q A;  5L9S A;  4PTK A;  4F31 B;  5I56 B;  4H0W A;  3PPR A;  4DE8 A;  1MQG A;  1ZJL A;  5TPA A;  4EUO A;  3VVD A;  4KYE A;  5T3J A;  2HQ0 A;  5IZZ A;  3PUY E;  2O84 X;  4N13 A;  1SW5 A;  3MW0 A;  3PV0 E;  4LN5 A;  4RNS A;  2FNC A;  5ELV A;  4YU0 A;  2ZZX A;  2ZZV A;  3O29 A;  2ZNU A;  3RPL B;  2XWI A;  3HN0 A;  1FTL A;  2DE4 A;  3TYH A;  1MY1 A;  5IAI A;  4XFE A;  2AIX A;  3SES A;  1LBX A;  2CEX A;  4OVS A;  2QVV A;  1FPF A;  4U4X A;  2QL3 A;  1Q1K A;  1LAG E;  3T96 B;  3HV1 A;  1IUD A;  3GBA A;  3VFJ A;  1I69 A;  5B7D A;  5EHM A;  3IOU A;  5EYH A;  4PAF A;  3MZB A;  4OXV A;  1OLC A;  1T0K A;  1OQG A;  2PT1 A;  4X04 A;  4R74 A;  1N7X A;  3VLW A;  5IKB A;  2V4C A;  4UAC A;  1Y9U A;  3L6G A;  3B8B A;  3O66 A;  4KPT A;  1WOD A;  5FHM A;  2A5S A;  4NF6 B;  3K6X A;  4IO3 A;  4MH5 A;  4U1O A;  5JEI A;  3LC8 A;  2RIN A;  5CI5 A;  1NV0 A;  2R8T A;  3O6G A;  4NGU A;  4IY6 A;  4YKK A;  4NED A;  4OHN A;  3ONM A;  1SI1 A;  3H06 B;  3H6U A;  4OFO A;  4RYA A;  1DTZ A;  5KDT A;  3IK6 B;  4U22 A;  4IB2 A;  2OZZ A;  3SKP A;  4U21 A;  1NV2 A;  3GYY A;  2PBW A;  1H43 A;  2X7Q A;  3OEK A;  3BFU A;  2Z8E A;  4O8M A;  3QUJ A;  1IXI A;  3B7D A;  3T66 A;  2PCR A;  2Y7R A;  4PQJ A;  4FED A;  4ZE8 A;  1I6B A;  4O3C A;  1PDA A;  3PUW E;  1GVC A;  3OXN A;  4GQO A;  2CEY A;  1RDY A;  4Q30 B;  3QMF A;  3USD A;  2RKM A;  4PAI A;  3EHT A;  2HXW A;  1DBZ A;  2V3T A;  5BWJ A;  3PMX A;  1FQC A;  3KG2 A;  1MDQ A;  2P3N A;  5CM6 A;  1D9Y A;  4C1T A;  4FE8 A;  3MWB A;  1LFG A;  3K02 A;  3OO9 A;  5I59 A;  4NHB A;  4LZ7 A;  1MY3 A;  4HCW A;  4JVI A;  4ISU A;  3W9V A;  4N17 A;  3ILU B;  3O9P A;  1PB9 A;  3ISP A;  4XXU A;  1H3D A;  3BBR A;  1NV3 A;  4NMY A;  1UQW A;  1N04 A;  1NNP A;  2B65 A;  2REG A;  4ZE9 A;  3IB0 A;  1HSJ A;  1MXY A;  1JEU A;  1JW5 A;  4OMB A;  4OFJ A;  5I5P A;  3IOT A;  4IGR A;  3RPW A;  2ZYM A;  2Q8J A;  5DEX B;  1M5D A;  1Y4T A;  1IMB A;  4NWD A;  3PPO A;  4P3L A;  3N94 A;  1QGX A;  1ANF A;  4AS4 A;  5IZ3 B;  4KCC A;  3NOH A;  3PUZ E;  2H25 A;  4RK2 A;  2DXY A;  3R26 A;  2I0C A;  4OA4 A;  1Y1Z A;  1JP4 A;  2XXH A;  3QK6 A;  1SW1 A;  1OLA A;  4DZ1 A;  3U1O A;  4G8M A;  3MC2 A;  1FRP A;  4U4S A;  1A8E A;  1FBD A;  4F2O A;  1EU8 A;  1URG A;  3VV5 A;  4PE3 A;  1H45 A;  4ZEF A;  4I9D A;  2V3U A;  2RC7 A;  5EQ9 A;  2XD3 A;  1FQA A;  4N8G A;  2F3B A;  1EH3 A;  2F7C A;  1RDX A;  4YIC A;  3A3C A;  4XKN A;  2O69 A;  1KA0 A;  2B4M A;  4ECF A;  3TUS A;  2Q88 A;  2UXA A;  4OVJ A;  4GL8 A;  2I4C A;  4UAB A;  3UN6 A;  4RXL A;  3PGF A;  3VVE A;  3K1N A;  3K00 A;  4WXJ A;  2XHD A;  3SZP A;  3RT8 A;  5ITP A;  1PEB A;  4I62 A;  2QMW A;  2Z22 A;  5A5L A;  4BDQ A;  1MQH A;  4M1V A;  1LB8 A;  4DCY A;  1NUZ A;  4PF6 A;  1MPD A;  2VT5 A;  5H8F B;  2F5X A;  1PB7 A;  3T1B A;  2Q8M A;  1USY H;  1M5C A;  4EXL A;  3HCQ A;  2WKY A;  2XX9 A;  4OAN A;  1WDN A;  5JTY A;  4RK9 A;  3I6V A;  4PDH A;  4JVC A;  2V93 A;  1DSN A;  2NUV A;  5CMM A;  1JW4 A;  2A5T A;  3MVY A;  4Q5T A;  1K9Y A;  2H9B A;  3RNN A;  3IO6 A;  1ZMG A;  4TLL B;  1K9Z A;  1IMA A;  4QFO A;  1YYZ A;  4OER A;  3RT6 B;  1BKA A;  3T9V A;  3OO6 A;  2I4B A;  3IFC A;  1A99 A;  3G3K A;  3EQ1 A;  1B51 A;  3KGC A;  1XS5 A;  3D4G A;  4DI4 B;  3N6T A;  4N81 A;  2QVU A;  2D3I A;  5A5X A;  2XXQ A;  2DWA A;  4MAG A;  3TTK A;  2HFB A;  3FAT A;  3CRB A;  5ITO A;  5FBP A;  3MVZ A;  1FTA A;  4ESW A;  1YAE A;  3R7X A;  3UK4 A;  3TQL A;  2HPG A;  2GH9 A;  1B7U A;  1O64 A;  1N3X A;  3SDF A;  3UGW A;  1R9Q A;  4R72 A;  4G68 A;  2ONK E;  4H8J A;  2F6P A;  4O7M A;  3EPE A;  3AXF A;  2QJE A;  1TT1 A;  2FVZ A;  3S9E A;  3N26 A;  4GXS B;  5F7V A;  3ILT B;  4PFW A;  1DPP A;  3K6U A;  1NV1 A;  1B3H A;  5AA2 B;  2I6E A;  2WBD A;  3S9M C;  3S2V A;  1A54 A;  1XC1 A;  1FBC A;  2GQ1 A;  4JDF A;  1MH3 A;  1VFD A;  4BDO A;  2R6G E;  2QFL A;  5TP9 A;  5I2K A;  3VLV A;  1FTJ A;  4R6K A;  4DDD A;  1SW4 A;  1FQD A;  4GWO A;  2VD3 A;  1CB6 A;  2HEU A;  4HXV A;  2F7A A;  4K3F A;  3P7I A;  2I49 A;  4N4U A;  3V8X B;  5H8F A;  4IR8 A;  1QUL A;  1JVX A;  4R2F A;  1UIV A;  3A3U A;  1QJM A;  4IGT A;  3TCF A;  3Q29 A;  3PD8 A;  1USY E;  1PC3 A;  3TTM A;  4ELP A;  2XXK A;  1O63 A;  4MMP A;  1FJ9 A;  1YTV A;  5CRY A;  5DVI A;  1VDW A;  1MXZ A;  1TWY A;  3QSL A;  4F1U A;  1MXW A;  4BLA A;  1TFD A;  1TFA A;  3RTF B;  1IMC A;  1US5 A;  1S50 A;  4TOZ A;  3VE1 B;  1IXG A;  4P8B A;  5H8H A;  1MG1 A;  1AMF A;  2F8D A;  4OWD A;  3MAM A;  3OEL A;  3K01 A;  1Y4C A;  2CZL A;  3FIR A;  1UTB B;  3N5L A;  1LAH E;  2BJI A;  1IME A;  4NF4 A;  4ND9 A;  5EQA A;  3ZKK A;  5L9M A;  2H4I A;  5H8Q B;  1H76 A;  3HHF A;  4NWC A;  1NNT A;  4ZEB A;  2O6A A;  1B7H A;  4IY5 A;  4I1D A;  4IO2 A;  4ZZA A;  1PBP A;  2F3D A;  1ATG A;  4XF5 A;  5AA4 A;  4P0G A;  3KZG A;  1M5F A;  4WKM A;  3CG1 A;  4EXK A;  2DE3 A;  3OSQ A;  3O6H A;  3FVO A;  3ODB A;  4TLM B;  4NF5 A;  2UYE A;  5FHN A;  4DIG A;  4GIZ A;  5I57 B;  4MFI A;  3WAE A;  3E4R A;  3TKD A;  2GHB A;  1MXU A;  2VHA A;  1JET A;  2ESN A;  3LSL A;  4IO5 A;  4JVD A;  4NX1 A;  2DQV A;  3UP9 A;  2F35 A;  5LTC A;  3KJ7 A;  1FTK A;  4OEN A;  2F36 A;  1QW0 A;  3B6T A;  4OYV A;  2Z8F A;  1MM6 A;  2FA7 A;  1SYI A;  4GFR A;  4NAP A;  3CHG A;  5I84 A;  1B3E A;  1B58 A;  1NUY A;  1FBE A;  2OK2 A;  1NL5 A;  4UA8 A;  5H8Q A;  1LCF A;  2I3W A;  1KA1 A;  3MUQ A;  5JTY B;  2O1M A;  2I58 A;  2UVH A;  2XXR A;  2O68 A;  2DDK A;  3K2D A;  2JJK A;  3FJ7 A;  2HAU A;  5H8S A;  1INP A;  4QRZ A;  4OZ9 A;  3IR1 A;  4G2Z A;  3IJO B;  1AWB A;  3OOA A;  4LA9 A;  1B4Z A;  3O6I A;  4P1L A;  3H6V A;  2PVU A;  3FV1 A;  5J16 A;  4LQ5 A;  3U93 A;  1MPC A;  4G4P A;  1URS A;  3T9H B;  2ZXT A;  4QFP A;  1B05 A;  2ZYO A;  3MQ9 A;  3K1P A;  4H5F A;  1FCK A;  4F19 A;  5J1D A;  3TOD A;  2XD2 A;  3DP8 A;  4N6K A;  3V83 A;  1P1Q A;  5AA3 A;  1P1W A;  1ZKB A;  2V25 A;  4NF8 A;  4NF6 A;  1I6A A;  3KBZ A;  3E9X A;  4I3E A;  4P9K A;  3FBP A;  3N6U A;  5I7I A;  5FTI A;  3H3G A;  4ZED A;  4X1B A;  1ZBM A;  2OLB A;  4H8I A;  5JK4 A;  1MPB A;  3EF7 A;  4GX3 A;  1KZ8 A;  4RA1 A;  1B2H A;  5DEX A;  1LEV A;  3G3G A;  2VP1 A;  3IB2 A;  3M8U A;  3C33 A;  5TU0 A;  4OTE A;  1FPG A;  2ONS A;  4LVQ A;  3HPI A;  4PAK A;  2V3Q A;  3WAF A;  3Q28 A;  1N0T A;  2ZMB A;  2MKZ A;  1NV6 A;  1XI6 A;  4GLI A;  1JW1 A;  2I0B A;  1A40 A;  3VXB A;  5I57 A;  1LGB C;  1LBC A;  4GXA A;  1QUJ A;  5I58 A;  4ELO A;  3LR1 A;  3FD3 A;  3FVN A;  4ZDM A;  4TQU Q;  2XX7 A;  3IOV A;  2WBB A;  3RPL A;  4NF5 B;  3KEI A;  3UIF A;  3IFA A;  1HSE A;  3B6W A;  3C34 A;  3EN3 A;  3QUF A;  2CZH A;  4POX A;  3SER A;  3TCH A;  1R9L A;  1QKA A;  4O94 A;  1MDP 1;  2XXP A;  4MLV A;  1J1N A;  5ET6 A;  1FJ6 A;  4P11 A;  4AQ4 A;  1DCU A;  4M4G A;  1SD3 A;  1OVB A;  4R6H A;  4OQO A;  4MNP A;  2Y7W A;  3FUZ A;  3RTW B;  5FHO A;  4HE2 A;  4LAT A;  1QKB A;  2AL4 A;  4G8H A;  3I3V A;  1UTB A;  4QSD A;  2M8C A;  1ZLQ A;  2UVI A;  2DVC A;  3MZ9 A;  3RY3 A;  2NVU B;  3FGS A;  3ZKL A;  4EQ7 A;  1F9B A;  2F34 A;  2F6G A;  1B5H A;  3ROJ A;  4GWS A;  4GX4 A;  3HHG A;  1S7Y A;  3D4C A;  4NQ8 A;  1JNF A;  1OQH A;  4JBZ A;  4QF9 A;  2E0S A;  4H67 A;  5EHS A;  4H6D A;  1A55 A; 
#chains in the Genus database with same CATH homology
 1NV4 A;  2DE2 A;  2FHY A;  1YYZ A;  2PCR A;  2CEX A;  2QPQ A;  4OVS A;  2HHM A;  1FPG A;  2QVV A;  1FSA A;  3LUZ A;  1FPF A;  4HCY A;  4PAK A;  2V3Q A;  1NV5 A;  2FBP A;  4MNC A;  4P47 A;  4PC9 A;  4OVP A;  3IFC A;  2PFZ A;  1FRP A;  5ET7 A;  5LTC A;  3KC0 A;  1FBD A;  4MEV A;  4MIJ A;  2MKZ A;  4MCO A;  1NV6 A;  5DW8 A;  4P1E A;  1EYJ A;  4DI4 B;  1XI6 A;  2XXK A;  5IM2 A;  2CEY A;  4N81 A;  1RDY A;  2QVU A;  3PTY A;  4PE3 A;  4O7I A;  4YZZ A;  4MMP A;  1FBG A;  1FJ9 A;  1G0H A;  4NG7 A;  4GWZ A;  2XWK A;  1D9Q A;  1VDW A;  1FBP A;  4MAG A;  1NV7 A;  2FIX A;  4NAP A;  4QXD A;  4F1U A;  3QMF A;  4N6D A;  2Q74 A;  1IMF A;  4P56 A;  4NF0 A;  3CHG A;  5ESY A;  5EQ9 A;  4PF8 A;  5EYH A;  4N8G A;  4PAI A;  4X9T A;  1DBZ A;  1NUY A;  2OX3 A;  4GBW A;  2Q9T A;  1IMC A;  2F3B A;  1FBE A;  4MNI A;  2OWZ A;  4PBQ A;  4YIC A;  1RDX A;  5IZ3 A;  5FBP A;  2HZL A;  4OVR A;  3A29 A;  1KA0 A;  2WBB A;  4G61 A;  3RPL A;  4F1V A;  2P3N A;  1FTA A;  1NUX A;  4PFI A;  2B4M A;  4P8B A;  4QBA A;  5CM6 A;  4X04 A;  3IFA A;  1BK4 A;  1KA1 A;  4PGP A;  5EQ8 A;  2WX9 A;  1LBZ A;  1FPI A;  1LBV A;  1IMD A;  1FBF A;  2HPG A;  2DDK A;  2JJK A;  4N15 A;  4UAB A;  2CZH A;  4I40 A;  1NI9 A;  3RYD A;  2V4C A;  4NHB A;  1INP A;  3B8B A;  4HE1 A;  4GWY A;  3KC1 A;  5I3S A;  4HCW A;  1YZ0 A;  4OVQ A;  4O94 A;  4JVI A;  1AWB A;  4PDD A;  1G0I A;  3W9V A;  3SZP A;  4N17 A;  1DK4 A;  4O7M A;  4P1L A;  5ET6 A;  3HFU A;  1FJ6 A;  3ISP A;  4GWX A;  5JK4 A;  2BJI A;  1IME A;  1NV3 A;  2Y5L A;  4FBP A;  3LV0 A;  5ET5 A;  4PDH A;  4N91 A;  1FPK A;  1DCU A;  4AS5 A;  5EQA A;  5J16 A;  2VPN A;  4PAF A;  1NV0 A;  2R8T A;  3T0J A;  4XEQ A;  4PGN A;  5A5L A;  2XWO A;  2FVZ A;  2L5V A;  1YXI A;  1FPD A;  4KXP A;  4M1V A;  4MNP A;  5LDZ A;  4MX6 A;  1EYK A;  3MST A;  1NUZ A;  4HE0 A;  4PF6 A;  4NGU A;  5I7I A;  4HE2 A;  3B50 A;  4PTK A;  5I5P A;  2B4L A;  2PFY A;  2WEF A;  2VT5 A;  2Y5K A;  2KR0 A;  4F19 A;  3MYU A;  5J1D A;  2FIE A;  1FPE A;  2KQZ A;  5F24 A;  4N6K A;  1NV1 A;  1FPB A;  1CNQ A;  4DI3 D;  4I3Y A;  2F5X A;  3U65 A;  4X8R A;  2CZK A;  1LBW A;  2WBD A;  2DVZ A;  2F3D A;  4PFB A;  3T1B A;  4XF5 A;  1IMB A;  1FBH A;  5T3J A;  3D1R A;  2Q8M A;  1FBC A;  2WYK A;  5ET8 A;  5EYG A;  3KBZ A;  4P3L A;  2XA5 A;  4GWW A;  1QGX A;  4I3E A;  2GQ1 A;  4OAN A;  2DE3 A;  4MHF A;  4P9K A;  4PCD A;  5IZZ A;  4AS4 A;  1Q9D A;  3FBP A;  1FPJ A;  4GBV A;  5EQ7 A;  1FPL A;  5IZ3 B;  3W9W A;  3ROJ A;  1NUW A;  2QFL A;  2VPO A;  4GWS A;  4GX4 A;  1LBY A;  2WYP A;  2P3V A;  3EKI A;  3NOH A;  4JVC A;  2ZZW A;  5IGA A;  4PFR A;  2XWV A;  4LN5 A;  4GX6 A;  4NQ8 A;  3BIG A;  1RDZ A;  4NN3 A;  1K9Y A;  1NV2 A;  1EYI A;  2HXR A;  2ZZX A;  4H46 A;  2ZZV A;  3GYY A;  4N8Y A;  4PBH A;  3RPL B;  4H45 A;  4HXV A;  2XWI A;  4PET A;  4F18 A;  4GWU A;  2DE4 A;  4OA4 A;  4N4U A;  4O8M A;  2QVR A;  1JP4 A;  3BIH A;  4MJO A;  4OVT A;  4GX3 A;  4IR8 A;  5IZ1 A;  1K9Z A;  1KZ8 A;  2HZK A;  4JVD A;  4XFE A;  1LEV A;  3E79 A;  3FXB A;  1SPI A;  3E78 A;  2CZI A;  1LBX A;  1IMA A;  4NX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...