4AS4A

Structure of human inositol monophosphatase 1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
274
structure length
274
Chain Sequence
DPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL MONOPHOSPHATASE 1
publication title Cloning, Expression, Purification, Crystallization and X-Ray Analysis of Inositol Monophosphatase from Mus Musculus and Homo Sapiens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 90
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4as4A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4as4A02
1RDXA 2FVZA 5EYHA 3QMFA 3A29A 4GX3A 4IR8A 4H45A 3RPLB 2WBBA 5I3SA 1DBZA 5IZ1A 4GWZA 1LEVA 5A5LA 2GQ1A 3LUZA 2P3NA 1FPDA 1NI9A 4O7IA 1QGXA 3B8BA 1KZ8A 4GWSA 5LDZA 1FBGA 1NV2A 1FPJA 1KA1A 3KC0A 4GWXA 1LBYA 2HHMA 2JJKA 4GBWA 2PCRA 1LBVA 1NV6A 1FPGA 1IMBA 1YZ0A 4H46A 5IZ3B 2Q74A 1SPIA 1FRPA 2FBPA 4HXVA 4HE1A 2QVVA 1INPA 5EQAA 1NUZA 1FJ9A 2P3VA 2DDKA 1NV7A 1RDYA 5EYGA 2F3DA 1DK4A 5ET6A 3BIHA 4MJOA 3RPLA 1XI6A 1FBEA 4N81A 5J16A 2F3BA 4GWUA 3LV0A 1IMFA 4AS4A 1NV4A 1YYZA 2Y5KA 1FPKA 1EYJA 1FPFA 4I3EA 5ESYA 5F24A 1FPLA 1FBCA 1FJ6A 4HE2A 1YXIA 1K9ZA 1BK4A 1K9YA 1NUWA 5ET7A 5ET8A 1FPBA 4I40A 1AWBA 3IFCA 4G61A 5DW8A 4GX4A 1G0HA 2R8TA 1NV1A 4GWYA 2CZIA 1EYKA 2VT5A 4GBVA 1EYIA 4AS5A 3T0JA 1VDWA 1JP4A 1FPIA 3RYDA 2BJIA 2OX3A 2OWZA 2QVRA 2Q8MA 1NV0A 1LBZA 4HE0A 1FPEA 1FBHA 2CZKA 3KBZA 2FIXA 4GWWA 3FBPA 1Q9DA 1IMDA 2Y5LA 1FSAA 4QXDA 5EQ8A 1CNQA 1FBDA 4I3YA 5EQ7A 1IMCA 2FIEA 5ET5A 3ROJA 1NUYA 1NUXA 3BIGA 2CZHA 4GX6A 4PTKA 5EQ9A 4FBPA 1FTAA 2WEFA 5FBPA 1G0IA 1IMEA 2QVUA 4KXPA 3D1RA 2QFLA 1LBXA 5IZ3A 1NV3A 1FBFA 5T3JA 1RDZA 1DCUA 1LBWA 2WBDA 1IMAA 3IFAA 1FBPA 1KA0A 1D9QA 1NV5A 3KC1A 2FHYA
chains in the Genus database with same CATH superfamily
5TPAA 5EYHA 4NF6A 3RPLB 1MG1A 1DBZA 5A5LA 2E1SA 5LDZA 3O97A 4NF6B 5H8HA 3ZKLA 4EXKA 4LA9A 4JWXA 2HHMA 4U1ZA 1PC3A 3B50A 2PCRA 3UP9A 3FIRA 5IZ3B 4KCCA 5H8HB 1SPIA 4JDFA 4RYAA 4YB6A 2X26A 1QJMA 1USYH 3MP1A 1FJ9A 2F5XA 2XWVA 3TYHA 5EHMA 4H0WA 2X7PA 4P1EA 4FAJA 1IXHA 1JW1A 2RKMA 1N0TA 1B4ZA 1Y9UA 3BIHA 4M1VA 5DTBA 4NG7A 2F3BA 3HSTA 3U94A 2HZKA 1NV4A 1EYJA 5ESYA 1Y3QA 3IOVA 1D9YA 2DWJA 3RT6B 3U8QA 1N04A 2R8TA 1MXZA 5FTHA 2XXIA 2DE4A 4ELOA 4WKMA 1LGBC 3UIFA 2QVRA 4FATA 1MXYA 4MBPA 2I3WA 1S9TA 3MBPA 4F3GA 5ET5A 3BIGA 5JTYA 5H8FB 1FTAA 1G0IA 1SD3A 3RQTA 1R9QA 4U23A 1AOVA 4ZDMA 3O28A 1DTZA 1Y4CA 3DP8A 4RA1A 1D9QA 5EHSA 4PDHA 2FHYA 1H45A 1GVCA 1N7WA 1XC1A 4X04A 3DP4A 5H8QB 2HAVA 2YLNA 3THIA 3N6UA 4C1UA 4F29A 4UABA 4IO7A 4G4PA 4HW8A 4F1UA 5BWJA 1BIYA 4P1LA 4P9KA 1MXWA 4PC9A 4NF4B 4H46A 4EXLA 2VD3A 4DZ1A 4QBAA 4EF2A 2DDKA 1QW0A 4X1BA 1PB7A 2HXWA 2ZYOA 2B3FA 2I48A 4TQUQ 3PPOA 4XTCQ 3M3FA 4PP0A 1I6AA 3EHTA 2I49A 3MUQA 4LONB 3RTFB 5I58B 4I62A 4NTLA 4PF8A 3PV0E 4G8NA 4F3BA 3QAXA 4OHNA 4XKRA 3TQWA 1LCFA 4GBVA 4MF3A 3N5LA 5L9SA 4H8JA 2GRVA 5JK4A 2BJIA 4MX6A 3D4CA 3KZGA 2NXOA 2PT2A 3CSGA 1ZBMA 2UVGA 4N15A 3EHUA 2UYFA 4Z0IA 3U93A 3PD8A 4NGUA 3D4GA 4N91A 1FSAA 4I3YA 1N7XA 5EQ7A 1WDNA 4U4SA 5CBRA 4G2ZA 2H4IA 4NF5A 2WBDA 4FIMA 3LSWA 2F7BA 3KC1A 1P1QA 4Q8RA 4NF5B 3G7WA 3BFUA 2F8DA 3TKDA 1IXIA 1B51A 1MRPA 3HPIA 3S9MC 5ICTA 3O6GA 1BLFA 1KZ8A 4GWSA 5AA1A 4IY5A 4IGRA 4IO6A 2JJKA 5M2VA 5DEXA 1JW4A 3FJ7A 2P2AA 4PETA 4PFRA 4GL8A 5DEXB 1LAFE 1SVXB 4P56A 4GVOA 3H6VA 3SEVA 4MJOA 2WYPA 3VXCA 3SESA 5J16A 4R2FA 2Z23A 4I9DA 2F34A 4QSEA 1YYZA 4WEDA 3RLFE 1M5EA 1FTOA 4QFOA 4DXCA 2R9JA 2ZZVA 2DS9A 1L5TA 1D4NA 1VDWA 4PAKA 4DE8A 3KG2A 1LFHA 2HFBA 3KSJA 3IB2A 4N6PA 3TMGA 4X1DA 3C34A 4YMBA 1MS7A 5EQ8A 3TELA 2ZZXA 3OELA 1LB8A 3MVXA 4PF6A 3MP8A 1TWYA 4OETA 4PE5B 4OWDA 4JB7A 3K02A 1RDXA 2DXRA 2FVZA 3U1OA 3LUYA 3OO9A 4GX3A 4IR8A 3R26A 3H6WA 2WBBA 2RINA 3RN8A 2RC7A 3V8XB 4BDLA 4HS7A 2DYXA 3B8BA 1LAXA 1VSOA 1I6BA 5F7VA 3R6UA 4XKNA 5F1QA 5CMBA 2I4CA 5I7IA 2Q2AA 5LTCA 1LBVA 1NV6A 3L6GA 1JW5A 3DELB 3FXQA 3K6WA 4JSOA 2Z8DA 1IXGA 5EQAA 2ONSA 5EYGA 1B1XA 4ZEIA 3K6VA 3MZ9A 3CHGA 1B3EA 2ABHA 1FPFA 3C32A 5TU0A 4R2BA 1FBCA 2Q2CA 3RNNA 4ELPA 3H6TA 4ZEKA 3TQLA 4PBHA 4GWYA 2VT5A 4NHBA 3MP6A 2O7IA 2H5YA 4X9TA 2DSFA 3C36A 3WAEA 2PBWA 3HO7A 1HSLA 4N07A 1MM7A 1XVYA 2O84X 4OEVA 2Y5LA 4YZZA 3T1BA 5ITPA 2I3VA 1FQEA 5AE4A 1LBXA 1Y4TA 3LBSA 1NV3A 2REGA 4ELRA 2ZZWA 1LBWA 3B6WA 2PVUA 1GR2A 4LZ8A 3BBRA 2XX9A 1QUIA 2HZLA 1ZU0A 4AB6A 2A5TB 1ZIUA 2B4MA 1B5IA 1ZKBA 1LEVA 1JEVA 4O7IA 1QVSA 3PGFA 1UQWA 3K01A 4XIGQ 1VFDA 1A8EA 3HHFA 4R6YA 1OQGA 2G93A 4MNIA 3S4UA 1Y3NA 2O7UA 3HFUA 3AXFA 3KJTA 3ONMA 1M5BA 1H3DA 1A8FA 3GBBA 4HCYA 3L6HA 4ZEFA 4MNPA 4N81A 4EDPA 3SEWA 4XF5A 4GWUA 2FYIA 3PUZE 3OO8A 4KD5A 3LV0A 1FPKA 4RNSA 1NUWA 2QRYA 4YKJA 4GX4A 3CI8A 2XXKA 1POTA 4BDMA 2O69A 4YKPA 4OANA 5I2KA 3FVOA 3VDFA 3O29A 2OWZA 5B70A 4IGTA 2QS2A 2ALUA 3K1MA 1DMBA 1ZLQA 1P1OA 4Q30B 4XEQA 4O3BA 3O6IA 3TPAA 2V3UA 4FE8A 4R72A 4PQJA 2KLFA 3ILTB 3OOAA 5CI5A 2H99A 4O94A 4PFBA 4EF1A 3DP6A 1N3XA 2I4BA 3K00A 3MWBA 2H9BA 3TFLA 4IO4A 3CRBA 3M3KA 1B0LA 3PUWE 1FPJA 1IUDA 3K6XA 3CG3A 3VVDA 1LLSA 5ICQA 2PYYA 2B3BA 1O7TA 1Z7ME 2F7AA 2KR0A 1Q35A 5I2NA 4PFWA 5ITOA 3PUXE 1RDYA 4N6KA 2ZYMA 5TPAB 5CC2A 3ZSFA 4H1XA 1VE4A 5CBSA 1R1NA 2O51A 1H44A 4AS4A 2XWIA 4LN5A 4GF8A 1FTJA 1BTJA 2V93A 4IO5A 1NH7A 1EYKA 4AS5A 5J1DA 3SEYA 4R74A 5FTIA 2YPNA 3VLVA 4DI3D 3MPLA 1UIUA 1MM6A 1LBZA 4BLAA 2CZKA 4FECA 4GWWA 3Q27A 1SBPA 2OK2A 3LC8A 1UTBA 3OD7A 4ZZEA 3I5OA 4OYVA 2OJTA 2FIEA 3V89B 3UA8A 2XXXA 1II5A 4YMAA 1SI0A 1MPBA 3ECRA 3FASA 4GQOA 5L8DA 4XKQA 4C1TA 1OMPA 4KCDA 4RY1A 3RTWB 5AA3A 5ELVA 3OEKA 2PMSA 3G3KA 4KFQA 4OQOA 3S9NC 3IO6A 1XOCA 1JQFA 4N17A 4F1YA 5CMMA 1LB9A 4JSDA 3LSXA 2RCBA 2XD3A 2FNCA 3O2AA 1MQHA 3E79A 3T93B 1CE2A 2W7YA 1FBGA 5JTYB 1QKBA 1XT8A 4M4GA 2DE3A 2F6GA 3IJXB 2Y7IA 4LP2B 1P1NA 2F6PA 4C0RA 3OO6A 1INPA 4DXUA 1US5A 4ONYA 4G8MA 1ANFA 3ISPA 3KOSA 1D3KA 4DIGA 5IZZA 1YCJA 4Q0CA 2PFZA 3W15C 1IMFA 1MQDA 4I3EA 5DT6A 3QUJA 2AIXA 2VP1A 1FPLA 1K9ZA 4BDNA 3IOWA 4OEUA 2CZIA 3Q25A 4JWYA 2AL5A 2CMOA 2QSXA 2ZNSA 4NEDA 4N8GA 3RYDA 2Q88A 4Q5TA 4MNCA 4X48A 1EZOA 3K6UA 2IEEA 2VPNA 1B3HA 2GHBA 4U4XA 1S7YA 4NMYA 4LVQA 4YB7A 4H5GA 4MEVA 3TCGA 4YAHX 3A09A 1EZPA 1YTVA 2CZHA 3P7IA 1B1HA 3TUSA 3OMBA 4F19A 1R9LA 3FGSA 1NNKA 4OVQA 1POY1 4OFLA 2WEFA 2OLBA 3VLUA 1MQGA 2YJPA 2UVHA 3JZJA 1I6QA 1MY0A 1RDZA 3IFAA 3I6VA 3RY3A 2O6AA 3LUZA 1NV5A 2DXYA 1JEUA 1MXVA 5A5XA 4OVJA 4F2OA 2OPDA 4N4UA 1CB6A 4N8YA 4E0WA 5A5XB 5IAIA 1MH4A 1NI9A 3PU5A 4ESXA 3MYUA 3VXBA 4GWXA 1RKMA 2QMWA 5H8NA 3IJOB 4QSCA 4U1OA 5H8NB 2Y7RA 3BFTA 1DTGA 3K1PA 5L9MA 2F78A 2XXVA 4NAPA 3V83A 3CR9A 3QYTA 3QK6A 5KCJA 3TAJA 3CIJA 1B4HA 2QL3A 3H03A 4NN3A 1T0KA 4IO2A 5FHOA 2D21A 4MHFA 1N84A 3IB1A 1R6ZA 5KCJB 1NFTA 3H6UA 4HE2A 5I5PA 1YXIA 4HTGA 1MY1A 3IOUA 3FJGA 4QRZA 1B6HA 5DVFA 2VHAA 1PB8A 2NOOA 3IO4A 3SERA 1WVJA 5ISUA 3OO7A 4ZS9A 1LFGA 1BKAA 2NWJA 3TCFA 3U92A 3QUFA 4KPTA 2PFYA 1NUYA 1B3GA 5DVIA 4IO3A 4NQ8A 3KSXA 1LSTA 4K3FA 2BJJX 2O68A 1S50A 1RYOA 4GL0A 4GWOA 3IK6B 3N94A 4JBZA 5AA2D 4TOZA 1SYHA 3C35A 2OWSA 2O1LA 4OERA 2PT1A 3CFLA 1FQCA 3FVGA 5I3SA 2DWHA 2CEYA 4RPNA 3PMWA 2P3NA 2ZYKA 1FPDA 3PMXA 5AA2A 2D3IA 4RPOA 2V84A 1XVXA 1HSEA 1US4A 2B4LA 3MVZA 5LOMA 1AMFA 3KOTA 1FQBA 4MIJA 4GOTA 1IIWA 4YU0A 3GXAA 2GFEA 2ONKE 3Q29A 1IITA 2VGQA 1SI1A 3PUYE 4MH5A 3UK4A 3QIMA 1B2HA 1DK4A 4EQBA 1VR5A 3CFXA 2XXUA 4P8BA 1FTLA 4LUBA 4OVSA 3FD3A 4F1VA 5IKBA 4PFIA 3KN8A 3W9VA 4RJZA 2RF1A 2I58A 2Q89A 3OXNA 3C9HA 4G68C 3LR1A 3H4ZA 1M5CA 3K1NA 3A3UA 1FPIA 3CFZA 2Z22A 4F22A 1O64A 2QMXA 2R6GE 4KR5A 1B58A 1CNQA 2F36A 4XKPA 5EQ9A 3FV1A 2HAUA 4LQ2A 1WODA 1URSA 4YKIA 4ZECA 3V5AA 4IY6A 1P1WA 4PFYA 3OSRA 4BDOA 2F7CA 3G3IA 1BP5A 1B7ZA 2DWIA 3MQ9A 4N13A 4DCYA 4MFIA 1OQHA 4OTEA 2CZLA 1B3LA 4P0GA 1ZJLA 3QSLA 2I0BA 2ESNA 4P3LA 1Y1MA 1JVXA 1UIVA 4ZE9A 1GTKA 1Q1KA 1Y20A 3CVGA 1JETA 1VFEA 3NOHA 3E3KA 5CM6A 2FBPA 3TDJA 4OVTA 4F3SA 1JNFA 1MDP1 4LZ7A 3EF7A 4R6HA 5IGAA 1SYIA 3IORA 2Y84A 3E4RA 4H6DA 2Q8JA 3SDFA 1QULA 3SEUA 1SW5A 1QUKA 2V3QA 2XWOA 1QKAA 4OMBA 4QFNA 2DVZA 3G3GA 2XWKA 1MXXA 3IB0A 4I40A 1G0HA 3KJ7A 2DOJA 3K0VA 1LBCA 4AQ4A 2NUVA 4U2RA 1YPNA 4OESA 4H65A 4EQ7A 2Q8MA 2ZXTA 1NV0A 3U65A 1A54A 2DE2A 4YICA 3C31A 3K2DA 3GBAA 4FEBA 4KHZE 4NF8A 1GV8A 2UVJA 3DLNA 3FZVA 1HSJA 3FXUA 4HCWA 1ZTYA 4FJPA 4NF8B 4WEPA 5I2KB 5H8SA 1B52A 3G3JA 1MQIA 1USYE 4H45A 2O1MA 5CMCA 4PE3A 5BUUA 5I59A 3MSTA 4OFJA 3PUVE 1NV2A 1LBYA 4R6KA 1FPGA 1J1NA 4KYSA 4QF9A 4JXIA 3KN3A 4X8RA 4PFTA 1OLCA 3CSBA 4I1DA 3RT8A 2AYSA 1OIBA 3UORA 4DXBA 3IX1A 4MAGA 1KWHA 3M8UA 2THIA 2XX8A 2XX7A 4GD5A 2OPEA 1SW4A 2Y7WA 1TFAA 4EUOA 1LAHE 4F2QA 2QS1A 1B05A 3JYRA 1BK4A 3W9WA 4OVRA 5DW8A 5JEIA 5TP9A 2XXPA 5HBCA 4XFEA 2E0SA 3ZS6A 1EZ9A 1IZ1A 5TP9B 5I2NB 1FBHA 2FIXA 3MPKA 4P0IA 1Q9DA 3VV5A 4RK9A 4GX6A 4XXUA 3B7DA 5IZ3A 3MAMA 4TLLB 1FBFA 2REJA 1SW1A 5B7DA 3MVWA 3T96B 3KBRA 3FV2A 1DCUA 1IMAA 1FBPA 4MCOA 1KA0A 5I56A 4G77A 3E78A 3H7MA 4QSDA 1URGA 3QMFA 3A29A 4R9GA 3MZ1A 1MY4A 5I56B 3PPPA 4ZEDA 2WYKA 1GGGA 2GQ1A 1UTBB 3TTKA 2D5WA 1KA1A 2XXTA 3SKPA 1YZ0A 3TTNA 4O3AA 4U21A 1FQDA 2MKZA 2NVUB 1FCKA 1M5DA 3CG1A 3S9EA 4AB5A 3T9XB 2Y7KA 5H8FA 4TLMB 4DDDA 1FJ6A 5DVJA 3DM0A 5ET8A 5ET7A 3PPRA 5I57A 3HV1A 3N6TA 5I57B 2KQZA 5H8QA 4DCXA 2G29A 3WAFA 1O63A 1A99A 2VOZA 1IXCA 2H25A 1MY2A 1IMCA 1XHYA 4PTKA 2ANJA 2XXHA 4FBPA 1AIVA 1YAEA 4NF4A 2V3TA 2VD2A 1UTHA 3MJNA 3H3GA 3HCQA 3B6TA 4KYEA 1DOTA 2HEUA 5I84A 3N26A 1FTMA 3S2VA 1UTHB 2OBGA 3MZBA 3VE1B 3ZKKA 3PPQA 2R71A 3FVNA 5K2XA 4PBQA 4GWZA 1D9VA 1QGXA 5IM2A 5I58A 2Q9TA 2PX1A 4O7MA 2GH9A 1JVYA 3SEXA 2Q74A 4E0XA 4HXVA 1B7UA 2FA7A 4O8MA 3GLBA 4OENA 2XXWA 1ATGA 2HQ0A 2P3VA 3KN7A 3Q26A 2Y7PA 1PB9A 4F31B 1XI6A 1B0HA 3TTMA 4PGPA 3LSFB 1IQ7A 1B7HA 2XD2A 1B5JA 3OEMA 3KEIA 3FVKA 1FPBA 4G61A 2Z8FA 4GXAA 4KYDA 5DYHA 3VLWA 4LQ5A 3IL1B 1TT1A 5CMKA 1Y1ZA 3FBPA 1IMDA 4PCDA 3T22A 1FBDA 2AL4A 3KFMA 3ROJA 1NUXA 4I8CA 1LFIA 3BKIB 2QS4A 1MDQA 1P99A 1IMEA 3MW0A 4THIA 3VFJA 2IA4A 4NX1A 1NNPA 4OA4A 5HM4B 1M5FA 1IEJA 3O6HA 3C33A 5KZTA 2M8CA 1EU8A 2X7QA 4ESWA 3UGWA 4OFOA 3LSLA 4GXSB 1B46A 2DQVA 5CRYA 4ZE8A 1PDAA 3PTYA 3PPNA 4JWOA 3FJMA 1LCTA 1TFDA 4R73A 1MPDA 1AH5A 4L17A 2I0CA 2V25A 1H43A 5KDTA 4HE1A 3E9XA 5EYFA 1RYXA 4YKKA 2L5VA 5KDTB 1FTKA 5ET6A 1MXUA 1NL5A 3EN3A 3T9HB 4NE4A 4QHQA 2F97A 4YB5A 2HCAA 3IAZA 1FQAA 3GYYA 3G3HA 2UYEA 4PAIA 5AA2B 5F24A 2P0SA 4ISUA 3PD9A 3E13X 1K9YA 3H06B 1PBQA 1AWBA 3OENA 4KQPA 4NWDA 3SETA 1FQFA 3HHGA 4H5FA 4ELQA 4H8IA 4N6DA 3KGCA 2RC8A 1NNTA 4UACA 3SZPA 3JV9A 4HE0A 3KBZA 1OVBA 2H98A 3VVFA 1OVTA 3IOTA 1NH8A 4OVPA 2F35A 3T9VA 3R7XA 4KXPA 2QVUA 2QJEA 5FHNA 4PGNA 1MQJA 5AA4A 1XS5A 2XXYA 4KI0E 5T3JA 4U22A 4F18A 4DI4B 3GZGA 2P1SA 4F39A 3O66A 1EH3A 3I3VA 5AA4B 4GRKA 2XHDA 4R75A 2WKYA 4H67A 3USDA 1FW0A 1MY3A 2UVIA 3G3FA 3S9LC 3RGYA 4GFRA 4LATA 4FEDA 1DPEA 4OZ9A 4JVDA 3TODA 4GBWA 1MH3A 5L9OA 4R9FA 1I69A 1IMBA 2GHAA 3FXRA 1SDXA 3B6QA 2QVVA 3F11A 3EQ1A 1NNFA 1NUZA 2DVCA 3TEPA 2DWAA 2XXQA 2F3DA 4MLVA 4PAFA 3FUZA 3EKIA 3PMVA 4IB2A 2RCAA 4BDQA 3T66A 1Y3PA 1B3FA 3IFCA 4GIZA 1NV1A 3TCHA 3M3LA 4RK2A 1B32A 4LZ5A 1B5HA 3MVYA 1JP4A 4POWA 1PEBA 2A5TA 3QXMA 2LAOA 4PFUA 1FPEA 4OXVA 4EQ9A 4MLQA 2OCUA 2OZZA 4O3CA 4MMPA 5K2YA 3RPWA 1A7LA 2WX9A 1SW2A 3ILUB 3HN0A 5FBPA 3UN6A 3IR1A 3D1RA 2QFLA 4G68A 1DSNA 4QFPA 1QUJA 1A55A 1AL3A 4G68B 3MC2A 4GLIA 4ZEBA 1H76A 1URDA 1PBPA 5IZ1A 1A40A 2HPGA 2ZYNA 2Z8EA 3TTRA 4ECFA 3KC0A 4QFLA 2XXRA 4ND9A 3ODBA 1MPCA 3VVEA 2XA5A 5FHMA 3FXBA 1FRPA 2RC9A 3EHSA 1SQYA 4NWCA 4G8HA 2ZNTA 3K4UA 1NV7A 4RXLA 4BDRA 1N76A 1NMUA 4P47A 1FBEA 3U72A 4FORA 2V4CA 4ZZAA 3OSQA 3C4MA 3TTLA 1LBBA 1TXFA 4Z7EA 2Y5KA 1ZMGA 5I59B 3Q28A 4UA8A 1NKXA 2OWTA 1Z7NE 3EPEA 3A3CA 2VPOA 4JVCA 4NF0A 3T9UA 1OLAA 4WXJA 3RUMA 1P1UA 1EYIA 2ZNUA 4DLDA 3T0JA 1ELJA 2DP8A 5HPQA 1N3WA 2A5SA 1LAGE 2OX3A 3O9PA 2HXRA 2I6EA 1F9BA 1DPPA 2CEXA 4JVIA 2ONRA 4QFKA 4QXDA 1B40A 3FATA 4F3PA 4POXA 2QPQA 3TZAA 2B65A 1B9JA 2QS3A 4P11A 2UXAA 3RPLA 2ZMBA 4PDDA
chains in the Genus database with same CATH topology
5EYHA 2HZLA 2B4MA 3RPLB 4PBQA 5I3SA 1DBZA 2CEYA 4GWZA 1LEVA 5A5LA 2P3NA 1FPDA 4O7IA 1QGXA 5IM2A 5LDZA 2Q9TA 2B4LA 4O7MA 2HHMA 3B50A 2PCRA 5IZ3B 2Q74A 4MIJA 1SPIA 4HXVA 4O8MA 4MNIA 3HFUA 1FJ9A 2F5XA 2XWVA 2P3VA 4P1EA 4HCYA 1DK4A 3BIHA 1XI6A 4MNPA 4M1VA 4N81A 4NG7A 4PGPA 2F3BA 4P8BA 4XF5A 4GWUA 2HZKA 4OVSA 3LV0A 1NV4A 4F1VA 1FPKA 4PFIA 3W9VA 1EYJA 5ESYA 1NUWA 1FPBA 4G61A 4GX4A 2R8TA 2XXKA 4OANA 2DE4A 1FPIA 2OWZA 2QVRA 4XEQA 3FBPA 1IMDA 4PCDA 1CNQA 1FBDA 5ET5A 3ROJA 1NUXA 3BIGA 5EQ9A 1FTAA 1G0IA 1IMEA 4NX1A 4OA4A 4O94A 4PFBA 1D9QA 4PDHA 2FHYA 4X04A 4P3LA 4UABA 4F1UA 3PTYA 4P1LA 1FPJA 4P9KA 3NOHA 4PC9A 4H46A 5CM6A 2FBPA 4OVTA 4HE1A 4QBAA 2KR0A 5IGAA 2DDKA 1RDYA 4N6KA 2L5VA 5ET6A 2V3QA 2XWOA 4AS4A 2XWIA 3GYYA 4PAIA 4LN5A 5F24A 2DVZA 4PF8A 1K9YA 2XWKA 4I40A 1AWBA 1G0HA 1EYKA 4GBVA 4AS5A 5J1DA 5JK4A 4N6DA 2BJIA 4MX6A 2Q8MA 4DI3D 3SZPA 1NV0A 1LBZA 4HE0A 3KBZA 4N15A 2CZKA 3U65A 4GWWA 4NGUA 4N91A 1FSAA 4I3YA 4OVPA 5EQ7A 2FIEA 2DE2A 4YICA 4KXPA 2QVUA 4PGNA 5T3JA 4F18A 4DI4B 2WBDA 4HCWA 3KC1A 4N17A 4H45A 4PE3A 3E79A 3MSTA 1KZ8A 4GWSA 1FBGA 1NV2A 1LBYA 2JJKA 4JVDA 4GBWA 2DE3A 1FPGA 1IMBA 2QVVA 4PETA 1INPA 4PFRA 4X8RA 1NUZA 4P56A 3ISPA 2F3DA 4MJOA 2WYPA 4MAGA 4PAFA 5IZZA 5J16A 3EKIA 2PFZA 1IMFA 1YYZA 4I3EA 1FPLA 1K9ZA 1BK4A 3W9WA 4OVRA 3IFCA 5DW8A 2ZZVA 1NV1A 2CZIA 4XFEA 1VDWA 4PAKA 4N8GA 1JP4A 3RYDA 4MNCA 2VPNA 1FPEA 1FBHA 2FIXA 1Q9DA 4MEVA 4MMPA 5EQ8A 4GX6A 2WX9A 2CZHA 4F19A 4OVQA 2WEFA 5FBPA 2ZZXA 3D1RA 2QFLA 5IZ3A 4PF6A 1FBFA 1RDZA 1DCUA 1IMAA 3IFAA 1FBPA 4MCOA 1KA0A 3LUZA 1NV5A 3E78A 1RDXA 2FVZA 3QMFA 3A29A 4N4UA 4GX3A 4IR8A 4N8YA 2WBBA 5IZ1A 2WYKA 2GQ1A 2HPGA 1NI9A 3B8BA 3MYUA 1KA1A 3KC0A 4GWXA 5I7IA 5LTCA 1LBVA 1NV6A 1YZ0A 2XA5A 3FXBA 1FRPA 5EQAA 1NV7A 2MKZA 5EYGA 4NAPA 4P47A 1FBEA 2V4CA 3CHGA 4NN3A 2Y5KA 1FPFA 4MHFA 2VPOA 1FBCA 1FJ6A 4JVCA 4HE2A 4NF0A 5I5PA 1YXIA 5ET8A 5ET7A 4PBHA 4GWYA 2VT5A 1EYIA 3T0JA 4NHBA 4X9TA 2OX3A 2KQZA 2HXRA 2CEXA 4JVIA 2Y5LA 4QXDA 4YZZA 2PFYA 1IMCA 3T1BA 1NUYA 4PTKA 4FBPA 4NQ8A 2QPQA 1LBXA 1NV3A 2ZZWA 1LBWA 3RPLA 4PDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDX A;  2FVZ A;  5EYH A;  3QMF A;  3A29 A;  4GX3 A;  4IR8 A;  4H45 A;  3RPL B;  2WBB A;  5I3S A;  1DBZ A;  5IZ1 A;  4GWZ A;  1LEV A;  5A5L A;  2GQ1 A;  3LUZ A;  2P3N A;  1FPD A;  1NI9 A;  4O7I A;  1QGX A;  3B8B A;  1KZ8 A;  4GWS A;  5LDZ A;  1FBG A;  1NV2 A;  1FPJ A;  1KA1 A;  3KC0 A;  4GWX A;  1LBY A;  2HHM A;  2JJK A;  4GBW A;  2PCR A;  1LBV A;  1NV6 A;  1FPG A;  1IMB A;  1YZ0 A;  4H46 A;  5IZ3 B;  2Q74 A;  1SPI A;  1FRP A;  2FBP A;  4HXV A;  4HE1 A;  2QVV A;  1INP A;  5EQA A;  1NUZ A;  1FJ9 A;  2P3V A;  2DDK A;  1NV7 A;  1RDY A;  5EYG A;  2F3D A;  1DK4 A;  5ET6 A;  3BIH A;  4MJO A;  3RPL A;  1XI6 A;  1FBE A;  4N81 A;  5J16 A;  2F3B A;  4GWU A;  3LV0 A;  1IMF A;  4AS4 A;  1NV4 A;  1YYZ A;  2Y5K A;  1FPK A;  1EYJ A;  1FPF A;  4I3E A;  5ESY A;  5F24 A;  1FPL A;  1FBC A;  1FJ6 A;  4HE2 A;  1YXI A;  1K9Z A;  1BK4 A;  1K9Y A;  1NUW A;  5ET7 A;  5ET8 A;  1FPB A;  4I40 A;  1AWB A;  3IFC A;  4G61 A;  5DW8 A;  4GX4 A;  1G0H A;  2R8T A;  1NV1 A;  4GWY A;  2CZI A;  1EYK A;  2VT5 A;  4GBV A;  1EYI A;  4AS5 A;  3T0J A;  1VDW A;  1JP4 A;  1FPI A;  3RYD A;  2BJI A;  2OX3 A;  2OWZ A;  2QVR A;  2Q8M A;  1NV0 A;  1LBZ A;  4HE0 A;  1FPE A;  1FBH A;  2CZK A;  3KBZ A;  2FIX A;  4GWW A;  3FBP A;  1Q9D A;  1IMD A;  2Y5L A;  1FSA A;  4QXD A;  5EQ8 A;  1CNQ A;  1FBD A;  4I3Y A;  5EQ7 A;  1IMC A;  2FIE A;  5ET5 A;  3ROJ A;  1NUY A;  1NUX A;  3BIG A;  2CZH A;  4GX6 A;  4PTK A;  5EQ9 A;  4FBP A;  1FTA A;  2WEF A;  5FBP A;  1G0I A;  1IME A;  2QVU A;  4KXP A;  3D1R A;  2QFL A;  1LBX A;  5IZ3 A;  1NV3 A;  1FBF A;  5T3J A;  1RDZ A;  1DCU A;  1LBW A;  2WBD A;  1IMA A;  3IFA A;  1FBP A;  1KA0 A;  1D9Q A;  1NV5 A;  3KC1 A;  2FHY A; 
#chains in the Genus database with same CATH topology
 5TPA A;  5EYH A;  4NF6 A;  3RPL B;  1MG1 A;  1DBZ A;  5A5L A;  2E1S A;  5LDZ A;  3O97 A;  4NF6 B;  5H8H A;  3ZKL A;  4EXK A;  4LA9 A;  4JWX A;  2HHM A;  4U1Z A;  1PC3 A;  3B50 A;  2PCR A;  3UP9 A;  3FIR A;  5IZ3 B;  4KCC A;  5H8H B;  1SPI A;  4JDF A;  4RYA A;  4YB6 A;  2X26 A;  1QJM A;  1USY H;  3MP1 A;  1FJ9 A;  2F5X A;  2XWV A;  3TYH A;  5EHM A;  4H0W A;  2X7P A;  4P1E A;  4FAJ A;  1IXH A;  1JW1 A;  2RKM A;  1N0T A;  1B4Z A;  1Y9U A;  3BIH A;  4M1V A;  5DTB A;  4NG7 A;  2F3B A;  3HST A;  3U94 A;  2HZK A;  1NV4 A;  1EYJ A;  5ESY A;  1Y3Q A;  3IOV A;  1D9Y A;  2DWJ A;  3RT6 B;  3U8Q A;  1N04 A;  2R8T A;  1MXZ A;  5FTH A;  2XXI A;  2DE4 A;  4ELO A;  4WKM A;  1LGB C;  3UIF A;  2QVR A;  4FAT A;  1MXY A;  4MBP A;  2I3W A;  1S9T A;  3MBP A;  4F3G A;  5ET5 A;  3BIG A;  5JTY A;  5H8F B;  1FTA A;  1G0I A;  1SD3 A;  3RQT A;  1R9Q A;  4U23 A;  1AOV A;  4ZDM A;  3O28 A;  1DTZ A;  1Y4C A;  3DP8 A;  4RA1 A;  1D9Q A;  5EHS A;  4PDH A;  2FHY A;  1H45 A;  1GVC A;  1N7W A;  1XC1 A;  4X04 A;  3DP4 A;  5H8Q B;  2HAV A;  2YLN A;  3THI A;  3N6U A;  4C1U A;  4F29 A;  4UAB A;  4IO7 A;  4G4P A;  4HW8 A;  4F1U A;  5BWJ A;  1BIY A;  4P1L A;  4P9K A;  1MXW A;  4PC9 A;  4NF4 B;  4H46 A;  4EXL A;  2VD3 A;  4DZ1 A;  4QBA A;  4EF2 A;  2DDK A;  1QW0 A;  4X1B A;  1PB7 A;  2HXW A;  2ZYO A;  2B3F A;  2I48 A;  4TQU Q;  3PPO A;  4XTC Q;  3M3F A;  4PP0 A;  1I6A A;  3EHT A;  2I49 A;  3MUQ A;  4LON B;  3RTF B;  5I58 B;  4I62 A;  4NTL A;  4PF8 A;  3PV0 E;  4G8N A;  4F3B A;  3QAX A;  4OHN A;  4XKR A;  3TQW A;  1LCF A;  4GBV A;  4MF3 A;  3N5L A;  5L9S A;  4H8J A;  2GRV A;  5JK4 A;  2BJI A;  4MX6 A;  3D4C A;  3KZG A;  2NXO A;  2PT2 A;  3CSG A;  1ZBM A;  2UVG A;  4N15 A;  3EHU A;  2UYF A;  4Z0I A;  3U93 A;  3PD8 A;  4NGU A;  3D4G A;  4N91 A;  1FSA A;  4I3Y A;  1N7X A;  5EQ7 A;  1WDN A;  4U4S A;  5CBR A;  4G2Z A;  2H4I A;  4NF5 A;  2WBD A;  4FIM A;  3LSW A;  2F7B A;  3KC1 A;  1P1Q A;  4Q8R A;  4NF5 B;  3G7W A;  3BFU A;  2F8D A;  3TKD A;  1IXI A;  1B51 A;  1MRP A;  3HPI A;  3S9M C;  5ICT A;  3O6G A;  1BLF A;  1KZ8 A;  4GWS A;  5AA1 A;  4IY5 A;  4IGR A;  4IO6 A;  2JJK A;  5M2V A;  5DEX A;  1JW4 A;  3FJ7 A;  2P2A A;  4PET A;  4PFR A;  4GL8 A;  5DEX B;  1LAF E;  1SVX B;  4P56 A;  4GVO A;  3H6V A;  3SEV A;  4MJO A;  2WYP A;  3VXC A;  3SES A;  5J16 A;  4R2F A;  2Z23 A;  4I9D A;  2F34 A;  4QSE A;  1YYZ A;  4WED A;  3RLF E;  1M5E A;  1FTO A;  4QFO A;  4DXC A;  2R9J A;  2ZZV A;  2DS9 A;  1L5T A;  1D4N A;  1VDW A;  4PAK A;  4DE8 A;  3KG2 A;  1LFH A;  2HFB A;  3KSJ A;  3IB2 A;  4N6P A;  3TMG A;  4X1D A;  3C34 A;  4YMB A;  1MS7 A;  5EQ8 A;  3TEL A;  2ZZX A;  3OEL A;  1LB8 A;  3MVX A;  4PF6 A;  3MP8 A;  1TWY A;  4OET A;  4PE5 B;  4OWD A;  4JB7 A;  3K02 A;  1RDX A;  2DXR A;  2FVZ A;  3U1O A;  3LUY A;  3OO9 A;  4GX3 A;  4IR8 A;  3R26 A;  3H6W A;  2WBB A;  2RIN A;  3RN8 A;  2RC7 A;  3V8X B;  4BDL A;  4HS7 A;  2DYX A;  3B8B A;  1LAX A;  1VSO A;  1I6B A;  5F7V A;  3R6U A;  4XKN A;  5F1Q A;  5CMB A;  2I4C A;  5I7I A;  2Q2A A;  5LTC A;  1LBV A;  1NV6 A;  3L6G A;  1JW5 A;  3DEL B;  3FXQ A;  3K6W A;  4JSO A;  2Z8D A;  1IXG A;  5EQA A;  2ONS A;  5EYG A;  1B1X A;  4ZEI A;  3K6V A;  3MZ9 A;  3CHG A;  1B3E A;  2ABH A;  1FPF A;  3C32 A;  5TU0 A;  4R2B A;  1FBC A;  2Q2C A;  3RNN A;  4ELP A;  3H6T A;  4ZEK A;  3TQL A;  4PBH A;  4GWY A;  2VT5 A;  4NHB A;  3MP6 A;  2O7I A;  2H5Y A;  4X9T A;  2DSF A;  3C36 A;  3WAE A;  2PBW A;  3HO7 A;  1HSL A;  4N07 A;  1MM7 A;  1XVY A;  2O84 X;  4OEV A;  2Y5L A;  4YZZ A;  3T1B A;  5ITP A;  2I3V A;  1FQE A;  5AE4 A;  1LBX A;  1Y4T A;  3LBS A;  1NV3 A;  2REG A;  4ELR A;  2ZZW A;  1LBW A;  3B6W A;  2PVU A;  1GR2 A;  4LZ8 A;  3BBR A;  2XX9 A;  1QUI A;  2HZL A;  1ZU0 A;  4AB6 A;  2A5T B;  1ZIU A;  2B4M A;  1B5I A;  1ZKB A;  1LEV A;  1JEV A;  4O7I A;  1QVS A;  3PGF A;  1UQW A;  3K01 A;  4XIG Q;  1VFD A;  1A8E A;  3HHF A;  4R6Y A;  1OQG A;  2G93 A;  4MNI A;  3S4U A;  1Y3N A;  2O7U A;  3HFU A;  3AXF A;  3KJT A;  3ONM A;  1M5B A;  1H3D A;  1A8F A;  3GBB A;  4HCY A;  3L6H A;  4ZEF A;  4MNP A;  4N81 A;  4EDP A;  3SEW A;  4XF5 A;  4GWU A;  2FYI A;  3PUZ E;  3OO8 A;  4KD5 A;  3LV0 A;  1FPK A;  4RNS A;  1NUW A;  2QRY A;  4YKJ A;  4GX4 A;  3CI8 A;  2XXK A;  1POT A;  4BDM A;  2O69 A;  4YKP A;  4OAN A;  5I2K A;  3FVO A;  3VDF A;  3O29 A;  2OWZ A;  5B70 A;  4IGT A;  2QS2 A;  2ALU A;  3K1M A;  1DMB A;  1ZLQ A;  1P1O A;  4Q30 B;  4XEQ A;  4O3B A;  3O6I A;  3TPA A;  2V3U A;  4FE8 A;  4R72 A;  4PQJ A;  2KLF A;  3ILT B;  3OOA A;  5CI5 A;  2H99 A;  4O94 A;  4PFB A;  4EF1 A;  3DP6 A;  1N3X A;  2I4B A;  3K00 A;  3MWB A;  2H9B A;  3TFL A;  4IO4 A;  3CRB A;  3M3K A;  1B0L A;  3PUW E;  1FPJ A;  1IUD A;  3K6X A;  3CG3 A;  3VVD A;  1LLS A;  5ICQ A;  2PYY A;  2B3B A;  1O7T A;  1Z7M E;  2F7A A;  2KR0 A;  1Q35 A;  5I2N A;  4PFW A;  5ITO A;  3PUX E;  1RDY A;  4N6K A;  2ZYM A;  5TPA B;  5CC2 A;  3ZSF A;  4H1X A;  1VE4 A;  5CBS A;  1R1N A;  2O51 A;  1H44 A;  4AS4 A;  2XWI A;  4LN5 A;  4GF8 A;  1FTJ A;  1BTJ A;  2V93 A;  4IO5 A;  1NH7 A;  1EYK A;  4AS5 A;  5J1D A;  3SEY A;  4R74 A;  5FTI A;  2YPN A;  3VLV A;  4DI3 D;  3MPL A;  1UIU A;  1MM6 A;  1LBZ A;  4BLA A;  2CZK A;  4FEC A;  4GWW A;  3Q27 A;  1SBP A;  2OK2 A;  3LC8 A;  1UTB A;  3OD7 A;  4ZZE A;  3I5O A;  4OYV A;  2OJT A;  2FIE A;  3V89 B;  3UA8 A;  2XXX A;  1II5 A;  4YMA A;  1SI0 A;  1MPB A;  3ECR A;  3FAS A;  4GQO A;  5L8D A;  4XKQ A;  4C1T A;  1OMP A;  4KCD A;  4RY1 A;  3RTW B;  5AA3 A;  5ELV A;  3OEK A;  2PMS A;  3G3K A;  4KFQ A;  4OQO A;  3S9N C;  3IO6 A;  1XOC A;  1JQF A;  4N17 A;  4F1Y A;  5CMM A;  1LB9 A;  4JSD A;  3LSX A;  2RCB A;  2XD3 A;  2FNC A;  3O2A A;  1MQH A;  3E79 A;  3T93 B;  1CE2 A;  2W7Y A;  1FBG A;  5JTY B;  1QKB A;  1XT8 A;  4M4G A;  2DE3 A;  2F6G A;  3IJX B;  2Y7I A;  4LP2 B;  1P1N A;  2F6P A;  4C0R A;  3OO6 A;  1INP A;  4DXU A;  1US5 A;  4ONY A;  4G8M A;  1ANF A;  3ISP A;  3KOS A;  1D3K A;  4DIG A;  5IZZ A;  1YCJ A;  4Q0C A;  2PFZ A;  3W15 C;  1IMF A;  1MQD A;  4I3E A;  5DT6 A;  3QUJ A;  2AIX A;  2VP1 A;  1FPL A;  1K9Z A;  4BDN A;  3IOW A;  4OEU A;  2CZI A;  3Q25 A;  4JWY A;  2AL5 A;  2CMO A;  2QSX A;  2ZNS A;  4NED A;  4N8G A;  3RYD A;  2Q88 A;  4Q5T A;  4MNC A;  4X48 A;  1EZO A;  3K6U A;  2IEE A;  2VPN A;  1B3H A;  2GHB A;  4U4X A;  1S7Y A;  4NMY A;  4LVQ A;  4YB7 A;  4H5G A;  4MEV A;  3TCG A;  4YAH X;  3A09 A;  1EZP A;  1YTV A;  2CZH A;  3P7I A;  1B1H A;  3TUS A;  3OMB A;  4F19 A;  1R9L A;  3FGS A;  1NNK A;  4OVQ A;  1POY 1;  4OFL A;  2WEF A;  2OLB A;  3VLU A;  1MQG A;  2YJP A;  2UVH A;  3JZJ A;  1I6Q A;  1MY0 A;  1RDZ A;  3IFA A;  3I6V A;  3RY3 A;  2O6A A;  3LUZ A;  1NV5 A;  2DXY A;  1JEU A;  1MXV A;  5A5X A;  4OVJ A;  4F2O A;  2OPD A;  4N4U A;  1CB6 A;  4N8Y A;  4E0W A;  5A5X B;  5IAI A;  1MH4 A;  1NI9 A;  3PU5 A;  4ESX A;  3MYU A;  3VXB A;  4GWX A;  1RKM A;  2QMW A;  5H8N A;  3IJO B;  4QSC A;  4U1O A;  5H8N B;  2Y7R A;  3BFT A;  1DTG A;  3K1P A;  5L9M A;  2F78 A;  2XXV A;  4NAP A;  3V83 A;  3CR9 A;  3QYT A;  3QK6 A;  5KCJ A;  3TAJ A;  3CIJ A;  1B4H A;  2QL3 A;  3H03 A;  4NN3 A;  1T0K A;  4IO2 A;  5FHO A;  2D21 A;  4MHF A;  1N84 A;  3IB1 A;  1R6Z A;  5KCJ B;  1NFT A;  3H6U A;  4HE2 A;  5I5P A;  1YXI A;  4HTG A;  1MY1 A;  3IOU A;  3FJG A;  4QRZ A;  1B6H A;  5DVF A;  2VHA A;  1PB8 A;  2NOO A;  3IO4 A;  3SER A;  1WVJ A;  5ISU A;  3OO7 A;  4ZS9 A;  1LFG A;  1BKA A;  2NWJ A;  3TCF A;  3U92 A;  3QUF A;  4KPT A;  2PFY A;  1NUY A;  1B3G A;  5DVI A;  4IO3 A;  4NQ8 A;  3KSX A;  1LST A;  4K3F A;  2BJJ X;  2O68 A;  1S50 A;  1RYO A;  4GL0 A;  4GWO A;  3IK6 B;  3N94 A;  4JBZ A;  5AA2 D;  4TOZ A;  1SYH A;  3C35 A;  2OWS A;  2O1L A;  4OER A;  2PT1 A;  3CFL A;  1FQC A;  3FVG A;  5I3S A;  2DWH A;  2CEY A;  4RPN A;  3PMW A;  2P3N A;  2ZYK A;  1FPD A;  3PMX A;  5AA2 A;  2D3I A;  4RPO A;  2V84 A;  1XVX A;  1HSE A;  1US4 A;  2B4L A;  3MVZ A;  5LOM A;  1AMF A;  3KOT A;  1FQB A;  4MIJ A;  4GOT A;  1IIW A;  4YU0 A;  3GXA A;  2GFE A;  2ONK E;  3Q29 A;  1IIT A;  2VGQ A;  1SI1 A;  3PUY E;  4MH5 A;  3UK4 A;  3QIM A;  1B2H A;  1DK4 A;  4EQB A;  1VR5 A;  3CFX A;  2XXU A;  4P8B A;  1FTL A;  4LUB A;  4OVS A;  3FD3 A;  4F1V A;  5IKB A;  4PFI A;  3KN8 A;  3W9V A;  4RJZ A;  2RF1 A;  2I58 A;  2Q89 A;  3OXN A;  3C9H A;  4G68 C;  3LR1 A;  3H4Z A;  1M5C A;  3K1N A;  3A3U A;  1FPI A;  3CFZ A;  2Z22 A;  4F22 A;  1O64 A;  2QMX A;  2R6G E;  4KR5 A;  1B58 A;  1CNQ A;  2F36 A;  4XKP A;  5EQ9 A;  3FV1 A;  2HAU A;  4LQ2 A;  1WOD A;  1URS A;  4YKI A;  4ZEC A;  3V5A A;  4IY6 A;  1P1W A;  4PFY A;  3OSR A;  4BDO A;  2F7C A;  3G3I A;  1BP5 A;  1B7Z A;  2DWI A;  3MQ9 A;  4N13 A;  4DCY A;  4MFI A;  1OQH A;  4OTE A;  2CZL A;  1B3L A;  4P0G A;  1ZJL A;  3QSL A;  2I0B A;  2ESN A;  4P3L A;  1Y1M A;  1JVX A;  1UIV A;  4ZE9 A;  1GTK A;  1Q1K A;  1Y20 A;  3CVG A;  1JET A;  1VFE A;  3NOH A;  3E3K A;  5CM6 A;  2FBP A;  3TDJ A;  4OVT A;  4F3S A;  1JNF A;  1MDP 1;  4LZ7 A;  3EF7 A;  4R6H A;  5IGA A;  1SYI A;  3IOR A;  2Y84 A;  3E4R A;  4H6D A;  2Q8J A;  3SDF A;  1QUL A;  3SEU A;  1SW5 A;  1QUK A;  2V3Q A;  2XWO A;  1QKA A;  4OMB A;  4QFN A;  2DVZ A;  3G3G A;  2XWK A;  1MXX A;  3IB0 A;  4I40 A;  1G0H A;  3KJ7 A;  2DOJ A;  3K0V A;  1LBC A;  4AQ4 A;  2NUV A;  4U2R A;  1YPN A;  4OES A;  4H65 A;  4EQ7 A;  2Q8M A;  2ZXT A;  1NV0 A;  3U65 A;  1A54 A;  2DE2 A;  4YIC A;  3C31 A;  3K2D A;  3GBA A;  4FEB A;  4KHZ E;  4NF8 A;  1GV8 A;  2UVJ A;  3DLN A;  3FZV A;  1HSJ A;  3FXU A;  4HCW A;  1ZTY A;  4FJP A;  4NF8 B;  4WEP A;  5I2K B;  5H8S A;  1B52 A;  3G3J A;  1MQI A;  1USY E;  4H45 A;  2O1M A;  5CMC A;  4PE3 A;  5BUU A;  5I59 A;  3MST A;  4OFJ A;  3PUV E;  1NV2 A;  1LBY A;  4R6K A;  1FPG A;  1J1N A;  4KYS A;  4QF9 A;  4JXI A;  3KN3 A;  4X8R A;  4PFT A;  1OLC A;  3CSB A;  4I1D A;  3RT8 A;  2AYS A;  1OIB A;  3UOR A;  4DXB A;  3IX1 A;  4MAG A;  1KWH A;  3M8U A;  2THI A;  2XX8 A;  2XX7 A;  4GD5 A;  2OPE A;  1SW4 A;  2Y7W A;  1TFA A;  4EUO A;  1LAH E;  4F2Q A;  2QS1 A;  1B05 A;  3JYR A;  1BK4 A;  3W9W A;  4OVR A;  5DW8 A;  5JEI A;  5TP9 A;  2XXP A;  5HBC A;  4XFE A;  2E0S A;  3ZS6 A;  1EZ9 A;  1IZ1 A;  5TP9 B;  5I2N B;  1FBH A;  2FIX A;  3MPK A;  4P0I A;  1Q9D A;  3VV5 A;  4RK9 A;  4GX6 A;  4XXU A;  3B7D A;  5IZ3 A;  3MAM A;  4TLL B;  1FBF A;  2REJ A;  1SW1 A;  5B7D A;  3MVW A;  3T96 B;  3KBR A;  3FV2 A;  1DCU A;  1IMA A;  1FBP A;  4MCO A;  1KA0 A;  5I56 A;  4G77 A;  3E78 A;  3H7M A;  4QSD A;  1URG A;  3QMF A;  3A29 A;  4R9G A;  3MZ1 A;  1MY4 A;  5I56 B;  3PPP A;  4ZED A;  2WYK A;  1GGG A;  2GQ1 A;  1UTB B;  3TTK A;  2D5W A;  1KA1 A;  2XXT A;  3SKP A;  1YZ0 A;  3TTN A;  4O3A A;  4U21 A;  1FQD A;  2MKZ A;  2NVU B;  1FCK A;  1M5D A;  3CG1 A;  3S9E A;  4AB5 A;  3T9X B;  2Y7K A;  5H8F A;  4TLM B;  4DDD A;  1FJ6 A;  5DVJ A;  3DM0 A;  5ET8 A;  5ET7 A;  3PPR A;  5I57 A;  3HV1 A;  3N6T A;  5I57 B;  2KQZ A;  5H8Q A;  4DCX A;  2G29 A;  3WAF A;  1O63 A;  1A99 A;  2VOZ A;  1IXC A;  2H25 A;  1MY2 A;  1IMC A;  1XHY A;  4PTK A;  2ANJ A;  2XXH A;  4FBP A;  1AIV A;  1YAE A;  4NF4 A;  2V3T A;  2VD2 A;  1UTH A;  3MJN A;  3H3G A;  3HCQ A;  3B6T A;  4KYE A;  1DOT A;  2HEU A;  5I84 A;  3N26 A;  1FTM A;  3S2V A;  1UTH B;  2OBG A;  3MZB A;  3VE1 B;  3ZKK A;  3PPQ A;  2R71 A;  3FVN A;  5K2X A;  4PBQ A;  4GWZ A;  1D9V A;  1QGX A;  5IM2 A;  5I58 A;  2Q9T A;  2PX1 A;  4O7M A;  2GH9 A;  1JVY A;  3SEX A;  2Q74 A;  4E0X A;  4HXV A;  1B7U A;  2FA7 A;  4O8M A;  3GLB A;  4OEN A;  2XXW A;  1ATG A;  2HQ0 A;  2P3V A;  3KN7 A;  3Q26 A;  2Y7P A;  1PB9 A;  4F31 B;  1XI6 A;  1B0H A;  3TTM A;  4PGP A;  3LSF B;  1IQ7 A;  1B7H A;  2XD2 A;  1B5J A;  3OEM A;  3KEI A;  3FVK A;  1FPB A;  4G61 A;  2Z8F A;  4GXA A;  4KYD A;  5DYH A;  3VLW A;  4LQ5 A;  3IL1 B;  1TT1 A;  5CMK A;  1Y1Z A;  3FBP A;  1IMD A;  4PCD A;  3T22 A;  1FBD A;  2AL4 A;  3KFM A;  3ROJ A;  1NUX A;  4I8C A;  1LFI A;  3BKI B;  2QS4 A;  1MDQ A;  1P99 A;  1IME A;  3MW0 A;  4THI A;  3VFJ A;  2IA4 A;  4NX1 A;  1NNP A;  4OA4 A;  5HM4 B;  1M5F A;  1IEJ A;  3O6H A;  3C33 A;  5KZT A;  2M8C A;  1EU8 A;  2X7Q A;  4ESW A;  3UGW A;  4OFO A;  3LSL A;  4GXS B;  1B46 A;  2DQV A;  5CRY A;  4ZE8 A;  1PDA A;  3PTY A;  3PPN A;  4JWO A;  3FJM A;  1LCT A;  1TFD A;  4R73 A;  1MPD A;  1AH5 A;  4L17 A;  2I0C A;  2V25 A;  1H43 A;  5KDT A;  4HE1 A;  3E9X A;  5EYF A;  1RYX A;  4YKK A;  2L5V A;  5KDT B;  1FTK A;  5ET6 A;  1MXU A;  1NL5 A;  3EN3 A;  3T9H B;  4NE4 A;  4QHQ A;  2F97 A;  4YB5 A;  2HCA A;  3IAZ A;  1FQA A;  3GYY A;  3G3H A;  2UYE A;  4PAI A;  5AA2 B;  5F24 A;  2P0S A;  4ISU A;  3PD9 A;  3E13 X;  1K9Y A;  3H06 B;  1PBQ A;  1AWB A;  3OEN A;  4KQP A;  4NWD A;  3SET A;  1FQF A;  3HHG A;  4H5F A;  4ELQ A;  4H8I A;  4N6D A;  3KGC A;  2RC8 A;  1NNT A;  4UAC A;  3SZP A;  3JV9 A;  4HE0 A;  3KBZ A;  1OVB A;  2H98 A;  3VVF A;  1OVT A;  3IOT A;  1NH8 A;  4OVP A;  2F35 A;  3T9V A;  3R7X A;  4KXP A;  2QVU A;  2QJE A;  5FHN A;  4PGN A;  1MQJ A;  5AA4 A;  1XS5 A;  2XXY A;  4KI0 E;  5T3J A;  4U22 A;  4F18 A;  4DI4 B;  3GZG A;  2P1S A;  4F39 A;  3O66 A;  1EH3 A;  3I3V A;  5AA4 B;  4GRK A;  2XHD A;  4R75 A;  2WKY A;  4H67 A;  3USD A;  1FW0 A;  1MY3 A;  2UVI A;  3G3F A;  3S9L C;  3RGY A;  4GFR A;  4LAT A;  4FED A;  1DPE A;  4OZ9 A;  4JVD A;  3TOD A;  4GBW A;  1MH3 A;  5L9O A;  4R9F A;  1I69 A;  1IMB A;  2GHA A;  3FXR A;  1SDX A;  3B6Q A;  2QVV A;  3F11 A;  3EQ1 A;  1NNF A;  1NUZ A;  2DVC A;  3TEP A;  2DWA A;  2XXQ A;  2F3D A;  4MLV A;  4PAF A;  3FUZ A;  3EKI A;  3PMV A;  4IB2 A;  2RCA A;  4BDQ A;  3T66 A;  1Y3P A;  1B3F A;  3IFC A;  4GIZ A;  1NV1 A;  3TCH A;  3M3L A;  4RK2 A;  1B32 A;  4LZ5 A;  1B5H A;  3MVY A;  1JP4 A;  4POW A;  1PEB A;  2A5T A;  3QXM A;  2LAO A;  4PFU A;  1FPE A;  4OXV A;  4EQ9 A;  4MLQ A;  2OCU A;  2OZZ A;  4O3C A;  4MMP A;  5K2Y A;  3RPW A;  1A7L A;  2WX9 A;  1SW2 A;  3ILU B;  3HN0 A;  5FBP A;  3UN6 A;  3IR1 A;  3D1R A;  2QFL A;  4G68 A;  1DSN A;  4QFP A;  1QUJ A;  1A55 A;  1AL3 A;  4G68 B;  3MC2 A;  4GLI A;  4ZEB A;  1H76 A;  1URD A;  1PBP A;  5IZ1 A;  1A40 A;  2HPG A;  2ZYN A;  2Z8E A;  3TTR A;  4ECF A;  3KC0 A;  4QFL A;  2XXR A;  4ND9 A;  3ODB A;  1MPC A;  3VVE A;  2XA5 A;  5FHM A;  3FXB A;  1FRP A;  2RC9 A;  3EHS A;  1SQY A;  4NWC A;  4G8H A;  2ZNT A;  3K4U A;  1NV7 A;  4RXL A;  4BDR A;  1N76 A;  1NMU A;  4P47 A;  1FBE A;  3U72 A;  4FOR A;  2V4C A;  4ZZA A;  3OSQ A;  3C4M A;  3TTL A;  1LBB A;  1TXF A;  4Z7E A;  2Y5K A;  1ZMG A;  5I59 B;  3Q28 A;  4UA8 A;  1NKX A;  2OWT A;  1Z7N E;  3EPE A;  3A3C A;  2VPO A;  4JVC A;  4NF0 A;  3T9U A;  1OLA A;  4WXJ A;  3RUM A;  1P1U A;  1EYI A;  2ZNU A;  4DLD A;  3T0J A;  1ELJ A;  2DP8 A;  5HPQ A;  1N3W A;  2A5S A;  1LAG E;  2OX3 A;  3O9P A;  2HXR A;  2I6E A;  1F9B A;  1DPP A;  2CEX A;  4JVI A;  2ONR A;  4QFK A;  4QXD A;  1B40 A;  3FAT A;  4F3P A;  4POX A;  2QPQ A;  3TZA A;  2B65 A;  1B9J A;  2QS3 A;  4P11 A;  2UXA A;  3RPL A;  2ZMB A;  4PDD A; 
#chains in the Genus database with same CATH homology
 5EYH A;  2HZL A;  2B4M A;  3RPL B;  4PBQ A;  5I3S A;  1DBZ A;  2CEY A;  4GWZ A;  1LEV A;  5A5L A;  2P3N A;  1FPD A;  4O7I A;  1QGX A;  5IM2 A;  5LDZ A;  2Q9T A;  2B4L A;  4O7M A;  2HHM A;  3B50 A;  2PCR A;  5IZ3 B;  2Q74 A;  4MIJ A;  1SPI A;  4HXV A;  4O8M A;  4MNI A;  3HFU A;  1FJ9 A;  2F5X A;  2XWV A;  2P3V A;  4P1E A;  4HCY A;  1DK4 A;  3BIH A;  1XI6 A;  4MNP A;  4M1V A;  4N81 A;  4NG7 A;  4PGP A;  2F3B A;  4P8B A;  4XF5 A;  4GWU A;  2HZK A;  4OVS A;  3LV0 A;  1NV4 A;  4F1V A;  1FPK A;  4PFI A;  3W9V A;  1EYJ A;  5ESY A;  1NUW A;  1FPB A;  4G61 A;  4GX4 A;  2R8T A;  2XXK A;  4OAN A;  2DE4 A;  1FPI A;  2OWZ A;  2QVR A;  4XEQ A;  3FBP A;  1IMD A;  4PCD A;  1CNQ A;  1FBD A;  5ET5 A;  3ROJ A;  1NUX A;  3BIG A;  5EQ9 A;  1FTA A;  1G0I A;  1IME A;  4NX1 A;  4OA4 A;  4O94 A;  4PFB A;  1D9Q A;  4PDH A;  2FHY A;  4X04 A;  4P3L A;  4UAB A;  4F1U A;  3PTY A;  4P1L A;  1FPJ A;  4P9K A;  3NOH A;  4PC9 A;  4H46 A;  5CM6 A;  2FBP A;  4OVT A;  4HE1 A;  4QBA A;  2KR0 A;  5IGA A;  2DDK A;  1RDY A;  4N6K A;  2L5V A;  5ET6 A;  2V3Q A;  2XWO A;  4AS4 A;  2XWI A;  3GYY A;  4PAI A;  4LN5 A;  5F24 A;  2DVZ A;  4PF8 A;  1K9Y A;  2XWK A;  4I40 A;  1AWB A;  1G0H A;  1EYK A;  4GBV A;  4AS5 A;  5J1D A;  5JK4 A;  4N6D A;  2BJI A;  4MX6 A;  2Q8M A;  4DI3 D;  3SZP A;  1NV0 A;  1LBZ A;  4HE0 A;  3KBZ A;  4N15 A;  2CZK A;  3U65 A;  4GWW A;  4NGU A;  4N91 A;  1FSA A;  4I3Y A;  4OVP A;  5EQ7 A;  2FIE A;  2DE2 A;  4YIC A;  4KXP A;  2QVU A;  4PGN A;  5T3J A;  4F18 A;  4DI4 B;  2WBD A;  4HCW A;  3KC1 A;  4N17 A;  4H45 A;  4PE3 A;  3E79 A;  3MST A;  1KZ8 A;  4GWS A;  1FBG A;  1NV2 A;  1LBY A;  2JJK A;  4JVD A;  4GBW A;  2DE3 A;  1FPG A;  1IMB A;  2QVV A;  4PET A;  1INP A;  4PFR A;  4X8R A;  1NUZ A;  4P56 A;  3ISP A;  2F3D A;  4MJO A;  2WYP A;  4MAG A;  4PAF A;  5IZZ A;  5J16 A;  3EKI A;  2PFZ A;  1IMF A;  1YYZ A;  4I3E A;  1FPL A;  1K9Z A;  1BK4 A;  3W9W A;  4OVR A;  3IFC A;  5DW8 A;  2ZZV A;  1NV1 A;  2CZI A;  4XFE A;  1VDW A;  4PAK A;  4N8G A;  1JP4 A;  3RYD A;  4MNC A;  2VPN A;  1FPE A;  1FBH A;  2FIX A;  1Q9D A;  4MEV A;  4MMP A;  5EQ8 A;  4GX6 A;  2WX9 A;  2CZH A;  4F19 A;  4OVQ A;  2WEF A;  5FBP A;  2ZZX A;  3D1R A;  2QFL A;  5IZ3 A;  4PF6 A;  1FBF A;  1RDZ A;  1DCU A;  1IMA A;  3IFA A;  1FBP A;  4MCO A;  1KA0 A;  3LUZ A;  1NV5 A;  3E78 A;  1RDX A;  2FVZ A;  3QMF A;  3A29 A;  4N4U A;  4GX3 A;  4IR8 A;  4N8Y A;  2WBB A;  5IZ1 A;  2WYK A;  2GQ1 A;  2HPG A;  1NI9 A;  3B8B A;  3MYU A;  1KA1 A;  3KC0 A;  4GWX A;  5I7I A;  5LTC A;  1LBV A;  1NV6 A;  1YZ0 A;  2XA5 A;  3FXB A;  1FRP A;  5EQA A;  1NV7 A;  2MKZ A;  5EYG A;  4NAP A;  4P47 A;  1FBE A;  2V4C A;  3CHG A;  4NN3 A;  2Y5K A;  1FPF A;  4MHF A;  2VPO A;  1FBC A;  1FJ6 A;  4JVC A;  4HE2 A;  4NF0 A;  5I5P A;  1YXI A;  5ET8 A;  5ET7 A;  4PBH A;  4GWY A;  2VT5 A;  1EYI A;  3T0J A;  4NHB A;  4X9T A;  2OX3 A;  2KQZ A;  2HXR A;  2CEX A;  4JVI A;  2Y5L A;  4QXD A;  4YZZ A;  2PFY A;  1IMC A;  3T1B A;  1NUY A;  4PTK A;  4FBP A;  4NQ8 A;  2QPQ A;  1LBX A;  1NV3 A;  2ZZW A;  1LBW A;  3RPL A;  4PDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...