4ASNA

Tubr from bacillus megaterium pbm400
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
SDYFEEVMRKLTIEDVSILGWLFQNEANAVFKAIKKSSIADELEYSTANFRKTLNKLEAIHFIGTVTGGKEHKLYLTEYGQQAVQQAIHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUBR
publication title Superstructure of the Centromeric Complex of Tubzrc Plasmid Partitioning Systems.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transcription
total genus 31
structure length 90
sequence length 90
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4asnA00
4NHJA 3WU0A 1I6XA 2CGPA 3K2ZA 4RS8A 5KVRA 1OYIA 3ZMUA 4GYGA 1RUNA 1IUYA 4IVNA 4ZZDA 1B9MA 5LGNA 4P5OA 2YX4A 5CJ9A 4L9JA 4JQFA 4RGXA 1K7AA 1B9NA 1GVJA 3T8TA 4MEXF 5IT9Z 3E3VA 1R1UA 1KYZA 2ZXJA 1ZG3A 4HLXA 3N97A 5BOXA 3TDZC 1ZREA 4P9UA 4CHUA 1QZYA 1FYMA 2EA2A 1S7OA 4EV0A 2Z3YA 2O61A 1WWXA 5E17F 5E1XA 2FA5A 3WG9A 3J80Z 4MHGA 4KN7X 3D5LA 5D6FA 1FP1D 4ETSA 2MH2A 4BXUA 1MJBA 2L4MA 4L9VA 3F6VA 4GGGA 4EM1A 1YFHA 1RUOA 5F6FA 2ESHA 5ICFA 2KIFA 2LF8A 2OZ6A 5FFXA 3U9GA 1BM9A 1R22A 3HYIA 4GYIA 2O8XA 4KUMA 2LF7A 1L3LA 3BDDA 4A6DA 4ESBA 2GA1A 4L18B 1EH7A 2V1UA 4BH9A 2DU9A 2FBHA 5FD5A 4KIFA 3WGHA 1BC8C 4HQEA 4I0BA 1Q1HA 3E6BA 5JFRA 3EYYA 2FU4A 3R0JA 3E6MA 5DCMA 2P5VA 4WXHA 1SFUA 2L3DA 3KZYA 1R1VA 4UVAA 1HW1A 3HRTA 4AIKA 3KZZA 2G9WA 2LNBA 4UVBA 4EMSA 4G7ZF 2EWNA 4ENMA 2A61A 3BJ6A 3E5XA 2V79A 1LVAA 3GLXA 5TJJA 1YTYA 3M8EA 2CYYA 3JW4A 3E6CC 1I27A 4L0ZB 4F7ZA 3ISPA 4L5IA 4D0PA 1J75A 2QYOA 3KE2A 4KT5C 4KIBA 2ZMEB 1IZ1A 1KQ0A 4UNOA 1E17A 5AONA 1UCRA 4KMFA 4UV8A 4FHTA 1FYKA 1XGSA 2FEZA 4OOIA 3O6BB 4I0AA 4M6XA 2W25A 1HSTA 1ULYA 3HUGA 2YSRA 3LA3A 1Z6RA 2FBKA 3SFZA 4MQ9F 4HX8A 3M9AA 1WI9A 3BPVA 1FC3A 2EV0A 1O3TA 3DQVC 4AD9A 1DDNA 2IT0A 2ZNYA 2JTVA 4G6QA 5D5VB 3ZPLA 5CLSA 2GQQA 3RIRA 3F8BA 3HRMA 3KCCA 3OV8A 1IN5A 2PEXA 1JE8A 4HOBA 4GO1A 2MLGA 2RKHA 2HGCA 2Z33A 3DPTA 3C3WA 1G6NA 2EV5A 3RYPA 3GZ6A 2VN2A 2MH9A 1UFMA 1F4KA 1R1TA 2HKXA 1HKQA 2XKPA 1DUXC 3V7CA 2KJBA 1XGNA 3GYHX 2KIUA 2FF4A 2H94A 4R1HA 3LQQA 5CVUA 2JPCA 4RAZA 1OYWA 1O57A 5HDKA 3H92A 4LB5A 3JTGA 2XROA 3VB2A 3CUOA 1TBXA 4ZZLA 1RNLA 4WX9A 2LDUA 3F23A 3WTSC 2XGXA 5HDNA 3R61A 1K79A 4Z2YA 1O3QA 2W57A 2P5LC 1O3RA 4LD5A 1O7LA 1V3FA 4HYEA 4G7HF 2RV8A 1PDNC 1MZBA 1QZZA 1T39A 1YG2A 5J8CA 3ERED 1S8NA 3IRQA 2A69F 2E7XA 4FX0A 1LDJA 1FP2A 2UXXA 2KIMA 1MJ9A 1YQAA 4AIHA 3F8MA 3HTUA 4KYWA 3B02A 3F8CA 3IHUA 1UB9A 2IVMA 2HTJA 3MZYA 3W6KB 3EYIA 1UHWA 3HSFA 2MC3A 1K78A 1BI3A 2H6BA 3RPUA 4IRIA 2VT3A 2GWRA 5K5RA 2D1HA 2HR3A 3DXJF 4LLGF 1T38A 3E97A 1BBYA 4CICA 2AS5F 1ZGAA 1B4AA 4CGZA 3F21A 2HDCA 2QBYA 4L9NA 5DD4A 3EETA 4EVIA 1FNNA 1BIBA 1CF7A 4PZJA 3ZMZA 1F5TA 4LJZF 1FT9A 4ESFA 4HDUA 3EDPA 1HKSA 3HOTA 2O6GE 2F5DA 3WTUC 2HKOA 5HLHA 1YO5C 3L00A 4YFNF 2VT2A 3K0LA 3ECHA 1YYVA 5FLXK 4HW0A 4N9HA 1SD6A 5CYVA 3J81K 3I5UA 3ZMTA 1ZLJA 2ZO4A 2DPDA 4WXDA 3S2WA 5CVIA 2QQAA 4MGRA 4CO8A 3QU3A 1X3UA 3KP5A 3E6DA 3QPHA 2WV0A 5H6QA 4WF2A 3K1PA 2QENA 4K2EA 2RC4A 2KJCA 4RGUA 4ZYHA 1Z05A 1C0WA 3P9KA 2PQ8A 4RGSA 1BJAA 2R7FA 4MTEA 3T8RA 1KQ9A 4KN4X 1W7PB 4Y17A 1ZRFA 1FYLA 1TNSA 1BN5A 2IJLA 4NB5A 2Y75A 4XSXF 3G73A 1OYYA 4U88A 5A2QZ 3FXUA 3B73A 4KNYA 2MLKA 3W6JB 2DK5A 2QUFA 3TQNA 5CVJA 4EM2A 1IRGA 1FWZA 5DUKA 1FBSA 3LA7A 4O5VA 3HIFA 2DTRA 2EFOA 5E8IA 1SD5A 1BI1A 4YG2F 2H09A 2DBBA 1TQIA 2NRAC 3TO6A 2RNJA 2CW0F 3CDHA 2VC1A 4ZYEA 2Q2EA 4WWCA 4B09A 2XKOA 2Y0MA 4CXFA 5L3BA 2OQRA 4U0WA 1ZHFA 2OZUA 4ZYDA 5JVTA 1TTYA 2O3FA 3FWEA 3REOA 4M73A 3FMSA 4O6JA 5HVQC 1G3YA 4WK8F 3FMRA 1T2KA 3GZ5A 2OQGA 3TO9A 2IP2A 4Q47A 2YR2A 1G3WA 4M72A 1W5TA 2MA3A 1ZG5A 1TQMA 5IT9K 3HHHA 2DPUA 3P9IA 3BJOA 2K27A 3I71A 1RZ4A 3GWZA 3BP8A 4KICA 1REPC 2FMYA 4RB0A 4B8XA 4WCGA 2P6SA 2X0LA 2NAZA 5DCMB 4HX4A 3GO5A 2EA4A 2BE5F 1HSJA 2GXGA 2BGCA 1Z7UA 2EFNA 1HKTA 3ZMVA 3WE3A 5L3CA 2BEOA 3NQOA 2UWMA 3WODF 3GFMA 5K1YA 3SHFA 3MZHA 4G94A 4YFKF 3GX4X 3HTSB 3CUQA 4HBLA 1S29A 2XAQA 1LJ9A 4IXAA 3KEOA 1R00A 1TW3A 2Z5UA 2J5OA 1H9GA 2VXZA 1LB2A 1D8JA 1T0FA 4CDGA 1KA8A 3WE2A 1DPUA 1XCBA 3KP4A 5L3FA 1G4DA 1QNTA 5E8GA 3PFIA 5AIPA 1FBUA 2ETHA 3H3ZA 4LMYA 4HF0A 3I54A 1IXCA 2J5PA 4Q5SF 2VE8A 4R79A 4E70A 4IHTA 4OMYA 4HA8A 2L02A 3MCZA 5DCFA 2DT5A 2BV6A 3FXRA 3DKWA 1Z6TA 1FLIA 4BHPA 2HEOA 3IRRA 3O3KA 1P6RA 4U0VA 1FPQA 5HS7A 2HQRA 3O2PE 2PI0A 1R5GA 5LEJA 1FX7A 2P6TA 3RTRA 4JK1X 4M9XA 1OMIA 5KK1A 4FX4A 1R36A 5F1RA 1XDUA 3GFJA 1TNTA 1DP7P 3MWMA 2HWVA 2IA0A 4EJOA 3V8KA 2EFPA 1T6SA 3JSPA 1OR7A 5DYMA 1LDDA 3GEZA 1FY7A 4N0BA 1MDMA 5LBQA 2L54A 1ZG1A 1TQPA 3CUQC 1WRJA 2JPBA 1JHHA 3D0SA 2L01A 3I58A 1B1BA 4EQQA 1HQCA 2VC0A 5FGMA 2E1NA 3V8LA 3JSOA 2RQPA 5H20A 1BI2A 4A0ZA 3OOPA 4LLNA 2C6YA 3RDIA 3V7SA 4BQAA 2A6EF 1BIAA 5DEQA 2IPQX 1U3EM 1YW9A 2XVCA 4IPAA 1MKMA 2DW4A 5D5WB 3FZVA 5DDGA 4I7HA 1U6GA 2VBXA 3HOSA 2K4BA 4LG0A 1U2WA 2M30A 3QP6A 1USSA 3ELKA 5LGTA 2FOKA 3KETA 2NYXA 3QP5A 4DQ2A 4TV7A 2K02A 1J9IA 3WTTC 4BNCA 2LSOA 2MBFA 5AIQA 5HLIA 3JAMZ 3I59A 1H9TA 2OBPA 2G7HA 2FBIA 3EQLF 3CTAA 1IAWA 1K78B 4EGYA 2DO7A 5CVRA 1ZN2A 3VEPA 5DV5A 4EJWA 2HOEA 2ZCWA 3EUHA 5D5XB 2DAOA 4LFUA 1ZGJA 4ZYGA 5H6RA 2OD5A 3AAFA 3BJAA 2A3SA 4A5NA 1QO0D 1O7FA 1OKRA 5FFZA 2FXAA 1SD4A 2K4JA 5E18F 1HW2A 1EH8A 2R3SA 4Y15A 1RI7A 2QBYB 1U78A 3K1NA 1PUEE 3V7RA 3GFLA 1CF7B 1BOAA 2HTSA 2PJPA 1KU2A 3HRSA 3LSTA 4I09A 2QLZA 2FE3A 1R5HA 4HV6A 1F1ZA 1FOKA 2EFQA 2IRFG 1QGPA 2HQNA 2DQRA 4S04A 2VBZA 4DNCA 3KLNA 3CLOA 5LHIA 2L4AA 1STZA 5JHUA 3I0TA 4OIQF 5F64A 3Q5FA 5D8LB 3C7JA 2Q0OA 4GXOA 1TLHB 2E1CA 2FSWA 4KDPA 5D4SA 1I5ZA 4HDVA 2CWEA 3F72A 4KA4A 3F3XA 2JSCA 3M1EA 1GHCA 4RAYA 2P4WA 2OAZA 2G7UA 3QOPA 2NS0A 2D45A 2ELHA 3R0AA 5LHHA 4QLCU 4R8HA 3RPQA 2KKOA 2IA1A 4M9ZA 4A5MA 2JZYA 5LLQA 3I53A 3QAHA 1MGTA 2ZFWA 3WTZA 4I98B 3C1DA 3F22A 3BWGA 2QM3A 4IRHA 5ICEA 2QVOA 2HYGD 3TOBA 2V1XA 5DD8A 3WTXC 4IRGA 2WC2A 1S6LA 5ILVA 2PMUA 1YLFA 3J81Z 2K86A 5FB2A 2A68F 4ASNA 5EEHA 4ESJA 3MEXA 5E1WA 2EJRA 4HLYA 2DLLA 4UHTA 5HLGA 4A6EA 4PGGA 3R6SA 2XHKA 4PDKA 3GVAA 3T1BA 4I02A 1U8RA 1E2XA 4BHCA 2ACJA 3HSRA 5E1ZB 2O03A 1K6OA 3L7WA 3GFIA 2JT1A 1YS7A 2KRFA 4HX7A 2VOOA 1TW2A 1OPCA 2GZWA 3ABUA 2FMLA 4M74A 1LNWA 1B59A 1SFEA 3NEUA 4HZFA 2P5KA 2VBWA 3COAC 2Y48A 1S3JA 3MAJA 1MD0A 2GAUA 2W84A 1ZLKA 2V1DA 3LQRA 2IW5A 1QQIA 2MD5A 4UVCA 5D4RA 5ED4A 3JTHA 3PQJA 4A12A 1HBXG 1AWCA 2DFIA 1J59A 1KYWA 1G3TA 5BPIA 3N4MA 3V8JA 5ILSA 1Z91A 3I4PA 2Q8KA 6PAXA 1W5SA 1JXSA 4G8XA 1P4WA 4LK1F 1I1GA 3L9FA 1KU7A 2HYFA 3KP7A 3CO6C 1XSDA 4MQVA 1WQ2A 5ERIA 4YFXF 3RKYA 2YX7A 5HOOA 3GW2A 2FNAA 1LEAA 4BAYA 2CSOA 2QWWA 3DFGA 3LAPA 3KP2A 2P7VB 1MJAA 2ADUA 3ECOA 3GUDA 1KQ8A 1XGMA 1Y0UA 2HZTA 3Q9VA 1J0RA 3CUQB 3P7NA 3WGGA 1U5TA 3R4KA 3DF8A 4ZH4F 2XASA 2XAFA 3MQ0A 2DI3A 1B6AA 3L09A 5D5UB 3QRFF 5BQTA 2F5EA 1IN6A 3RYRA 5FO5A 2XRNA 1ZYRF 5L3GA 5HDGA 3J80K 2FRHA 4Q4ZF 3FM5A 3F8NA 1YW8A 1F9NA 2EB7A 4AWXB 3J7AO 2K7LA 1PP7U 4XLNF 2V6CA 1ZAOA 2P8TA 3SXYA 3BZ6A 2NNNA 1BC7C 3WTYC 1SD7A 2RGVA 3SZTA 1ZH5A 1IXSB 4UUVA 4IF4A 1W4MA 4MEYF 2F5FA 2EFWA 1YS6A 3HHGA 3IKTA 4MNUA 2M1BA 1IF1A 2FQ3A 5TRDA 3RJPA 5ILUA 3U1DA 3DEUA 3IL2A 1XB4A 1UHMA 1QPMA 1L0OC 3LAJA 1FZPB 4IHSA 4RB2C 5E20A 4L9TA 1ZARA 4OU0A 3WU1B 3PQKA 2AXLA 1IW7F 2PFBA 4OINF 2M8EA 4HV5A 2F5CA 2YU3A 1XDSA 2GIVA 1XMKA 1D5VA 4U7BA 3RKXA 3BOQA 4QWQA 3C18A 1EV7A 2WWYA 1MDMB 5JI6A 1R7JA 3MFKA 2VBYA 4N9IA 3KP3A 1IN7A 2QZ8A 1U5TC 1RIOH 3BPXA 4KMUX 5CVVA 1I1SA 2XV4S 3ABTA 4CYDA 4A0YA 3GXOA 4U7DA 2XUBA 4Y13A 1ON1A 4O3MA 1SAXA 1XCVA 2PLYA 4ENKA 5ICCA 2E7WA 2A07F 4PGHA 1XGOA 4OIRF 1LQ1A 2ZBKA 3NRVA 3T0YA 1IN4A 2JRTA 3TO7A 4S05A 2ZNZA 1YW7A 3WGIA 3KEQA 4RB1A 2QQBA 2PN6A 2M5WA 4EGZA 4ENJA 1ZRDA 5K5QA 1GXPA 4LG0B 1D8KA 4OMZA 3BROA 5J8FA 1KU3A 3P9CA 4RGRA 1IN8A 3TGNA 4JBAA 4UV9A 1BI0A 3Q9SA 4H0EA 1HW5A 2R7DA 3F8FA 5HS8A 2GXBA 2ZMEA 2Z99A 2D2WA 4LK0F 1KGSA 1USTA 3I59B 4HF2A 4I01A 3KFWX 5BPDA 1CGPA 2PMHA 1G3SA 3ML6A 2A6HF 1WKMA 4LLLA 1J7KA 2CO5A 1XD7A 2HFHA 4L0YB 2VOPA 3L2CA 2DK8A 3ROUA 5L3DA 4HAMA 5JR3A 1AOYA 1J2XA 1LDKB 2WTEA 3VODA 2COMA 2P7CB 5D8KB 3FX3A 1R23A 4A0XA 2W85A 5BMZA 4EM0B 3ZMSA 1D3YA 4XSZF 1KU9A 3F6OA 3VFZA 3U2RA 2M45A 1V4RA 4RB3C 3TOAA 2EK5A 2TDXA 2GA2A 3IKVA 3FXQA 2STTA 2CQKA 5J6XA 2XAHA 3LA2A 4IJAA 3JAMK 2XAGA 1W7PD 2EV6A 2O0YA 3ZN0A 2UXNA 5LRSA 4YIFA 3V4GA 5EEGA 1J5YA 1XSVA 2VONA 4P55A 4A2UA 2RDPA 3K69A 2STWA 4HF1A 3ULQB 2BYVE 3G3ZA 3KLOA 1JHFA 4KIGA 4LGWA 3ZP5A 4M71A 4G7OF 2ISZA 3VOEA 3M7GA 1FSEA 3ZMDA 2D1VA 2W24A 3CO7C 1SMTA 1JGSA 4UXNA 1VTNC 3FM3A 3HSEA 4XLPF 2XAJA 2FNPA 4HQMA 4NQWA 1ON2A 4OIPF 4M6YA 4L5JA 4ENNA 3ZQ7A 5FD6A 2UZKA 4WXCA 1ODDA 3E5UA 2VE9A 2ZKZA 1P4XA 2IA2A 2XIGA 3TKYA 2ISYA 3DV8A 4P9FA 3SQNA 2NNYA 3DPLC 2H6CA 2F2EA 1WSUA 4BHBA 5IT3A 2YPRA 2LKPA 1IXRC 3KP6A 3LWFA 1A04A 3TDUC 4ON0A 4GCVA 1XN7A 1H0MA 1S7AA 3IC7A 3M8FA 2VODA 1R58A 4XRFA 4EJUA 5FLXZ 3BY6A 3K9TA 1SFXA 3FHZA 4YIIA 2Z9OA 2V9VA 1P2FA 3WTVC 3H3UA 1Z1DA 2OA4A 1QBJA 2CG4A 4U0YA 1O3SA 5LGUA 1SMYF 1XSXA 4G6DA 2BBYA 4KFCA 3I64A 4FT8A 5LRRA 5LEKA 3IWFA 4AIJA 1XMAA 2HS5A 4OIOF 2ZJ2A 4CZZA 3DP7A 4BYYA 1T98A 2PG4A 1HXDA 5K5OA 3CJNA 1ONVA 4G9YA 3QU6A 2ESNA 2QQ9A 4XBFA 5ICGA 4I2OA 4EJTA 3T5XA 2A5YB 5D6EA 2M87A 1GXQA 2X4HA 5A2QK 5BS6A 1IRFA 3RKWA 4MTDA 1Z9CA 1FBQA 1ZRCA 1NHAA 3R60A 1FSHA 2RN7A 5HS9A 4P96A 3RI4A 4Q48A 3SZPA 3QPTA 2PBIA 2DQLA 3IWZA 5LHGA 1U5TB 3GF2A 3E5QA 3ZN1A 3WTWC 4M9SA 3FF5A 1DPRA 3HRUA 2CFXA 2OU2A 5L3EA 1YIOA 4PCQA 1EH6A 1PP8F 4LB6B 1P4AA 2B0LA 4AVPA 1W7PA 1P92A 4EJVA 5DUIA 1LEBA 3FMQA 3LFKA 3K1MA 2RVCA 2H27A
chains in the Genus database with same CATH superfamily
4B3AA 3ASNH 4NHJA 3WU0A 1ZELA 1I6XA 1WZ2A 4DGWB 1QVTA 2CGPA 3K2ZA 4RS8A 3A01B 5KVRA 2JK3A 2JRMA 1ETVA 1OYIA 3SEQA 1RR8C 1OISA 3ZMUA 4GYGA 2LRDA 1RUNA 1IUYA 4IVNA 3S1NJ 4A3GJ 4ZZDA 1B9MA 4XKWA 3EPZA 5LGNA 2R5YA 4P5OA 1K61A 2YX4A 1YX3A 5CJ9A 3FBIB 3BR6A 2E71A 4JQFA 4L9JA 4F93B 4RGXA 1K7AA 2QSFX 1B9NA 1SFOJ 4NC6A 1GVJA 2L7FP 3T8TA 4MEXF 3OS1A 1IRXA 4AYBA 1UZCA 5IT9Z 3E3VA 1R1UA 4RA2A 1KYZA 2ZXJA 2EH3A 1ZG3A 3MKLA 5EZGA 4HLXA 2BVLA 4JX5A 2BY2A 4X0GA 4M3BA 2E19A 3N97A 5BOXA 1U9NA 2XF5A 5M5WJ 3TDZC 1ZREA 3TW6A 4P9UA 3JRGA 4CHUA 4CCMA 2KZGA 1QZYA 1FYMA 2EA2A 1S7OA 4EV0A 3SJMA 2Z3YA 1ZR4A 2O61A 3BTCA 4IX7A 4IZZA 1WWXA 4C2TA 5E17F 5E1XA 1PJRA 2FA5A 2KDOA 3WG9A 1VQOI 3J80Z 3N05A 2QCOA 2VXDA 4MHGA 3ZR8X 4KN7X 3D5LA 5D6FA 1FP1D 4ETSA 5B5EC 2MH2A 4BXUA 3MVPA 1MJBA 2A6TA 2ZSIB 3K10A 2L4MA 3M8JA 2B7EA 4L9VA 1RPWA 3CC7I 2K5CA 3GLLA 3KZIC 4Y52J 3IH3A 4HPQA 1WJ5A 3F6VA 4GGGA 4HEA2 4CYCB 1X1BA 1TWHJ 4EM1A 1YFHA 1TT0A 1RUOA 3AG4H 4UUSA 5F6FA 2ESHA 5ICFA 2KIFA 2DYRH 2LF8A 2OZ6A 4PFPA 5FFXA 4B43A 1BM9A 3U9GA 1R22A 3HYIA 1MNDA 1XTAA 2O8XA 4GYIA 2XAUA 3HGGA 2KQRA 1Y39A 4KUMA 1G2HA 1PUFA 2LF7A 3OYNA 1BJZA 3DBRB 1L3LA 3BDDA 3OIOA 4H4KC 4A6DA 4ESBA 2GA1A 1RC9A 4L18B 3AL0C 1EH7A 2V1UA 4BH9A 1TWGJ 2DU9A 2FBHA 3S3MA 5FD5A 4KIFA 1JKPC 3WGHA 2DMUA 1BC8C 4HQEA 4I0BA 3OYGA 1Q1HA 3C2GA 3E6BA 1JI8A 5JFRA 5K7FA 3EYYA 2FU4A 3RPUD 1UHSA 3R0JA 3A4CA 4PUSA 3E6MA 5KAIC 2K3PA 5DCMA 2P5VA 1UJ8A 2WY8Q 4II2A 3OWTA 3H9QA 4WXHA 2O9LA 1VZ0A 2BW3B 4XKVA 2WBMA 1SFUA 4JX6A 3ZGKA 2L3DA 4F91B 4F52A 3FIWA 1VFCA 3KZYA 1R1VA 5F0CA 1UG0A 2ZXIA 4IEJA 4UVAA 1HW1A 3HRTA 1TL8A 4RM2A 4AIKA 3KZZA 2G9WA 2LNBA 4UVBA 4EMSA 4G7ZF 2EWNA 4ENMA 1MNEA 1H88C 2QSGX 2A61A 3BJ6A 3E5XA 2V79A 1LVAA 3GLXA 5TJJA 3JR9A 3M8EA 1YTYA 2CYYA 3ASOH 1OCOH 3JW4A 3E6CC 1I27A 3MD2A 4BEHB 4L0ZB 3OYMA 3I55I 4F7ZA 2CH0A 3ISPA 4L5IA 4D0PA 1J75A 2MGQA 3DTIA 2QYOA 3U21A 3KE2A 4KT5C 4KIBA 1TWFJ 2DOAA 3KYDB 2ZMEB 5H2FC 2MFZA 1IZ1A 1KQ0A 4UNOA 4BXXJ 1E17A 5AONA 1UCRA 1FMVA 4YELA 4AM3A 5JLWA 4KMFA 4UV8A 3WU2C 2EZHA 3K70D 4FHTA 1JT0A 2UV1A 4OAYA 3QPLA 1QRYA 2EBIA 1FYKA 2DXIA 1XGSA 2FEZA 3MZ8A 4OOIA 3KEYA 3O6BB 4I0AA 1YOVB 4M6XA 2W25A 2Q1ZB 1HSTA 1ULYA 5J1UA 3HUGA 1FIAA 4IHVA 1EKEA 2YSRA 2IS6A 2DOFA 1Z6RA 3LA3A 2YUSA 3BTIA 2FBKA 3SFZA 3H36A 4MQ9F 1IDZA 2KPMA 4HX8A 3M9AA 2CJJA 4BE0A 1WI9A 3BPVA 1FC3A 4F55A 3FXLA 1VI0A 2EV0A 1O3TA 3DQVC 4AD9A 1DDNA 2IT0A 2ZNYA 2JTVA 5IYCJ 5BNGA 4G6QA 2CFOA 5D5VB 3ZPLA 5CLSA 2KT0A 2NVUB 3BQYA 2GQQA 3RIRA 3CJQB 3F8BA 4BACA 3HRMA 3KCCA 2LVSA 1GLNA 3OV8A 1IN5A 4HSTA 4Y7NJ 3W6VA 1GT0C 2PEXA 2DMPA 1H89C 1JE8A 2CQ7A 4CUGA 4HOBA 4GO1A 4C2MJ 2MLGA 2RKHA 2HDWA 1N77A 2HI3A 5GPCA 2HGCA 3KYLA 2Z33A 3DPTA 2DA1A 3C3WA 1G6NA 2EV5A 2ID6A 3Q0VA 2IXSA 1GDTA 1D1CA 2GM4A 5CQEA 3RYPA 3OIPA 2ELKA 5F0FA 3CCMI 2Y69H 3GZ6A 2HYJA 2VN2A 2MH9A 3ZQHA 1UFMA 1F4KA 3J7AY 2JUCA 1WJDA 3JRIA 1R1TA 2HKXA 3E1SA 1HKQA 3ZQIA 2XKPA 1DGWY 4AYBN 1DUXC 3V7CA 2KJBA 1XGNA 3GYHX 4XORA 2LREA 2GBYA 2KIUA 2FF4A 3EUAA 3ESWB 3S1MJ 2H94A 4R1HA 4HNVA 5IP9J 3LQQA 4XLFA 1HLVA 2VKDA 5KHDA 5CVUA 2GXAA 2JPCA 4RAZA 3CCQI 1MBFA 1OYWA 1O57A 3JRCA 3VSKA 2V9PA 5HDKA 3H92A 4LB5A 3JTGA 3K4CA 3VB2A 2XROA 5FRMA 1MNMC 1IG7A 2QKMB 3CUOA 1TBXA 4IQJA 2DT7B 4UB8C 3ZQLA 3ABLH 2NVXJ 2RQQA 3HDDA 5EG0A 4ZZLA 2XGCA 1U8BA 2UUZA 1RNLA 4WX9A 3ZQCA 2LDUA 3F23A 3WTSC 2XGXA 2ZJQF 4UB6C 2VUMJ 4NQWB 5HDNA 2CV1A 3R61A 3PUBA 1Z3YA 1K79A 3DWLE 4Z2YA 2K9NA 1O3QA 4JX4A 2W57A 2CW8A 2P5LC 1O3RA 2O8KA 3OYAA 5FKKA 1Y6IA 5FRNA 4LD5A 1O7LA 1V3FA 4HYEA 1DQUA 1WJAA 3OYCA 1ERDA 4G7HF 4LOCA 1NK2P 1MSEC 1FMWA 2I5UA 4PJLA 2RV8A 1PDNC 1JTYA 3WHBA 2I8DA 1MZBA 2K3FA 3DLAA 1POGA 1BW6A 1QZZA 1T39A 2E60A 1YG2A 2BXYA 3TBIA 5J8CA 5B66C 3ERED 1LE8A 3W2VA 3CCJI 3VYSB 1S8NA 3IRQA 2A69F 1R4NB 2E7XA 4FX0A 1LDJA 1FP2A 2LBFA 2UXXA 1E0EA 2KIMA 4J19A 1MJ9A 4CA0A 3GTMJ 2LTPA 1K6YA 1YQAA 4A3IJ 4AIHA 3H5NA 3F8MA 2LOOA 3H9JA 4L5EA 3HTUA 3LOCA 4KYWA 1OFCX 3B02A 2HOTA 3F8CA 3IHUA 1UB9A 3IP4B 1KONA 2F4OB 2IVMA 2HTJA 3FBNB 3PUFA 3MZYA 5FKNA 3W6KB 4DOZA 1MMSA 2R5ZB 3EYIA 1UHWA 3HSFA 2MC3A 1K78A 2FD5A 1BI3A 1ETWA 2H6BA 3RPUA 1JUSA 4IRIA 2VT3A 2GWRA 5K5RA 3J7YJ 1HA8A 3W2WA 3M3YJ 1VQMI 2D1HA 1Q1VA 2KL4A 1A36A 2HR3A 3ZQGA 3DXJF 3MKWB 5B1AH 3GTKJ 1V54H 4KJZA 4LLGF 1T38A 1BR4A 3E97A 1BBYA 2ME0A 4CICA 2V7FA 2LH9A 2AS5F 2VJ5A 1ZGAA 2FOWA 1B4AA 4CGZA 1Z3XA 3F21A 3S93A 1BR1A 5C4JJ 2HDCA 2QBYA 4L9NA 5DD4A 3EETA 3UR3C 4EVIA 2LR8A 1FNNA 1BIBA 1CF7A 2VL8A 4PZJA 1F36A 3ZMZA 2L0KA 3PFYA 4E7IA 4I99C 1F5TA 2DA4A 2X6OA 4LJZF 1FT9A 4ESFA 4HDUA 1TP4A 3EDPA 1SVLA 4CSWA 5HNHA 1HKSA 3VDXA 4ZTFA 4RLQA 3HOTA 2O6GE 2XC7A 4BQOA 2BOLA 2EZLA 3DTKA 3O8GA 2B9SA 4AUXA 2R7UA 2F5DA 1IRZA 3WTUC 2DYSH 2HKOA 2LY9A 2R7ZJ 1OCZH 5HLHA 1B72A 2WAFA 2VPRA 1YO5C 3L00A 4YFNF 3W3CA 2VT2A 1T8IA 3K0LA 1R6RA 3ECHA 1YYVA 5FLXK 4HW0A 1JTXA 4N9HA 1SD6A 2YS9A 5CYVA 3AG3H 1QZEA 3HC7A 5IPAA 3J81K 1VQ4I 3I5UA 4XLEA 3ZMTA 2V26A 3G2BA 1ZLJA 2ZO4A 4DIQA 5M3MJ 2X9DA 2DPDA 3F0CA 3H0GJ 3QPSA 4WXDA 2QQAA 5CVIA 3S2WA 3OR2C 4XMYA 4MGRA 4CO8A 2JMWA 3LSIA 1X3UA 2F5VA 2IEKA 2MABA 2MW8A 3KP5A 3QU3A 3HXLA 4V2FA 1M1EB 2LY1A 3UKGA 1VQPI 3E6DA 4XKCA 1XG1A 2L7KA 4MIMA 3QPHA 2WV0A 5H6QA 3AL0B 4WF2A 1S5LC 1X2MA 3K1PA 2IS2A 1IGNA 2JVGA 2QENA 4XRSG 4K2EA 2RC4A 2KJCA 4RGUA 4B44A 4ZYHA 1Z05A 1C0WA 1WJEA 3P9KA 2BHZA 2PQ8A 2F4IA 4RGSA 4YEJA 1BJAA 2R7FA 1JKRC 4MTEA 3T8RA 1KQ9A 2DODA 4KN4X 1W7PB 2ZSHB 4Y17A 1ZRFA 3Q0WA 2XSDC 1FYLA 1ZQ3P 4AC0A 3IH2A 2VI6A 1S9HA 5M5YJ 1TNSA 1BN5A 2ZC2A 2IJLA 1VNDA 4NB5A 3CJTB 2Y75A 4XSXF 3PM1A 1WHUA 1JGGA 1VQ8I 2OF7A 3G73A 4A3KJ 2O7OA 3OL4A 1OYYA 2DN0A 4U88A 5A2QZ 3PIOF 4E7KA 3Q0UA 4BY1J 1D1BA 1MBKA 5GADJ 3FXUA 3B73A 1HF0A 4KNYA 1R4MB 2E2HJ 4ZDPA 4XQFA 2MLKA 3W6JB 2DK5A 4PJJA 1ETQA 2E5ZA 2R5YB 2QUFA 3NWSA 3TQNA 4XL9A 5CVJA 4PJMA 3DTEA 4EM2A 5GAEJ 1IRGA 1Z21A 2F6CA 5CKTA 1FWZA 5DUKA 1FBSA 3LA7A 4O5VA 3HIFA 2DA5A 1P9QC 3KIOA 2DTRA 2EFOA 2W00A 3TEDA 1XMXA 1Z0XA 5E8IA 5DM6F 3IAM2 4I6ZA 3SYTA 1SD5A 1BI1A 4YG2F 1BOBA 3GTOJ 2H09A 4MO7A 2DBBA 2G0EA 3KYCB 1TQIA 4BJ5C 3TO6A 2NRAC 2JA2A 2RNJA 2CQNA 2QQ8A 2CW0F 1Z7LA 3CDHA 1R9TJ 2VC1A 3K4KA 4A3DJ 4ZYEA 3BR1A 3BT9A 2Q2EA 2EZKA 4WWCA 3K70C 4OAZA 4B09A 2XKOA 2Y0MA 4CXFA 5M5XJ 5L3BA 2OQRA 4U0WA 1ZHFA 2OZUA 4ZYDA 1RR7A 3BC8A 5JVTA 4XICA 1QHHD 1TTYA 3PL8A 2O3FA 3FWEA 3ZOBA 3REOA 3UNGC 4M73A 1A6IA 3FMSA 2LC2A 1UELB 3ONQA 4NUBA 4O6JA 4ANJA 2HDDA 2X1CA 3S8PA 1QU3A 4AVZA 5HVQC 1G3YA 4WK8F 3FMRA 1T2KA 3GZ5A 3TP3A 2OQGA 4UUSB 3TO9A 2IP2A 4Q47A 2X85A 2YR2A 3K2AA 1G3WA 3C2HA 4M72A 1W5TA 2IGOA 2MA3A 1ZG5A 2ELJA 2M2EA 1PUFB 1TQMA 2HVRA 5IT9K 5F08A 1MW7A 3VYUB 5FJ8J 3HHHA 2FX0A 2DPUA 5C3EJ 3P9IA 5E3LA 3BJOA 2K27A 3I71A 1RZ4A 2ZJRF 2VQHA 3GWZA 3BP8A 4KICA 1REPC 3CF2A 2FMYA 4RB0A 2NXNB 4B8XA 4WCGA 4RM3A 1X58A 1MBHA 2P6SA 3HM5A 2VB6A 1JUPA 2NAZA 2X0LA 5DCMB 3B6CA 4HX4A 2R0QC 3JRBA 3GO5A 2AQEA 2E35A 1D5YA 2EA4A 2BE5F 1NG7A 5B1BH 3U1KA 1HSJA 4XRMA 4YRVA 4A3EJ 4PJNA 2GXGA 3BG6A 2BGCA 5FROA 1Z7UA 2EFNA 1HKTA 3ZMVA 3WE3A 5IOZA 2BEOA 5L3CA 3GTLJ 2GOMA 3G1OA 4P1WA 3NQOA 2HQ5A 2UWMA 3WODF 2DMQA 1WI3A 4GRIA 1OQYA 2BZTA 2LK2A 3FXJA 3GFMA 5K1YA 2X1DA 4FE4A 1T56A 3SHFA 2RAEA 3MZHA 4G94A 4YFKF 2R7QA 3GX4X 4A3LJ 3HTSB 3CUQA 4HBLA 2R7TA 3S16J 1S29A 3KX2A 2V1NA 1HDDC 2XAQA 1LJ9A 4IXAA 4N4NB 3KEOA 1R00A 1TW3A 2Z5UA 2J5OA 1H9GA 2VXZA 3L1PA 2LG4A 2ME6A 1UMQA 1P7JA 3S1RJ 1S7EA 3HZJA 1LB2A 1WFXA 1D8JA 1T0FA 4CDGA 1KA8A 5GTHC 4IO9F 3WE2A 1DPUA 1XCBA 3KP4A 5L3FA 3OS2A 1QNTA 1G4DA 2IAIA 1TC3C 5E8GA 3ABMH 3PFIA 1RESA 5AIPA 1AU7A 1R5ID 1FBUA 9ANTA 2ETHA 2QEXI 3A2KA 3H3ZA 1YJWI 4LMYA 4HF0A 1IUFA 1I50J 2MC4A 1VQNI 3I54A 1IXCA 2J5PA 2PX9A 3DBLB 4Q5SF 1FJLA 2K40A 2VE8A 3HUGB 4R79A 4E70A 4IHTA 5C44J 3SDBA 3K6GA 2HQAA 3OOUA 2VJJA 4B3XA 4IHWA 1RETA 1A35A 4C3IJ 1H8AC 4HA8A 2L02A 4OMYA 2EZIA 3MCZA 5DCFA 2DT5A 1MMAA 3GTGJ 3FISA 2Y0SA 2HXIA 2MSYA 2BV6A 3X2QH 4UY8I 3OYJA 3FXRA 3DKWA 3CZ6A 4RAGA 1Z6TA 1FLIA 1Z67A 4BHPA 2HEOA 4BU2A 3IRRA 1Z77A 3O3KA 3CCEI 4BDZA 4XOTA 3LSPA 3OYEA 3LNQA 3K4JA 1CQTA 2HPMA 2X6WA 1P6RA 4U0VA 1FPQA 5HS7A 2HQRA 3O2PE 1IV6A 2PI0A 2WA0A 3HOZJ 1R5GA 5B3SH 3H1CA 5LEJA 2CRGA 1DGRM 4G6TB 3QOEA 1FX7A 1YE9A 5JVGF 2P6TA 3RTRA 2L5QA 3CCRI 2VKHA 5GAHJ 4JK1X 3HOVJ 4M9XA 1OMIA 5KK1A 4XIDA 1R36A 5F1RA 4FX4A 1XDUA 2Y9YA 3GFJA 5EGOA 4FETA 1TNTA 2GIZA 2IGMA 1DP7P 3H0DA 1GV5A 2BW3A 3MWMA 4Y33A 2HWVA 2IA0A 4EJOA 5GTIC 3V8KA 4RBOA 2EFPA 5E3NA 4XNFA 2E2IJ 4IL6C 1T6SA 3JSPA 1RKTA 1OR7A 2M8GX 2EIKH 5DYMA 1LDDA 2LP0A 1X1CA 3GEZA 2XB5A 1FY7A 4HG2A 4N0BA 4CCLA 1MDMA 2EINH 1MH4A 2JUGA 1N78A 5LBQA 2L54A 4BE2A 2K9QA 5E3OA 1OCPA 1ZG1A 4C3HJ 3DCFA 1TQPA 3CUQC 1WRJA 2JPBA 1JHHA 2R7VA 3D0SA 2L01A 3I58A 1B1BA 1W0UA 4EQQA 3SFIA 1HQCA 2VC0A 5FGMA 5EG0B 2E1NA 2K9LA 3V8LA 3AG2H 3CMMA 5K7ZA 3JSOA 1WGXA 2RQPA 2EPFA 1BI2A 1T0FC 3CDLA 2CUEA 4HSRA 5H20A 1MBGA 4A0ZA 3LL7A 4BUPA 1VF9A 4DBQA 3OOPA 5JHFA 4I76A 1D1AA 2OCCH 4BJ6C 1QPIA 4LLNA 4F92B 4LIVA 2C6YA 2BY0A 4ZJZA 1G8XA 4RMNA 4BJTA 3RDIA 5J4VA 3V7SA 2M0CA 1VQLI 4BQAA 2A6EF 1BIAA 5DEQA 2IPQX 4QIWN 1U3EM 2BVMA 5J47A 1YW9A 2XVCA 2XF7A 5F27A 2AO9A 2XRLA 4IPAA 2DTZA 1MKMA 2DW4A 5D5WB 3CCSI 3FDYA 3FZVA 2R93J 5DDGA 3BR3A 1ETKA 4I7HA 3LSRA 1U6GA 2VBXA 3HOSA 2VJIA 1ETYA 2K4BA 4LG0A 1LE8B 2M7AA 1DU0A 2P0WA 1U2WA 2M30A 3QP6A 4BGDA 1USSA 3ELKA 2LBFB 5LGTA 2H8WA 2O5RA 2FOKA 4HRIA 1ETXA 2KZVA 2NYXA 3QP5A 4X1EA 4DQ2A 3KETA 1G59A 4TV7A 2NVQJ 3AG1H 4V19K 2K02A 4PSWA 2R7RA 1K4TA 1J9IA 3CCUI 5CQGA 5F0HA 3WTTC 4XONA 4BNCA 2DMNA 2LSOA 2MBFA 2LY2A 5AIQA 2Z2SB 5HLIA 2QF7A 2ZFUA 3JAMZ 3I59A 2CMPA 1H9TA 2OBPA 2G7HA 3VWBA 3OSGA 2FBIA 3EQLF 5FLVA 3LSMA 2DA7A 3CTAA 1IAWA 1VQ7I 2ICWG 3GTPJ 1K78B 2WB1N 4EGYA 1X1DA 5KAFC 3HOUJ 1NK3P 1WH7A 2DO7A 4CCJA 2W48A 5CVRA 1ZN2A 3VEPA 5DV5A 5J3LA 3HGYA 4EJWA 2HOEA 2ZCWA 3EUHA 1Y1VJ 4BQQA 5D5XB 1FEXA 2DAOA 4LFUA 3IAS2 4KITB 1ZGJA 4ZYGA 5H6RA 2OD5A 3CC2I 3SDGA 3CCVI 2KFDA 3AAFA 3BZKA 1W36D 1QA6A 3BJAA 2A3SA 4QSHA 4A5NA 1QVUA 2LKSA 5DS9A 4A3BJ 1QO0D 1O7FA 1OR7C 2ZXWH 2OTLI 1OKRA 5FFZA 2FXAA 3Q3SA 1SD4A 2K4JA 5E18F 2TCTA 1EH8A 1HW2A 2R3SA 4Y15A 1RI7A 1LFBA 4EEFG 3G6EI 4A3JJ 2QBYB 1ACIA 1U78A 3K1NA 4F3QA 1PUEE 3V7RA 3GFLA 1CF7B 1BOAA 2HTSA 2PJPA 3HL2A 1KU2A 5CPRB 4E7ZA 5K7HA 3EUKL 3QYBA 1EF4A 3HRSA 1Y56A 2JSPA 3I4MJ 4DZPA 3LSTA 4I09A 3CJRB 2QLZA 3PIPF 1WH5A 2FE3A 2V6EA 3M07A 1R5HA 1V5FA 4BBRJ 2RREA 1ZKGA 1FOYA 4HV6A 1F1ZA 1IC8A 1FOKA 2ECCA 2EFQA 1QGPA 2KISA 2HQNA 2IRFG 3CP8A 2DJNA 5IY5H 2KDZA 2ZJPF 2DQRA 4S04A 5HNFA 2VBZA 4XM3A 4DNCA 3KLNA 3CDIA 3CLOA 1B72B 5LHIA 2L4AA 1STZA 2Y0SN 4CCOA 5JHUA 3I0TA 1B8IA 3ZQFA 2FUG2 4OIQF 3DPUA 1WPKA 1TWCJ 5F64A 3L2QA 3Q5FA 3FXKA 5D8LB 3C7JA 2Q0OA 4GXOA 1TLHB 2E1CA 2PJRA 2FSWA 4KDPA 5D4SA 2JJ7A 3VYTB 1I5ZA 4HDVA 2CWEA 2A05A 3ERMA 3F72A 2EILH 3E0JB 4GDFA 4KA4A 2OTJI 2FJ1A 3F3XA 2JSCA 3M1EA 1GHCA 4RAYA 4D7MA 1AKHA 1MSFC 2P4WA 2Y2ZA 2OAZA 1I3QJ 2G7UA 3QOPA 2NS0A 2D45A 2ELHA 3JRHA 3R0AA 5LHHA 1D0ZA 4B1RA 2XDVA 3HBLA 3BQZA 1W0TA 4QLCU 2GOXB 4R8HA 3RPQA 2KKOA 1YRNA 2IA1A 1X3WB 4M9ZA 4A5MA 2JZYA 5LLQA 1IV8A 3I53A 2HU9A 3QAHA 3I4NJ 1MGTA 2ZFWA 3WTZA 4I98B 2X6YA 1OJLA 3OMYA 3C1DA 3F22A 3BWGA 1XC5A 2QM3A 1JJ6C 2L9SA 4IRHA 4C2UA 5ICEA 4E7HA 2QVOA 1ZGWA 1R71A 2W4SA 5FKMA 4ZTJA 2CU7A 1EJ9A 3E7LA 2CV2A 2HYGD 1WJBA 3ZRGA 4DZJA 3CCYA 3TOBA 2V1XA 5DD8A 3EUHC 3WTXC 2R7OA 3WHCA 4D9JA 4IRGA 2WC2A 4D5FA 1S6LA 2EIMH 1LVKA 5ILVA 2PMUA 4IHYA 1YLFA 3J81Z 2K86A 1VQ5I 1D0XA 5FB2A 1S72I 1SANA 2A68F 4ASNA 2NVTJ 1IDYA 1I3AA 3SZGA 4AU7A 5EEHA 3JRAA 4ESJA 2L7ZA 3MEXA 5E1WA 2HXOA 3RCOA 2EJRA 2HNHA 4HLYA 1SVMA 2DLLA 3L2RA 3GMEA 4DYCA 4UHTA 3BTLA 2F4MB 5HLGA 4A6EA 4PGGA 1MMGA 3RKQA 3R6SA 2XHKA 4PDKA 4M3DA 3G71I 2E1MB 1SEUA 3GVAA 3T1BA 3BG9A 4I02A 3TP0A 1U8RA 5HODA 1E2XA 2AHQA 4BHCA 3HSRA 2ACJA 4PK4A 4NC7A 3RSNA 2GLOA 2VKEA 5E1ZB 3QQAA 3A0HC 2O03A 4E4HA 3IV5A 3L7WA 3PNVA 2HPIA 3JCUC 5IOYA 1K6OA 3GFIA 2JT1A 1YS7A 2KRFA 3D5RC 1ITYA 3OS0A 2Q2EB 4HX7A 4JOMA 2XB0X 4QPOA 2VOOA 1R49A 1TW2A 5GP9A 4GFBA 2DCEA 3OY9A 3L2UA 1OPCA 1A6QA 2GZWA 2OPTA 3ABUA 4M6VA 2FMLA 3VYRB 1BA5A 3PSFA 4M74A 2K9SA 1AHDP 4B4CA 2M3AA 1LNWA 4XOPA 3VSLA 1B59A 1SFEA 3NEUA 1HC8A 3HPGA 4HZFA 2P5KA 3OYBA 2VBWA 3COAC 2M4GA 3OIQA 2Y48A 1S3JA 3MAJA 1MD0A 1UAAA 2GAUA 5EZHA 3K4LA 2W84A 1ZLKA 2E2JJ 2W7NA 1X2NA 2V1DA 2IW5A 3LQRA 5LD2C 3CD6I 1QQIA 2MD5A 3O8HA 4UVCA 2VPLA 5D4RA 5ED4A 3JTHA 3PQJA 2B63J 2K9MA 4A12A 2KP6A 2YU9J 1HBXG 1AWCA 2HOAA 2DFIA 1J59A 1KYWA 4S0HB 3BG3A 3LFUA 1G3TA 4C9YA 5BPIA 3N4MA 3D1NI 4NNJA 3F9KA 3V8JA 5ILSA 1Z91A 4HNTA 3I4PA 2Q8KA 6PAXA 1W5SA 1JXSA 4G8XA 1P4WA 4LK1F 1I1GA 3L9FA 4YIRX 1WJCA 4CZCA 1KU7A 3OL3A 1V5EA 2HYFA 3KP7A 3OYKA 2I10A 3CO6C 4JYKA 1XSDA 1O4XA 4MQVA 1U9OA 1WQ2A 5ERIA 4DJAA 4YFXF 1Y1WJ 3RKYA 2YX7A 4W1UA 5HOOA 4IHXA 3DBHB 3GW2A 4A93J 2FNAA 2VKVA 1RRJA 1LEAA 4BAYA 2KLOA 2JA7J 5E3MA 5TISC 4A3FJ 3V42A 4B48A 4CH7A 2NVYJ 1WJFA 2CSOA 1V5GA 2QWWA 3DFGA 3LAPA 3KP2A 2P7VB 2XF6A 1MJAA 2ADUA 3ECOA 3GUDA 2R7WA 1KQ8A 2JA8J 4PJ0C 3HKZA 4M3EA 5LFAA 1XGMA 2IBDA 3HB9A 1Y0UA 2HZTA 3Q9VA 2R7SA 1J0RA 3CUQB 3P7NA 3RQ4A 3WGGA 1U5TA 3GBGA 5E79C 4BBSJ 3R4KA 3CMYA 3DF8A 1JUMA 1IJWC 1MIJA 2DFHA 3P5JA 3AKZA 3S3NA 4ZH4F 2XASA 3DEWA 2JQ7A 2XAFA 3MQ0A 4ZC3A 2DI3A 2ZB9A 1B6AA 3L09A 3PNYA 5D5UB 4UUTA 3QRFF 2F5EA 5BQTA 1IN6A 3RYRA 5FO5A 2XRNA 1ZYRF 4BXFA 5L3GA 1YJ9I 5HDGA 3J80K 2IGNA 3QWLA 2FRHA 1I39A 3QYFA 4Q4ZF 3FM5A 1Y0NA 3F8NA 1YW8A 2TRTA 3G1MA 1F9NA 2WB1A 5DTDA 3A01A 3DU6A 1K83J 2EB7A 4JP0A 4AWXB 3CCLI 2KMUA 3J7AO 2K7LA 1TT5B 1PP7U 1XX5A 1OLTA 3H3VK 4XLNF 1W1WE 2V6CA 1ZAOA 2P8TA 3OYHA 2KIQA 3SXYA 3BZ6A 3DLLF 1E3HA 4DW6A 3ZQQA 2NNNA 1BC7C 3WTYC 4ZDLA 4FISA 1SD7A 4RDUA 1NH3A 2RGVA 3HEFA 3S2DJ 4FQGA 4BY7J 3SZTA 1ZH5A 1IXSB 4UUVA 4IF4A 1W4MA 4M3FA 4MEYF 2F5FA 2EFWA 2E1MC 4LG3A 1YS6A 4ZDOA 2JN6A 2OCEA 2V4JC 2OUMA 5IYDJ 3HHGA 3IKTA 3IH4A 1J09A 4CCNA 3HG9A 4E7LA 4J00A 2M0MA 4C30A 3FK7A 4MNUA 2A5WA 2M1BA 2X51A 1IF1A 2DOEA 2FQ3A 5TRDA 3GTQJ 2LFBA 2FQ4A 2Y31A 1F43A 3RJPA 3LSKA 2E36A 5ILUA 3U1DA 2VLAA 1ORKA 3DEUA 4CCKA 3IL2A 4DYQA 1XB4A 3L2WA 2Y9ZA 3RZOJ 1UHMA 2XGEA 4RAFA 1QPMA 1L0OC 3K4BA 2EIJH 3LAJA 1LFUP 3BZCA 4BKXA 4XLHA 1FZPB 5EGOB 4IHSA 4RB2C 2IGKA 2H8RA 5E20A 4L9TA 1ZARA 4OU0A 3FXMA 2BY1A 4KT6A 3WU1B 1T95A 2ECBA 2LD5A 3PQKA 4PSXA 1X4OA 2AXLA 1IW7F 2PFBA 4OINF 2M8EA 4HV5A 2F5CA 1VQKI 2YU3A 3LMMA 4CYCA 1XDSA 2AQFA 2GIVA 3PNTA 1XMKA 2PMZN 1D5VA 1WCMJ 2BHYA 4U7BA 3RKXA 3K4NA 1W36C 3HJEA 3DU5A 3BOQA 3QYEA 3C18A 1EV7A 4QWQA 3AFHA 1X4PA 4G12A 2WWYA 1I6HJ 2M7BA 2M34A 3RQIA 5JI6A 1R7JA 1MDMB 1X3ZB 3BR2A 3MFKA 4QTRA 3S2HJ 2VBYA 4N9IA 3KP3A 4Y3OA 2NOJB 1IN7A 2QZ8A 5GPAA 1U5TC 1RIOH 2JVHA 1W5CC 3BPXA 4D1QA 1P7IA 4II3A 4KMUX 5CVVA 1I1SA 2OV7A 2XV4S 3ABTA 4CYDA 3HPHA 4A0YA 3GXOA 2L9RA 4U7DA 1BL0A 2XUBA 4Y13A 1X1AA 1HDPA 2COBA 1ON1A 1Y8RB 3LSHA 2QA4I 4O3MA 1SAXA 3BTJA 2XPUA 1XCVA 2PLYA 2EQRA 3FK6A 2X6XA 4ENKA 2L7MP 1OCTC 1TWAJ 3PO2J 5ICCA 2E7WA 2A07F 4PGHA 2D5VA 1BR2A 1HOMA 1YI2I 1XGOA 4OIRF 4E7JA 1LQ1A 3S17J 2ZBKA 2CS3A 2MYSA 2MG4A 3JRDA 3NRVA 3CESA 3T0YA 1IN4A 2JRTA 3TO7A 4S05A 3HOYJ 4D7NA 4XR6A 2ZNZA 1YW7A 3WGIA 2HZDA 2LLKA 2V9KA 3KEQA 1N25A 1U0JA 2WY7Q 4RB1A 2QQBA 2PN6A 2M5WA 1E3PA 4D5CA 4EGZA 3K7AJ 4ENJA 1JKOC 2QSHX 2IS4A 2NS7A 3NARA 1ZRDA 5K5QA 4ABZA 1GXPA 4LG0B 1D8KA 4OMZA 3BROA 3KPHA 5J8FA 1KU3A 1ZK8A 4BEHA 3P9CA 4RGRA 2JA6J 1IN8A 3CLQA 3DKXA 3TGNA 4JBAA 1E3OC 5FKLA 4J01A 3A0BC 4UV9A 1BI0A 3Q9SA 4H0EA 3LSJA 1HW5A 4MLOA 2R7DA 3F8FA 5HS8A 1FTZA 3TW7A 2ZMEA 3GZNB 2GXBA 2Z99A 2D2WA 4LK0F 1KGSA 1BW5A 1USTA 5J1RA 3I59B 5J40A 4HF2A 5FKOA 4I01A 3BG7A 3KFWX 2LKXA 4OWRB 2WADA 5BPDA 2VQGA 1CGPA 3ABKH 2PMHA 3ZCOA 2X48A 3J7ZI 1G3SA 4XLAA 2WAQA 3ML6A 4A69C 2DDAA 4IKFA 2A6HF 1WKMA 4FASD 4PFOA 4LLLA 1J7KA 2CO5A 1XD7A 2HFHA 4L0YB 3HKZN 2VOPA 4NDLA 3L2CA 2DK8A 3ROUA 3H35A 1T08B 3FKIJ 2VIXA 5L3DA 4HAMA 1X19A 5JR3A 4A3MJ 2K85A 1AOYA 1J2XA 1LDKB 1T33A 2WTEA 3FKJA 2COMA 3VODA 1APLC 5D8KB 2P7CB 3FX3A 1R23A 1LKXA 5FLMJ 1YIJI 4A0XA 3SEZA 1WVRA 5F04A 1IO2A 1NG6A 2R4GA 2W85A 5BMZA 2N8GA 4FE7A 1ENHA 3LSGA 3ZMSA 4EM0B 3W2AA 1D3YA 4XSZF 2X1EA 1FIPA 2L9NA 1YJNI 1KU9A 3F6OA 3VFZA 3U2RA 2M45A 1V4RA 2ID3A 4RB3C 3L2VA 1GVDA 3TOAA 3DKYA 2EK5A 5EYRA 2TDXA 2GA2A 1HCRA 2Z1DA 5C4XJ 2RNGA 1TZLA 3IKVA 3FXQA 2VQLA 2STTA 2CQKA 2DDBA 5J6XA 2DMTA 2XAHA 3LA2A 4IJAA 3JAMK 2XAGA 3A1YA 1W7PD 4XN3A 1FOXA 2EV6A 2O0YA 3M4OJ 3ZN0A 2UXNA 5LRSA 4YIFA 4BS9A 1YX5A 2DFEA 2WAEA 3OYFA 3MKYB 3V4GA 5EEGA 1J5YA 1XSVA 2E1OA 1B8IB 2VONA 4P55A 4XK4A 4LIUA 4X6AJ 5TGTA 4EATA 4A2UA 5IYBJ 3K4MA 3I3LA 3CC4I 4MFDA 2RDPA 3K69A 2STWA 4HF1A 2PJRB 4AIDA 1A5JA 3ULQB 4E6KG 2BYVE 3G3ZA 3KLOA 2AXTC 1OCCH 3B6AA 1JHFA 2DA6A 1VQ9I 1FOWA 4KIGA 4LGWA 5EDNA 4FCYA 3D5SC 3ZP5A 4M71A 4G7OF 2ISZA 3VOEA 1D0YA 3CF5F 1AKHB 2CUJA 3M7GA 1FSEA 4U87A 3ZMDA 4E7SA 3BR0A 2D1VA 2CV0A 2W24A 3H5AA 3JRFA 4BQNA 3HOXJ 4B47A 4W97A 3CO7C 1SMTA 1AA7A 1JGSA 2DFFA 4UXNA 1VTNC 4BE1A 2QGUA 3GTJJ 3FM3A 3HSEA 1YRNB 1KZHA 2HVQA 2ZMEC 3FXOA 4XLPF 2XAJA 2FNPA 4HQMA 2CUZA 1ZR2A 3TMOA 2VQCA 2WV1A 4NQWA 1ON2A 3GCMA 4BDYA 4OIPF 4M6YA 3BCAA 4L5JA 4DYRA 3FHNA 4ENNA 1JT6A 3ZQ7A 3MN2A 5FD6A 3S3OA 1RKWA 2UZKA 4WXCA 1ODDA 3BR5A 3E5UA 2VE9A 2XPVA 2ZKZA 1P4XA 2IA2A 2XIGA 1A31A 3TKYA 2ISYA 5EF6A 3DV8A 2H1LA 2W1OA 2KRCA 4Z6YA 2P81A 3MKZA 2XGDA 4NBQA 4P9FA 3SQNA 1XS9A 3OSFA 1UG2A 2NNYA 3DPLC 2H6CA 2F2EA 1SC7A 3CP2A 1WSUA 1OCRH 2JWTA 5HLTA 1JJ8C 4LITA 3I9V2 4BHBA 5IT3A 4IOAF 2M4KA 2YPRA 4C3JJ 2VJ4A 2L9VA 2LKPA 2OC6A 5IP6A 5F1JA 1IXRC 4IOCF 4HNUA 3KP6A 3LWFA 3BCBA 4XLCA 2BXZA 1SVOA 1A04A 3TDUC 5J4YA 4ON0A 3G4SI 4GCVA 2R5ZA 2NS8A 4XN0A 1XN7A 2W82A 3PSIA 1H0MA 1S7AA 2IS1A 5DM7F 3PJRA 5M3FJ 3IC7A 3WG7H 3M8FA 2VODA 4XRSA 1R58A 4XRFA 4EJUA 3BLYA 1DU6A 3PO3J 3OR1C 2H1KA 5FLXZ 3BY6A 3K9TA 1SFXA 3FHZA 4YIIA 1SAUA 3I56I 2F48A 2Z9OA 1LFPA 1X1PA 2V9VA 1P2FA 2DA3A 2OJED 3WTVC 2KHMA 3H3UA 2R7XA 2XPWA 1Z1DA 2LMDA 4A3CJ 3QODA 4IQ4A 4M3GA 2E34A 2OA4A 3HOWJ 2DT6A 4ZYAA 3NWTA 1MMNA 1SFKA 1QBJA 2CG4A 4XKBA 4U0YA 1NTCA 1O3SA 5LGUA 3CMEI 1SMYF 1XSXA 4G6DA 2NOGA 2BBYA 4KFCA 3I64A 1N75A 1MBJA 4FT8A 1LUJB 1LPQA 5LRRA 3JREA 5LEKA 2CUFA 2PMZA 3IWFA 3TL4X 4AIJA 1XMAA 2HS5A 1YITI 4OIOF 2ZJ2A 4MFEA 3DP7A 4CZZA 4BYYA 3BG5A 2QKLB 2PG4A 1T98A 3RZDJ 1MMDA 2JA5J 4DBRA 2WAQN 1HXDA 1PYVA 5K5OA 4KISA 4ITVA 4BL0B 2CQQA 3CJNA 1ONVA 2DJIA 3S14J 4G9YA 3QU6A 2ESNA 1DP3A 2QQ9A 1XPXA 2DA2A 4XBFA 1JKQC 3A02A 4V2GA 1ZTRA 3S1QJ 5ICGA 4I2OA 3IUOA 3H5RA 4EJTA 3T5XA 2A5YB 5D6EA 1ETOA 2M87A 1GUUA 1GXQA 2X4HA 3M1CA 5JLXA 5A2QK 3OYIA 5BS6A 1IRFA 3RKWA 4MTDA 3CMAI 1Z9CA 1FBQA 5IP7J 5EEAA 1VQ6I 4RLFA 5EJCA 1ZRCA 2HVSA 1NHAA 1PVEA 3DEEA 3R60A 4QPQA 2Y30A 2KRHA 1K4SA 3G1LA 1FSHA 2RN7A 5HS9A 4P96A 2VASA 5GAGJ 4Y4RA 3RI4A 1EA3A 3OYLA 4Q48A 3NAUA 3SZPA 3QPTA 5KCMA 3MMYB 2PBIA 3C2BA 2DQLA 2CW7A 3H9GA 1FTTA 2MD0A 3IWZA 5LHGA 2CQXA 3S15J 1U5TB 5J1YA 3GF2A 3E5QA 3CQZJ 3ZN1A 3ZXSA 1V55H 1Y8QB 3WTWC 1YHQI 4M9SA 1GV2A 2M9HA 3OYDA 3FF5A 1DPRA 2L2OA 3HRUA 2R92J 2CFXA 2OU2A 4FTHA 3A03A 5L3EA 1YIOA 2HOSA 3S32A 2XSJC 2LYCA 4PCQA 2E5NA 1QHGA 1EH6A 1MBEA 2ZXHA 1PP8F 4LB6B 3VPRA 1P4AA 2B0LA 5KNLA 4AVPA 4NC8A 1W7PA 2BY3A 1P92A 4EJVA 5DUIA 2Z16A 1MH3A 1LEBA 3FMQA 3LFKA 3K1MA 2RVCA 4N4OB 2H27A
chains in the Genus database with same CATH topology
4NHJA 3WU0A 1I6XA 2CGPA 3K2ZA 4RS8A 5KVRA 1OYIA 3ZMUA 4GYGA 1RUNA 1IUYA 4IVNA 4ZZDA 1B9MA 5LGNA 4P5OA 2YX4A 5CJ9A 4L9JA 4JQFA 4RGXA 1K7AA 1B9NA 1GVJA 3T8TA 4MEXF 5IT9Z 3E3VA 1R1UA 1KYZA 2ZXJA 1ZG3A 4HLXA 3N97A 5BOXA 3TDZC 1ZREA 4P9UA 4CHUA 1QZYA 1FYMA 2EA2A 1S7OA 4EV0A 2Z3YA 2O61A 1WWXA 5E17F 5E1XA 2FA5A 3WG9A 3J80Z 4MHGA 4KN7X 3D5LA 5D6FA 1FP1D 4ETSA 2MH2A 4BXUA 1MJBA 2L4MA 4L9VA 3F6VA 4GGGA 4EM1A 1YFHA 1RUOA 5F6FA 2ESHA 5ICFA 2KIFA 2LF8A 2OZ6A 5FFXA 3U9GA 1BM9A 1R22A 3HYIA 4GYIA 2O8XA 4KUMA 2LF7A 1L3LA 3BDDA 4A6DA 4ESBA 2GA1A 4L18B 1EH7A 2V1UA 4BH9A 2DU9A 2FBHA 5FD5A 4KIFA 3WGHA 1BC8C 4HQEA 4I0BA 1Q1HA 3E6BA 5JFRA 3EYYA 2FU4A 3R0JA 3E6MA 5DCMA 2P5VA 4WXHA 1SFUA 2L3DA 3KZYA 1R1VA 4UVAA 1HW1A 3HRTA 4AIKA 3KZZA 2G9WA 2LNBA 4UVBA 4EMSA 4G7ZF 2EWNA 4ENMA 2A61A 3BJ6A 3E5XA 2V79A 1LVAA 3GLXA 5TJJA 1YTYA 3M8EA 2CYYA 3JW4A 3E6CC 1I27A 4L0ZB 4F7ZA 3ISPA 4L5IA 4D0PA 1J75A 2QYOA 3KE2A 4KT5C 4KIBA 2ZMEB 1IZ1A 1KQ0A 4UNOA 1E17A 5AONA 1UCRA 4KMFA 4UV8A 4FHTA 1FYKA 1XGSA 2FEZA 4OOIA 3O6BB 4I0AA 4M6XA 2W25A 1HSTA 1ULYA 3HUGA 2YSRA 3LA3A 1Z6RA 2FBKA 3SFZA 4MQ9F 4HX8A 3M9AA 1WI9A 3BPVA 1FC3A 2EV0A 1O3TA 3DQVC 4AD9A 1DDNA 2IT0A 2ZNYA 2JTVA 4G6QA 5D5VB 3ZPLA 5CLSA 2GQQA 3RIRA 3F8BA 3HRMA 3KCCA 3OV8A 1IN5A 2PEXA 1JE8A 4HOBA 4GO1A 2MLGA 2RKHA 2HGCA 2Z33A 3DPTA 3C3WA 1G6NA 2EV5A 3RYPA 3GZ6A 2VN2A 2MH9A 1UFMA 1F4KA 1R1TA 2HKXA 1HKQA 2XKPA 1DUXC 3V7CA 2KJBA 1XGNA 3GYHX 2KIUA 2FF4A 2H94A 4R1HA 3LQQA 5CVUA 2JPCA 4RAZA 1OYWA 1O57A 5HDKA 3H92A 4LB5A 3JTGA 2XROA 3VB2A 3CUOA 1TBXA 4ZZLA 1RNLA 4WX9A 2LDUA 3F23A 3WTSC 2XGXA 5HDNA 3R61A 1K79A 4Z2YA 1O3QA 2W57A 2P5LC 1O3RA 4LD5A 1O7LA 1V3FA 4HYEA 4G7HF 2RV8A 1PDNC 1MZBA 1QZZA 1T39A 1YG2A 5J8CA 3ERED 1S8NA 3IRQA 2A69F 2E7XA 4FX0A 1LDJA 1FP2A 2UXXA 2KIMA 1MJ9A 1YQAA 4AIHA 3F8MA 3HTUA 4KYWA 3B02A 3F8CA 3IHUA 1UB9A 2IVMA 2HTJA 3MZYA 3W6KB 3EYIA 1UHWA 3HSFA 2MC3A 1K78A 1BI3A 2H6BA 3RPUA 4IRIA 2VT3A 2GWRA 5K5RA 2D1HA 2HR3A 3DXJF 4LLGF 1T38A 3E97A 1BBYA 4CICA 2AS5F 1ZGAA 1B4AA 4CGZA 3F21A 2HDCA 2QBYA 4L9NA 5DD4A 3EETA 4EVIA 1FNNA 1BIBA 1CF7A 4PZJA 3ZMZA 1F5TA 4LJZF 1FT9A 4ESFA 4HDUA 3EDPA 1HKSA 3HOTA 2O6GE 2F5DA 3WTUC 2HKOA 5HLHA 1YO5C 3L00A 4YFNF 2VT2A 3K0LA 3ECHA 1YYVA 5FLXK 4HW0A 4N9HA 1SD6A 5CYVA 3J81K 3I5UA 3ZMTA 1ZLJA 2ZO4A 2DPDA 4WXDA 3S2WA 5CVIA 2QQAA 4MGRA 4CO8A 3QU3A 1X3UA 3KP5A 3E6DA 3QPHA 2WV0A 5H6QA 4WF2A 3K1PA 2QENA 4K2EA 2RC4A 2KJCA 4RGUA 4ZYHA 1Z05A 1C0WA 3P9KA 2PQ8A 4RGSA 1BJAA 2R7FA 4MTEA 3T8RA 1KQ9A 4KN4X 1W7PB 4Y17A 1ZRFA 1FYLA 1TNSA 1BN5A 2IJLA 4NB5A 2Y75A 4XSXF 3G73A 1OYYA 4U88A 5A2QZ 3FXUA 3B73A 4KNYA 2MLKA 3W6JB 2DK5A 2QUFA 3TQNA 5CVJA 4EM2A 1IRGA 1FWZA 5DUKA 1FBSA 3LA7A 4O5VA 3HIFA 2DTRA 2EFOA 5E8IA 1SD5A 1BI1A 4YG2F 2H09A 2DBBA 1TQIA 2NRAC 3TO6A 2RNJA 2CW0F 3CDHA 2VC1A 4ZYEA 2Q2EA 4WWCA 4B09A 2XKOA 2Y0MA 4CXFA 5L3BA 2OQRA 4U0WA 1ZHFA 2OZUA 4ZYDA 5JVTA 1TTYA 2O3FA 3FWEA 3REOA 4M73A 3FMSA 4O6JA 5HVQC 1G3YA 4WK8F 3FMRA 1T2KA 3GZ5A 2OQGA 3TO9A 2IP2A 4Q47A 2YR2A 1G3WA 4M72A 1W5TA 2MA3A 1ZG5A 1TQMA 5IT9K 3HHHA 2DPUA 3P9IA 3BJOA 2K27A 3I71A 1RZ4A 3GWZA 3BP8A 4KICA 1REPC 2FMYA 4RB0A 4B8XA 4WCGA 2P6SA 2X0LA 2NAZA 5DCMB 4HX4A 3GO5A 2EA4A 2BE5F 1HSJA 2GXGA 2BGCA 1Z7UA 2EFNA 1HKTA 3ZMVA 3WE3A 5L3CA 2BEOA 3NQOA 2UWMA 3WODF 3GFMA 5K1YA 3SHFA 3MZHA 4G94A 4YFKF 3GX4X 3HTSB 3CUQA 4HBLA 1S29A 2XAQA 1LJ9A 4IXAA 3KEOA 1R00A 1TW3A 2Z5UA 2J5OA 1H9GA 2VXZA 1LB2A 1D8JA 1T0FA 4CDGA 1KA8A 3WE2A 1DPUA 1XCBA 3KP4A 5L3FA 1G4DA 1QNTA 5E8GA 3PFIA 5AIPA 1FBUA 2ETHA 3H3ZA 4LMYA 4HF0A 3I54A 1IXCA 2J5PA 4Q5SF 2VE8A 4R79A 4E70A 4IHTA 4OMYA 4HA8A 2L02A 3MCZA 5DCFA 2DT5A 2BV6A 3FXRA 3DKWA 1Z6TA 1FLIA 4BHPA 2HEOA 3IRRA 3O3KA 1P6RA 4U0VA 1FPQA 5HS7A 2HQRA 3O2PE 2PI0A 1R5GA 5LEJA 1FX7A 2P6TA 3RTRA 4JK1X 4M9XA 1OMIA 5KK1A 4FX4A 1R36A 5F1RA 1XDUA 3GFJA 1TNTA 1DP7P 3MWMA 2HWVA 2IA0A 4EJOA 3V8KA 2EFPA 1T6SA 3JSPA 1OR7A 5DYMA 1LDDA 3GEZA 1FY7A 4N0BA 1MDMA 5LBQA 2L54A 1ZG1A 1TQPA 3CUQC 1WRJA 2JPBA 1JHHA 3D0SA 2L01A 3I58A 1B1BA 4EQQA 1HQCA 2VC0A 5FGMA 2E1NA 3V8LA 3JSOA 2RQPA 5H20A 1BI2A 4A0ZA 3OOPA 4LLNA 2C6YA 3RDIA 3V7SA 4BQAA 2A6EF 1BIAA 5DEQA 2IPQX 1U3EM 1YW9A 2XVCA 4IPAA 1MKMA 2DW4A 5D5WB 3FZVA 5DDGA 4I7HA 1U6GA 2VBXA 3HOSA 2K4BA 4LG0A 1U2WA 2M30A 3QP6A 1USSA 3ELKA 5LGTA 2FOKA 3KETA 2NYXA 3QP5A 4DQ2A 4TV7A 2K02A 1J9IA 3WTTC 4BNCA 2LSOA 2MBFA 5AIQA 5HLIA 3JAMZ 3I59A 1H9TA 2OBPA 2G7HA 2FBIA 3EQLF 3CTAA 1IAWA 1K78B 4EGYA 2DO7A 5CVRA 1ZN2A 3VEPA 5DV5A 4EJWA 2HOEA 2ZCWA 3EUHA 5D5XB 2DAOA 4LFUA 1ZGJA 4ZYGA 5H6RA 2OD5A 3AAFA 3BJAA 2A3SA 4A5NA 1QO0D 1O7FA 1OKRA 5FFZA 2FXAA 1SD4A 2K4JA 5E18F 1HW2A 1EH8A 2R3SA 4Y15A 1RI7A 2QBYB 1U78A 3K1NA 1PUEE 3V7RA 3GFLA 1CF7B 1BOAA 2HTSA 2PJPA 1KU2A 3HRSA 3LSTA 4I09A 2QLZA 2FE3A 1R5HA 4HV6A 1F1ZA 1FOKA 2EFQA 2IRFG 1QGPA 2HQNA 2DQRA 4S04A 2VBZA 4DNCA 3KLNA 3CLOA 5LHIA 2L4AA 1STZA 5JHUA 3I0TA 4OIQF 5F64A 3Q5FA 5D8LB 3C7JA 2Q0OA 4GXOA 1TLHB 2E1CA 2FSWA 4KDPA 5D4SA 1I5ZA 4HDVA 2CWEA 3F72A 4KA4A 3F3XA 2JSCA 3M1EA 1GHCA 4RAYA 2P4WA 2OAZA 2G7UA 3QOPA 2NS0A 2D45A 2ELHA 3R0AA 5LHHA 4QLCU 4R8HA 3RPQA 2KKOA 2IA1A 4M9ZA 4A5MA 2JZYA 5LLQA 3I53A 3QAHA 1MGTA 2ZFWA 3WTZA 4I98B 3C1DA 3F22A 3BWGA 2QM3A 4IRHA 5ICEA 2QVOA 2HYGD 3TOBA 2V1XA 5DD8A 3WTXC 4IRGA 2WC2A 1S6LA 5ILVA 2PMUA 1YLFA 3J81Z 2K86A 5FB2A 2A68F 4ASNA 5EEHA 4ESJA 3MEXA 5E1WA 2EJRA 4HLYA 2DLLA 4UHTA 5HLGA 4A6EA 4PGGA 3R6SA 2XHKA 4PDKA 3GVAA 3T1BA 4I02A 1U8RA 1E2XA 4BHCA 2ACJA 3HSRA 5E1ZB 2O03A 1K6OA 3L7WA 3GFIA 2JT1A 1YS7A 2KRFA 4HX7A 2VOOA 1TW2A 1OPCA 2GZWA 3ABUA 2FMLA 4M74A 1LNWA 1B59A 1SFEA 3NEUA 4HZFA 2P5KA 2VBWA 3COAC 2Y48A 1S3JA 3MAJA 1MD0A 2GAUA 2W84A 1ZLKA 2V1DA 3LQRA 2IW5A 1QQIA 2MD5A 4UVCA 5D4RA 5ED4A 3JTHA 3PQJA 4A12A 1HBXG 1AWCA 2DFIA 1J59A 1KYWA 1G3TA 5BPIA 3N4MA 3V8JA 5ILSA 1Z91A 3I4PA 2Q8KA 6PAXA 1W5SA 1JXSA 4G8XA 1P4WA 4LK1F 1I1GA 3L9FA 1KU7A 2HYFA 3KP7A 3CO6C 1XSDA 4MQVA 1WQ2A 5ERIA 4YFXF 3RKYA 2YX7A 5HOOA 3GW2A 2FNAA 1LEAA 4BAYA 2CSOA 2QWWA 3DFGA 3LAPA 3KP2A 2P7VB 1MJAA 2ADUA 3ECOA 3GUDA 1KQ8A 1XGMA 1Y0UA 2HZTA 3Q9VA 1J0RA 3CUQB 3P7NA 3WGGA 1U5TA 3R4KA 3DF8A 4ZH4F 2XASA 2XAFA 3MQ0A 2DI3A 1B6AA 3L09A 5D5UB 3QRFF 5BQTA 2F5EA 1IN6A 3RYRA 5FO5A 2XRNA 1ZYRF 5L3GA 5HDGA 3J80K 2FRHA 4Q4ZF 3FM5A 3F8NA 1YW8A 1F9NA 2EB7A 4AWXB 3J7AO 2K7LA 1PP7U 4XLNF 2V6CA 1ZAOA 2P8TA 3SXYA 3BZ6A 2NNNA 1BC7C 3WTYC 1SD7A 2RGVA 3SZTA 1ZH5A 1IXSB 4UUVA 4IF4A 1W4MA 4MEYF 2F5FA 2EFWA 1YS6A 3HHGA 3IKTA 4MNUA 2M1BA 1IF1A 2FQ3A 5TRDA 3RJPA 5ILUA 3U1DA 3DEUA 3IL2A 1XB4A 1UHMA 1QPMA 1L0OC 3LAJA 1FZPB 4IHSA 4RB2C 5E20A 4L9TA 1ZARA 4OU0A 3WU1B 3PQKA 2AXLA 1IW7F 2PFBA 4OINF 2M8EA 4HV5A 2F5CA 2YU3A 1XDSA 2GIVA 1XMKA 1D5VA 4U7BA 3RKXA 3BOQA 4QWQA 3C18A 1EV7A 2WWYA 1MDMB 5JI6A 1R7JA 3MFKA 2VBYA 4N9IA 3KP3A 1IN7A 2QZ8A 1U5TC 1RIOH 3BPXA 4KMUX 5CVVA 1I1SA 2XV4S 3ABTA 4CYDA 4A0YA 3GXOA 4U7DA 2XUBA 4Y13A 1ON1A 4O3MA 1SAXA 1XCVA 2PLYA 4ENKA 5ICCA 2E7WA 2A07F 4PGHA 1XGOA 4OIRF 1LQ1A 2ZBKA 3NRVA 3T0YA 1IN4A 2JRTA 3TO7A 4S05A 2ZNZA 1YW7A 3WGIA 3KEQA 4RB1A 2QQBA 2PN6A 2M5WA 4EGZA 4ENJA 1ZRDA 5K5QA 1GXPA 4LG0B 1D8KA 4OMZA 3BROA 5J8FA 1KU3A 3P9CA 4RGRA 1IN8A 3TGNA 4JBAA 4UV9A 1BI0A 3Q9SA 4H0EA 1HW5A 2R7DA 3F8FA 5HS8A 2GXBA 2ZMEA 2Z99A 2D2WA 4LK0F 1KGSA 1USTA 3I59B 4HF2A 4I01A 3KFWX 5BPDA 1CGPA 2PMHA 1G3SA 3ML6A 2A6HF 1WKMA 4LLLA 1J7KA 2CO5A 1XD7A 2HFHA 4L0YB 2VOPA 3L2CA 2DK8A 3ROUA 5L3DA 4HAMA 5JR3A 1AOYA 1J2XA 1LDKB 2WTEA 3VODA 2COMA 2P7CB 5D8KB 3FX3A 1R23A 4A0XA 2W85A 5BMZA 4EM0B 3ZMSA 1D3YA 4XSZF 1KU9A 3F6OA 3VFZA 3U2RA 2M45A 1V4RA 4RB3C 3TOAA 2EK5A 2TDXA 2GA2A 3IKVA 3FXQA 2STTA 2CQKA 5J6XA 2XAHA 3LA2A 4IJAA 3JAMK 2XAGA 1W7PD 2EV6A 2O0YA 3ZN0A 2UXNA 5LRSA 4YIFA 3V4GA 5EEGA 1J5YA 1XSVA 2VONA 4P55A 4A2UA 2RDPA 3K69A 2STWA 4HF1A 3ULQB 2BYVE 3G3ZA 3KLOA 1JHFA 4KIGA 4LGWA 3ZP5A 4M71A 4G7OF 2ISZA 3VOEA 3M7GA 1FSEA 3ZMDA 2D1VA 2W24A 3CO7C 1SMTA 1JGSA 4UXNA 1VTNC 3FM3A 3HSEA 4XLPF 2XAJA 2FNPA 4HQMA 4NQWA 1ON2A 4OIPF 4M6YA 4L5JA 4ENNA 3ZQ7A 5FD6A 2UZKA 4WXCA 1ODDA 3E5UA 2VE9A 2ZKZA 1P4XA 2IA2A 2XIGA 3TKYA 2ISYA 3DV8A 4P9FA 3SQNA 2NNYA 3DPLC 2H6CA 2F2EA 1WSUA 4BHBA 5IT3A 2YPRA 2LKPA 1IXRC 3KP6A 3LWFA 1A04A 3TDUC 4ON0A 4GCVA 1XN7A 1H0MA 1S7AA 3IC7A 3M8FA 2VODA 1R58A 4XRFA 4EJUA 5FLXZ 3BY6A 3K9TA 1SFXA 3FHZA 4YIIA 2Z9OA 2V9VA 1P2FA 3WTVC 3H3UA 1Z1DA 2OA4A 1QBJA 2CG4A 4U0YA 1O3SA 5LGUA 1SMYF 1XSXA 4G6DA 2BBYA 4KFCA 3I64A 4FT8A 5LRRA 5LEKA 3IWFA 4AIJA 1XMAA 2HS5A 4OIOF 2ZJ2A 4CZZA 3DP7A 4BYYA 1T98A 2PG4A 1HXDA 5K5OA 3CJNA 1ONVA 4G9YA 3QU6A 2ESNA 2QQ9A 4XBFA 5ICGA 4I2OA 4EJTA 3T5XA 2A5YB 5D6EA 2M87A 1GXQA 2X4HA 5A2QK 5BS6A 1IRFA 3RKWA 4MTDA 1Z9CA 1FBQA 1ZRCA 1NHAA 3R60A 1FSHA 2RN7A 5HS9A 4P96A 3RI4A 4Q48A 3SZPA 3QPTA 2PBIA 2DQLA 3IWZA 5LHGA 1U5TB 3GF2A 3E5QA 3ZN1A 3WTWC 4M9SA 3FF5A 1DPRA 3HRUA 2CFXA 2OU2A 5L3EA 1YIOA 4PCQA 1EH6A 1PP8F 4LB6B 1P4AA 2B0LA 4AVPA 1W7PA 1P92A 4EJVA 5DUIA 1LEBA 3FMQA 3LFKA 3K1MA 2RVCA 2H27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHJ A;  3WU0 A;  1I6X A;  2CGP A;  3K2Z A;  4RS8 A;  5KVR A;  1OYI A;  3ZMU A;  4GYG A;  1RUN A;  1IUY A;  4IVN A;  4ZZD A;  1B9M A;  5LGN A;  4P5O A;  2YX4 A;  5CJ9 A;  4L9J A;  4JQF A;  4RGX A;  1K7A A;  1B9N A;  1GVJ A;  3T8T A;  4MEX F;  5IT9 Z;  3E3V A;  1R1U A;  1KYZ A;  2ZXJ A;  1ZG3 A;  4HLX A;  3N97 A;  5BOX A;  3TDZ C;  1ZRE A;  4P9U A;  4CHU A;  1QZY A;  1FYM A;  2EA2 A;  1S7O A;  4EV0 A;  2Z3Y A;  2O61 A;  1WWX A;  5E17 F;  5E1X A;  2FA5 A;  3WG9 A;  3J80 Z;  4MHG A;  4KN7 X;  3D5L A;  5D6F A;  1FP1 D;  4ETS A;  2MH2 A;  4BXU A;  1MJB A;  2L4M A;  4L9V A;  3F6V A;  4GGG A;  4EM1 A;  1YFH A;  1RUO A;  5F6F A;  2ESH A;  5ICF A;  2KIF A;  2LF8 A;  2OZ6 A;  5FFX A;  3U9G A;  1BM9 A;  1R22 A;  3HYI A;  4GYI A;  2O8X A;  4KUM A;  2LF7 A;  1L3L A;  3BDD A;  4A6D A;  4ESB A;  2GA1 A;  4L18 B;  1EH7 A;  2V1U A;  4BH9 A;  2DU9 A;  2FBH A;  5FD5 A;  4KIF A;  3WGH A;  1BC8 C;  4HQE A;  4I0B A;  1Q1H A;  3E6B A;  5JFR A;  3EYY A;  2FU4 A;  3R0J A;  3E6M A;  5DCM A;  2P5V A;  4WXH A;  1SFU A;  2L3D A;  3KZY A;  1R1V A;  4UVA A;  1HW1 A;  3HRT A;  4AIK A;  3KZZ A;  2G9W A;  2LNB A;  4UVB A;  4EMS A;  4G7Z F;  2EWN A;  4ENM A;  2A61 A;  3BJ6 A;  3E5X A;  2V79 A;  1LVA A;  3GLX A;  5TJJ A;  1YTY A;  3M8E A;  2CYY A;  3JW4 A;  3E6C C;  1I27 A;  4L0Z B;  4F7Z A;  3ISP A;  4L5I A;  4D0P A;  1J75 A;  2QYO A;  3KE2 A;  4KT5 C;  4KIB A;  2ZME B;  1IZ1 A;  1KQ0 A;  4UNO A;  1E17 A;  5AON A;  1UCR A;  4KMF A;  4UV8 A;  4FHT A;  1FYK A;  1XGS A;  2FEZ A;  4OOI A;  3O6B B;  4I0A A;  4M6X A;  2W25 A;  1HST A;  1ULY A;  3HUG A;  2YSR A;  3LA3 A;  1Z6R A;  2FBK A;  3SFZ A;  4MQ9 F;  4HX8 A;  3M9A A;  1WI9 A;  3BPV A;  1FC3 A;  2EV0 A;  1O3T A;  3DQV C;  4AD9 A;  1DDN A;  2IT0 A;  2ZNY A;  2JTV A;  4G6Q A;  5D5V B;  3ZPL A;  5CLS A;  2GQQ A;  3RIR A;  3F8B A;  3HRM A;  3KCC A;  3OV8 A;  1IN5 A;  2PEX A;  1JE8 A;  4HOB A;  4GO1 A;  2MLG A;  2RKH A;  2HGC A;  2Z33 A;  3DPT A;  3C3W A;  1G6N A;  2EV5 A;  3RYP A;  3GZ6 A;  2VN2 A;  2MH9 A;  1UFM A;  1F4K A;  1R1T A;  2HKX A;  1HKQ A;  2XKP A;  1DUX C;  3V7C A;  2KJB A;  1XGN A;  3GYH X;  2KIU A;  2FF4 A;  2H94 A;  4R1H A;  3LQQ A;  5CVU A;  2JPC A;  4RAZ A;  1OYW A;  1O57 A;  5HDK A;  3H92 A;  4LB5 A;  3JTG A;  2XRO A;  3VB2 A;  3CUO A;  1TBX A;  4ZZL A;  1RNL A;  4WX9 A;  2LDU A;  3F23 A;  3WTS C;  2XGX A;  5HDN A;  3R61 A;  1K79 A;  4Z2Y A;  1O3Q A;  2W57 A;  2P5L C;  1O3R A;  4LD5 A;  1O7L A;  1V3F A;  4HYE A;  4G7H F;  2RV8 A;  1PDN C;  1MZB A;  1QZZ A;  1T39 A;  1YG2 A;  5J8C A;  3ERE D;  1S8N A;  3IRQ A;  2A69 F;  2E7X A;  4FX0 A;  1LDJ A;  1FP2 A;  2UXX A;  2KIM A;  1MJ9 A;  1YQA A;  4AIH A;  3F8M A;  3HTU A;  4KYW A;  3B02 A;  3F8C A;  3IHU A;  1UB9 A;  2IVM A;  2HTJ A;  3MZY A;  3W6K B;  3EYI A;  1UHW A;  3HSF A;  2MC3 A;  1K78 A;  1BI3 A;  2H6B A;  3RPU A;  4IRI A;  2VT3 A;  2GWR A;  5K5R A;  2D1H A;  2HR3 A;  3DXJ F;  4LLG F;  1T38 A;  3E97 A;  1BBY A;  4CIC A;  2AS5 F;  1ZGA A;  1B4A A;  4CGZ A;  3F21 A;  2HDC A;  2QBY A;  4L9N A;  5DD4 A;  3EET A;  4EVI A;  1FNN A;  1BIB A;  1CF7 A;  4PZJ A;  3ZMZ A;  1F5T A;  4LJZ F;  1FT9 A;  4ESF A;  4HDU A;  3EDP A;  1HKS A;  3HOT A;  2O6G E;  2F5D A;  3WTU C;  2HKO A;  5HLH A;  1YO5 C;  3L00 A;  4YFN F;  2VT2 A;  3K0L A;  3ECH A;  1YYV A;  5FLX K;  4HW0 A;  4N9H A;  1SD6 A;  5CYV A;  3J81 K;  3I5U A;  3ZMT A;  1ZLJ A;  2ZO4 A;  2DPD A;  4WXD A;  3S2W A;  5CVI A;  2QQA A;  4MGR A;  4CO8 A;  3QU3 A;  1X3U A;  3KP5 A;  3E6D A;  3QPH A;  2WV0 A;  5H6Q A;  4WF2 A;  3K1P A;  2QEN A;  4K2E A;  2RC4 A;  2KJC A;  4RGU A;  4ZYH A;  1Z05 A;  1C0W A;  3P9K A;  2PQ8 A;  4RGS A;  1BJA A;  2R7F A;  4MTE A;  3T8R A;  1KQ9 A;  4KN4 X;  1W7P B;  4Y17 A;  1ZRF A;  1FYL A;  1TNS A;  1BN5 A;  2IJL A;  4NB5 A;  2Y75 A;  4XSX F;  3G73 A;  1OYY A;  4U88 A;  5A2Q Z;  3FXU A;  3B73 A;  4KNY A;  2MLK A;  3W6J B;  2DK5 A;  2QUF A;  3TQN A;  5CVJ A;  4EM2 A;  1IRG A;  1FWZ A;  5DUK A;  1FBS A;  3LA7 A;  4O5V A;  3HIF A;  2DTR A;  2EFO A;  5E8I A;  1SD5 A;  1BI1 A;  4YG2 F;  2H09 A;  2DBB A;  1TQI A;  2NRA C;  3TO6 A;  2RNJ A;  2CW0 F;  3CDH A;  2VC1 A;  4ZYE A;  2Q2E A;  4WWC A;  4B09 A;  2XKO A;  2Y0M A;  4CXF A;  5L3B A;  2OQR A;  4U0W A;  1ZHF A;  2OZU A;  4ZYD A;  5JVT A;  1TTY A;  2O3F A;  3FWE A;  3REO A;  4M73 A;  3FMS A;  4O6J A;  5HVQ C;  1G3Y A;  4WK8 F;  3FMR A;  1T2K A;  3GZ5 A;  2OQG A;  3TO9 A;  2IP2 A;  4Q47 A;  2YR2 A;  1G3W A;  4M72 A;  1W5T A;  2MA3 A;  1ZG5 A;  1TQM A;  5IT9 K;  3HHH A;  2DPU A;  3P9I A;  3BJO A;  2K27 A;  3I71 A;  1RZ4 A;  3GWZ A;  3BP8 A;  4KIC A;  1REP C;  2FMY A;  4RB0 A;  4B8X A;  4WCG A;  2P6S A;  2X0L A;  2NAZ A;  5DCM B;  4HX4 A;  3GO5 A;  2EA4 A;  2BE5 F;  1HSJ A;  2GXG A;  2BGC A;  1Z7U A;  2EFN A;  1HKT A;  3ZMV A;  3WE3 A;  5L3C A;  2BEO A;  3NQO A;  2UWM A;  3WOD F;  3GFM A;  5K1Y A;  3SHF A;  3MZH A;  4G94 A;  4YFK F;  3GX4 X;  3HTS B;  3CUQ A;  4HBL A;  1S29 A;  2XAQ A;  1LJ9 A;  4IXA A;  3KEO A;  1R00 A;  1TW3 A;  2Z5U A;  2J5O A;  1H9G A;  2VXZ A;  1LB2 A;  1D8J A;  1T0F A;  4CDG A;  1KA8 A;  3WE2 A;  1DPU A;  1XCB A;  3KP4 A;  5L3F A;  1G4D A;  1QNT A;  5E8G A;  3PFI A;  5AIP A;  1FBU A;  2ETH A;  3H3Z A;  4LMY A;  4HF0 A;  3I54 A;  1IXC A;  2J5P A;  4Q5S F;  2VE8 A;  4R79 A;  4E70 A;  4IHT A;  4OMY A;  4HA8 A;  2L02 A;  3MCZ A;  5DCF A;  2DT5 A;  2BV6 A;  3FXR A;  3DKW A;  1Z6T A;  1FLI A;  4BHP A;  2HEO A;  3IRR A;  3O3K A;  1P6R A;  4U0V A;  1FPQ A;  5HS7 A;  2HQR A;  3O2P E;  2PI0 A;  1R5G A;  5LEJ A;  1FX7 A;  2P6T A;  3RTR A;  4JK1 X;  4M9X A;  1OMI A;  5KK1 A;  4FX4 A;  1R36 A;  5F1R A;  1XDU A;  3GFJ A;  1TNT A;  1DP7 P;  3MWM A;  2HWV A;  2IA0 A;  4EJO A;  3V8K A;  2EFP A;  1T6S A;  3JSP A;  1OR7 A;  5DYM A;  1LDD A;  3GEZ A;  1FY7 A;  4N0B A;  1MDM A;  5LBQ A;  2L54 A;  1ZG1 A;  1TQP A;  3CUQ C;  1WRJ A;  2JPB A;  1JHH A;  3D0S A;  2L01 A;  3I58 A;  1B1B A;  4EQQ A;  1HQC A;  2VC0 A;  5FGM A;  2E1N A;  3V8L A;  3JSO A;  2RQP A;  5H20 A;  1BI2 A;  4A0Z A;  3OOP A;  4LLN A;  2C6Y A;  3RDI A;  3V7S A;  4BQA A;  2A6E F;  1BIA A;  5DEQ A;  2IPQ X;  1U3E M;  1YW9 A;  2XVC A;  4IPA A;  1MKM A;  2DW4 A;  5D5W B;  3FZV A;  5DDG A;  4I7H A;  1U6G A;  2VBX A;  3HOS A;  2K4B A;  4LG0 A;  1U2W A;  2M30 A;  3QP6 A;  1USS A;  3ELK A;  5LGT A;  2FOK A;  3KET A;  2NYX A;  3QP5 A;  4DQ2 A;  4TV7 A;  2K02 A;  1J9I A;  3WTT C;  4BNC A;  2LSO A;  2MBF A;  5AIQ A;  5HLI A;  3JAM Z;  3I59 A;  1H9T A;  2OBP A;  2G7H A;  2FBI A;  3EQL F;  3CTA A;  1IAW A;  1K78 B;  4EGY A;  2DO7 A;  5CVR A;  1ZN2 A;  3VEP A;  5DV5 A;  4EJW A;  2HOE A;  2ZCW A;  3EUH A;  5D5X B;  2DAO A;  4LFU A;  1ZGJ A;  4ZYG A;  5H6R A;  2OD5 A;  3AAF A;  3BJA A;  2A3S A;  4A5N A;  1QO0 D;  1O7F A;  1OKR A;  5FFZ A;  2FXA A;  1SD4 A;  2K4J A;  5E18 F;  1HW2 A;  1EH8 A;  2R3S A;  4Y15 A;  1RI7 A;  2QBY B;  1U78 A;  3K1N A;  1PUE E;  3V7R A;  3GFL A;  1CF7 B;  1BOA A;  2HTS A;  2PJP A;  1KU2 A;  3HRS A;  3LST A;  4I09 A;  2QLZ A;  2FE3 A;  1R5H A;  4HV6 A;  1F1Z A;  1FOK A;  2EFQ A;  2IRF G;  1QGP A;  2HQN A;  2DQR A;  4S04 A;  2VBZ A;  4DNC A;  3KLN A;  3CLO A;  5LHI A;  2L4A A;  1STZ A;  5JHU A;  3I0T A;  4OIQ F;  5F64 A;  3Q5F A;  5D8L B;  3C7J A;  2Q0O A;  4GXO A;  1TLH B;  2E1C A;  2FSW A;  4KDP A;  5D4S A;  1I5Z A;  4HDV A;  2CWE A;  3F72 A;  4KA4 A;  3F3X A;  2JSC A;  3M1E A;  1GHC A;  4RAY A;  2P4W A;  2OAZ A;  2G7U A;  3QOP A;  2NS0 A;  2D45 A;  2ELH A;  3R0A A;  5LHH A;  4QLC U;  4R8H A;  3RPQ A;  2KKO A;  2IA1 A;  4M9Z A;  4A5M A;  2JZY A;  5LLQ A;  3I53 A;  3QAH A;  1MGT A;  2ZFW A;  3WTZ A;  4I98 B;  3C1D A;  3F22 A;  3BWG A;  2QM3 A;  4IRH A;  5ICE A;  2QVO A;  2HYG D;  3TOB A;  2V1X A;  5DD8 A;  3WTX C;  4IRG A;  2WC2 A;  1S6L A;  5ILV A;  2PMU A;  1YLF A;  3J81 Z;  2K86 A;  5FB2 A;  2A68 F;  4ASN A;  5EEH A;  4ESJ A;  3MEX A;  5E1W A;  2EJR A;  4HLY A;  2DLL A;  4UHT A;  5HLG A;  4A6E A;  4PGG A;  3R6S A;  2XHK A;  4PDK A;  3GVA A;  3T1B A;  4I02 A;  1U8R A;  1E2X A;  4BHC A;  2ACJ A;  3HSR A;  5E1Z B;  2O03 A;  1K6O A;  3L7W A;  3GFI A;  2JT1 A;  1YS7 A;  2KRF A;  4HX7 A;  2VOO A;  1TW2 A;  1OPC A;  2GZW A;  3ABU A;  2FML A;  4M74 A;  1LNW A;  1B59 A;  1SFE A;  3NEU A;  4HZF A;  2P5K A;  2VBW A;  3COA C;  2Y48 A;  1S3J A;  3MAJ A;  1MD0 A;  2GAU A;  2W84 A;  1ZLK A;  2V1D A;  3LQR A;  2IW5 A;  1QQI A;  2MD5 A;  4UVC A;  5D4R A;  5ED4 A;  3JTH A;  3PQJ A;  4A12 A;  1HBX G;  1AWC A;  2DFI A;  1J59 A;  1KYW A;  1G3T A;  5BPI A;  3N4M A;  3V8J A;  5ILS A;  1Z91 A;  3I4P A;  2Q8K A;  6PAX A;  1W5S A;  1JXS A;  4G8X A;  1P4W A;  4LK1 F;  1I1G A;  3L9F A;  1KU7 A;  2HYF A;  3KP7 A;  3CO6 C;  1XSD A;  4MQV A;  1WQ2 A;  5ERI A;  4YFX F;  3RKY A;  2YX7 A;  5HOO A;  3GW2 A;  2FNA A;  1LEA A;  4BAY A;  2CSO A;  2QWW A;  3DFG A;  3LAP A;  3KP2 A;  2P7V B;  1MJA A;  2ADU A;  3ECO A;  3GUD A;  1KQ8 A;  1XGM A;  1Y0U A;  2HZT A;  3Q9V A;  1J0R A;  3CUQ B;  3P7N A;  3WGG A;  1U5T A;  3R4K A;  3DF8 A;  4ZH4 F;  2XAS A;  2XAF A;  3MQ0 A;  2DI3 A;  1B6A A;  3L09 A;  5D5U B;  3QRF F;  5BQT A;  2F5E A;  1IN6 A;  3RYR A;  5FO5 A;  2XRN A;  1ZYR F;  5L3G A;  5HDG A;  3J80 K;  2FRH A;  4Q4Z F;  3FM5 A;  3F8N A;  1YW8 A;  1F9N A;  2EB7 A;  4AWX B;  3J7A O;  2K7L A;  1PP7 U;  4XLN F;  2V6C A;  1ZAO A;  2P8T A;  3SXY A;  3BZ6 A;  2NNN A;  1BC7 C;  3WTY C;  1SD7 A;  2RGV A;  3SZT A;  1ZH5 A;  1IXS B;  4UUV A;  4IF4 A;  1W4M A;  4MEY F;  2F5F A;  2EFW A;  1YS6 A;  3HHG A;  3IKT A;  4MNU A;  2M1B A;  1IF1 A;  2FQ3 A;  5TRD A;  3RJP A;  5ILU A;  3U1D A;  3DEU A;  3IL2 A;  1XB4 A;  1UHM A;  1QPM A;  1L0O C;  3LAJ A;  1FZP B;  4IHS A;  4RB2 C;  5E20 A;  4L9T A;  1ZAR A;  4OU0 A;  3WU1 B;  3PQK A;  2AXL A;  1IW7 F;  2PFB A;  4OIN F;  2M8E A;  4HV5 A;  2F5C A;  2YU3 A;  1XDS A;  2GIV A;  1XMK A;  1D5V A;  4U7B A;  3RKX A;  3BOQ A;  4QWQ A;  3C18 A;  1EV7 A;  2WWY A;  1MDM B;  5JI6 A;  1R7J A;  3MFK A;  2VBY A;  4N9I A;  3KP3 A;  1IN7 A;  2QZ8 A;  1U5T C;  1RIO H;  3BPX A;  4KMU X;  5CVV A;  1I1S A;  2XV4 S;  3ABT A;  4CYD A;  4A0Y A;  3GXO A;  4U7D A;  2XUB A;  4Y13 A;  1ON1 A;  4O3M A;  1SAX A;  1XCV A;  2PLY A;  4ENK A;  5ICC A;  2E7W A;  2A07 F;  4PGH A;  1XGO A;  4OIR F;  1LQ1 A;  2ZBK A;  3NRV A;  3T0Y A;  1IN4 A;  2JRT A;  3TO7 A;  4S05 A;  2ZNZ A;  1YW7 A;  3WGI A;  3KEQ A;  4RB1 A;  2QQB A;  2PN6 A;  2M5W A;  4EGZ A;  4ENJ A;  1ZRD A;  5K5Q A;  1GXP A;  4LG0 B;  1D8K A;  4OMZ A;  3BRO A;  5J8F A;  1KU3 A;  3P9C A;  4RGR A;  1IN8 A;  3TGN A;  4JBA A;  4UV9 A;  1BI0 A;  3Q9S A;  4H0E A;  1HW5 A;  2R7D A;  3F8F A;  5HS8 A;  2GXB A;  2ZME A;  2Z99 A;  2D2W A;  4LK0 F;  1KGS A;  1UST A;  3I59 B;  4HF2 A;  4I01 A;  3KFW X;  5BPD A;  1CGP A;  2PMH A;  1G3S A;  3ML6 A;  2A6H F;  1WKM A;  4LLL A;  1J7K A;  2CO5 A;  1XD7 A;  2HFH A;  4L0Y B;  2VOP A;  3L2C A;  2DK8 A;  3ROU A;  5L3D A;  4HAM A;  5JR3 A;  1AOY A;  1J2X A;  1LDK B;  2WTE A;  3VOD A;  2COM A;  2P7C B;  5D8K B;  3FX3 A;  1R23 A;  4A0X A;  2W85 A;  5BMZ A;  4EM0 B;  3ZMS A;  1D3Y A;  4XSZ F;  1KU9 A;  3F6O A;  3VFZ A;  3U2R A;  2M45 A;  1V4R A;  4RB3 C;  3TOA A;  2EK5 A;  2TDX A;  2GA2 A;  3IKV A;  3FXQ A;  2STT A;  2CQK A;  5J6X A;  2XAH A;  3LA2 A;  4IJA A;  3JAM K;  2XAG A;  1W7P D;  2EV6 A;  2O0Y A;  3ZN0 A;  2UXN A;  5LRS A;  4YIF A;  3V4G A;  5EEG A;  1J5Y A;  1XSV A;  2VON A;  4P55 A;  4A2U A;  2RDP A;  3K69 A;  2STW A;  4HF1 A;  3ULQ B;  2BYV E;  3G3Z A;  3KLO A;  1JHF A;  4KIG A;  4LGW A;  3ZP5 A;  4M71 A;  4G7O F;  2ISZ A;  3VOE A;  3M7G A;  1FSE A;  3ZMD A;  2D1V A;  2W24 A;  3CO7 C;  1SMT A;  1JGS A;  4UXN A;  1VTN C;  3FM3 A;  3HSE A;  4XLP F;  2XAJ A;  2FNP A;  4HQM A;  4NQW A;  1ON2 A;  4OIP F;  4M6Y A;  4L5J A;  4ENN A;  3ZQ7 A;  5FD6 A;  2UZK A;  4WXC A;  1ODD A;  3E5U A;  2VE9 A;  2ZKZ A;  1P4X A;  2IA2 A;  2XIG A;  3TKY A;  2ISY A;  3DV8 A;  4P9F A;  3SQN A;  2NNY A;  3DPL C;  2H6C A;  2F2E A;  1WSU A;  4BHB A;  5IT3 A;  2YPR A;  2LKP A;  1IXR C;  3KP6 A;  3LWF A;  1A04 A;  3TDU C;  4ON0 A;  4GCV A;  1XN7 A;  1H0M A;  1S7A A;  3IC7 A;  3M8F A;  2VOD A;  1R58 A;  4XRF A;  4EJU A;  5FLX Z;  3BY6 A;  3K9T A;  1SFX A;  3FHZ A;  4YII A;  2Z9O A;  2V9V A;  1P2F A;  3WTV C;  3H3U A;  1Z1D A;  2OA4 A;  1QBJ A;  2CG4 A;  4U0Y A;  1O3S A;  5LGU A;  1SMY F;  1XSX A;  4G6D A;  2BBY A;  4KFC A;  3I64 A;  4FT8 A;  5LRR A;  5LEK A;  3IWF A;  4AIJ A;  1XMA A;  2HS5 A;  4OIO F;  2ZJ2 A;  4CZZ A;  3DP7 A;  4BYY A;  1T98 A;  2PG4 A;  1HXD A;  5K5O A;  3CJN A;  1ONV A;  4G9Y A;  3QU6 A;  2ESN A;  2QQ9 A;  4XBF A;  5ICG A;  4I2O A;  4EJT A;  3T5X A;  2A5Y B;  5D6E A;  2M87 A;  1GXQ A;  2X4H A;  5A2Q K;  5BS6 A;  1IRF A;  3RKW A;  4MTD A;  1Z9C A;  1FBQ A;  1ZRC A;  1NHA A;  3R60 A;  1FSH A;  2RN7 A;  5HS9 A;  4P96 A;  3RI4 A;  4Q48 A;  3SZP A;  3QPT A;  2PBI A;  2DQL A;  3IWZ A;  5LHG A;  1U5T B;  3GF2 A;  3E5Q A;  3ZN1 A;  3WTW C;  4M9S A;  3FF5 A;  1DPR A;  3HRU A;  2CFX A;  2OU2 A;  5L3E A;  1YIO A;  4PCQ A;  1EH6 A;  1PP8 F;  4LB6 B;  1P4A A;  2B0L A;  4AVP A;  1W7P A;  1P92 A;  4EJV A;  5DUI A;  1LEB A;  3FMQ A;  3LFK A;  3K1M A;  2RVC A;  2H27 A; 
#chains in the Genus database with same CATH topology
 4B3A A;  3ASN H;  4NHJ A;  3WU0 A;  1ZEL A;  1I6X A;  1WZ2 A;  4DGW B;  1QVT A;  2CGP A;  3K2Z A;  4RS8 A;  3A01 B;  5KVR A;  2JK3 A;  2JRM A;  1ETV A;  1OYI A;  3SEQ A;  1RR8 C;  1OIS A;  3ZMU A;  4GYG A;  2LRD A;  1RUN A;  1IUY A;  4IVN A;  3S1N J;  4A3G J;  4ZZD A;  1B9M A;  4XKW A;  3EPZ A;  5LGN A;  2R5Y A;  4P5O A;  1K61 A;  2YX4 A;  1YX3 A;  5CJ9 A;  3FBI B;  3BR6 A;  2E71 A;  4JQF A;  4L9J A;  4F93 B;  4RGX A;  1K7A A;  2QSF X;  1B9N A;  1SFO J;  4NC6 A;  1GVJ A;  2L7F P;  3T8T A;  4MEX F;  3OS1 A;  1IRX A;  4AYB A;  1UZC A;  5IT9 Z;  3E3V A;  1R1U A;  4RA2 A;  1KYZ A;  2ZXJ A;  2EH3 A;  1ZG3 A;  3MKL A;  5EZG A;  4HLX A;  2BVL A;  4JX5 A;  2BY2 A;  4X0G A;  4M3B A;  2E19 A;  3N97 A;  5BOX A;  1U9N A;  2XF5 A;  5M5W J;  3TDZ C;  1ZRE A;  3TW6 A;  4P9U A;  3JRG A;  4CHU A;  4CCM A;  2KZG A;  1QZY A;  1FYM A;  2EA2 A;  1S7O A;  4EV0 A;  3SJM A;  2Z3Y A;  1ZR4 A;  2O61 A;  3BTC A;  4IX7 A;  4IZZ A;  1WWX A;  4C2T A;  5E17 F;  5E1X A;  1PJR A;  2FA5 A;  2KDO A;  3WG9 A;  1VQO I;  3J80 Z;  3N05 A;  2QCO A;  2VXD A;  4MHG A;  3ZR8 X;  4KN7 X;  3D5L A;  5D6F A;  1FP1 D;  4ETS A;  5B5E C;  2MH2 A;  4BXU A;  3MVP A;  1MJB A;  2A6T A;  2ZSI B;  3K10 A;  2L4M A;  3M8J A;  2B7E A;  4L9V A;  1RPW A;  3CC7 I;  2K5C A;  3GLL A;  3KZI C;  4Y52 J;  3IH3 A;  4HPQ A;  1WJ5 A;  3F6V A;  4GGG A;  4HEA 2;  4CYC B;  1X1B A;  1TWH J;  4EM1 A;  1YFH A;  1TT0 A;  1RUO A;  3AG4 H;  4UUS A;  5F6F A;  2ESH A;  5ICF A;  2KIF A;  2DYR H;  2LF8 A;  2OZ6 A;  4PFP A;  5FFX A;  4B43 A;  1BM9 A;  3U9G A;  1R22 A;  3HYI A;  1MND A;  1XTA A;  2O8X A;  4GYI A;  2XAU A;  3HGG A;  2KQR A;  1Y39 A;  4KUM A;  1G2H A;  1PUF A;  2LF7 A;  3OYN A;  1BJZ A;  3DBR B;  1L3L A;  3BDD A;  3OIO A;  4H4K C;  4A6D A;  4ESB A;  2GA1 A;  1RC9 A;  4L18 B;  3AL0 C;  1EH7 A;  2V1U A;  4BH9 A;  1TWG J;  2DU9 A;  2FBH A;  3S3M A;  5FD5 A;  4KIF A;  1JKP C;  3WGH A;  2DMU A;  1BC8 C;  4HQE A;  4I0B A;  3OYG A;  1Q1H A;  3C2G A;  3E6B A;  1JI8 A;  5JFR A;  5K7F A;  3EYY A;  2FU4 A;  3RPU D;  1UHS A;  3R0J A;  3A4C A;  4PUS A;  3E6M A;  5KAI C;  2K3P A;  5DCM A;  2P5V A;  1UJ8 A;  2WY8 Q;  4II2 A;  3OWT A;  3H9Q A;  4WXH A;  2O9L A;  1VZ0 A;  2BW3 B;  4XKV A;  2WBM A;  1SFU A;  4JX6 A;  3ZGK A;  2L3D A;  4F91 B;  4F52 A;  3FIW A;  1VFC A;  3KZY A;  1R1V A;  5F0C A;  1UG0 A;  2ZXI A;  4IEJ A;  4UVA A;  1HW1 A;  3HRT A;  1TL8 A;  4RM2 A;  4AIK A;  3KZZ A;  2G9W A;  2LNB A;  4UVB A;  4EMS A;  4G7Z F;  2EWN A;  4ENM A;  1MNE A;  1H88 C;  2QSG X;  2A61 A;  3BJ6 A;  3E5X A;  2V79 A;  1LVA A;  3GLX A;  5TJJ A;  3JR9 A;  3M8E A;  1YTY A;  2CYY A;  3ASO H;  1OCO H;  3JW4 A;  3E6C C;  1I27 A;  3MD2 A;  4BEH B;  4L0Z B;  3OYM A;  3I55 I;  4F7Z A;  2CH0 A;  3ISP A;  4L5I A;  4D0P A;  1J75 A;  2MGQ A;  3DTI A;  2QYO A;  3U21 A;  3KE2 A;  4KT5 C;  4KIB A;  1TWF J;  2DOA A;  3KYD B;  2ZME B;  5H2F C;  2MFZ A;  1IZ1 A;  1KQ0 A;  4UNO A;  4BXX J;  1E17 A;  5AON A;  1UCR A;  1FMV A;  4YEL A;  4AM3 A;  5JLW A;  4KMF A;  4UV8 A;  3WU2 C;  2EZH A;  3K70 D;  4FHT A;  1JT0 A;  2UV1 A;  4OAY A;  3QPL A;  1QRY A;  2EBI A;  1FYK A;  2DXI A;  1XGS A;  2FEZ A;  3MZ8 A;  4OOI A;  3KEY A;  3O6B B;  4I0A A;  1YOV B;  4M6X A;  2W25 A;  2Q1Z B;  1HST A;  1ULY A;  5J1U A;  3HUG A;  1FIA A;  4IHV A;  1EKE A;  2YSR A;  2IS6 A;  2DOF A;  1Z6R A;  3LA3 A;  2YUS A;  3BTI A;  2FBK A;  3SFZ A;  3H36 A;  4MQ9 F;  1IDZ A;  2KPM A;  4HX8 A;  3M9A A;  2CJJ A;  4BE0 A;  1WI9 A;  3BPV A;  1FC3 A;  4F55 A;  3FXL A;  1VI0 A;  2EV0 A;  1O3T A;  3DQV C;  4AD9 A;  1DDN A;  2IT0 A;  2ZNY A;  2JTV A;  5IYC J;  5BNG A;  4G6Q A;  2CFO A;  5D5V B;  3ZPL A;  5CLS A;  2KT0 A;  2NVU B;  3BQY A;  2GQQ A;  3RIR A;  3CJQ B;  3F8B A;  4BAC A;  3HRM A;  3KCC A;  2LVS A;  1GLN A;  3OV8 A;  1IN5 A;  4HST A;  4Y7N J;  3W6V A;  1GT0 C;  2PEX A;  2DMP A;  1H89 C;  1JE8 A;  2CQ7 A;  4CUG A;  4HOB A;  4GO1 A;  4C2M J;  2MLG A;  2RKH A;  2HDW A;  1N77 A;  2HI3 A;  5GPC A;  2HGC A;  3KYL A;  2Z33 A;  3DPT A;  2DA1 A;  3C3W A;  1G6N A;  2EV5 A;  2ID6 A;  3Q0V A;  2IXS A;  1GDT A;  1D1C A;  2GM4 A;  5CQE A;  3RYP A;  3OIP A;  2ELK A;  5F0F A;  3CCM I;  2Y69 H;  3GZ6 A;  2HYJ A;  2VN2 A;  2MH9 A;  3ZQH A;  1UFM A;  1F4K A;  3J7A Y;  2JUC A;  1WJD A;  3JRI A;  1R1T A;  2HKX A;  3E1S A;  1HKQ A;  3ZQI A;  2XKP A;  1DGW Y;  4AYB N;  1DUX C;  3V7C A;  2KJB A;  1XGN A;  3GYH X;  4XOR A;  2LRE A;  2GBY A;  2KIU A;  2FF4 A;  3EUA A;  3ESW B;  3S1M J;  2H94 A;  4R1H A;  4HNV A;  5IP9 J;  3LQQ A;  4XLF A;  1HLV A;  2VKD A;  5KHD A;  5CVU A;  2GXA A;  2JPC A;  4RAZ A;  3CCQ I;  1MBF A;  1OYW A;  1O57 A;  3JRC A;  3VSK A;  2V9P A;  5HDK A;  3H92 A;  4LB5 A;  3JTG A;  3K4C A;  3VB2 A;  2XRO A;  5FRM A;  1MNM C;  1IG7 A;  2QKM B;  3CUO A;  1TBX A;  4IQJ A;  2DT7 B;  4UB8 C;  3ZQL A;  3ABL H;  2NVX J;  2RQQ A;  3HDD A;  5EG0 A;  4ZZL A;  2XGC A;  1U8B A;  2UUZ A;  1RNL A;  4WX9 A;  3ZQC A;  2LDU A;  3F23 A;  3WTS C;  2XGX A;  2ZJQ F;  4UB6 C;  2VUM J;  4NQW B;  5HDN A;  2CV1 A;  3R61 A;  3PUB A;  1Z3Y A;  1K79 A;  3DWL E;  4Z2Y A;  2K9N A;  1O3Q A;  4JX4 A;  2W57 A;  2CW8 A;  2P5L C;  1O3R A;  2O8K A;  3OYA A;  5FKK A;  1Y6I A;  5FRN A;  4LD5 A;  1O7L A;  1V3F A;  4HYE A;  1DQU A;  1WJA A;  3OYC A;  1ERD A;  4G7H F;  4LOC A;  1NK2 P;  1MSE C;  1FMW A;  2I5U A;  4PJL A;  2RV8 A;  1PDN C;  1JTY A;  3WHB A;  2I8D A;  1MZB A;  2K3F A;  3DLA A;  1POG A;  1BW6 A;  1QZZ A;  1T39 A;  2E60 A;  1YG2 A;  2BXY A;  3TBI A;  5J8C A;  5B66 C;  3ERE D;  1LE8 A;  3W2V A;  3CCJ I;  3VYS B;  1S8N A;  3IRQ A;  2A69 F;  1R4N B;  2E7X A;  4FX0 A;  1LDJ A;  1FP2 A;  2LBF A;  2UXX A;  1E0E A;  2KIM A;  4J19 A;  1MJ9 A;  4CA0 A;  3GTM J;  2LTP A;  1K6Y A;  1YQA A;  4A3I J;  4AIH A;  3H5N A;  3F8M A;  2LOO A;  3H9J A;  4L5E A;  3HTU A;  3LOC A;  4KYW A;  1OFC X;  3B02 A;  2HOT A;  3F8C A;  3IHU A;  1UB9 A;  3IP4 B;  1KON A;  2F4O B;  2IVM A;  2HTJ A;  3FBN B;  3PUF A;  3MZY A;  5FKN A;  3W6K B;  4DOZ A;  1MMS A;  2R5Z B;  3EYI A;  1UHW A;  3HSF A;  2MC3 A;  1K78 A;  2FD5 A;  1BI3 A;  1ETW A;  2H6B A;  3RPU A;  1JUS A;  4IRI A;  2VT3 A;  2GWR A;  5K5R A;  3J7Y J;  1HA8 A;  3W2W A;  3M3Y J;  1VQM I;  2D1H A;  1Q1V A;  2KL4 A;  1A36 A;  2HR3 A;  3ZQG A;  3DXJ F;  3MKW B;  5B1A H;  3GTK J;  1V54 H;  4KJZ A;  4LLG F;  1T38 A;  1BR4 A;  3E97 A;  1BBY A;  2ME0 A;  4CIC A;  2V7F A;  2LH9 A;  2AS5 F;  2VJ5 A;  1ZGA A;  2FOW A;  1B4A A;  4CGZ A;  1Z3X A;  3F21 A;  3S93 A;  1BR1 A;  5C4J J;  2HDC A;  2QBY A;  4L9N A;  5DD4 A;  3EET A;  3UR3 C;  4EVI A;  2LR8 A;  1FNN A;  1BIB A;  1CF7 A;  2VL8 A;  4PZJ A;  1F36 A;  3ZMZ A;  2L0K A;  3PFY A;  4E7I A;  4I99 C;  1F5T A;  2DA4 A;  2X6O A;  4LJZ F;  1FT9 A;  4ESF A;  4HDU A;  1TP4 A;  3EDP A;  1SVL A;  4CSW A;  5HNH A;  1HKS A;  3VDX A;  4ZTF A;  4RLQ A;  3HOT A;  2O6G E;  2XC7 A;  4BQO A;  2BOL A;  2EZL A;  3DTK A;  3O8G A;  2B9S A;  4AUX A;  2R7U A;  2F5D A;  1IRZ A;  3WTU C;  2DYS H;  2HKO A;  2LY9 A;  2R7Z J;  1OCZ H;  5HLH A;  1B72 A;  2WAF A;  2VPR A;  1YO5 C;  3L00 A;  4YFN F;  3W3C A;  2VT2 A;  1T8I A;  3K0L A;  1R6R A;  3ECH A;  1YYV A;  5FLX K;  4HW0 A;  1JTX A;  4N9H A;  1SD6 A;  2YS9 A;  5CYV A;  3AG3 H;  1QZE A;  3HC7 A;  5IPA A;  3J81 K;  1VQ4 I;  3I5U A;  4XLE A;  3ZMT A;  2V26 A;  3G2B A;  1ZLJ A;  2ZO4 A;  4DIQ A;  5M3M J;  2X9D A;  2DPD A;  3F0C A;  3H0G J;  3QPS A;  4WXD A;  2QQA A;  5CVI A;  3S2W A;  3OR2 C;  4XMY A;  4MGR A;  4CO8 A;  2JMW A;  3LSI A;  1X3U A;  2F5V A;  2IEK A;  2MAB A;  2MW8 A;  3KP5 A;  3QU3 A;  3HXL A;  4V2F A;  1M1E B;  2LY1 A;  3UKG A;  1VQP I;  3E6D A;  4XKC A;  1XG1 A;  2L7K A;  4MIM A;  3QPH A;  2WV0 A;  5H6Q A;  3AL0 B;  4WF2 A;  1S5L C;  1X2M A;  3K1P A;  2IS2 A;  1IGN A;  2JVG A;  2QEN A;  4XRS G;  4K2E A;  2RC4 A;  2KJC A;  4RGU A;  4B44 A;  4ZYH A;  1Z05 A;  1C0W A;  1WJE A;  3P9K A;  2BHZ A;  2PQ8 A;  2F4I A;  4RGS A;  4YEJ A;  1BJA A;  2R7F A;  1JKR C;  4MTE A;  3T8R A;  1KQ9 A;  2DOD A;  4KN4 X;  1W7P B;  2ZSH B;  4Y17 A;  1ZRF A;  3Q0W A;  2XSD C;  1FYL A;  1ZQ3 P;  4AC0 A;  3IH2 A;  2VI6 A;  1S9H A;  5M5Y J;  1TNS A;  1BN5 A;  2ZC2 A;  2IJL A;  1VND A;  4NB5 A;  3CJT B;  2Y75 A;  4XSX F;  3PM1 A;  1WHU A;  1JGG A;  1VQ8 I;  2OF7 A;  3G73 A;  4A3K J;  2O7O A;  3OL4 A;  1OYY A;  2DN0 A;  4U88 A;  5A2Q Z;  3PIO F;  4E7K A;  3Q0U A;  4BY1 J;  1D1B A;  1MBK A;  5GAD J;  3FXU A;  3B73 A;  1HF0 A;  4KNY A;  1R4M B;  2E2H J;  4ZDP A;  4XQF A;  2MLK A;  3W6J B;  2DK5 A;  4PJJ A;  1ETQ A;  2E5Z A;  2R5Y B;  2QUF A;  3NWS A;  3TQN A;  4XL9 A;  5CVJ A;  4PJM A;  3DTE A;  4EM2 A;  5GAE J;  1IRG A;  1Z21 A;  2F6C A;  5CKT A;  1FWZ A;  5DUK A;  1FBS A;  3LA7 A;  4O5V A;  3HIF A;  2DA5 A;  1P9Q C;  3KIO A;  2DTR A;  2EFO A;  2W00 A;  3TED A;  1XMX A;  1Z0X A;  5E8I A;  5DM6 F;  3IAM 2;  4I6Z A;  3SYT A;  1SD5 A;  1BI1 A;  4YG2 F;  1BOB A;  3GTO J;  2H09 A;  4MO7 A;  2DBB A;  2G0E A;  3KYC B;  1TQI A;  4BJ5 C;  3TO6 A;  2NRA C;  2JA2 A;  2RNJ A;  2CQN A;  2QQ8 A;  2CW0 F;  1Z7L A;  3CDH A;  1R9T J;  2VC1 A;  3K4K A;  4A3D J;  4ZYE A;  3BR1 A;  3BT9 A;  2Q2E A;  2EZK A;  4WWC A;  3K70 C;  4OAZ A;  4B09 A;  2XKO A;  2Y0M A;  4CXF A;  5M5X J;  5L3B A;  2OQR A;  4U0W A;  1ZHF A;  2OZU A;  4ZYD A;  1RR7 A;  3BC8 A;  5JVT A;  4XIC A;  1QHH D;  1TTY A;  3PL8 A;  2O3F A;  3FWE A;  3ZOB A;  3REO A;  3UNG C;  4M73 A;  1A6I A;  3FMS A;  2LC2 A;  1UEL B;  3ONQ A;  4NUB A;  4O6J A;  4ANJ A;  2HDD A;  2X1C A;  3S8P A;  1QU3 A;  4AVZ A;  5HVQ C;  1G3Y A;  4WK8 F;  3FMR A;  1T2K A;  3GZ5 A;  3TP3 A;  2OQG A;  4UUS B;  3TO9 A;  2IP2 A;  4Q47 A;  2X85 A;  2YR2 A;  3K2A A;  1G3W A;  3C2H A;  4M72 A;  1W5T A;  2IGO A;  2MA3 A;  1ZG5 A;  2ELJ A;  2M2E A;  1PUF B;  1TQM A;  2HVR A;  5IT9 K;  5F08 A;  1MW7 A;  3VYU B;  5FJ8 J;  3HHH A;  2FX0 A;  2DPU A;  5C3E J;  3P9I A;  5E3L A;  3BJO A;  2K27 A;  3I71 A;  1RZ4 A;  2ZJR F;  2VQH A;  3GWZ A;  3BP8 A;  4KIC A;  1REP C;  3CF2 A;  2FMY A;  4RB0 A;  2NXN B;  4B8X A;  4WCG A;  4RM3 A;  1X58 A;  1MBH A;  2P6S A;  3HM5 A;  2VB6 A;  1JUP A;  2NAZ A;  2X0L A;  5DCM B;  3B6C A;  4HX4 A;  2R0Q C;  3JRB A;  3GO5 A;  2AQE A;  2E35 A;  1D5Y A;  2EA4 A;  2BE5 F;  1NG7 A;  5B1B H;  3U1K A;  1HSJ A;  4XRM A;  4YRV A;  4A3E J;  4PJN A;  2GXG A;  3BG6 A;  2BGC A;  5FRO A;  1Z7U A;  2EFN A;  1HKT A;  3ZMV A;  3WE3 A;  5IOZ A;  2BEO A;  5L3C A;  3GTL J;  2GOM A;  3G1O A;  4P1W A;  3NQO A;  2HQ5 A;  2UWM A;  3WOD F;  2DMQ A;  1WI3 A;  4GRI A;  1OQY A;  2BZT A;  2LK2 A;  3FXJ A;  3GFM A;  5K1Y A;  2X1D A;  4FE4 A;  1T56 A;  3SHF A;  2RAE A;  3MZH A;  4G94 A;  4YFK F;  2R7Q A;  3GX4 X;  4A3L J;  3HTS B;  3CUQ A;  4HBL A;  2R7T A;  3S16 J;  1S29 A;  3KX2 A;  2V1N A;  1HDD C;  2XAQ A;  1LJ9 A;  4IXA A;  4N4N B;  3KEO A;  1R00 A;  1TW3 A;  2Z5U A;  2J5O A;  1H9G A;  2VXZ A;  3L1P A;  2LG4 A;  2ME6 A;  1UMQ A;  1P7J A;  3S1R J;  1S7E A;  3HZJ A;  1LB2 A;  1WFX A;  1D8J A;  1T0F A;  4CDG A;  1KA8 A;  5GTH C;  4IO9 F;  3WE2 A;  1DPU A;  1XCB A;  3KP4 A;  5L3F A;  3OS2 A;  1QNT A;  1G4D A;  2IAI A;  1TC3 C;  5E8G A;  3ABM H;  3PFI A;  1RES A;  5AIP A;  1AU7 A;  1R5I D;  1FBU A;  9ANT A;  2ETH A;  2QEX I;  3A2K A;  3H3Z A;  1YJW I;  4LMY A;  4HF0 A;  1IUF A;  1I50 J;  2MC4 A;  1VQN I;  3I54 A;  1IXC A;  2J5P A;  2PX9 A;  3DBL B;  4Q5S F;  1FJL A;  2K40 A;  2VE8 A;  3HUG B;  4R79 A;  4E70 A;  4IHT A;  5C44 J;  3SDB A;  3K6G A;  2HQA A;  3OOU A;  2VJJ A;  4B3X A;  4IHW A;  1RET A;  1A35 A;  4C3I J;  1H8A C;  4HA8 A;  2L02 A;  4OMY A;  2EZI A;  3MCZ A;  5DCF A;  2DT5 A;  1MMA A;  3GTG J;  3FIS A;  2Y0S A;  2HXI A;  2MSY A;  2BV6 A;  3X2Q H;  4UY8 I;  3OYJ A;  3FXR A;  3DKW A;  3CZ6 A;  4RAG A;  1Z6T A;  1FLI A;  1Z67 A;  4BHP A;  2HEO A;  4BU2 A;  3IRR A;  1Z77 A;  3O3K A;  3CCE I;  4BDZ A;  4XOT A;  3LSP A;  3OYE A;  3LNQ A;  3K4J A;  1CQT A;  2HPM A;  2X6W A;  1P6R A;  4U0V A;  1FPQ A;  5HS7 A;  2HQR A;  3O2P E;  1IV6 A;  2PI0 A;  2WA0 A;  3HOZ J;  1R5G A;  5B3S H;  3H1C A;  5LEJ A;  2CRG A;  1DGR M;  4G6T B;  3QOE A;  1FX7 A;  1YE9 A;  5JVG F;  2P6T A;  3RTR A;  2L5Q A;  3CCR I;  2VKH A;  5GAH J;  4JK1 X;  3HOV J;  4M9X A;  1OMI A;  5KK1 A;  4XID A;  1R36 A;  5F1R A;  4FX4 A;  1XDU A;  2Y9Y A;  3GFJ A;  5EGO A;  4FET A;  1TNT A;  2GIZ A;  2IGM A;  1DP7 P;  3H0D A;  1GV5 A;  2BW3 A;  3MWM A;  4Y33 A;  2HWV A;  2IA0 A;  4EJO A;  5GTI C;  3V8K A;  4RBO A;  2EFP A;  5E3N A;  4XNF A;  2E2I J;  4IL6 C;  1T6S A;  3JSP A;  1RKT A;  1OR7 A;  2M8G X;  2EIK H;  5DYM A;  1LDD A;  2LP0 A;  1X1C A;  3GEZ A;  2XB5 A;  1FY7 A;  4HG2 A;  4N0B A;  4CCL A;  1MDM A;  2EIN H;  1MH4 A;  2JUG A;  1N78 A;  5LBQ A;  2L54 A;  4BE2 A;  2K9Q A;  5E3O A;  1OCP A;  1ZG1 A;  4C3H J;  3DCF A;  1TQP A;  3CUQ C;  1WRJ A;  2JPB A;  1JHH A;  2R7V A;  3D0S A;  2L01 A;  3I58 A;  1B1B A;  1W0U A;  4EQQ A;  3SFI A;  1HQC A;  2VC0 A;  5FGM A;  5EG0 B;  2E1N A;  2K9L A;  3V8L A;  3AG2 H;  3CMM A;  5K7Z A;  3JSO A;  1WGX A;  2RQP A;  2EPF A;  1BI2 A;  1T0F C;  3CDL A;  2CUE A;  4HSR A;  5H20 A;  1MBG A;  4A0Z A;  3LL7 A;  4BUP A;  1VF9 A;  4DBQ A;  3OOP A;  5JHF A;  4I76 A;  1D1A A;  2OCC H;  4BJ6 C;  1QPI A;  4LLN A;  4F92 B;  4LIV A;  2C6Y A;  2BY0 A;  4ZJZ A;  1G8X A;  4RMN A;  4BJT A;  3RDI A;  5J4V A;  3V7S A;  2M0C A;  1VQL I;  4BQA A;  2A6E F;  1BIA A;  5DEQ A;  2IPQ X;  4QIW N;  1U3E M;  2BVM A;  5J47 A;  1YW9 A;  2XVC A;  2XF7 A;  5F27 A;  2AO9 A;  2XRL A;  4IPA A;  2DTZ A;  1MKM A;  2DW4 A;  5D5W B;  3CCS I;  3FDY A;  3FZV A;  2R93 J;  5DDG A;  3BR3 A;  1ETK A;  4I7H A;  3LSR A;  1U6G A;  2VBX A;  3HOS A;  2VJI A;  1ETY A;  2K4B A;  4LG0 A;  1LE8 B;  2M7A A;  1DU0 A;  2P0W A;  1U2W A;  2M30 A;  3QP6 A;  4BGD A;  1USS A;  3ELK A;  2LBF B;  5LGT A;  2H8W A;  2O5R A;  2FOK A;  4HRI A;  1ETX A;  2KZV A;  2NYX A;  3QP5 A;  4X1E A;  4DQ2 A;  3KET A;  1G59 A;  4TV7 A;  2NVQ J;  3AG1 H;  4V19 K;  2K02 A;  4PSW A;  2R7R A;  1K4T A;  1J9I A;  3CCU I;  5CQG A;  5F0H A;  3WTT C;  4XON A;  4BNC A;  2DMN A;  2LSO A;  2MBF A;  2LY2 A;  5AIQ A;  2Z2S B;  5HLI A;  2QF7 A;  2ZFU A;  3JAM Z;  3I59 A;  2CMP A;  1H9T A;  2OBP A;  2G7H A;  3VWB A;  3OSG A;  2FBI A;  3EQL F;  5FLV A;  3LSM A;  2DA7 A;  3CTA A;  1IAW A;  1VQ7 I;  2ICW G;  3GTP J;  1K78 B;  2WB1 N;  4EGY A;  1X1D A;  5KAF C;  3HOU J;  1NK3 P;  1WH7 A;  2DO7 A;  4CCJ A;  2W48 A;  5CVR A;  1ZN2 A;  3VEP A;  5DV5 A;  5J3L A;  3HGY A;  4EJW A;  2HOE A;  2ZCW A;  3EUH A;  1Y1V J;  4BQQ A;  5D5X B;  1FEX A;  2DAO A;  4LFU A;  3IAS 2;  4KIT B;  1ZGJ A;  4ZYG A;  5H6R A;  2OD5 A;  3CC2 I;  3SDG A;  3CCV I;  2KFD A;  3AAF A;  3BZK A;  1W36 D;  1QA6 A;  3BJA A;  2A3S A;  4QSH A;  4A5N A;  1QVU A;  2LKS A;  5DS9 A;  4A3B J;  1QO0 D;  1O7F A;  1OR7 C;  2ZXW H;  2OTL I;  1OKR A;  5FFZ A;  2FXA A;  3Q3S A;  1SD4 A;  2K4J A;  5E18 F;  2TCT A;  1EH8 A;  1HW2 A;  2R3S A;  4Y15 A;  1RI7 A;  1LFB A;  4EEF G;  3G6E I;  4A3J J;  2QBY B;  1ACI A;  1U78 A;  3K1N A;  4F3Q A;  1PUE E;  3V7R A;  3GFL A;  1CF7 B;  1BOA A;  2HTS A;  2PJP A;  3HL2 A;  1KU2 A;  5CPR B;  4E7Z A;  5K7H A;  3EUK L;  3QYB A;  1EF4 A;  3HRS A;  1Y56 A;  2JSP A;  3I4M J;  4DZP A;  3LST A;  4I09 A;  3CJR B;  2QLZ A;  3PIP F;  1WH5 A;  2FE3 A;  2V6E A;  3M07 A;  1R5H A;  1V5F A;  4BBR J;  2RRE A;  1ZKG A;  1FOY A;  4HV6 A;  1F1Z A;  1IC8 A;  1FOK A;  2ECC A;  2EFQ A;  1QGP A;  2KIS A;  2HQN A;  2IRF G;  3CP8 A;  2DJN A;  5IY5 H;  2KDZ A;  2ZJP F;  2DQR A;  4S04 A;  5HNF A;  2VBZ A;  4XM3 A;  4DNC A;  3KLN A;  3CDI A;  3CLO A;  1B72 B;  5LHI A;  2L4A A;  1STZ A;  2Y0S N;  4CCO A;  5JHU A;  3I0T A;  1B8I A;  3ZQF A;  2FUG 2;  4OIQ F;  3DPU A;  1WPK A;  1TWC J;  5F64 A;  3L2Q A;  3Q5F A;  3FXK A;  5D8L B;  3C7J A;  2Q0O A;  4GXO A;  1TLH B;  2E1C A;  2PJR A;  2FSW A;  4KDP A;  5D4S A;  2JJ7 A;  3VYT B;  1I5Z A;  4HDV A;  2CWE A;  2A05 A;  3ERM A;  3F72 A;  2EIL H;  3E0J B;  4GDF A;  4KA4 A;  2OTJ I;  2FJ1 A;  3F3X A;  2JSC A;  3M1E A;  1GHC A;  4RAY A;  4D7M A;  1AKH A;  1MSF C;  2P4W A;  2Y2Z A;  2OAZ A;  1I3Q J;  2G7U A;  3QOP A;  2NS0 A;  2D45 A;  2ELH A;  3JRH A;  3R0A A;  5LHH A;  1D0Z A;  4B1R A;  2XDV A;  3HBL A;  3BQZ A;  1W0T A;  4QLC U;  2GOX B;  4R8H A;  3RPQ A;  2KKO A;  1YRN A;  2IA1 A;  1X3W B;  4M9Z A;  4A5M A;  2JZY A;  5LLQ A;  1IV8 A;  3I53 A;  2HU9 A;  3QAH A;  3I4N J;  1MGT A;  2ZFW A;  3WTZ A;  4I98 B;  2X6Y A;  1OJL A;  3OMY A;  3C1D A;  3F22 A;  3BWG A;  1XC5 A;  2QM3 A;  1JJ6 C;  2L9S A;  4IRH A;  4C2U A;  5ICE A;  4E7H A;  2QVO A;  1ZGW A;  1R71 A;  2W4S A;  5FKM A;  4ZTJ A;  2CU7 A;  1EJ9 A;  3E7L A;  2CV2 A;  2HYG D;  1WJB A;  3ZRG A;  4DZJ A;  3CCY A;  3TOB A;  2V1X A;  5DD8 A;  3EUH C;  3WTX C;  2R7O A;  3WHC A;  4D9J A;  4IRG A;  2WC2 A;  4D5F A;  1S6L A;  2EIM H;  1LVK A;  5ILV A;  2PMU A;  4IHY A;  1YLF A;  3J81 Z;  2K86 A;  1VQ5 I;  1D0X A;  5FB2 A;  1S72 I;  1SAN A;  2A68 F;  4ASN A;  2NVT J;  1IDY A;  1I3A A;  3SZG A;  4AU7 A;  5EEH A;  3JRA A;  4ESJ A;  2L7Z A;  3MEX A;  5E1W A;  2HXO A;  3RCO A;  2EJR A;  2HNH A;  4HLY A;  1SVM A;  2DLL A;  3L2R A;  3GME A;  4DYC A;  4UHT A;  3BTL A;  2F4M B;  5HLG A;  4A6E A;  4PGG A;  1MMG A;  3RKQ A;  3R6S A;  2XHK A;  4PDK A;  4M3D A;  3G71 I;  2E1M B;  1SEU A;  3GVA A;  3T1B A;  3BG9 A;  4I02 A;  3TP0 A;  1U8R A;  5HOD A;  1E2X A;  2AHQ A;  4BHC A;  3HSR A;  2ACJ A;  4PK4 A;  4NC7 A;  3RSN A;  2GLO A;  2VKE A;  5E1Z B;  3QQA A;  3A0H C;  2O03 A;  4E4H A;  3IV5 A;  3L7W A;  3PNV A;  2HPI A;  3JCU C;  5IOY A;  1K6O A;  3GFI A;  2JT1 A;  1YS7 A;  2KRF A;  3D5R C;  1ITY A;  3OS0 A;  2Q2E B;  4HX7 A;  4JOM A;  2XB0 X;  4QPO A;  2VOO A;  1R49 A;  1TW2 A;  5GP9 A;  4GFB A;  2DCE A;  3OY9 A;  3L2U A;  1OPC A;  1A6Q A;  2GZW A;  2OPT A;  3ABU A;  4M6V A;  2FML A;  3VYR B;  1BA5 A;  3PSF A;  4M74 A;  2K9S A;  1AHD P;  4B4C A;  2M3A A;  1LNW A;  4XOP A;  3VSL A;  1B59 A;  1SFE A;  3NEU A;  1HC8 A;  3HPG A;  4HZF A;  2P5K A;  3OYB A;  2VBW A;  3COA C;  2M4G A;  3OIQ A;  2Y48 A;  1S3J A;  3MAJ A;  1MD0 A;  1UAA A;  2GAU A;  5EZH A;  3K4L A;  2W84 A;  1ZLK A;  2E2J J;  2W7N A;  1X2N A;  2V1D A;  2IW5 A;  3LQR A;  5LD2 C;  3CD6 I;  1QQI A;  2MD5 A;  3O8H A;  4UVC A;  2VPL A;  5D4R A;  5ED4 A;  3JTH A;  3PQJ A;  2B63 J;  2K9M A;  4A12 A;  2KP6 A;  2YU9 J;  1HBX G;  1AWC A;  2HOA A;  2DFI A;  1J59 A;  1KYW A;  4S0H B;  3BG3 A;  3LFU A;  1G3T A;  4C9Y A;  5BPI A;  3N4M A;  3D1N I;  4NNJ A;  3F9K A;  3V8J A;  5ILS A;  1Z91 A;  4HNT A;  3I4P A;  2Q8K A;  6PAX A;  1W5S A;  1JXS A;  4G8X A;  1P4W A;  4LK1 F;  1I1G A;  3L9F A;  4YIR X;  1WJC A;  4CZC A;  1KU7 A;  3OL3 A;  1V5E A;  2HYF A;  3KP7 A;  3OYK A;  2I10 A;  3CO6 C;  4JYK A;  1XSD A;  1O4X A;  4MQV A;  1U9O A;  1WQ2 A;  5ERI A;  4DJA A;  4YFX F;  1Y1W J;  3RKY A;  2YX7 A;  4W1U A;  5HOO A;  4IHX A;  3DBH B;  3GW2 A;  4A93 J;  2FNA A;  2VKV A;  1RRJ A;  1LEA A;  4BAY A;  2KLO A;  2JA7 J;  5E3M A;  5TIS C;  4A3F J;  3V42 A;  4B48 A;  4CH7 A;  2NVY J;  1WJF A;  2CSO A;  1V5G A;  2QWW A;  3DFG A;  3LAP A;  3KP2 A;  2P7V B;  2XF6 A;  1MJA A;  2ADU A;  3ECO A;  3GUD A;  2R7W A;  1KQ8 A;  2JA8 J;  4PJ0 C;  3HKZ A;  4M3E A;  5LFA A;  1XGM A;  2IBD A;  3HB9 A;  1Y0U A;  2HZT A;  3Q9V A;  2R7S A;  1J0R A;  3CUQ B;  3P7N A;  3RQ4 A;  3WGG A;  1U5T A;  3GBG A;  5E79 C;  4BBS J;  3R4K A;  3CMY A;  3DF8 A;  1JUM A;  1IJW C;  1MIJ A;  2DFH A;  3P5J A;  3AKZ A;  3S3N A;  4ZH4 F;  2XAS A;  3DEW A;  2JQ7 A;  2XAF A;  3MQ0 A;  4ZC3 A;  2DI3 A;  2ZB9 A;  1B6A A;  3L09 A;  3PNY A;  5D5U B;  4UUT A;  3QRF F;  2F5E A;  5BQT A;  1IN6 A;  3RYR A;  5FO5 A;  2XRN A;  1ZYR F;  4BXF A;  5L3G A;  1YJ9 I;  5HDG A;  3J80 K;  2IGN A;  3QWL A;  2FRH A;  1I39 A;  3QYF A;  4Q4Z F;  3FM5 A;  1Y0N A;  3F8N A;  1YW8 A;  2TRT A;  3G1M A;  1F9N A;  2WB1 A;  5DTD A;  3A01 A;  3DU6 A;  1K83 J;  2EB7 A;  4JP0 A;  4AWX B;  3CCL I;  2KMU A;  3J7A O;  2K7L A;  1TT5 B;  1PP7 U;  1XX5 A;  1OLT A;  3H3V K;  4XLN F;  1W1W E;  2V6C A;  1ZAO A;  2P8T A;  3OYH A;  2KIQ A;  3SXY A;  3BZ6 A;  3DLL F;  1E3H A;  4DW6 A;  3ZQQ A;  2NNN A;  1BC7 C;  3WTY C;  4ZDL A;  4FIS A;  1SD7 A;  4RDU A;  1NH3 A;  2RGV A;  3HEF A;  3S2D J;  4FQG A;  4BY7 J;  3SZT A;  1ZH5 A;  1IXS B;  4UUV A;  4IF4 A;  1W4M A;  4M3F A;  4MEY F;  2F5F A;  2EFW A;  2E1M C;  4LG3 A;  1YS6 A;  4ZDO A;  2JN6 A;  2OCE A;  2V4J C;  2OUM A;  5IYD J;  3HHG A;  3IKT A;  3IH4 A;  1J09 A;  4CCN A;  3HG9 A;  4E7L A;  4J00 A;  2M0M A;  4C30 A;  3FK7 A;  4MNU A;  2A5W A;  2M1B A;  2X51 A;  1IF1 A;  2DOE A;  2FQ3 A;  5TRD A;  3GTQ J;  2LFB A;  2FQ4 A;  2Y31 A;  1F43 A;  3RJP A;  3LSK A;  2E36 A;  5ILU A;  3U1D A;  2VLA A;  1ORK A;  3DEU A;  4CCK A;  3IL2 A;  4DYQ A;  1XB4 A;  3L2W A;  2Y9Z A;  3RZO J;  1UHM A;  2XGE A;  4RAF A;  1QPM A;  1L0O C;  3K4B A;  2EIJ H;  3LAJ A;  1LFU P;  3BZC A;  4BKX A;  4XLH A;  1FZP B;  5EGO B;  4IHS A;  4RB2 C;  2IGK A;  2H8R A;  5E20 A;  4L9T A;  1ZAR A;  4OU0 A;  3FXM A;  2BY1 A;  4KT6 A;  3WU1 B;  1T95 A;  2ECB A;  2LD5 A;  3PQK A;  4PSX A;  1X4O A;  2AXL A;  1IW7 F;  2PFB A;  4OIN F;  2M8E A;  4HV5 A;  2F5C A;  1VQK I;  2YU3 A;  3LMM A;  4CYC A;  1XDS A;  2AQF A;  2GIV A;  3PNT A;  1XMK A;  2PMZ N;  1D5V A;  1WCM J;  2BHY A;  4U7B A;  3RKX A;  3K4N A;  1W36 C;  3HJE A;  3DU5 A;  3BOQ A;  3QYE A;  3C18 A;  1EV7 A;  4QWQ A;  3AFH A;  1X4P A;  4G12 A;  2WWY A;  1I6H J;  2M7B A;  2M34 A;  3RQI A;  5JI6 A;  1R7J A;  1MDM B;  1X3Z B;  3BR2 A;  3MFK A;  4QTR A;  3S2H J;  2VBY A;  4N9I A;  3KP3 A;  4Y3O A;  2NOJ B;  1IN7 A;  2QZ8 A;  5GPA A;  1U5T C;  1RIO H;  2JVH A;  1W5C C;  3BPX A;  4D1Q A;  1P7I A;  4II3 A;  4KMU X;  5CVV A;  1I1S A;  2OV7 A;  2XV4 S;  3ABT A;  4CYD A;  3HPH A;  4A0Y A;  3GXO A;  2L9R A;  4U7D A;  1BL0 A;  2XUB A;  4Y13 A;  1X1A A;  1HDP A;  2COB A;  1ON1 A;  1Y8R B;  3LSH A;  2QA4 I;  4O3M A;  1SAX A;  3BTJ A;  2XPU A;  1XCV A;  2PLY A;  2EQR A;  3FK6 A;  2X6X A;  4ENK A;  2L7M P;  1OCT C;  1TWA J;  3PO2 J;  5ICC A;  2E7W A;  2A07 F;  4PGH A;  2D5V A;  1BR2 A;  1HOM A;  1YI2 I;  1XGO A;  4OIR F;  4E7J A;  1LQ1 A;  3S17 J;  2ZBK A;  2CS3 A;  2MYS A;  2MG4 A;  3JRD A;  3NRV A;  3CES A;  3T0Y A;  1IN4 A;  2JRT A;  3TO7 A;  4S05 A;  3HOY J;  4D7N A;  4XR6 A;  2ZNZ A;  1YW7 A;  3WGI A;  2HZD A;  2LLK A;  2V9K A;  3KEQ A;  1N25 A;  1U0J A;  2WY7 Q;  4RB1 A;  2QQB A;  2PN6 A;  2M5W A;  1E3P A;  4D5C A;  4EGZ A;  3K7A J;  4ENJ A;  1JKO C;  2QSH X;  2IS4 A;  2NS7 A;  3NAR A;  1ZRD A;  5K5Q A;  4ABZ A;  1GXP A;  4LG0 B;  1D8K A;  4OMZ A;  3BRO A;  3KPH A;  5J8F A;  1KU3 A;  1ZK8 A;  4BEH A;  3P9C A;  4RGR A;  2JA6 J;  1IN8 A;  3CLQ A;  3DKX A;  3TGN A;  4JBA A;  1E3O C;  5FKL A;  4J01 A;  3A0B C;  4UV9 A;  1BI0 A;  3Q9S A;  4H0E A;  3LSJ A;  1HW5 A;  4MLO A;  2R7D A;  3F8F A;  5HS8 A;  1FTZ A;  3TW7 A;  2ZME A;  3GZN B;  2GXB A;  2Z99 A;  2D2W A;  4LK0 F;  1KGS A;  1BW5 A;  1UST A;  5J1R A;  3I59 B;  5J40 A;  4HF2 A;  5FKO A;  4I01 A;  3BG7 A;  3KFW X;  2LKX A;  4OWR B;  2WAD A;  5BPD A;  2VQG A;  1CGP A;  3ABK H;  2PMH A;  3ZCO A;  2X48 A;  3J7Z I;  1G3S A;  4XLA A;  2WAQ A;  3ML6 A;  4A69 C;  2DDA A;  4IKF A;  2A6H F;  1WKM A;  4FAS D;  4PFO A;  4LLL A;  1J7K A;  2CO5 A;  1XD7 A;  2HFH A;  4L0Y B;  3HKZ N;  2VOP A;  4NDL A;  3L2C A;  2DK8 A;  3ROU A;  3H35 A;  1T08 B;  3FKI J;  2VIX A;  5L3D A;  4HAM A;  1X19 A;  5JR3 A;  4A3M J;  2K85 A;  1AOY A;  1J2X A;  1LDK B;  1T33 A;  2WTE A;  3FKJ A;  2COM A;  3VOD A;  1APL C;  5D8K B;  2P7C B;  3FX3 A;  1R23 A;  1LKX A;  5FLM J;  1YIJ I;  4A0X A;  3SEZ A;  1WVR A;  5F04 A;  1IO2 A;  1NG6 A;  2R4G A;  2W85 A;  5BMZ A;  2N8G A;  4FE7 A;  1ENH A;  3LSG A;  3ZMS A;  4EM0 B;  3W2A A;  1D3Y A;  4XSZ F;  2X1E A;  1FIP A;  2L9N A;  1YJN I;  1KU9 A;  3F6O A;  3VFZ A;  3U2R A;  2M45 A;  1V4R A;  2ID3 A;  4RB3 C;  3L2V A;  1GVD A;  3TOA A;  3DKY A;  2EK5 A;  5EYR A;  2TDX A;  2GA2 A;  1HCR A;  2Z1D A;  5C4X J;  2RNG A;  1TZL A;  3IKV A;  3FXQ A;  2VQL A;  2STT A;  2CQK A;  2DDB A;  5J6X A;  2DMT A;  2XAH A;  3LA2 A;  4IJA A;  3JAM K;  2XAG A;  3A1Y A;  1W7P D;  4XN3 A;  1FOX A;  2EV6 A;  2O0Y A;  3M4O J;  3ZN0 A;  2UXN A;  5LRS A;  4YIF A;  4BS9 A;  1YX5 A;  2DFE A;  2WAE A;  3OYF A;  3MKY B;  3V4G A;  5EEG A;  1J5Y A;  1XSV A;  2E1O A;  1B8I B;  2VON A;  4P55 A;  4XK4 A;  4LIU A;  4X6A J;  5TGT A;  4EAT A;  4A2U A;  5IYB J;  3K4M A;  3I3L A;  3CC4 I;  4MFD A;  2RDP A;  3K69 A;  2STW A;  4HF1 A;  2PJR B;  4AID A;  1A5J A;  3ULQ B;  4E6K G;  2BYV E;  3G3Z A;  3KLO A;  2AXT C;  1OCC H;  3B6A A;  1JHF A;  2DA6 A;  1VQ9 I;  1FOW A;  4KIG A;  4LGW A;  5EDN A;  4FCY A;  3D5S C;  3ZP5 A;  4M71 A;  4G7O F;  2ISZ A;  3VOE A;  1D0Y A;  3CF5 F;  1AKH B;  2CUJ A;  3M7G A;  1FSE A;  4U87 A;  3ZMD A;  4E7S A;  3BR0 A;  2D1V A;  2CV0 A;  2W24 A;  3H5A A;  3JRF A;  4BQN A;  3HOX J;  4B47 A;  4W97 A;  3CO7 C;  1SMT A;  1AA7 A;  1JGS A;  2DFF A;  4UXN A;  1VTN C;  4BE1 A;  2QGU A;  3GTJ J;  3FM3 A;  3HSE A;  1YRN B;  1KZH A;  2HVQ A;  2ZME C;  3FXO A;  4XLP F;  2XAJ A;  2FNP A;  4HQM A;  2CUZ A;  1ZR2 A;  3TMO A;  2VQC A;  2WV1 A;  4NQW A;  1ON2 A;  3GCM A;  4BDY A;  4OIP F;  4M6Y A;  3BCA A;  4L5J A;  4DYR A;  3FHN A;  4ENN A;  1JT6 A;  3ZQ7 A;  3MN2 A;  5FD6 A;  3S3O A;  1RKW A;  2UZK A;  4WXC A;  1ODD A;  3BR5 A;  3E5U A;  2VE9 A;  2XPV A;  2ZKZ A;  1P4X A;  2IA2 A;  2XIG A;  1A31 A;  3TKY A;  2ISY A;  5EF6 A;  3DV8 A;  2H1L A;  2W1O A;  2KRC A;  4Z6Y A;  2P81 A;  3MKZ A;  2XGD A;  4NBQ A;  4P9F A;  3SQN A;  1XS9 A;  3OSF A;  1UG2 A;  2NNY A;  3DPL C;  2H6C A;  2F2E A;  1SC7 A;  3CP2 A;  1WSU A;  1OCR H;  2JWT A;  5HLT A;  1JJ8 C;  4LIT A;  3I9V 2;  4BHB A;  5IT3 A;  4IOA F;  2M4K A;  2YPR A;  4C3J J;  2VJ4 A;  2L9V A;  2LKP A;  2OC6 A;  5IP6 A;  5F1J A;  1IXR C;  4IOC F;  4HNU A;  3KP6 A;  3LWF A;  3BCB A;  4XLC A;  2BXZ A;  1SVO A;  1A04 A;  3TDU C;  5J4Y A;  4ON0 A;  3G4S I;  4GCV A;  2R5Z A;  2NS8 A;  4XN0 A;  1XN7 A;  2W82 A;  3PSI A;  1H0M A;  1S7A A;  2IS1 A;  5DM7 F;  3PJR A;  5M3F J;  3IC7 A;  3WG7 H;  3M8F A;  2VOD A;  4XRS A;  1R58 A;  4XRF A;  4EJU A;  3BLY A;  1DU6 A;  3PO3 J;  3OR1 C;  2H1K A;  5FLX Z;  3BY6 A;  3K9T A;  1SFX A;  3FHZ A;  4YII A;  1SAU A;  3I56 I;  2F48 A;  2Z9O A;  1LFP A;  1X1P A;  2V9V A;  1P2F A;  2DA3 A;  2OJE D;  3WTV C;  2KHM A;  3H3U A;  2R7X A;  2XPW A;  1Z1D A;  2LMD A;  4A3C J;  3QOD A;  4IQ4 A;  4M3G A;  2E34 A;  2OA4 A;  3HOW J;  2DT6 A;  4ZYA A;  3NWT A;  1MMN A;  1SFK A;  1QBJ A;  2CG4 A;  4XKB A;  4U0Y A;  1NTC A;  1O3S A;  5LGU A;  3CME I;  1SMY F;  1XSX A;  4G6D A;  2NOG A;  2BBY A;  4KFC A;  3I64 A;  1N75 A;  1MBJ A;  4FT8 A;  1LUJ B;  1LPQ A;  5LRR A;  3JRE A;  5LEK A;  2CUF A;  2PMZ A;  3IWF A;  3TL4 X;  4AIJ A;  1XMA A;  2HS5 A;  1YIT I;  4OIO F;  2ZJ2 A;  4MFE A;  3DP7 A;  4CZZ A;  4BYY A;  3BG5 A;  2QKL B;  2PG4 A;  1T98 A;  3RZD J;  1MMD A;  2JA5 J;  4DBR A;  2WAQ N;  1HXD A;  1PYV A;  5K5O A;  4KIS A;  4ITV A;  4BL0 B;  2CQQ A;  3CJN A;  1ONV A;  2DJI A;  3S14 J;  4G9Y A;  3QU6 A;  2ESN A;  1DP3 A;  2QQ9 A;  1XPX A;  2DA2 A;  4XBF A;  1JKQ C;  3A02 A;  4V2G A;  1ZTR A;  3S1Q J;  5ICG A;  4I2O A;  3IUO A;  3H5R A;  4EJT A;  3T5X A;  2A5Y B;  5D6E A;  1ETO A;  2M87 A;  1GUU A;  1GXQ A;  2X4H A;  3M1C A;  5JLX A;  5A2Q K;  3OYI A;  5BS6 A;  1IRF A;  3RKW A;  4MTD A;  3CMA I;  1Z9C A;  1FBQ A;  5IP7 J;  5EEA A;  1VQ6 I;  4RLF A;  5EJC A;  1ZRC A;  2HVS A;  1NHA A;  1PVE A;  3DEE A;  3R60 A;  4QPQ A;  2Y30 A;  2KRH A;  1K4S A;  3G1L A;  1FSH A;  2RN7 A;  5HS9 A;  4P96 A;  2VAS A;  5GAG J;  4Y4R A;  3RI4 A;  1EA3 A;  3OYL A;  4Q48 A;  3NAU A;  3SZP A;  3QPT A;  5KCM A;  3MMY B;  2PBI A;  3C2B A;  2DQL A;  2CW7 A;  3H9G A;  1FTT A;  2MD0 A;  3IWZ A;  5LHG A;  2CQX A;  3S15 J;  1U5T B;  5J1Y A;  3GF2 A;  3E5Q A;  3CQZ J;  3ZN1 A;  3ZXS A;  1V55 H;  1Y8Q B;  3WTW C;  1YHQ I;  4M9S A;  1GV2 A;  2M9H A;  3OYD A;  3FF5 A;  1DPR A;  2L2O A;  3HRU A;  2R92 J;  2CFX A;  2OU2 A;  4FTH A;  3A03 A;  5L3E A;  1YIO A;  2HOS A;  3S32 A;  2XSJ C;  2LYC A;  4PCQ A;  2E5N A;  1QHG A;  1EH6 A;  1MBE A;  2ZXH A;  1PP8 F;  4LB6 B;  3VPR A;  1P4A A;  2B0L A;  5KNL A;  4AVP A;  4NC8 A;  1W7P A;  2BY3 A;  1P92 A;  4EJV A;  5DUI A;  2Z16 A;  1MH3 A;  1LEB A;  3FMQ A;  3LFK A;  3K1M A;  2RVC A;  4N4O B;  2H27 A; 
#chains in the Genus database with same CATH homology
 4NHJ A;  3WU0 A;  1I6X A;  2CGP A;  3K2Z A;  4RS8 A;  5KVR A;  1OYI A;  3ZMU A;  4GYG A;  1RUN A;  1IUY A;  4IVN A;  4ZZD A;  1B9M A;  5LGN A;  4P5O A;  2YX4 A;  5CJ9 A;  4L9J A;  4JQF A;  4RGX A;  1K7A A;  1B9N A;  1GVJ A;  3T8T A;  4MEX F;  5IT9 Z;  3E3V A;  1R1U A;  1KYZ A;  2ZXJ A;  1ZG3 A;  4HLX A;  3N97 A;  5BOX A;  3TDZ C;  1ZRE A;  4P9U A;  4CHU A;  1QZY A;  1FYM A;  2EA2 A;  1S7O A;  4EV0 A;  2Z3Y A;  2O61 A;  1WWX A;  5E17 F;  5E1X A;  2FA5 A;  3WG9 A;  3J80 Z;  4MHG A;  4KN7 X;  3D5L A;  5D6F A;  1FP1 D;  4ETS A;  2MH2 A;  4BXU A;  1MJB A;  2L4M A;  4L9V A;  3F6V A;  4GGG A;  4EM1 A;  1YFH A;  1RUO A;  5F6F A;  2ESH A;  5ICF A;  2KIF A;  2LF8 A;  2OZ6 A;  5FFX A;  3U9G A;  1BM9 A;  1R22 A;  3HYI A;  4GYI A;  2O8X A;  4KUM A;  2LF7 A;  1L3L A;  3BDD A;  4A6D A;  4ESB A;  2GA1 A;  4L18 B;  1EH7 A;  2V1U A;  4BH9 A;  2DU9 A;  2FBH A;  5FD5 A;  4KIF A;  3WGH A;  1BC8 C;  4HQE A;  4I0B A;  1Q1H A;  3E6B A;  5JFR A;  3EYY A;  2FU4 A;  3R0J A;  3E6M A;  5DCM A;  2P5V A;  4WXH A;  1SFU A;  2L3D A;  3KZY A;  1R1V A;  4UVA A;  1HW1 A;  3HRT A;  4AIK A;  3KZZ A;  2G9W A;  2LNB A;  4UVB A;  4EMS A;  4G7Z F;  2EWN A;  4ENM A;  2A61 A;  3BJ6 A;  3E5X A;  2V79 A;  1LVA A;  3GLX A;  5TJJ A;  1YTY A;  3M8E A;  2CYY A;  3JW4 A;  3E6C C;  1I27 A;  4L0Z B;  4F7Z A;  3ISP A;  4L5I A;  4D0P A;  1J75 A;  2QYO A;  3KE2 A;  4KT5 C;  4KIB A;  2ZME B;  1IZ1 A;  1KQ0 A;  4UNO A;  1E17 A;  5AON A;  1UCR A;  4KMF A;  4UV8 A;  4FHT A;  1FYK A;  1XGS A;  2FEZ A;  4OOI A;  3O6B B;  4I0A A;  4M6X A;  2W25 A;  1HST A;  1ULY A;  3HUG A;  2YSR A;  3LA3 A;  1Z6R A;  2FBK A;  3SFZ A;  4MQ9 F;  4HX8 A;  3M9A A;  1WI9 A;  3BPV A;  1FC3 A;  2EV0 A;  1O3T A;  3DQV C;  4AD9 A;  1DDN A;  2IT0 A;  2ZNY A;  2JTV A;  4G6Q A;  5D5V B;  3ZPL A;  5CLS A;  2GQQ A;  3RIR A;  3F8B A;  3HRM A;  3KCC A;  3OV8 A;  1IN5 A;  2PEX A;  1JE8 A;  4HOB A;  4GO1 A;  2MLG A;  2RKH A;  2HGC A;  2Z33 A;  3DPT A;  3C3W A;  1G6N A;  2EV5 A;  3RYP A;  3GZ6 A;  2VN2 A;  2MH9 A;  1UFM A;  1F4K A;  1R1T A;  2HKX A;  1HKQ A;  2XKP A;  1DUX C;  3V7C A;  2KJB A;  1XGN A;  3GYH X;  2KIU A;  2FF4 A;  2H94 A;  4R1H A;  3LQQ A;  5CVU A;  2JPC A;  4RAZ A;  1OYW A;  1O57 A;  5HDK A;  3H92 A;  4LB5 A;  3JTG A;  2XRO A;  3VB2 A;  3CUO A;  1TBX A;  4ZZL A;  1RNL A;  4WX9 A;  2LDU A;  3F23 A;  3WTS C;  2XGX A;  5HDN A;  3R61 A;  1K79 A;  4Z2Y A;  1O3Q A;  2W57 A;  2P5L C;  1O3R A;  4LD5 A;  1O7L A;  1V3F A;  4HYE A;  4G7H F;  2RV8 A;  1PDN C;  1MZB A;  1QZZ A;  1T39 A;  1YG2 A;  5J8C A;  3ERE D;  1S8N A;  3IRQ A;  2A69 F;  2E7X A;  4FX0 A;  1LDJ A;  1FP2 A;  2UXX A;  2KIM A;  1MJ9 A;  1YQA A;  4AIH A;  3F8M A;  3HTU A;  4KYW A;  3B02 A;  3F8C A;  3IHU A;  1UB9 A;  2IVM A;  2HTJ A;  3MZY A;  3W6K B;  3EYI A;  1UHW A;  3HSF A;  2MC3 A;  1K78 A;  1BI3 A;  2H6B A;  3RPU A;  4IRI A;  2VT3 A;  2GWR A;  5K5R A;  2D1H A;  2HR3 A;  3DXJ F;  4LLG F;  1T38 A;  3E97 A;  1BBY A;  4CIC A;  2AS5 F;  1ZGA A;  1B4A A;  4CGZ A;  3F21 A;  2HDC A;  2QBY A;  4L9N A;  5DD4 A;  3EET A;  4EVI A;  1FNN A;  1BIB A;  1CF7 A;  4PZJ A;  3ZMZ A;  1F5T A;  4LJZ F;  1FT9 A;  4ESF A;  4HDU A;  3EDP A;  1HKS A;  3HOT A;  2O6G E;  2F5D A;  3WTU C;  2HKO A;  5HLH A;  1YO5 C;  3L00 A;  4YFN F;  2VT2 A;  3K0L A;  3ECH A;  1YYV A;  5FLX K;  4HW0 A;  4N9H A;  1SD6 A;  5CYV A;  3J81 K;  3I5U A;  3ZMT A;  1ZLJ A;  2ZO4 A;  2DPD A;  4WXD A;  3S2W A;  5CVI A;  2QQA A;  4MGR A;  4CO8 A;  3QU3 A;  1X3U A;  3KP5 A;  3E6D A;  3QPH A;  2WV0 A;  5H6Q A;  4WF2 A;  3K1P A;  2QEN A;  4K2E A;  2RC4 A;  2KJC A;  4RGU A;  4ZYH A;  1Z05 A;  1C0W A;  3P9K A;  2PQ8 A;  4RGS A;  1BJA A;  2R7F A;  4MTE A;  3T8R A;  1KQ9 A;  4KN4 X;  1W7P B;  4Y17 A;  1ZRF A;  1FYL A;  1TNS A;  1BN5 A;  2IJL A;  4NB5 A;  2Y75 A;  4XSX F;  3G73 A;  1OYY A;  4U88 A;  5A2Q Z;  3FXU A;  3B73 A;  4KNY A;  2MLK A;  3W6J B;  2DK5 A;  2QUF A;  3TQN A;  5CVJ A;  4EM2 A;  1IRG A;  1FWZ A;  5DUK A;  1FBS A;  3LA7 A;  4O5V A;  3HIF A;  2DTR A;  2EFO A;  5E8I A;  1SD5 A;  1BI1 A;  4YG2 F;  2H09 A;  2DBB A;  1TQI A;  2NRA C;  3TO6 A;  2RNJ A;  2CW0 F;  3CDH A;  2VC1 A;  4ZYE A;  2Q2E A;  4WWC A;  4B09 A;  2XKO A;  2Y0M A;  4CXF A;  5L3B A;  2OQR A;  4U0W A;  1ZHF A;  2OZU A;  4ZYD A;  5JVT A;  1TTY A;  2O3F A;  3FWE A;  3REO A;  4M73 A;  3FMS A;  4O6J A;  5HVQ C;  1G3Y A;  4WK8 F;  3FMR A;  1T2K A;  3GZ5 A;  2OQG A;  3TO9 A;  2IP2 A;  4Q47 A;  2YR2 A;  1G3W A;  4M72 A;  1W5T A;  2MA3 A;  1ZG5 A;  1TQM A;  5IT9 K;  3HHH A;  2DPU A;  3P9I A;  3BJO A;  2K27 A;  3I71 A;  1RZ4 A;  3GWZ A;  3BP8 A;  4KIC A;  1REP C;  2FMY A;  4RB0 A;  4B8X A;  4WCG A;  2P6S A;  2X0L A;  2NAZ A;  5DCM B;  4HX4 A;  3GO5 A;  2EA4 A;  2BE5 F;  1HSJ A;  2GXG A;  2BGC A;  1Z7U A;  2EFN A;  1HKT A;  3ZMV A;  3WE3 A;  5L3C A;  2BEO A;  3NQO A;  2UWM A;  3WOD F;  3GFM A;  5K1Y A;  3SHF A;  3MZH A;  4G94 A;  4YFK F;  3GX4 X;  3HTS B;  3CUQ A;  4HBL A;  1S29 A;  2XAQ A;  1LJ9 A;  4IXA A;  3KEO A;  1R00 A;  1TW3 A;  2Z5U A;  2J5O A;  1H9G A;  2VXZ A;  1LB2 A;  1D8J A;  1T0F A;  4CDG A;  1KA8 A;  3WE2 A;  1DPU A;  1XCB A;  3KP4 A;  5L3F A;  1G4D A;  1QNT A;  5E8G A;  3PFI A;  5AIP A;  1FBU A;  2ETH A;  3H3Z A;  4LMY A;  4HF0 A;  3I54 A;  1IXC A;  2J5P A;  4Q5S F;  2VE8 A;  4R79 A;  4E70 A;  4IHT A;  4OMY A;  4HA8 A;  2L02 A;  3MCZ A;  5DCF A;  2DT5 A;  2BV6 A;  3FXR A;  3DKW A;  1Z6T A;  1FLI A;  4BHP A;  2HEO A;  3IRR A;  3O3K A;  1P6R A;  4U0V A;  1FPQ A;  5HS7 A;  2HQR A;  3O2P E;  2PI0 A;  1R5G A;  5LEJ A;  1FX7 A;  2P6T A;  3RTR A;  4JK1 X;  4M9X A;  1OMI A;  5KK1 A;  4FX4 A;  1R36 A;  5F1R A;  1XDU A;  3GFJ A;  1TNT A;  1DP7 P;  3MWM A;  2HWV A;  2IA0 A;  4EJO A;  3V8K A;  2EFP A;  1T6S A;  3JSP A;  1OR7 A;  5DYM A;  1LDD A;  3GEZ A;  1FY7 A;  4N0B A;  1MDM A;  5LBQ A;  2L54 A;  1ZG1 A;  1TQP A;  3CUQ C;  1WRJ A;  2JPB A;  1JHH A;  3D0S A;  2L01 A;  3I58 A;  1B1B A;  4EQQ A;  1HQC A;  2VC0 A;  5FGM A;  2E1N A;  3V8L A;  3JSO A;  2RQP A;  5H20 A;  1BI2 A;  4A0Z A;  3OOP A;  4LLN A;  2C6Y A;  3RDI A;  3V7S A;  4BQA A;  2A6E F;  1BIA A;  5DEQ A;  2IPQ X;  1U3E M;  1YW9 A;  2XVC A;  4IPA A;  1MKM A;  2DW4 A;  5D5W B;  3FZV A;  5DDG A;  4I7H A;  1U6G A;  2VBX A;  3HOS A;  2K4B A;  4LG0 A;  1U2W A;  2M30 A;  3QP6 A;  1USS A;  3ELK A;  5LGT A;  2FOK A;  3KET A;  2NYX A;  3QP5 A;  4DQ2 A;  4TV7 A;  2K02 A;  1J9I A;  3WTT C;  4BNC A;  2LSO A;  2MBF A;  5AIQ A;  5HLI A;  3JAM Z;  3I59 A;  1H9T A;  2OBP A;  2G7H A;  2FBI A;  3EQL F;  3CTA A;  1IAW A;  1K78 B;  4EGY A;  2DO7 A;  5CVR A;  1ZN2 A;  3VEP A;  5DV5 A;  4EJW A;  2HOE A;  2ZCW A;  3EUH A;  5D5X B;  2DAO A;  4LFU A;  1ZGJ A;  4ZYG A;  5H6R A;  2OD5 A;  3AAF A;  3BJA A;  2A3S A;  4A5N A;  1QO0 D;  1O7F A;  1OKR A;  5FFZ A;  2FXA A;  1SD4 A;  2K4J A;  5E18 F;  1HW2 A;  1EH8 A;  2R3S A;  4Y15 A;  1RI7 A;  2QBY B;  1U78 A;  3K1N A;  1PUE E;  3V7R A;  3GFL A;  1CF7 B;  1BOA A;  2HTS A;  2PJP A;  1KU2 A;  3HRS A;  3LST A;  4I09 A;  2QLZ A;  2FE3 A;  1R5H A;  4HV6 A;  1F1Z A;  1FOK A;  2EFQ A;  2IRF G;  1QGP A;  2HQN A;  2DQR A;  4S04 A;  2VBZ A;  4DNC A;  3KLN A;  3CLO A;  5LHI A;  2L4A A;  1STZ A;  5JHU A;  3I0T A;  4OIQ F;  5F64 A;  3Q5F A;  5D8L B;  3C7J A;  2Q0O A;  4GXO A;  1TLH B;  2E1C A;  2FSW A;  4KDP A;  5D4S A;  1I5Z A;  4HDV A;  2CWE A;  3F72 A;  4KA4 A;  3F3X A;  2JSC A;  3M1E A;  1GHC A;  4RAY A;  2P4W A;  2OAZ A;  2G7U A;  3QOP A;  2NS0 A;  2D45 A;  2ELH A;  3R0A A;  5LHH A;  4QLC U;  4R8H A;  3RPQ A;  2KKO A;  2IA1 A;  4M9Z A;  4A5M A;  2JZY A;  5LLQ A;  3I53 A;  3QAH A;  1MGT A;  2ZFW A;  3WTZ A;  4I98 B;  3C1D A;  3F22 A;  3BWG A;  2QM3 A;  4IRH A;  5ICE A;  2QVO A;  2HYG D;  3TOB A;  2V1X A;  5DD8 A;  3WTX C;  4IRG A;  2WC2 A;  1S6L A;  5ILV A;  2PMU A;  1YLF A;  3J81 Z;  2K86 A;  5FB2 A;  2A68 F;  4ASN A;  5EEH A;  4ESJ A;  3MEX A;  5E1W A;  2EJR A;  4HLY A;  2DLL A;  4UHT A;  5HLG A;  4A6E A;  4PGG A;  3R6S A;  2XHK A;  4PDK A;  3GVA A;  3T1B A;  4I02 A;  1U8R A;  1E2X A;  4BHC A;  2ACJ A;  3HSR A;  5E1Z B;  2O03 A;  1K6O A;  3L7W A;  3GFI A;  2JT1 A;  1YS7 A;  2KRF A;  4HX7 A;  2VOO A;  1TW2 A;  1OPC A;  2GZW A;  3ABU A;  2FML A;  4M74 A;  1LNW A;  1B59 A;  1SFE A;  3NEU A;  4HZF A;  2P5K A;  2VBW A;  3COA C;  2Y48 A;  1S3J A;  3MAJ A;  1MD0 A;  2GAU A;  2W84 A;  1ZLK A;  2V1D A;  3LQR A;  2IW5 A;  1QQI A;  2MD5 A;  4UVC A;  5D4R A;  5ED4 A;  3JTH A;  3PQJ A;  4A12 A;  1HBX G;  1AWC A;  2DFI A;  1J59 A;  1KYW A;  1G3T A;  5BPI A;  3N4M A;  3V8J A;  5ILS A;  1Z91 A;  3I4P A;  2Q8K A;  6PAX A;  1W5S A;  1JXS A;  4G8X A;  1P4W A;  4LK1 F;  1I1G A;  3L9F A;  1KU7 A;  2HYF A;  3KP7 A;  3CO6 C;  1XSD A;  4MQV A;  1WQ2 A;  5ERI A;  4YFX F;  3RKY A;  2YX7 A;  5HOO A;  3GW2 A;  2FNA A;  1LEA A;  4BAY A;  2CSO A;  2QWW A;  3DFG A;  3LAP A;  3KP2 A;  2P7V B;  1MJA A;  2ADU A;  3ECO A;  3GUD A;  1KQ8 A;  1XGM A;  1Y0U A;  2HZT A;  3Q9V A;  1J0R A;  3CUQ B;  3P7N A;  3WGG A;  1U5T A;  3R4K A;  3DF8 A;  4ZH4 F;  2XAS A;  2XAF A;  3MQ0 A;  2DI3 A;  1B6A A;  3L09 A;  5D5U B;  3QRF F;  5BQT A;  2F5E A;  1IN6 A;  3RYR A;  5FO5 A;  2XRN A;  1ZYR F;  5L3G A;  5HDG A;  3J80 K;  2FRH A;  4Q4Z F;  3FM5 A;  3F8N A;  1YW8 A;  1F9N A;  2EB7 A;  4AWX B;  3J7A O;  2K7L A;  1PP7 U;  4XLN F;  2V6C A;  1ZAO A;  2P8T A;  3SXY A;  3BZ6 A;  2NNN A;  1BC7 C;  3WTY C;  1SD7 A;  2RGV A;  3SZT A;  1ZH5 A;  1IXS B;  4UUV A;  4IF4 A;  1W4M A;  4MEY F;  2F5F A;  2EFW A;  1YS6 A;  3HHG A;  3IKT A;  4MNU A;  2M1B A;  1IF1 A;  2FQ3 A;  5TRD A;  3RJP A;  5ILU A;  3U1D A;  3DEU A;  3IL2 A;  1XB4 A;  1UHM A;  1QPM A;  1L0O C;  3LAJ A;  1FZP B;  4IHS A;  4RB2 C;  5E20 A;  4L9T A;  1ZAR A;  4OU0 A;  3WU1 B;  3PQK A;  2AXL A;  1IW7 F;  2PFB A;  4OIN F;  2M8E A;  4HV5 A;  2F5C A;  2YU3 A;  1XDS A;  2GIV A;  1XMK A;  1D5V A;  4U7B A;  3RKX A;  3BOQ A;  4QWQ A;  3C18 A;  1EV7 A;  2WWY A;  1MDM B;  5JI6 A;  1R7J A;  3MFK A;  2VBY A;  4N9I A;  3KP3 A;  1IN7 A;  2QZ8 A;  1U5T C;  1RIO H;  3BPX A;  4KMU X;  5CVV A;  1I1S A;  2XV4 S;  3ABT A;  4CYD A;  4A0Y A;  3GXO A;  4U7D A;  2XUB A;  4Y13 A;  1ON1 A;  4O3M A;  1SAX A;  1XCV A;  2PLY A;  4ENK A;  5ICC A;  2E7W A;  2A07 F;  4PGH A;  1XGO A;  4OIR F;  1LQ1 A;  2ZBK A;  3NRV A;  3T0Y A;  1IN4 A;  2JRT A;  3TO7 A;  4S05 A;  2ZNZ A;  1YW7 A;  3WGI A;  3KEQ A;  4RB1 A;  2QQB A;  2PN6 A;  2M5W A;  4EGZ A;  4ENJ A;  1ZRD A;  5K5Q A;  1GXP A;  4LG0 B;  1D8K A;  4OMZ A;  3BRO A;  5J8F A;  1KU3 A;  3P9C A;  4RGR A;  1IN8 A;  3TGN A;  4JBA A;  4UV9 A;  1BI0 A;  3Q9S A;  4H0E A;  1HW5 A;  2R7D A;  3F8F A;  5HS8 A;  2GXB A;  2ZME A;  2Z99 A;  2D2W A;  4LK0 F;  1KGS A;  1UST A;  3I59 B;  4HF2 A;  4I01 A;  3KFW X;  5BPD A;  1CGP A;  2PMH A;  1G3S A;  3ML6 A;  2A6H F;  1WKM A;  4LLL A;  1J7K A;  2CO5 A;  1XD7 A;  2HFH A;  4L0Y B;  2VOP A;  3L2C A;  2DK8 A;  3ROU A;  5L3D A;  4HAM A;  5JR3 A;  1AOY A;  1J2X A;  1LDK B;  2WTE A;  3VOD A;  2COM A;  2P7C B;  5D8K B;  3FX3 A;  1R23 A;  4A0X A;  2W85 A;  5BMZ A;  4EM0 B;  3ZMS A;  1D3Y A;  4XSZ F;  1KU9 A;  3F6O A;  3VFZ A;  3U2R A;  2M45 A;  1V4R A;  4RB3 C;  3TOA A;  2EK5 A;  2TDX A;  2GA2 A;  3IKV A;  3FXQ A;  2STT A;  2CQK A;  5J6X A;  2XAH A;  3LA2 A;  4IJA A;  3JAM K;  2XAG A;  1W7P D;  2EV6 A;  2O0Y A;  3ZN0 A;  2UXN A;  5LRS A;  4YIF A;  3V4G A;  5EEG A;  1J5Y A;  1XSV A;  2VON A;  4P55 A;  4A2U A;  2RDP A;  3K69 A;  2STW A;  4HF1 A;  3ULQ B;  2BYV E;  3G3Z A;  3KLO A;  1JHF A;  4KIG A;  4LGW A;  3ZP5 A;  4M71 A;  4G7O F;  2ISZ A;  3VOE A;  3M7G A;  1FSE A;  3ZMD A;  2D1V A;  2W24 A;  3CO7 C;  1SMT A;  1JGS A;  4UXN A;  1VTN C;  3FM3 A;  3HSE A;  4XLP F;  2XAJ A;  2FNP A;  4HQM A;  4NQW A;  1ON2 A;  4OIP F;  4M6Y A;  4L5J A;  4ENN A;  3ZQ7 A;  5FD6 A;  2UZK A;  4WXC A;  1ODD A;  3E5U A;  2VE9 A;  2ZKZ A;  1P4X A;  2IA2 A;  2XIG A;  3TKY A;  2ISY A;  3DV8 A;  4P9F A;  3SQN A;  2NNY A;  3DPL C;  2H6C A;  2F2E A;  1WSU A;  4BHB A;  5IT3 A;  2YPR A;  2LKP A;  1IXR C;  3KP6 A;  3LWF A;  1A04 A;  3TDU C;  4ON0 A;  4GCV A;  1XN7 A;  1H0M A;  1S7A A;  3IC7 A;  3M8F A;  2VOD A;  1R58 A;  4XRF A;  4EJU A;  5FLX Z;  3BY6 A;  3K9T A;  1SFX A;  3FHZ A;  4YII A;  2Z9O A;  2V9V A;  1P2F A;  3WTV C;  3H3U A;  1Z1D A;  2OA4 A;  1QBJ A;  2CG4 A;  4U0Y A;  1O3S A;  5LGU A;  1SMY F;  1XSX A;  4G6D A;  2BBY A;  4KFC A;  3I64 A;  4FT8 A;  5LRR A;  5LEK A;  3IWF A;  4AIJ A;  1XMA A;  2HS5 A;  4OIO F;  2ZJ2 A;  4CZZ A;  3DP7 A;  4BYY A;  1T98 A;  2PG4 A;  1HXD A;  5K5O A;  3CJN A;  1ONV A;  4G9Y A;  3QU6 A;  2ESN A;  2QQ9 A;  4XBF A;  5ICG A;  4I2O A;  4EJT A;  3T5X A;  2A5Y B;  5D6E A;  2M87 A;  1GXQ A;  2X4H A;  5A2Q K;  5BS6 A;  1IRF A;  3RKW A;  4MTD A;  1Z9C A;  1FBQ A;  1ZRC A;  1NHA A;  3R60 A;  1FSH A;  2RN7 A;  5HS9 A;  4P96 A;  3RI4 A;  4Q48 A;  3SZP A;  3QPT A;  2PBI A;  2DQL A;  3IWZ A;  5LHG A;  1U5T B;  3GF2 A;  3E5Q A;  3ZN1 A;  3WTW C;  4M9S A;  3FF5 A;  1DPR A;  3HRU A;  2CFX A;  2OU2 A;  5L3E A;  1YIO A;  4PCQ A;  1EH6 A;  1PP8 F;  4LB6 B;  1P4A A;  2B0L A;  4AVP A;  1W7P A;  1P92 A;  4EJV A;  5DUI A;  1LEB A;  3FMQ A;  3LFK A;  3K1M A;  2RVC A;  2H27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...