4ASLA

Structure of epa1a in complex with the t-antigen (gal-b1-3- galnac)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
229
structure length
229
Chain Sequence
ASKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNREYDGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Promiscuity and Specificity During Candida Glabrata Invasion of Host Epithelia.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Cell adhesion
molecule keywords EPA1P
total genus 63
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aslA00
4AHZA 2XJQA 4AFBA 4COWA 4LHNA 4LHLA 2XJSA 4COUA 5A3MA 4AHXA 4AI1A 4AI3A 4A3XA 4LHKA 4CP1A 4D3WA 2XJVA 2XJPA 4COZA 4AI0A 4COVA 5A3LA 4AHWA 4GQ7A 4CP2A 4COYA 4CP0A 4AFAA 4AF9A 4AFCA 4AI2A 2XJRA 2XJTA 2XJUA 4ASLA 4AHYA
chains in the Genus database with same CATH superfamily
5KXCA 4CDUB 1K5MC 2OPKA 2PAMA 3GALA 5A33B 5FLHA 2J7MA 2WL1A 1WMEA 4COWA 2KXLA 4QB2A 5E6HA 1BK0A 2VOKA 3VBRB 3KV4A 1JZ6A 4IGPA 1SQ4A 1Z7S2 4QB1A 3I97A 1MEC2 3CZJA 4QPIA 4LBMA 3KF3A 2UY8A 2DVFA 4JHTA 5BNPC 5FRAA 1JUHA 4I3GA 3ZSJA 4CUCA 2VGDA 3AC0A 1QH7A 4QQHA 1P8JA 4A6SA 3RI9A 1C1LA 5FY8A 3KM5A 4OQ8A 5A3WA 5F3IA 1G9CA 1ZREA 1RUF3 2VBPA 1H30A 5A7OA 1MS0A 1TME2 4MXWB 1CR7A 2ARAA 2HEYF 1DQ6A 2PMWB 1JOPA 4L9BA 4XEZA 2G4IA 2B39A 1CX1A 3OBRA 2WT0A 4A42A 5GLTA 1YI9A 4URTA 1G8WA 1LOAA 1JZ8A 3WINE 4MOAA 1RGSA 4B7EA 1WCKA 4RR3A 1QEXA 3POBA 3UGGA 1X50A 2EXIA 2PLV1 2ZEYA 3GBGA 3POSA 3OB8A 3ETQA 3VZLA 1VMFA 3VDDC 3MLJA 4D6QA 2WWJA 5JR2A 1JS9A 1UX6A 2YFUA 4BQ4A 4FTEA 5GJ6A 5F2WA 2VMGA 4R9AA 3MGUA 3TRSB 4XXPA 3OPZA 5A1FA 4YG6A 3BODA 3OBTA 3ORJA 3G7DA 4QQLA 5SV8A 1WLTA 4K20A 2JEMA 2VZ1A 3S30A 5BNPA 3ENRA 1C57A 2YFZA 3JD72 4JX0A 4YVSC 1NZIA 5JI9A 4YW1A 5LW9A 1VB4A 1JTZX 3M8LA 5A3PA 1MEC1 2CL2A 1PX4A 3KT4A 4EWDA 1BQPA 1PVC3 4EN8B 2BOJA 5J09A 3JB4C 3ZFGC 2Z42A 5KXDA 3C7HA 3FJSA 3E5QA 3MPPG 2VUJA 2I07B 3USSA 4AW7A 2XWBB 1ACCA 3ZN6A 5C9AB 4OUEA 1IGOA 2LM3A 1JH5A 3J9SA 2PQQA 5F6LB 2C9KA 4AXOA 3WF0A 5F8PA 4GH4B 3B9IA 1TE1B 3DCQA 1RMU2 4LO8A 5E88A 4LUMA 4CEWA 2EIEA 4BJ0A 5B2GB 5JXJA 2XBO1 1TMF2 2ZKNA 2JDMA 1H9WA 3UGFA 5CEHA 2YXSA 3MUZ1 4XF9A 4A4AA 4RHV2 2WNVC 2FCTA 2ILMA 4XZUG 5E1RA 1VBD3 4LHNA 4AI9A 3WNNA 1ALYA 1D4M2 4XHXA 4S2GA 1OH3A 4N90A 1CAXB 1LHUA 4QX5A 4QX2A 4S2DA 3AZZA 4Y4YA 3E6DA 1GWLA 2OZJA 2SBAA 1UOGA 1ULPA 5ACA2 5I0DA 2P6HA 2WWUA 5GLUA 3LEKA 2JDAA 3RZHA 5BNOC 1C8M1 3POYA 4MHUA 5EQUA 3T2QA 1O3QA 1E5IA 1AL23 1W99A 4RL7A 4UW3A 2D6PA 2OVUA 2PHWA 4HVRA 4KWKA 5JZGA 2HBTA 4I02A 3AB0A 4CSWA 4LE3A 3HJRA 2PHXA 2QZ3A 5J3UA 2A6YA 4BDVB 5H9QA 1JN2P 1ZBA3 4K9SA 3U37A 1GZWB 1NA1A 2NQYA 1HQNA 2VG9A 3KMHA 1H6YA 1W8NA 2YDEA 2YMZA 1KJRA 3LF7A 1LHWA 1D0HA 4QM8A 4P08A 5FY5A 2JG8A 5A32B 3VBFC 1OBNA 4V1PA 3WW3A 3RNSA 3SKVA 3VKMA 4Q4X3 4Z07A 2VW2A 1BHGA 4CPBD 3BN6A 2VW1A 3POEA 4ES9A 1XNAA 4O9EA 4QXBA 4M3CE 1QJY1 3MV11 1ZZ6A 3NAPC 3AVSA 4NIHA 1WCQA 2OX0A 4YVSA 5I91A 4RS5C 1UYPA 5IK5A 3KLSA 4FFIA 1Y4WA 1MR5A 4YFZA 1PO22 4FFHA 1LGCA 1HXS2 1QOOA 3A21A 4PT6A 3WF3A 1QWRA 4UBHA 4INDA 1B35B 2MHFA 4LBNA 4RFT0 4P9LA 2Z5WA 2F4PA 3DEMA 4LNVA 1LHVA 1CWPA 1YYNA 2GP5A 4DXSA 1X8MA 5CG9A 3ZFFB 4E27A 3OUHA 1V9U1 1O7FA 2K2SA 1JZ4A 3MIHA 2G9ZA 4NHMA 1TMF3 2ZX3A 1AR91 3H1YA 1HQWA 4H7MA 4ISQA 4QPIB 5EWSA 3MDPA 3U4SA 4CP0A 1F5FA 1QOSA 2Q4SA 5EJZB 1QJEA 1RUH3 2ZTNA 5FXWA 1GP6A 5FYHA 2VL4A 4GMP3 1UZYA 1ENRA 1US2A 5CIRA 3AP9A 2VPVA 4XILA 5C3PA 3MIDA 3I49A 5FMOS 4QHOA 4B1LA 1JZ2A 3UT0A 2K0GA 1PVXA 2WN3A 4HKWA 5F7UA 5JSOA 1RIRA 4J25A 4IGQA 3J8F2 3LOIA 4WVMB 1DGRA 4AEMA 5BNNA 3E6BA 4E8CA 4A3XA 3AKQA 3QH7A 2J22A 3JQWA 4QGNA 3N9NA 1ZNPA 4QGMA 4R4XA 2Q0AA 1J84A 1IHMA 2VQTA 1REDA 4DMIA 1OA3A 3SCFA 2DUQA 3IPVA 3HQUA 3OGSA 4I01A 2WS92 4RQPB 1CJDA 4XFFA 5C4WB 1YUDA 5LEJA 4F8AA 3AZYA 1Y9MA 2WS91 4IEVA 1QIQA 2A71A 1PK6A 4FAGA 4Z2WA 3VL8A 4LBQA 4DEVA 1Y9GA 5A7PA 1VRH2 2W46A 4IEZA 4C91A 2JG9C 1IPKA 4BQWA 4COUA 4W65A 2C26A 3IMMA 3ZXFA 4CUBA 1HV1A 4JDMA 3ZDVA 5GZFA 2XDVA 4QDQA 2D98A 4LHKA 3VBUC 1S0EA 4ATEA 2GN7A 4KWUA 2P3YA 2C9AA 4QM9A 5JIAA 5BXXA 1V9U3 1L7LA 1JBCA 5AVAA 4XFCA 1IS3A 4DY3A 5AC93 1PNGA 5FY1A 1ZRDA 1HXS1 5F6KA 4QX3A 3RSJA 1OFSA 3Q8BA 5ISLA 3NJZA 4FOYA 3BTYA 1VAKA 1EAH1 4QQPA 5LBFA 2QQVA 3OEBA 4P02B 2RJ2A 5HCBA 3PTYA 3VBOA 3AFKA 4GULA 4GZ9A 1JYWA 1L7RA 1LEDA 3OGRA 3N9PA 4ZU7A 1S55A 1W3XA 4KWLA 4QD2A 4H55A 1W8OA 3H8UA 2C24A 4RGGA 3W59A 2PHDA 2B46X 4HSLA 1WMDA 1S0CA 3ZMOA 1MZ6A 1PMHX 3JZVA 2ZOEB 1ODMA 2VQAA 3I2IA 3BGAA 3IAQA 4LKDA 4QDRA 3SCGA 1ZRCA 1D2QA 1ZBA1 2JG8C 2A6WA 1H8TB 4OI2A 1GOHA 4YW2A 3ZFEA 1NCQC 4TWTA 5J37A 1V6KA 2UWCA 3QACA 4XFBA 1D0GA 4RR3B 4IV3B 3VKOA 3AKSA 1IS4A 4WZFA 4CEYC 1C1FA 3WCSA 3RQ0A 2EIBA 3VBHC 2A73B 3P3NA 2AACA 5CNAA 1IPJA 1JZ5A 1WKYA 2GMEA 2ET1A 2W95A 4PDWB 3QH6A 1CPMA 4UFIA 2R1BA 2WZPP 1PX3A 5AFBA 1S4CA 2BQPA 4COYA 3H9AA 1VBD1 1OLQA 1QNWA 4NHLA 4XE9A 3VD3A 3LGRA 3FUQA 5FZOB 5SV5A 5A1LA 2WFF2 3NO8A 4Q0QA 1PK6C 3TEWA 1V70A 2D6MA 2QQLA 1UU5A 2WUHA 3NJVA 1XXNA 2UURA 4HVOA 2G1MA 1XNDA 1TVGA 2ADEA 2JIJA 1VALA 4GALA 4IXLA 4YM2A 3EYPA 3S5AA 4KH9A 4IGOA 4PF1A 4JRLA 3RJRA 4KWJA 1NCQA 4AI3A 1E5RA 4E4ZA 1VBC3 3CJIB 3FWEA 1GOGA 1RUNA 3IZOA 1AYN3 1NCRB 1QOTA 1V6NA 1OLRA 3PVOA 3JBG1 1G9FA 4HLTA 5FYIA 4DIQA 5KHJA 1WCUA 1FYUA 2Y0OA 3O1SA 1W39A 1RUD1 5FMBA 3ZXAC 2D44A 3GJAA 3KSCA 4YYOA 2BDRA 4OLLA 1JW6A 4V2WA 1ASJ2 2VTXJ 1QU0A 2BGOA 3FLRA 4BK4A 1YIPA 2X5IC 4BK5A 4YARA 1RUOA 1N3PA 4Q4W2 1F2NA 2RJLA 4WM7C 2OA2A 4IEOA 4AAPA 1O8SA 4IV1B 2W0XA 1OH4A 4AFBA 1BYHA 4GKYA 4OI1A 3KGLA 1UYXA 1XE7A 3AK0A 2R6QA 1OKOA 3IN9A 4XYXA 5EIYB 5D21A 5A1AA 4YM3A 4DPNA 4LXLA 4WZCA 5LASA 2DF7A 2V73A 4XJWA 3M3EA 4BYYA 2HYKA 3WF4A 1X82A 4IETA 4UF0B 5ANNA 3ZKUA 2BNNA 5FZDA 2VNVA 1NLSA 2ZMLA 1PMJX 3AYAA 3VBSA 3N3HA 3SISA 1VRH3 2A7AA 1CESA 2RDQA 4JQTA 3LIGA 4P9YA 5H9PA 4EJRA 1PM4A 1G9BA 4EQVA 3N7KA 3A0NA 5LBBA 1RUE2 2DVBA 5IWFA 3WG1A 3WLUA 1BEV1 2A5ZA 2ZEZA 5EZWA 1DQ5A 1KEXA 4A41A 4OHYA 1XNBA 1W0PA 4PQ9A 5LY2A 1W9WA 4DUVA 1R1A2 5JXHA 2MNGA 1K45A 2QQOA 1LR5A 3L9JT 4HZFA 4FP3A 3NMBA 5A33A 5BYNA 1RVF2 4CDXC 5FREA 3VBSB 5JI7A 5FZKA 5M0TA 2I2SA 2D3SA 1W05A 1W8FA 4CEWB 3GZEA 1WW4A 4C90A 5FOBB 2RG4A 2ZGUA 3IAPA 3C7FA 3T4HB 3EQEA 3MYXA 5IHRA 1Z0HA 2GU9A 1H1IA 2FDHA 1EV13 1ZX5A 1J58A 5FJKA 3AMPA 5I93A 2FDJA 1VMJA 5LRSA 1QJU1 2VY0A 4YSFA 3MIEA 4S2FA 5K0UC 4LOSA 1W6OB 2E7AA 2L9LA 2X10A 2XH6A 3CBNA 3CLPA 4FPFA 4IW3A 1Q8VA 2PYTA 4MV2A 2RMU2 3NNLA 5CYYA 4D6RA 4D0QA 4YGEA 2OZ6A 4Z1VA 3ABZA 3GJBA 5FPXA 4LA3A 2DYCA 1ZVFA 4GWJA 5APAA 4META 5CFCB 1Q56A 3BTAA 1COV2 4XAEA 4NAOA 1W8TA 3O1MA 2O14A 1XNTA 2HEVF 4IE5A 5EFUA 4Y3OA 4Q4V3 4QQ2A 3TEZA 5KXBA 4SBVA 4LO5B 2SLIA 1FOD3 1UXZA 2ZMKA 3ON7A 3SH5A 5F39A 1Q8SA 3QOPA 4FCAA 4OULA 2WFPA 5FLIA 4I0AA 1OD3A 4CDQB 5FYMA 1K42A 4AGVA 1YEWA 3B93A 4HVQA 2VNOA 5I0TA 3I3DA 5K9YA 2Q1MA 2RHPA 3V0BA 5T5OA 4K8RB 1GR3A 2ERFA 3AVRA 4IV3A 4G3YC 2OKXA 2WA3A 2W1QA 5FZ3A 1OC1A 4ZU4A 3UGHA 3UESA 3Q9OA 4K6BA 2OT7A 3WW1A 2ATFA 1S2EA 2XJVA 1GNZA 2V4VA 2H0VA 1GKBA 4RGAA 3LIHA 4FPKA 1S0GA 4OMCA 3T08A 3M70A 4EN7B 1OKQA 3H0OA 1AJOA 1DGRN 4E4DX 4IUGA 4Y1VA 1OXCA 1EUUA 2QQMA 3DV8A 1MZ5A 1VIWB 4AI2A 4LA2A 1PIV2 1VP6A 3PU3A 1I6XA 1LOFA 3M3CA 3M4FA 5FP9A 4LORA 3VD9A 4A44A 4FPJA 3ZPOA 3BVCA 2LROA 4PCRA 3AYDA 3ZSLA 1O3SA 1JI6A 4BLIA 3PLQA 3VDCA 4E2QA 4YWAA 3ZO0B 1QH6A 4P9GA 2P34A 2BBAA 3HQRA 3N36A 2QJVA 4OHXA 4CXXA 4LLFA 5FYVA 1F31A 1ZA7A 1D2SA 1YC61 2XBO3 4MXVA 2HWE2 1WD3A 1N3OA 2JKXA 2R073 2Q1ZB 2TNFA 1D7PM 1OLME 2GC2A 3DYMA 3PURA 4BXSV 3ZFEB 5L9VA 2YHJA 4AAXA 5LA0A 2XOMA 2E6VA 2CTVA 3BYWA 3VB9A 2BERA 3RG0A 1GWMA 2QQPA 4AEDC 3JBG3 2HWD3 4B29A 1RINA 2A3XA 2R072 3FZ3A 4QT6A 3HIFA 2VCBA 5H9RA 3URFA 3S7EA 3GBWA 4HOOA 4P5HA 3TWIA 4CCLA 3H8XA 1CD3G 2QNKA 3TN92 4DY5A 1XBFA 1VB2A 1AR61 4HANA 1R64A 3PJYA 3GCWA 1W6NB 5EV7A 3C7GA 5DUUA 2AEYA 4JKKA 3QLQA 4HL0A 1RL3A 4AHWA 1UO9A 1PIV3 2HJIA 3GDBA 3ZSEA 5A3UA 5L36A 5C8CC 1FNYA 2E26A 4ZPIA 1HXS3 2WO1A 3VBRC 1UZVA 2QUOA 1AX2A 4JVAA 4XCAA 1OA2A 2BZDA 3LDKA 5A7SA 2DCYA 3NNMA 4LBKA 3U75A 3VHNA 4FPHA 4WM8A 1AUYA 4Z8BA 4ZZ8A 5BNPB 4ZHNA 1ZYBA 4HK9A 1NCRA 4GB32 4MUVA 2P6CA 2WAAA 1N1VA 4NPMA 4R52A 1NQJA 5LRRA 1EYBA 1FMD2 2WYFA 4MH0E 3ZYHA 3RVHA 2YPJA 1O59A 1UY2A 5C4WC 2RDNA 4JGZB 5JOYA 5A80A 1YIFA 3W5NA 3ES4A 4Q0UA 2Q8EA 1RC6A 1V6OA 3Q8AA 4XTMA 2VTXA 2HWF2 3CJXA 2UWBA 1TME3 3DKWA 1W8HA 2W94A 4K1YA 4Q2FA 2UYBA 3NQHA 1KITA 3D0JA 4YVWB 2ZHLA 1GBGA 2R061 5DN2A 2AH2A 1W0OA 4M3CA 4UFHA 4MZUA 3RZMA 2WRAA 4C8DA 3CIHA 2OYZA 1RUI1 1W6QA 2ZMNA 3VDDB 2H0BA 4ZU5A 4OI0A 1OOPC 2E9QA 4N7UA 3WF1A 4AVVA 1VMHA 1ZZ8A 4NIIA 1K5JA 3ZVXA 4AVTA 4MGIE 1JYTA 4W6YA 1HRI1 3I59B 4YVSB 1DGWX 2Y33A 1QQP1 4CCNA 1ZZ9A 3MBWA 1W6MB 2PHTA 2YGMA 4NPLA 3SEEA 3H8RA 4P5YA 2GSYA 1LB2A 3GYDA 3T2PA 1JOBA 2IFWA 4QXCA 1KXGA 5FZ7A 5T54A 2VUDA 3WQ7A 1FV2A 5G05L 2C1FA 4NN0A 3USUB 2AEZA 1WW6A 3GGLA 1YQ2A 1M06G 1SLCA 3NKTA 2HWD1 3MV01 2HBUA 4K8FA 1QXJA 3ZFFA 2A6VA 4NHXA 5KR7A 2WYSA 2B7YA 4X8NA 5G04L 4EZHA 5JSRA 2ZACA 4GXLA 1IOAA 4XQ4A 2YZ4A 4G4FA 2LW8A 3B69A 3AZWA 3LKJA 1H2KA 3VBOB 5BNNC 4C0HA 1QJZA 2QDNA 3U4XA 4O7XA 4BQ5A 3ZFGA 2WIIB 1BVP1 2BEOA 2RDSA 1MQTC 3WP5A 5GLWA 5KHGA 2D97A 5AFEA 1BBT1 4LMFA 1GICA 4ORFA 2AREA 2OQ7A 2WNVB 5FO9B 1SCSA 3E5XA 4H14A 2ZXQA 1ULCA 4IL7A 1H4GA 2ZA9A 4KG0A 1F15A 1C4RA 3IM0A 2YBKA 1VBB1 1RHI1 3RMYA 4M0NA 3T2OA 4BQ3A 2ZHMA 3NV1A 3BOPA 4HSJA 5GM0A 2DV9A 4PDWA 2ID4A 5GALA 1ND3C 3S57A 1OMIA 5FY0A 4EWEA 5C7GA 1I9RA 1DG6A 3MICA 2RS11 3JUUA 1UYYA 1RHI3 4N53C 1ONAA 2JE8A 1LHOA 2YG0A 2ZCWA 5JZGB 2VMCA 3IBMA 4KGGA 4AWDA 4CU6A 1RJ7A 2BTVC 3AMMA 5GLVA 4GWMA 2F17A 5FXZA 1LOFC 3U78A 5ABJA 2OQ6A 5HV0A 3LQCA 4MGTA 3MF9A 5CBLA 4AVBA 5F3EA 4MGZE 1DCSA 1DBNA 1OOPA 1XPWA 4UFKA 2XUEA 4QKDA 1A3KA 1MS3A 3IMNA 1OUSA 1SEFA 1XYNA 4MGYE 1IQAA 2D6NA 4YM0A 5FMCA 1IS6A 1SFPA 1SPPB 3CNAA 1W28A 1RUC3 3SH4A 4L99A 3PUHA 5A70A 3PIJA 2XJPA 5JWPA 1U5ZA 4HETA 2QZ2A 4Y22B 1ZZ7A 1POQA 4JKLA 3CJIA 1DZRA 1BK1A 1ND3A 2B8MA 3VZKA 3UK9A 5ABJB 1QXPA 1W90A 2ZPXA 4BQ2A 1RUC1 1GZ9A 4M3CF 2P3JA 2WS93 3ACLA 4OUMA 1MPXA 2XR4A 4TLFA 2C4XA 4ATFA 4CDWB 1YFYA 1CONA 2WNVA 4JAAA 1QJX2 4DUXA 4EN6B 4Y33A 1DQ4A 1RUJ3 1H0BA 3VZOA 4U2AA 4JHZA 3ROUA 3ASIA 2BVVA 5FPAA 3LEIA 5C71A 2PLV2 2H6BA 3MLKA 4JRAA 5FFOC 4BE3A 3R4SA 4BQXA 2XHNA 4EYUA 1EUTA 1F4AA 2VBBA 5FQ0B 3VZMA 3WG3A 3J8F3 4UAPA 1S0IA 5IVCA 2VOTA 4DEQA 2RS13 1U5YA 1UIKA 2HWB2 3J4UH 3I3EA 5FLJA 4KQ7A 3B01A 1S0JA 5CG8A 2WO7A 4FVVA 4AE2A 1HN1A 3LSEA 1BLZA 4NRPA 4Z82A 3A23A 3WUDA 2DTWA 1LEMA 2PFWA 1S0FA 2XB6C 1STMA 2XJUA 4K40A 2QQKA 1UL9A 1O3TA 4XJAA 4CDXB 3UJOA 5DAPA 1N47A 1YJLA 3UKTA 1CAXA 2W1SA 5FUNA 3PTRB 3R4DB 2ZKLA 4XABA 2Y60A 1WBLA 2EXKA 4CEWC 1RHI2 1SACA 3D0SA 4ONUA 5A7WA 2VH9A 1O4TA 3I59A 4LKEA 4N43A 1ZZBA 4TTGA 4IESA 5T5LA 4MGQA 4RQPC 3ZYIB 4FTBA 1LU2A 5DAVA 1C8M2 1NE6A 5A6QA 2Y6FA 4LULA 5FZLA 2WZR2 4Q4Y1 1NUKA 1GOFA 1OSGA 5EPAA 1YNAA 4CEYA 1IG3A 2DURA 4YZ5A 3CL1A 3V0AB 1W6MA 4ZXKA 2WFF3 1HRI3 3HNMA 3GZUC 4MGKE 4J1WA 3ZXGA 4QXKA 1D4M1 2IXHA 1XE8A 1MS8A 4HBNA 4XURA 4OZOA 5CFCC 3WP6A 3KS7A 2BNMA 2XPJA 4JDNA 4YZ4A 2X8KA 1W8WA 5K8SA 2P3KA 2R042 4M01A 1GFF2 4XETA 4ZXEA 3W21A 3POIA 3OUJA 1POV3 1ENSA 5FPZA 4BM8A 4YRDA 1D4M3 5I0SA 1W6PB 3OPTA 1KFXL 4FPYA 3WEZA 3UKNA 4CDQC 2GC0A 2XG3A 4YVWA 4D8MA 1H4HA 4Z92B 2Y34A 1HRV1 3J7NA 3VBUA 1FI2A 3ZYPA 1MS5A 4XUOA 4JC1A 2W5FA 4FTSA 1QJX1 5IFTA 1N1SA 3GZTB 4YW3A 5FK8A 3I2HA 1G86A 1O4YA 3IB3A 5J98B 1G9AA 1FPN2 1H8VA 4HN0A 4PF5A 3FHIB 4LO6B 3DYPA 1XOYA 1LECA 1DU3D 2Q1FA 1EPWA 2DFCA 3MF6A 2DU1A 3HBZA 3C2UA 5LZ6A 5C8WA 4E4HA 1VBC2 1DYPA 2LS6A 5IVJA 2XMLA 2E63A 1OUXA 3E97A 4HT1T 1NA1B 2X05A 5FR3A 1AYN2 1JHNA 2OPWA 4PIZA 1PGW2 1RMU1 2Y26A 4KU7A 3RZKA 2RS51 1PVC2 3W5MA 1RITA 2PLV3 3BI3A 5C3OA 1ZRFA 1ULFA 1L7QA 2P3IA 3K4AA 2JIGA 2EAAA 2YU1A 1CAWA 4XUQA 4LT5A 3OYWA 4CXYA 1AL22 1AZDA 3GBFA 2ZGSA 3ZX7A 3ACIA 1W9SA 3AP6A 2P4EA 1JUIA 2JG9A 4PDWC 3KCYA 3V65A 4MG2A 4YNIA 4QPGB 3K48A 1DQ1A 3N7JA 2HWE3 3ZXJA 5AVPA 2W52A 5FP4A 5LCWL 2W1WA 2OS2A 2Y38A 5DAWA 5BNOB 1RJ8A 2OUJA 3QBQA 1ZBE3 4QU2A 3TOJA 2RS12 1SCRA 4UW6A 2Y6HA 2JB8A 2GMMA 5GZCA 3POJA 3CQOA 4JGYA 2YYOA 1VBE3 1UWWA 2HWE1 1Q43A 2X29A 2D3PA 2NN8A 4LK7A 4G9SB 1PMIA 2ZX0A 3DN7A 3ZMNA 5C70A 2BUKA 2D43A 4Q4V1 4CA9A 5FO8B 1XNCA 4D69A 2V5YA 2VCMA 4L8QA 3I54A 1ASJ3 2VNGA 2NPIA 4NRQA 3INAA 3RJ2X 1F35A 1AX0A 1VBE2 2RM22 3VHPA 2JDZA 4CDWA 3GF6A 1QHDA 5FY4A 2W92A 3ZXKA 5C8CB 5CFDC 1PM7A 1RVF3 4QKBA 3LE0A 3WD5A 5F3GA 4DXRA 4XF3A 2Q8CA 1W8UA 4YM1A 1JYIA 3IDCB 4AGGA 1AX1A 1SLTA 4P9WA 3P5BA 4GWIA 1QMJA 4FQ4A 1WLCA 1CN1A 2XJRA 3O1PA 5IUQA 2Z2SB 3VZNA 1QY4A 2BU9A 3APBA 2DVAA 3AP4A 5FPLA 1G9DA 2CV6A 4JGZC 2BOIA 3DPRB 3JB8A 1SFNA 4RGKA 4DFSA 3LSDA 1ZRRA 5I8YA 3GHMA 4P9XA 1Y43B 3NVCA 3GZAA 4B4PA 3V64A 1RYYA 2D5HA 2A1XA 3NV3A 2BP6A 2VC9A 3N9MA 1GSLA 1RUI2 3D82A 1SLBA 2W2IA 3ZYFA 2CWSA 1W8ZA 2XUMA 2EALA 3ZN5A 3VBSC 4LOTA 2IXJA 1AYM1 4Q27A 4D6SA 4FXGB 5F3CA 1WLWA 1X8EA 2G9GA 3S0MA 3JU9A 4BXFA 5FPVA 1JYNA 3KV9A 4URAA 2EIGA 4FP2A 5FDBA 3N35A 2K46A 3T30A 1MACA 3GM8A 1FT9A 1QJU3 4LKSA 2FD8A 2Z79A 4NHKA 2QQWA 1FMD1 1PO11 2WNUA 4LBLA 2LTNA 4XPVA 1PZ7A 3UJQA 5KXEA 4UFJA 4OHVA 5KWRA 2QTWB 1NAEA 1W9YA 3ZM8A 4CDXA 1YQCA 4D94A 5L7OA 1RUE3 2JG9B 3AYEA 4NOTA 3LDRA 4FFGA 4CU8A 3FL7A 2C0ZA 2E33A 1NZCA 2Q8OA 3W20A 3VBUB 4AYUA 5C5UA 5BNNB 2ZHNA 4PBPA 3K3NA 1REFA 3ZYRA 2HWC2 4NJ4A 1JOJA 2Z4FA 4OYUA 3D4KA 3FN9A 4XBQA 5A3MA 5CKMA 1O91A 2CU5A 5CKNA 2JD4A 4FOQA 3WF2A 4M4PA 3K4DA 3ATGA 5F5AA 2V5DA 2ZBJA 4COZA 1RUG2 1GQPA 3AJYA 3VBFA 2WZEA 4Y1UA 5JAXA 1AR62 2OUHA 5FKCA 5CZKA 2BRTA 2EXJA 4CCOA 1UIJA 4TXWA 2A70A 4XUPA 4AQ2A 5F37A 1EV12 1X36A 2J1SA 4GMP0 3ZFGB 1HQLA 1FAYA 1ULOA 1YXWA 2FCUA 3NJYA 3T0AA 5DQ0A 5C3SA 4MSVA 1ULEA 3THCA 1C8NA 1BMV1 2PN5A 3ST7A 4CUAA 1UD1A 3UV9A 3ME2A 2ZAAA 5LB6A 5C9AC 3FE5A 2QE3A 3TNQA 5JOWA 1A34A 2IXKA 5T5PA 1ULDA 4NRMA 3SHRA 2G19A 1VJ2A 5B4NA 4XBLA 3TN93 1C8M3 2J1AA 1BBT3 1UY0A 1IS5A 2VMHA 2VZSA 3KQRA 2ZGQA 4NHYA 4AVAA 4FPCA 1NCQB 3AP7A 1KDKA 4YW5A 3A0KA 3E1F1 1AXYA 2Q8DA 4XFIA 1DYOA 3MI8A 2JE9A 4Q0PA 5C3RA 4BA6A 3JBG2 1PGSA 4FAHA 1RUJ2 3M3OA 3GNEA 2MEV2 4QB6A 2HWF3 2HEWF 3O12A 1VE0A 1S1AA 4NO4A 4XFHA 4Y5Z0 1GP5A 3WW4A 4N9IA 2WA4A 5GZEA 3AZVA 1AR73 1CAWB 3POGA 3I2GA 4E2SA 2BYVE 3O7OA 3I3MA 1MZEA 2WZR3 1UW8A 1PO21 4DUWA 2V4AA 4JCKA 1AR63 4CU9A 1F5JA 2XXZA 4TLGA 1NXD1 5HI0A 1WW5A 2JDHA 1QJY2 2ZGKA 4GD4A 4X6RB 4ET7A 1A6CA 4UW4A 4XIOA 3R6SA 3BTZA 1VBD2 3PU8A 4JTOA 1HW5A 1WD4A 2BFUS 5EXOA 1TME1 2AC1A 1AXKA 4JDOA 2VQ0A 2IFRA 4P9IA 5HXMA 3MFAA 2JWPA 4Y24A 2HWD2 3WNLA 3D3AA 3VKLA 3ZDSA 1XU2A 1IKQA 2XGXA 4E8DA 1UY4A 2C5DA 4S2HA 4JZRA 4Q4X2 4BMEA 4XACA 3O1RA 2W87A 3KT7A 3ZYGA 4LTAA 4Y20B 1Y3TA 2XJSA 4YGBA 1H1AA 4A45A 3M3IA 2XQXA 1COV1 1POV0 4KG8A 1UAIA 2GC3A 3ZYJB 1U12A 1ZBA2 4EE2A 4AGRA 3AKPA 5FCCA 2ARXA 1VAMA 2WBKA 1AJKA 4NPRA 5HCFA 3U10A 3WR0A 3OY8B 1HRV3 4B1MA 4AFAA 3ZSKA 3BOWA 2WQ8A 1KRIA 3SC7X 4XDOA 2TUNA 3K77A 4AK3A 3EO6A 5FZEA 1FX5A 5C8CA 1LOGA 3QD6A 4J1XA 3I2FA 1LENA 2J42A 1OVSA 3FFZA 4FPOB 4LHLA 1NY71 1MQTA 3OD0A 3AJZA 4CDUA 1DP0A 2JDKA 5T52A 1KD7A 2CGOA 3EJKA 1RUG3 1YFUA 5F5IA 4QKNA 3IWZA 4B8EA 3VV1A 2ZAHA 5CAZA 2FHRA 4QHBA 5KC6A 4QQOA 3HQXA 1OPMA 5TSWA 5B4XA 3AKTA 1OFNA 1OOPB 1LESA 1JU3A 2D3RA 1F9KA 1PGL1 4XFAA 4XQWA 5IW0A 4M00A 4LR4A 5C5TA 2XVKA 5FZOA 4AHZA 2XL7A 3ZR6A 4QX7A 5CA6A 1HN0A 4XJZA 2VO5A 3HR9A 1X9PA 1OT5A 5DDJ1 1RUC2 3RI8A 4CU7A 1MVQA 3OGJA 1XQNA 4HN1A 4N7IA 1SLAA 2WABA 2F6BA 2J1VA 3NL1A 4AVSA 1Q8QA 2OIIA 4BIOA 1GYKA 4SLIA 3USUA 3HN1A 5CFCA 2B42B 2PHRA 3LOBA 3O14A 2V09A 4CCMA 1T6GC 4GB31 3ZXDA 1HJGA 3FHQA 5FZ9A 5IAXA 1H6XA 2BNOA 2XONA 3NNFA 4YFWA 2FDIA 4BHPA 2W1UA 4Q4V2 3LA2A 4FPEA 3TNPB 3K46A 2GH8A 2WWSA 1JU4A 4Q0SA 4XIKA 5JR7B 3HVDA 1JMUB 4WBBA 1UPIA 2NP0A 5GKAC 2VW0A 4TYSA 2HWC1 1MVEA 4AQ6A 3S5QA 3WDXA 4XUTA 4EN9B 1L3JA 1SPPA 3BUCA 3IT8A 1GNHA 1BCXA 2ZHKA 3OF1A 1TEIA 5A3OA 4TSVA 3JD71 3OGVA 2RVAA 4QPGC 2ARCA 2X53S 3T0BA 4BMBA 3FHAA 3M2MA 3T0DA 1W6PA 3H3ZA 4XF1A 4AL9A 5JPMB 3HPNA 3ILFA 1RB8G 3V0BB 4Y5TA 2X5IA 1W3VA 5IYYA 5BNOA 1DZQA 1Z78A 4O65A 4KBZA 5A6ZA 2D6LX 4HFSA 4BOWA 4ZKTB 4I3PA 2EAKA 4Q1RA 5HV4A 4AHXA 1GV9A 1AYM3 2W91A 3VD5A 4FBFA 2JDUA 2DUPA 1LKNA 1KDMA 2YUEA 3DYOA 5LA2A 1UMZA 5FWJA 1FMD3 1SDWA 2TBVA 5KHHA 4LUKA 3B7MA 3DXTA 3WUCA 1ASJ1 4EZ4A 3O1TA 1ST8A 5L9RA 3ZR5A 4K21A 3OG2A 2E31A 2Z69A 4PI2A 4L2NA 1A8MA 1OQEA 4AFCA 4GA9A 1S0BA 3OTFA 4Y5SA 1V0AA 5C33A 1SBEA 1DHKB 2J1TA 2CHHA 3W9AA 5CFDB 4AHYA 1K12A 2AZ5A 3KZ4C 5FP3A 4OFGA 4PLOA 5H9SA 4Q29A 1YJKA 2RJKA 1KQRA 3T1LA 1TNFA 5I0UA 3U0ZA 1PGL2 4TZDA 3PVBB 1ENQA 4Y4RA 4DINB 5ABJC 4ZZ5A 3H1WA 5E89A 5DUVA 1LTEA 1KS4A 4D3WA 5IT6A 2WDBA 3KWVA 3VKFC 4ARYA 5FPUA 1CAVA 3O0VA 3MW4A 3WP4A 1F4HA 1QDOA 4HG6B 2KD7A 3HEIA 5FBZA 1V6MA 4OHZA 1O5LA 2I74A 4XCBA 2HWC3 1UZ0A 3AM2A 2B5HA 4MADA 2VMEA 1WWYA 4PQQA 3VLBB 5IAVA 5C3QA 2CY6A 3VN4A 2VUCA 3PDQA 2BWAA 2JXAA 4BQYA 2Y0IA 3CKHA 1XYPA 4DB5A 1Q5OA 3MO4A 1OPOA 5FYSA 3OGGA 2VOWA 3Q8FA 3WDTA 5J36A 5JVVA 2IXLA 3UYJA 2RV9A 3BPZA 3NNGA 5FKBA 2R062 3IDAA 5K0UA 1I5ZA 1TMF1 4XBNA 4XJ8A 1UY1A 2FZ1A 2I45A 4IV1A 3NKGA 5FUIA 3FBYA 4UT5A 3KGZA 2QDRA 4CUGA 4EV0A 5IK4A 3B3QE 3ZN4A 1V6IA 3B5LB 3M1HA 5IVBA 3O1UA 2ENRA 5A3LA 1OQ1A 5FTTC 1RVF1 2WNUC 3NNJA 1XSRA 5FYZA 2QQIA 1HRI2 4M4RA 1A8DA 2QQNA 2WSUA 3C8XA 3KCCA 4Y22A 3U11A 4AFMA 4NE9A 1NLQA 3U1XA 4KBBA 3ILRA 1YLLA 5D8AC 1UPSA 4QGLA 3N9LA 3NV2A 2UWAA 3LAGA 4MYEA 3ZPYA 4LBOA 2A6ZA 1QJY3 1PZ9A 1XJAA 2FDGA 4DOUA 1Q8OA 3I2JA 4R9DA 3SEPA 3SH3A 2R30A 3PUQA 3ZYBA 2HWB1 3ECQA 1W04A 4QX0A 4DZGA 1QQP3 4O61A 1B35C 3RYPA 2JDYA 2VCCA 2ZZJA 3J7HA 5FY7A 3V0AA 1CZSA 1EAH3 2P17A 2GNBA 4FT8A 4L92A 1YFXA 5KHKA 1W03A 2J1RA 4LIVA 2XLAA 1VBA2 2A3WA 3H3UA 3LFMA 4O9GA 4QX8A 5FYYA 3E6CC 3KCXA 4ASKA 1PVC1 1URXA 3FBMA 3ZIXA 2O8QA 3LA3A 3BTXA 2B9VA 4D7SA 2UY9A 5CADA 4Q4Y3 5F2SA 2PTMA 3P1IA 1AL21 3RZJA 3TBDA 5FZFA 1EY2A 1TG7A 4LO7A 3ZN6B 2VVEA 5C9AA 4NIAA 2WQZC 3MPBA 1J1LA 1G6NA 1R082 5EJ3A 1K5MB 4CE8A 3OY8A 2Q5TA 3WSOA 1UXXX 2GMPA 1R081 3ZIWA 1XNKA 4XXAA 4WM7A 2O1QA 5DABA 3A4UA 3MZHA 4ES8A 1BMV2 4BLJA 1PIV1 2NZ9A 1IKPA 2VCAA 2EA7A 4HXCA 3U07A 3AP5A 1KS5A 5CKQA 1O5UA 4ASLA 1HDKA 3ES1A 2ZGMA 2RS33 2NM1A 3K2OA 4AZZA 1X33A 2K9ZA 1NA1C 2ES3A 3L2HA 1T6BX 1F8VA 3A22A 2FQPA 1WGPA 1Y9QA 2WT2A 3P6BA 4H2AA 1X9TA 3KVAA 4UOJA 3R05A 4HK8A 4WV8A 2PAKA 3BPSA 4HMZA 4U36A 2IC1A 4GKXA 4QXHA 2RS52 4XOGA 4LPLA 4B3NA 4Y1ZA 2JJ6A 4FXKB 3AX4A 3GXUA 4XVHA 1NX9A 2CYFA 3C3VA 4FPGA 4E2GA 2VOVA 2WNOA 1J1TA 1AR72 1YFWA 2A3YA 1ND2A 2ZGTA 4JV4A 4QWNA 1VBB2 1ND3B 5EYYA 2KR2A 4W50A 4YG0A 1DLCA 3RYKA 3CEWA 4D7YA 5FZ4A 2WT1A 3AYCA 5FY9A 3SXWA 3WW2A 4N53B 4Q8LA 5LBEA 1CVNA 2WN2A 1UU6A 1W2TA 5GLZA 4IE6A 4XF4A 2KA3A 5I0RA 4QHZA 4OZXA 3PL0A 4YZ2A 4XF0A 2ETEA 5CISA 3OJBA 1W9TA 2YGLA 4AF9A 2R0FA 1RTVA 4C0BA 1SDDB 2A6XA 4OMDA 5FV3A 4IEUA 3TEYA 1GZWA 1OF3A 2R0HA 1A78A 2DCJA 4YZ3A 4YW7A 1YQ6A 1NT0A 2GN3A 2YV8A 4XDQA 1CZTA 1DYKA 1W2AX 3LWCA 1DFQA 3ALQA 1C3HA 1H8TC 2MPFA 3VL9A 2YY1A 1FNZA 3FC0A 3KVBA 4LEJA 4CZSA 4DQAA 5GZGA 4UF0A 1QQP2 3ZSMA 2EVXA 3HBKA 1LULA 2GZWA 3NWKA 3THTA 1JZ3A 5A7WB 3RFRA 1BJQA 5LATA 1S2BA 3EHKA 3RPQA 2PHUA 3ILNA 2HLEA 4L97A 4CDWC 1R1A3 1BEV3 1R1ZA 1HX6A 1PO23 5FZ1A 1HKDA 2AENA 4YW4A 2DCZA 1C28A 1LOBA 2GC1A 1YCIA 2BGCA 5FZBA 4B4RA 4GJZA 1HJFA 3TYJA 3LCPA 2RMU1 3LEMA 4PLNA 3RZLA 2BW8A 2KM2A 4CCCA 5J1XA 3OCPA 4IE4A 3OPWA 5FZ8A 4L11A 1JXNA 2Y64A 3O0WA 1BEV2 1JYCA 1UMHA 4EWAA 1QJU2 4XUNA 1N1YA 1PK6B 1RXFA 3KF5A 5I8SA 1GUIA 3SMHA 1PNFA 5CU1A 5ACA3 4KU8A 1AR93 2VQUA 4W6XA 2FMYA 3H7JA 3LEGA 3N9QA 1EV11 1TZOA 3RWNA 1XRUA 3KV5A 2IXCA 1UZWA 2PAEA 4CP2A 2FDFA 1C5HA 3JD73 4LQRA 1SZBA 2PELA 1KJLA 1KFUL 2E51A 1O6UA 2R16A 2VMIA 3I8TA 5FZGA 3VBFB 1KGYA 4D7TA 4CPBA 1AHSA 1Q8PA 3DF0A 3HT2A 4IEWA 5HCHA 5FO7B 3WT3A 1HIXA 1VBE1 5FZAA 3PNAA 1U0AA 3ZOIA 2MEV1 1FXZA 4E4SA 3RZZA 5JOZA 5A3TA 4Q5OA 3AXEA 3NV4A 4UI9L 4WM8C 1LOCA 1M4WA 1OD5A 2J1EA 4CP9A 3B9CA 5JUVA 2VD7A 2YC2A 2R043 2D5FA 4WM7B 2WO2A 4ZONA 4KMQA 2ET7A 1ND2B 2BJSA 1REEA 2VMFA 4GB33 1Z7S1 4IE7A 4WVMA 4YVWC 4IEPA 4AEDA 4E9KA 5L7OB 4NAMA 4QKFA 5C4WA 3HWJA 1K5MA 3CDZB 1UQXA 3ZFFC 2ZEWA 4AEKA 3AMQA 4RFRB 5LBCA 3NRUA 2VU9A 2DUOA 3IKWA 3K75B 5IVYA 3C7EA 3ACFA 1ZRIA 3I2DA 3PVNA 4XHBA 2GNMA 4QPIC 5DDJ3 3SITA 1H8TA 3MUY1 2VXJA 3PVEA 5FZCA 2XQRA 5FOJB 1AYM2 2XVGA 4GIQA 3PMSA 4NROA 5L9BA 3ZLIA 2QQUA 4LE4A 4LKFA 4Y26A 4CDUC 4FOWA 2DDUA 1OF4A 5FP7A 2VNRA 4XMAA 1WBFA 1W2OA 4AFDA 3CZUA 3POFA 4N43B 5EYXA 5FWEA 4COVA 5DDJ2 4DRVA 2IXIA 4ZS2A 5DUXA 2EXHA 1GZTA 1AR83 1V00A 5I8TA 3AMNA 2VE1A 3LZZA 1DDLA 3F2ZA 4NWVA 2DCKA 1R093 2IVIB 2Y6KA 1UCXA 4AQSA 3IPVB 2JX9A 3B94A 1FV3A 3J7LA 3DPRA 2WC2A 5FIXA 4BZ4A 5A6YA 1I3HA 2E7TA 2CGPA 3IDEA 3WY6A 4NWWA 3WDVA 5DPNA 4LLOA 2W39A 1PO12 2XLGA 3AMHA 1SMVA 4LBJA 4Q4X1 4PIXA 1V6JA 1J3RA 4IEXA 3MW2A 4I09A 2BWCA 1RUD3 5LY1A 2CNAA 2XKPA 1AR71 3N7LA 3R0RA 1CIYA 2VBDA 4RSUA 5JXIA 1XYOA 4PJYA 4XJUA 3H8OA 4JQRA 5DUWA 3LFIA 5ERLA 2OW4A 3UNPA 3Q8CA 4FOVA 4ISRA 3VDAA 1C5IA 1WA4A 3IDBB 3PMEA 2IUWA 1SBDA 1RMU3 4MX3A 1AF9A 1CAUA 1OQDA 5AC91 2XKOA 4QPYA 5IK7A 3KHCA 1O3RA 5FZ0A 4AEJA 1CJPA 5IVFA 5BPXA 1QJFA 1QGLA 4N9HA 3V56A 3UKVA 1EAH2 2VZVA 4Q0VA 4F3JA 1GP4A 2E7QA 1UN1A 4MVTA 3EMRA 2ZS6B 4AI1A 2FDKA 3OOXA 3LPFA 1XB9A 3VHRA 4CP1A 2YC0A 5D2AA 5F9TA 2Y8KA 1NG0A 4XQDA 5IVEA 3O1OA 3K3OA 4UWDA 5LA9A 2RM23 1WZXA 2HYXA 2ZX2A 1XE0A 2VVFA 3RRDA 5AC92 4DO0A 4V2VA 4MXWA 1VRBA 4MGSA 2RDRA 2ZZQA 4LK6A 3IIIA 3IIAA 1ULGA 1TNRA 2DFBA 3HMYA 5IVVA 4RA0A 3ITQA 3POWA 5HCAA 3SKJE 2FZ2A 1OHFA 4RHV1 3N4MA 3NJXA 3GCXA 4UFLA 3WX5A 1HB1A 1GMMA 2XBO2 2DTYA 2ZABA 2PHLA 5F1RA 4IEYA 4Z2AA 1AXZA 2WNUB 4H7LA 4R9BA 4QX1A 4CCDA 4KNCA 3WNOA 3FLTA 1LAJA 4ITCA 1MZFA 2ZGOA 4CCEA 1ZBE2 1LCLA 2WO3A 1IPSA 3I3QA 4IEQA 4QDSA 1POV1 1O8PA 2LALA 3VBHB 1APNA 4M0HA 1N3QA 1H2NA 5FK7A 4RYDA 3I2KA 2D40A 3RWKX 4UFMA 3AL6A 2JD9A 3WDUA 1LU1A 1OI6A 1UU4A 2VZPA 4JGYB 2R071 3WNMA 3B02A 4AI8A 3DPRC 3HD8B 2BV4A 3ZFEC 3ELNA 3RDIA 4K7JA 3T2TA 1VPHA 2WLPA 4RQPA 3H3LA 1SLLA 2NLRA 2XL9A 3P3PA 1XSQA 5F5CA 1PGW1 5IATA 1V9U2 1R083 3WZ1A 4AEDB 5FJHA 3NAPA 3KV6A 1AVBA 1XC6A 4QPGA 2YBPA 2BGPA 3TAYA 5K4LA 2D7FA 5FAXA 2D6OX 3DXUA 4P00B 5FYCA 1MS1A 5LK5A 2VZQA 2AUYA 3BIEA 4FQZA 2CAVA 4CTEA 1BVVA 1VLNA 4HONA 5JPNB 1DGWA 1ENXA 4PI0A 1GNYA 5FYTA 3BCWA 4R4ZA 4OUSA 5JMCA 1LODA 3J8F1 3LA7A 4LBQD 1W9FA 2R041 1J59A 2PHFA 3NAPB 3HN3A 3TB0A 1IZ3A 2XWJB 2DCTA 4GAZA 4A7YA 4RS5B 3T1MA 2X5IB 2FCVA 2C6SA 1RXGA 2VZRA 2WJSA 2WSVA 3PUAA 1HV0A 4HKLA 2D6KA 4K1ZA 4FSJA 4JTNA 4MHRA 5T5JA 4IV1C 4P14A 1LGNA 3U14A 4MLOA 1OURA 1YQ8A 1WLDA 2GNTA 1E5HA 2LUWA 4NUBA 5FYBA 1US3A 4K3UA 4Q4W3 2UU8A 3CMGA 1FPN1 2H6CA 3WOGA 1N1TA 2QFEA 2W9XA 2WR9A 4XAAA 3VBHA 2DVGA 4QPWA 3WNKA 3AZXA 2GH2A 4QAWA 2GP3A 5KHIA 1JHJA 1BXHA 5JXGA 2TEPA 4LJHA 1NE4A 2AR6A 1TQ5A 3PUSA 3KB5A 2ZX1A 3WG4A 2CDOA 4GMP1 5FMDA 1AR81 3OBAA 1IQDC 3N9OA 1RUH1 3JQXA 5J96B 2W3JA 5J7MA 1W6OA 5LA1A 1J3PA 1QXRA 1BBT2 1YHFA 1NQDA 3W58A 4BPZA 2R32A 2PA7A 4XTPA 2JENA 2DBIA 3WP3A 4HPKA 5ACA1 4X6QB 3KHBA 3VZJA 4FFFA 1YWKA 4CDQA 3VDBA 5DZGA 3VD4A 2RE9A 5FYUA 2CGNA 4I0BA 4C1XA 2RS32 3VDDA 1H2LA 4QMAA 5DAXA 5HXVA 4N53A 3WQ1A 3L2YA 4J6GA 4CP9B 1JZ7A 1XU1A 4FO9A 3WHUA 1NLRA 3ACGA 5FPBA 2QCSB 2DBNA 1Y7BA 3Q8EA 3WVJA 2FBEA 4LBQB 3BIWE 3WNXA 4A2UA 1R1A1 3AFGA 4A7ZA 4NVPA 5FUPA 5K0UB 1MEC3 1OLMA 4YZ1A 1CIWA 1MS4A 3AKRA 1PZ8A 2ZGLA 4WVWA 1UX7A 2W47A 3JXSA 4NIGA 4DNYA 2B9UA 5A32A 2J1UA 2VZOA 4R8HA 4MO3M 4ZY9A 4EROA 5A6XA 5A3NA 1JODA 3VBOC 4L0PA 5C6CA 2MEV3 1FOD2 2RR11 1V6LA 4B7KA 2WNEA 2VTFA 1UOJA 2VMDA 1MQTB 4GQ7A 3A7QA 3DGTA 1HB2A 5JOXA 1RUE1 2XJQA 1ZA4A 3AXDA 1LOEA 5FQ0A 4UW5A 2Y6GA 5EJ1B 1CAVB 4Q1PA 4UXAA 1BKZA 1GU3A 4AOCA 1COV3 2JB4A 4W8JA 3DKQA 1QNYA 4KGQA 3KD4A 4PIYA 4ASMB 1YO8A 4I0WB 5FZHA 3SCHA 1T2XA 1UZZA 3VKNA 2GAUA 2W68A 4FPLA 2QQJA 3WQ0A 3FX3A 2DU0A 2ZGPA 1VBA1 2FMDA 5DZEA 4DXTA 4R9CA 4WVZA 1CAUB 3NW4A 4XC9A 2VJXA 4KL1A 2P5BA 2VR4A 1GANA 2CSGA 1RUF1 2XJTA 2EIDA 4DXZA 1DGLA 3ETPA 1O4ZA 4GWNA 1SLIA 3HNYM 4IERA 1WMFA 3M7AA 1GZCA 1VBC1 4GH4C 5JSPA 4FI9A 3RYRA 3HOBA 3WV6A 2HWB3 4DS0A 1I1EA 1WCDJ 2YU2A 4PBOA 3MFCA 3OUIA 4IV3C 4BQ1A 4CCJA 4RHV3 1H1MA 2YB7A 1DQ2A 3K51A 3D8CA 1UOBA 3LD8A 3CF6E 3LDBA 2X09A 3MW3A 5HPOA 2WFF1 1QDCA 1W6NA 3SNMA 2P2KA 1ZBE1 1AL0G 3T3YA 3H1MA 5L73A 5E16A 3H50A 5T3NA 5T55A 1UYZA 4CCKA 1UNBA 1RUI3 1VBA3 3F95A 1VAVA 3WDYA 1W0NA 2P37A 1NY72 2RS31 2YROA 1JYXA 3OYWB 1K3IA 2XVLA 5J48A 5K7PA 3DECA 4DRRA 2Y6JA 1W06A 4Q26A 5FMOL 5CVRA 5D8AA 5A7NA 3WCRA 3LPGA 2YC4A 4YG3A 5IK8A 2BBVA 3ZXLA 5A7QA 1RUD2 1OVPA 2D93A 2RS53 3GHNA 3O1VA 4GH4A 4YPJA 3WQBA 4BISA 4LHSA 2E32A 5BNQA 4BH9A 1BZWA 4GJYA 2B4KA 3EB7A 4IQPA 2VULA 2QKDA 3VGIA 2RR13 2VUAA 3EBRA 5DMYA 5DG1A 3G6JB 5DAQA 2YBSA 3RZGA 3X29B 3PUIA 2ZGRA 5FP8A 4XMIA 2HH9A 3THPA 2DWRA 1E57A 1DF0A 1LGBA 4N43C 4XZPA 1YI7A 3CU7A 2VZ3A 3FMGA 5JIUA 4KI5M 4BIFA 1DLLA 2VZUA 4CVUA 4X8PA 1B09A 2ZEXA 1PHMA 2IVJA 3RS6A 3CHXA 4HPKB 2XLFA 2R7EB 1HLCA 1WA6X 1CX4A 2HKXA 3ZXEA 2HWF1 4OI4A 2CWMA 2R1DA 1S2KA 2ZGNA 2JECA 5KBFA 2O8OA 2JKBA 5DXDA 4JGZA 5F32A 3OBZA 1DZTA 1H2MA 3J7MA 2WZR1 2ORZA 4Q4Y2 3MIFA 1GWKA 3MIBA 2VOXA 5DZFA 5FBJA 2W08A 5DG2A 4Y1YA 3MIGA 3HAGA 4NMIA 3OEAA 5LK7B 1DQ0A 1RUH2 2P1BA 5E8AA 1MS9A 4AQTA 1GQHA 3D6EA 2A75A 4C1WA 1Q3EA 4CYDA 2QBXA 1FATA 3H42B 3S6PA 4XDPA 3QCWA 3RMXA 1EPZA 1X7NA 1B35A 2RM21 2QVSB 2BVBA 2V72A 4UBGA 2EF6A 4HKOA 2WLQA 1J83A 2AGSA 3M3QA 4YGDA 1CGPA 3WNPA 3WDWA 2YPDA 1NOVA 3R4UA 4OHWA 1LRHA 2IWGB 1SBFA 2JDPA 2VZTA 1R092 3H7YA 2BFUL 5L19A 3T4VA 4TN7A 4AR2A 5JDBA 4N8MA 2EICA 3HT1A 3KQ4B 3PHMA 5T50A 3THDA 3WHTA 3PJQA 3WG2A 2R49A 2NMNA 1YRZA 4WVVA 3AL5A 1UKRA 1RUF2 2Y6LA 2IZWA 1S0DA 1GQGA 4EN0A 4BB3A 2ZJCA 3PIGA 4AG4A 2ORXA 3UL2A 5HBAA 4F7ZA 4Y20A 1I5PA 3S7IA 1Z7S3 4I30A 4W6WA 3MLLA 3HNBM 1OA4A 3I2OA 3DUIA 3BU0A 4M3CB 3KT1A 3D5OA 5FXXA 1J3QA 2NMOA 1IG0A 4ARXA 2UYAA 1VRH1 3O5SA 3OD4A 4YW6A 5ANQA 4QU1A 1RUJ1 1R091 3SQOA 5F5QA 3WXPA 2Q30A 4OCTA 4YLZA 3EXUA 1FOD1 2ARBA 2RR12 4I2OA 2XHKA 2CDPA 2G9FA 5FXVA 5EP9A 1CQ9A 2ADDA 2VVDA 2WQ4A 1LJ7A 2WINB 3RGBA 5BV6A 2WZ8A 2DVDA 1W6QB 4A7KA 3I3BA 4Q8KA 2LRPA 1GLHA 2RMU3 4RD7A 1SFYA 1HB4A 1WW7A 4JGYC 5IJRA 1YQ5A 4IE0A 2GALA 5GZDA 3TN91 4AI0A 4AVCA 5BY5A 2VAUA 3FUOA 1FPN3 1W2UA 5LEKA 1ZM1A 3ACHA 3FLPA 4Q4W1 4UYBA 2PQSA 5CB7A 1NKGA 1UF2C 2JICA 4NR1A 1HB3A 1HRV2 1WMXA 2VXRA 1CPNA 5JMOA 3BKZA 3DL3A 2ZX4A 3VBRA 3ZKYA 1LNSA 5JZGC 2VECA 2GDFA 1E5SA 4XW3A 4YGCA 5JCTA 4CRQA 2AYHA 2JG8B 4H3WA 1AYN1 5CFDA 1RUG1 1WCSA 4OQ9A 1UOFA 4LIUA 1D4VB 4A3ZA 1DIWA 3VD7A 3E5UA 1AR92 4NIDA 3C7OA 4RR3C 4Y1XA 4PHZA 2GNDA 2WKKA 4CEYB 3MHZA 5KC5A 3FFQA 3NSTA 2O0OA 3TEXA 1UMIA 5D8AB 5BUVA 1SG3A 5FZMA 2R063 1NYWA 3BB6A 4OVEA 1QKQA 5EHDA 3JCIA 1NXMA 3LB9A 3I7DA 4WM8B 2WAOA 4ZS3A 3J26N 4RN5A 5IFPA 4LITA 3O0XA 4IDZA 4RS5A 3UETA 1QF3A 4CXWA 4BCUA 1VBB3 2JDNA 1LHNA 1ODNA 4XJ9A 3I4IA 1ND2C 1H9PA 1WUVA 3BU7A 4B4QA 5LWBA 5JLVA 5L7OC 2VM9A 2JE7A 4JKMA 2B45X 4P9JA 2BPA2 1JYVA 1PO13 3CO2A 1W2NA 1U5XA 2PXJA 4A6OA 3B00A 1CZVA 4XFGA 2NYYA 3MEPA 3K4ZA 3VHOA 3T09A 4BWOA 3OSDA 1UKGA 3VUOA 4F83A 1EP0A 1ZZCA 3CJIC 1QJX3 2CAUA 5FZIA 2E53A 2F4LA 1NCRC 3N7MA 4W4ZA 5FZ6A 3SLIA 1U5IA 5D1IA 3BALA 1SHWB 2OXBA 4LO4B 1AR82 1G7YA 1UY3A 4BU2A 1VR3A 2N7GA 4PLMA
chains in the Genus database with same CATH topology
5KXCA 4CDUB 1K5MC 2OPKA 2PAMA 3GALA 5A33B 5FLHA 2WL1A 4COWA 1WMEA 2KXLA 2VOKA 3VBRB 1SQ4A 1Z7S2 1MEC2 4QPIA 4LBMA 2UY8A 2DVFA 5BNPC 5FRAA 1JUHA 4I3GA 3ZSJA 2VGDA 1QH7A 4QQHA 3RI9A 1C1LA 3KM5A 1G9CA 1ZREA 1RUF3 1H30A 1MS0A 1TME2 4MXWB 1CR7A 2HEYF 1DQ6A 4L9BA 4XEZA 2G4IA 2B39A 3OBRA 2WT0A 5GLTA 1YI9A 4URTA 1G8WA 1LOAA 3WINE 1RGSA 4B7EA 1WCKA 4RR3A 1X50A 2EXIA 2PLV1 3GBGA 3POSA 3VZLA 3ETQA 3VDDC 3MLJA 4FTEA 1UX6A 5GJ6A 2VMGA 4R9AA 3MGUA 3TRSB 4XXPA 3OPZA 4YG6A 3BODA 3OBTA 4QQLA 3G7DA 5SV8A 3S30A 1WLTA 4K20A 2JEMA 5BNPA 3ENRA 1C57A 3JD72 4YVSC 5JI9A 4YW1A 1VB4A 1JTZX 3M8LA 1MEC1 2CL2A 3KT4A 4EWDA 1BQPA 1PVC3 4EN8B 5J09A 3JB4C 3ZFGC 2Z42A 5KXDA 3FJSA 3E5QA 3MPPG 2VUJA 2I07B 3USSA 4AW7A 2XWBB 3ZN6A 5C9AB 1IGOA 2LM3A 1JH5A 3J9SA 2PQQA 5F6LB 4AXOA 4GH4B 3B9IA 1TE1B 1RMU2 4LO8A 5E88A 4LUMA 4CEWA 5B2GB 2XBO1 1TMF2 2ZKNA 1H9WA 2YXSA 4XF9A 5AC92 4RHV2 2WNVC 5E1RA 2ILMA 1VBD3 4LHNA 1ALYA 1D4M2 4XHXA 4S2GA 4N90A 1CAXB 1LHUA 4QX5A 4S2DA 3AZZA 4Y4YA 3E6DA 2OZJA 2SBAA 5ACA2 5GLUA 5BNOC 1C8M1 3POYA 1O3QA 1AL23 4RL7A 4UW3A 2D6PA 2OVUA 2PHWA 4HVRA 4KWKA 5JZGA 4I02A 3AB0A 4LE3A 2PHXA 2QZ3A 5J3UA 2A6YA 5H9QA 1JN2P 1ZBA3 4K9SA 1GZWB 1NA1A 2NQYA 1HQNA 2VG9A 3KMHA 2YDEA 2YMZA 1KJRA 1LHWA 1D0HA 4QM8A 2JG8A 5A32B 3VBFC 4V1PA 3WW3A 3RNSA 3VKMA 4Q4X3 4Z07A 2VW2A 2VW1A 4ES9A 4O9EA 4M3CE 1QJY1 1ZZ6A 3NAPC 4YVSA 5I91A 4RS5C 5IK5A 3KLSA 1MR5A 4YFZA 1PO22 1LGCA 1HXS2 1QOOA 1QWRA 4UBHA 4INDA 1B35B 2MHFA 4LBNA 4RFT0 4P9LA 2Z5WA 2F4PA 4LNVA 1LHVA 1YYNA 1X8MA 5CG9A 3ZFFB 4E27A 1V9U1 1O7FA 2K2SA 3MIHA 4NHMA 1TMF3 2ZX3A 1AR91 3H1YA 1HQWA 4H7MA 4ISQA 4QPIB 5EWSA 3MDPA 4CP0A 1F5FA 1QOSA 2Q4SA 1RUH3 2ZTNA 4GMP3 1UZYA 1ENRA 5CIRA 3AP9A 2VPVA 4XILA 3MIDA 5FMOS 2K0GA 1PVXA 5JSOA 4HKWA 1RIRA 4AEMA 3J8F2 3LOIA 4WVMB 1DGRA 5BNNA 3E6BA 4A3XA 3AKQA 3QH7A 3JQWA 4QGNA 1ZNPA 4QGMA 4R4XA 2Q0AA 1IHMA 1REDA 4DMIA 1OA3A 3SCFA 2DUQA 3IPVA 4I01A 2WS92 4RQPB 1CJDA 4XFFA 5C4WB 1YUDA 5LEJA 4F8AA 3AZYA 2WS91 4IEVA 2A71A 1PK6A 4FAGA 4Z2WA 3VL8A 4LBQA 1VRH2 4IEZA 4C91A 2JG9C 1IPKA 4COUA 4W65A 3ZXFA 1HV1A 4JDMA 5GZFA 2D98A 4LHKA 3VBUC 1S0EA 4ATEA 2GN7A 4QM9A 2C9AA 5JIAA 5BXXA 1V9U3 1JBCA 5AVAA 4XFCA 1IS3A 4DY3A 5AC93 1PNGA 1ZRDA 1HXS1 5F6KA 3RSJA 1OFSA 3NJZA 4FOYA 1VAKA 1EAH1 5HCBA 3PTYA 3VBOA 3AFKA 4GULA 1LEDA 4ZU7A 1S55A 4KWLA 4QD2A 4H55A 3H8UA 4RGGA 3W59A 2PHDA 2B46X 4HSLA 1WMDA 1S0CA 3ZMOA 1MZ6A 3JZVA 2ZOEB 2VQAA 3SCGA 1ZRCA 1D2QA 1ZBA1 2JG8C 2A6WA 1H8TB 4OI2A 4YW2A 3ZFEA 1NCQC 4TWTA 5J37A 1V6KA 2UWCA 3QACA 4XFBA 1D0GA 4RR3B 4IV3B 3VKOA 3AKSA 1IS4A 4WZFA 4CEYC 1C1FA 3WCSA 3RQ0A 3VBHC 2A73B 3P3NA 5CNAA 1IPJA 2GMEA 2ET1A 4PDWB 3QH6A 1CPMA 2R1BA 2WZPP 5AFBA 2BQPA 4COYA 3H9AA 1VBD1 1OLQA 1QNWA 4NHLA 4XE9A 3LGRA 3FUQA 5SV5A 2WFF2 3NO8A 4Q0QA 1PK6C 1V70A 2D6MA 1UU5A 4HVOA 1XXNA 2UURA 5E89A 1XNDA 4IXLA 4YM2A 1VALA 4GALA 4KH9A 4JRLA 3RJRA 4KWJA 1NCQA 4AI3A 4E4ZA 1VBC3 3CJIB 3FWEA 1RUNA 1AYN3 1NCRB 1QOTA 1V6NA 1OLRA 3PVOA 3JBG1 1G9FA 4HLTA 5KHJA 1FYUA 2Y0OA 1W39A 1RUD1 3ZXAC 2D44A 3KSCA 4YYOA 4OLLA 1JW6A 1ASJ2 1QU0A 3FLRA 1YIPA 2X5IC 4YARA 1RUOA 1N3PA 4Q4W2 1F2NA 2RJLA 4WM7C 2OA2A 4IEOA 4IV1B 2W0XA 4AFBA 1BYHA 4GKYA 4OI1A 3KGLA 1XE7A 3AK0A 2R6QA 4XYXA 3IN9A 4YM3A 4DPNA 4WZCA 2DF7A 2V73A 4XJWA 3M3EA 4BYYA 2HYKA 1X82A 4IETA 2BNNA 1NLSA 2ZMLA 3VBSA 3AYAA 3N3HA 3SISA 1VRH3 2A7AA 1CESA 4P9YA 5H9PA 4EJRA 1G9BA 3N7KA 3A0NA 1RUE2 2DVBA 3WG1A 3WLUA 1BEV1 2A5ZA 5EZWA 1DQ5A 4OHYA 1XNBA 1W0PA 4PQ9A 1R1A2 2MNGA 1LR5A 3L9JT 4HZFA 4FP3A 5A33A 5BYNA 1RVF2 4CDXC 5FREA 3VBSB 5JI7A 2I2SA 2D3SA 4CEWB 1WW4A 4C90A 5FOBB 2ZGUA 3EQEA 3MYXA 1Z0HA 2GU9A 1H1IA 1EV13 1ZX5A 1J58A 3AMPA 5I93A 5LRSA 1QJU1 2VY0A 4YSFA 3MIEA 4S2FA 5K0UC 1W6OB 2E7AA 2XH6A 3CLPA 4FPFA 4MV2A 1Q8VA 2PYTA 2RMU2 4YGEA 2OZ6A 4Z1VA 5FPXA 4LA3A 2DYCA 1ZVFA 4META 5CFCB 1Q56A 3BTAA 1COV2 2HEVF 5EFUA 4Q4V3 4QQ2A 5KXBA 4SBVA 4LO5B 2SLIA 1FOD3 2ZMKA 3SH5A 1Q8SA 3QOPA 4FCAA 4OULA 2WFPA 5FLIA 4I0AA 4CDQB 4AGVA 3B93A 4HVQA 2VNOA 5I0TA 5K9YA 2Q1MA 2RHPA 3V0BA 5T5OA 1GR3A 2ERFA 4IV3A 4G3YC 2WA3A 4ZU4A 3Q9OA 4K6BA 3WW1A 2ATFA 2XJVA 1GNZA 2H0VA 1GKBA 4RGAA 4FPKA 1S0GA 4EN7B 3M70A 1OKQA 3H0OA 1AJOA 1DGRN 4E4DX 4Y1VA 3DV8A 1MZ5A 1VIWB 4AI2A 4LA2A 1PIV2 1VP6A 1I6XA 1LOFA 3M3CA 3M4FA 4FPJA 4PCRA 3AYDA 3ZSLA 1O3SA 4BLIA 3PLQA 4E2QA 3ZO0B 1QH6A 4P9GA 2P34A 3N36A 2QJVA 4OHXA 4LLFA 1F31A 2XBO3 1D2SA 4MXVA 2HWE2 1WD3A 1N3OA 2R073 2TNFA 2Q1ZB 2XPJA 2GC2A 3ZFEB 2YHJA 2E6VA 2CTVA 3RG0A 2QQPA 4AEDC 3JBG3 2HWD3 4B29A 1RINA 2A3XA 2R072 3FZ3A 4QT6A 3HIFA 5H9RA 3URFA 3S7EA 3GBWA 4P5HA 3TWIA 1CD3G 2QNKA 3TN92 4DY5A 1VB2A 1AR61 4HANA 3PJYA 1W6NB 5EV7A 5DUUA 3QLQA 4HL0A 1RL3A 4AHWA 2HJIA 1PIV3 3ZSEA 5L36A 5C8CC 1FNYA 1HXS3 3VBRC 2QUOA 4JVAA 1AX2A 1OA2A 2DCYA 4LBKA 3VHNA 4FPHA 4WM8A 1AUYA 4Z8BA 5BNPB 1ZYBA 4HK9A 1NCRA 4GB32 4MUVA 1N1VA 4R52A 1NQJA 5LRRA 1EYBA 1FMD2 4MH0E 2YPJA 5C4WC 4JGZB 5JOYA 1YIFA 3ES4A 4Q0UA 1RC6A 1V6OA 4XTMA 2HWF2 3CJXA 2UWBA 1TME3 3DKWA 4K1YA 4Q2FA 2UYBA 4YVWB 1KITA 3D0JA 2ZHLA 1GBGA 2R061 2AH2A 1W0OA 4M3CA 4MZUA 2OYZA 1RUI1 1W6QA 2ZMNA 3VDDB 2H0BA 4ZU5A 4OI0A 1OOPC 2E9QA 4N7UA 4AVVA 1ZZ8A 3ZVXA 4AVTA 4MGIE 4W6YA 1HRI1 3I59B 4YVSB 1DGWX 1QQP1 1ZZ9A 1W6MB 2PHTA 2YGMA 2GSYA 1LB2A 3GYDA 2IFWA 5T54A 1KXGA 3WQ7A 1FV2A 2C1FA 4NN0A 3USUB 1WW6A 1M06G 1SLCA 3NKTA 2HWD1 4K8FA 3ZFFA 1QXJA 2A6VA 2B7YA 4X8NA 5JSRA 2ZACA 4GXLA 1IOAA 4XQ4A 2YZ4A 4G4FA 3LKJA 3B69A 3AZWA 5BNNC 1H2KA 3VBOB 4C0HA 1QJZA 2QDNA 3U4XA 3ZFGA 2WIIB 1BVP1 2BEOA 3WP5A 1MQTC 5GLWA 5KHGA 2D97A 5AFEA 1BBT1 4ORFA 1GICA 2AREA 2WNVB 5FO9B 1SCSA 3E5XA 4H14A 4IL7A 1ULCA 1H4GA 2ZA9A 4KG0A 1C4RA 3IM0A 3RMYA 1VBB1 1RHI1 4M0NA 2ZHMA 3NV1A 3BOPA 4HSJA 5GM0A 2DV9A 4PDWA 5GALA 1ND3C 1OMIA 4EWEA 1I9RA 1DG6A 3MICA 2RS11 3JUUA 1RHI3 4N53C 1ONAA 2ZCWA 1LHOA 5JZGB 3IBMA 4KGGA 4AWDA 1RJ7A 2BTVC 3AMMA 5GLVA 4GWMA 1LOFC 5ABJA 3MF9A 5CBLA 4AVBA 4MGZE 1DBNA 1OOPA 1MS3A 1A3KA 3IMNA 1SEFA 1XYNA 4MGYE 1IQAA 2D6NA 4YM0A 1IS6A 3CNAA 1RUC3 3SH4A 4L99A 2XJPA 5JWPA 1U5ZA 4HETA 2QZ2A 4Y22B 1ZZ7A 3CJIA 1DZRA 1BK1A 1ND3A 2B8MA 3VZKA 3UK9A 5ABJB 1QXPA 2ZPXA 1RUC1 1GZ9A 4M3CF 2P3JA 2WS93 3ACLA 4OUMA 4TLFA 4ATFA 4CDWB 1YFYA 1CONA 2WNVA 4JAAA 1QJX2 4EN6B 1DQ4A 1RUJ3 1H0BA 3VZOA 4U2AA 3ROUA 3ASIA 2BVVA 2PLV2 2H6BA 3MLKA 4JRAA 5FFOC 4BE3A 3R4SA 5FQ0B 3VZMA 3WG3A 3J8F3 1S0IA 2RS13 1U5YA 1UIKA 2HWB2 3J4UH 5FLJA 4KQ7A 3B01A 1S0JA 5CG8A 4FVVA 4AE2A 3LSEA 4Z82A 3WUDA 2DTWA 1LEMA 2PFWA 1S0FA 2XB6C 2XJUA 4K40A 1O3TA 1UL9A 4XJAA 4CDXB 3UJOA 1N47A 1YJLA 3UKTA 1CAXA 3R4DB 2ZKLA 1WBLA 2EXKA 4CEWC 1RHI2 1SACA 3D0SA 4ONUA 2VH9A 1O4TA 3I59A 4N43A 1ZZBA 4IESA 5T5LA 4RQPC 3ZYIB 4FTBA 1LU2A 1C8M2 1NE6A 4LULA 2WZR2 4Q4Y1 1OSGA 4CEYA 1YNAA 2DURA 4YZ5A 3CL1A 3V0AB 1W6MA 4ZXKA 2WFF3 1HRI3 3GZUC 4MGKE 4J1WA 3ZXGA 4QXKA 1D4M1 2IXHA 1XE8A 1MS8A 4HBNA 5CFCC 3WP6A 3KS7A 2BNMA 4JDNA 4YZ4A 2X8KA 5K8SA 2P3KA 2R042 4M01A 1GFF2 4XETA 1POV3 1ENSA 5FPZA 4BM8A 4YRDA 1D4M3 5I0SA 1W6PB 1KFXL 4FPYA 4CDQC 3UKNA 2GC0A 2XG3A 4YVWA 4Z92B 1H4HA 1HRV1 3ZYPA 3VBUA 1FI2A 1MS5A 4JC1A 4FTSA 1QJX1 1N1SA 3GZTB 4YW3A 1G86A 1O4YA 5J98B 1G9AA 1FPN2 1H8VA 4HN0A 4PF5A 3FHIB 4LO6B 1LECA 1DU3D 1EPWA 2DFCA 3MF6A 2DU1A 3HBZA 3C2UA 5C8WA 1VBC2 1DYPA 3VUOA 4HT1T 2E63A 3E97A 1NA1B 1AYN2 1JHNA 4PIZA 1PGW2 1RMU1 2Y26A 4KU7A 2RS51 1PVC2 1RITA 2PLV3 1ZRFA 1ULFA 2P3IA 2EAAA 1CAWA 4LT5A 3OYWA 1AL22 1AZDA 3GBFA 2ZGSA 3ZX7A 3AP6A 1JUIA 2JG9A 4PDWC 3KCYA 3V65A 4YNIA 4QPGB 3K48A 1DQ1A 3N7JA 2HWE3 3ZXJA 5AVPA 2W52A 2Y38A 5BNOB 1RJ8A 2OUJA 3QBQA 1ZBE3 4QU2A 3TOJA 2RS12 1SCRA 4UW6A 2GMMA 5GZCA 4JGYA 2YYOA 1VBE3 2HWE1 2X29A 1Q43A 2D3PA 2NN8A 3ZMNA 4G9SB 1PMIA 2ZX0A 3DN7A 2BUKA 2D43A 4Q4V1 5FO8B 1XNCA 4D69A 2V5YA 4L8QA 3I54A 1ASJ3 2VNGA 2NPIA 3INAA 3RJ2X 1AX0A 1VBE2 2RM22 3VHPA 2JDZA 4CDWA 3GF6A 1QHDA 3ZXKA 5C8CB 5CFDC 1PM7A 1RVF3 3WD5A 4XF3A 4YM1A 1JYIA 3IDCB 4AGGA 1AX1A 1SLTA 4P9WA 1QMJA 4FQ4A 1WLCA 1CN1A 2XJRA 5IUQA 2Z2SB 3VZNA 1QY4A 3APBA 1G9DA 2DVAA 3AP4A 2CV6A 4JGZC 3DPRB 3JB8A 1SFNA 4DFSA 3LSDA 1ZRRA 5I8YA 3GHMA 4P9XA 1Y43B 3NVCA 3GZAA 4B4PA 3V64A 2D5HA 3NV3A 1GSLA 1RUI2 3D82A 1SLBA 2CWSA 2XUMA 2EALA 3ZN5A 3VBSC 2IXJA 1AYM1 4Q27A 4FXGB 1WLWA 1X8EA 2G9GA 3S0MA 3JU9A 2EIGA 4FP2A 5FDBA 3N35A 1MACA 1FT9A 1QJU3 2Z79A 4NHKA 1FMD1 1PO11 2WNUA 4LBLA 2LTNA 4XPVA 1PZ7A 3UJQA 5KXEA 4OHVA 5KWRA 4CDXA 4D94A 5L7OA 1RUE3 2JG9B 3AYEA 4NOTA 2C0ZA 2Q8OA 1NZCA 4AYUA 3VBUB 5BNNB 2ZHNA 4PBPA 3ZYRA 1REFA 2HWC2 1JOJA 3D4KA 4XBQA 5A3MA 1O91A 2JD4A 4FOQA 3ATGA 2ZBJA 4COZA 1RUG2 3AJYA 1AR62 3VBFA 5JAXA 4Y1UA 2OUHA 2EXJA 1UIJA 2A70A 4AQ2A 1EV12 1X36A 4GMP0 3ZFGB 1HQLA 1FAYA 1YXWA 4MSVA 1ULEA 1C8NA 1BMV1 2PN5A 3ST7A 1UD1A 3UV9A 3ME2A 2ZAAA 5C9AC 3FE5A 2QE3A 3TNQA 5JOWA 2IXKA 5T5PA 1ULDA 3SHRA 1VJ2A 4XBLA 3TN93 1C8M3 1BBT3 1IS5A 2VMHA 3KQRA 2ZGQA 4AVAA 4FPCA 1NCQB 3AP7A 1KDKA 4YW5A 3A0KA 1AXYA 4XFIA 3MI8A 2JE9A 4Q0PA 4BA6A 3JBG2 1PGSA 4FAHA 1RUJ2 3M3OA 3GNEA 2MEV2 2HWF3 2HEWF 3O12A 4Y5Z0 1S1AA 4NO4A 4XFHA 3WW4A 4N9IA 2WA4A 5GZEA 3AZVA 1AR73 1CAWB 4E2SA 2BYVE 3O7OA 1MZEA 2WZR3 1UW8A 1PO21 4JCKA 1AR63 1F5JA 1NXD1 5HI0A 1WW5A 2ZGKA 1QJY2 4X6RB 1A6CA 4UW4A 4XIOA 3R6SA 1VBD2 4JTOA 1HW5A 1WD4A 2BFUS 5EXOA 1TME1 1AXKA 4JDOA 2VQ0A 2IFRA 4P9IA 3MFAA 4Y24A 2HWD2 3ZDSA 1XU2A 1IKQA 2XGXA 2C5DA 4S2HA 4Q4X2 4BMEA 3KT7A 3ZYGA 4LTAA 4Y20B 1Y3TA 2XJSA 4YGBA 1H1AA 3M3IA 1COV1 1POV0 4KG8A 1UAIA 2GC3A 3ZYJB 1U12A 1ZBA2 4AGRA 3AKPA 5FCCA 2ARXA 1VAMA 1AJKA 4NPRA 5HCFA 3U10A 3WR0A 3OY8B 1HRV3 4AFAA 3ZSKA 3BOWA 1KRIA 2TUNA 4AK3A 3EO6A 1FX5A 5C8CA 1LOGA 3QD6A 4J1XA 1LENA 3FFZA 4FPOB 4LHLA 1NY71 1MQTA 3OD0A 3AJZA 4CDUA 5T52A 1KD7A 2CGOA 3EJKA 1RUG3 1YFUA 3IWZA 4B8EA 3VV1A 2ZAHA 5CAZA 2FHRA 4QHBA 5KC6A 4QQOA 3HQXA 1OPMA 5TSWA 3AKTA 1OFNA 1OOPB 1LESA 2D3RA 1F9KA 1PGL1 4XFAA 4XQWA 4M00A 4LR4A 2XVKA 4AHZA 2XL7A 5CA6A 4XJZA 3HR9A 5DDJ1 1RUC2 3RI8A 1MVQA 3OGJA 1XQNA 4HN1A 4N7IA 1SLAA 2F6BA 3NL1A 4AVSA 1Q8QA 2OIIA 4BIOA 1GYKA 4SLIA 3USUA 3HN1A 5CFCA 2B42B 2PHRA 3LOBA 3O14A 2V09A 1T6GC 4GB31 3ZXDA 2BNOA 4YFWA 4BHPA 4Q4V2 3LA2A 4FPEA 3TNPB 2GH8A 2WWSA 4Q0SA 4XIKA 5JR7B 4WBBA 1UPIA 2NP0A 5GKAC 2VW0A 4TYSA 2HWC1 1MVEA 4AQ6A 3WDXA 4EN9B 1L3JA 3IT8A 1GNHA 1BCXA 2ZHKA 3OF1A 1TEIA 4TSVA 3JD71 4QPGC 2X53S 4BMBA 3M2MA 1W6PA 3H3ZA 4XF1A 5JPMB 3ILFA 1RB8G 3V0BB 2X5IA 5BNOA 1DZQA 1Z78A 2D6LX 4HFSA 4BOWA 4ZKTB 4I3PA 2EAKA 4Q1RA 4AHXA 1GV9A 1AYM3 4FBFA 2DUPA 1LKNA 1KDMA 2YUEA 1UMZA 1FMD3 1SDWA 2TBVA 5KHHA 4LUKA 3B7MA 3WUCA 1ASJ1 4K21A 2Z69A 4L2NA 1A8MA 1OQEA 4AFCA 4GA9A 1S0BA 3OTFA 5C33A 1SBEA 1DHKB 3W9AA 5CFDB 4AHYA 2AZ5A 3KZ4C 4OFGA 4PLOA 5H9SA 4Q29A 1YJKA 2RJKA 1KQRA 3T1LA 1TNFA 5I0UA 3U0ZA 1PGL2 4TZDA 3PVBB 1ENQA 4DINB 5ABJC 3H1WA 5DUVA 1LTEA 1KS4A 4D3WA 5IT6A 3VKFC 1CAVA 3O0VA 3MW4A 3WP4A 1QDOA 5FBZA 1V6MA 4OHZA 1O5LA 2I74A 2HWC3 3AM2A 2B5HA 3VLBB 2CY6A 3VN4A 2BWAA 2JXAA 2Y0IA 1XYPA 4DB5A 1Q5OA 1OPOA 3OGGA 2VOWA 3WDTA 5J36A 5JVVA 2IXLA 3VKLA 3BPZA 5K0UA 2R062 1I5ZA 1TMF1 4XBNA 4XJ8A 2FZ1A 2I45A 4IV1A 3NKGA 3FBYA 4EV0A 3KGZA 2QDRA 5IK4A 3B3QE 3ZN4A 1V6IA 3B5LB 3M1HA 2ENRA 5A3LA 1OQ1A 5FTTC 1RVF1 2WNUC 1HRI2 1A8DA 2WSUA 3U11A 3KCCA 4Y22A 4AFMA 4KBBA 3ILRA 1YLLA 5D8AC 1UPSA 4QGLA 3NV2A 2UWAA 3LAGA 4MYEA 3ZPYA 4LBOA 2A6ZA 1QJY3 1PZ9A 4DOUA 1Q8OA 4R9DA 3SH3A 2R30A 2HWB1 3ECQA 4DZGA 1QQP3 1B35C 3RYPA 2ZZJA 3V0AA 1EAH3 2P17A 2GNBA 4FT8A 4L92A 1YFXA 5KHKA 2XLAA 1VBA2 2A3WA 3H3UA 4O9GA 3E6CC 3KCXA 1PVC1 1URXA 3FBMA 3ZIXA 2O8QA 3LA3A 4D7SA 2UY9A 5CADA 4Q4Y3 2PTMA 1AL21 3TBDA 1EY2A 4LO7A 3ZN6B 2VVEA 5C9AA 2WQZC 3MPBA 1J1LA 1G6NA 1R082 5EJ3A 1K5MB 3OY8A 2Q5TA 2GMPA 1R081 3ZIWA 1XNKA 4XXAA 4WM7A 2O1QA 3A4UA 3MZHA 4ES8A 1BMV2 4BLJA 1PIV1 2NZ9A 1IKPA 2EA7A 3U07A 3AP5A 1KS5A 1O5UA 4ASLA 1HDKA 3ES1A 2ZGMA 2RS33 2NM1A 1X33A 1NA1C 2K9ZA 2ES3A 3L2HA 1F8VA 2FQPA 1WGPA 1Y9QA 2WT2A 3R05A 4HK8A 4WV8A 2PAKA 4HMZA 4U36A 4XOGA 2IC1A 4GKXA 4D7YA 2RS52 4B3NA 4Y1ZA 2JJ6A 4FXKB 3AX4A 2CYFA 3C3VA 4FPGA 4E2GA 2VOVA 1J1TA 1AR72 1YFWA 2A3YA 1ND2A 2ZGTA 4JV4A 1VBB2 1ND3B 5EYYA 4YG0A 3RYKA 3CEWA 2WT1A 3AYCA 3SXWA 3WW2A 4N53B 4Q8LA 1CVNA 1UU6A 5GLZA 5I0RA 4XF4A 2KA3A 4OZXA 4YZ2A 4XF0A 2ETEA 3OJBA 2YGLA 4AF9A 2R0FA 1RTVA 4C0BA 2A6XA 4IEUA 1GZWA 2R0HA 1A78A 2DCJA 4YZ3A 2GN3A 2YV8A 1DYKA 3LWCA 1DFQA 3ALQA 1C3HA 1H8TC 2MPFA 3VL9A 2YY1A 1FNZA 3FC0A 4LEJA 4CZSA 4DQAA 1QQP2 3ZSMA 2EVXA 3NWKA 1LULA 2GZWA 3THTA 1BJQA 1S2BA 3EHKA 3RPQA 2PHUA 3ILNA 4L97A 4CDWC 1R1A3 1BEV3 1R1ZA 1HX6A 1PO23 1HKDA 2AENA 4YW4A 2DCZA 1C28A 1LOBA 1YCIA 2GC1A 2BGCA 4B4RA 3TYJA 3LCPA 2RMU1 4PLNA 2BW8A 2KM2A 3OCPA 4L11A 1JXNA 3O0WA 1BEV2 1JYCA 4EWAA 1QJU2 1N1YA 1PK6B 5I8SA 3SMHA 1PNFA 5CU1A 5ACA3 4KU8A 1AR93 4W6XA 2FMYA 3H7JA 1EV11 3RWNA 1XRUA 2IXCA 4CP2A 2PAEA 1C5HA 3JD73 4QQPA 2PELA 1KJLA 1KFUL 2E51A 2R16A 2VMIA 3I8TA 3VBFB 4D7TA 5GZGA 1AHSA 1Q8PA 3DF0A 3HT2A 4IEWA 5FO7B 3WT3A 1HIXA 1VBE1 3PNAA 1U0AA 2MEV1 1FXZA 4E4SA 3RZZA 5JOZA 3AXEA 3NV4A 4WM8C 1LOCA 1M4WA 1OD5A 3B9CA 2R043 2D5FA 4WM7B 2ET7A 1ND2B 4WVMA 1REEA 4GB33 4YVWC 1Z7S1 4E9KA 5L7OB 4IEPA 4AEDA 5C4WA 3HWJA 1K5MA 3ZFFC 4AEKA 3AMQA 2VU9A 2DUOA 3IKWA 3I2DA 4XHBA 3PVNA 2GNMA 4QPIC 5DDJ3 3SITA 1H8TA 3PVEA 5FOJB 1AYM2 2XVGA 4GIQA 3PMSA 4LE4A 4Y26A 4CDUC 4FOWA 2VNRA 4XMAA 1WBFA 4AFDA 4N43B 5EYXA 4COVA 5DDJ2 4DRVA 2IXIA 5DUXA 2EXHA 1AR83 1V00A 5I8TA 3AMNA 3LZZA 1DDLA 4NWVA 2DCKA 1R093 1UCXA 4AQSA 3IPVB 3B94A 2JX9A 1FV3A 2CGPA 3DPRA 2WC2A 4BZ4A 1I3HA 2E7TA 3IDEA 3WY6A 4NWWA 3WDVA 4LLOA 2W39A 1PO12 2XLGA 3AMHA 1SMVA 4LBJA 4Q4X1 4PIXA 1V6JA 1J3RA 4IEXA 3MW2A 4I09A 2BWCA 1RUD3 2CNAA 2XKPA 1AR71 3N7LA 3R0RA 4RSUA 1XYOA 4PJYA 4XJUA 4JQRA 5DUWA 2OW4A 4FOVA 4ISRA 1C5IA 1WA4A 3IDBB 3PMEA 1SBDA 1RMU3 4MX3A 1AF9A 1CAUA 1OQDA 5AC91 2XKOA 4QPYA 5IK7A 1O3RA 4AEJA 1CJPA 5BPXA