4ASNA

Tubr from bacillus megaterium pbm400
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
SDYFEEVMRKLTIEDVSILGWLFQNEANAVFKAIKKSSIADELEYSTANFRKTLNKLEAIHFIGTVTGGKEHKLYLTEYGQQAVQQAIHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Superstructure of the Centromeric Complex of Tubzrc Plasmid Partitioning Systems.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transcription
molecule keywords TUBR
total genus 31
structure length 90
sequence length 90
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4asnA00
2LDUA 3CUQB 3WG9A 2Z3YA 3E6MA 2QM3A 2V6CA 3DP7A 4HDUA 3LAJA 3JTHA 1O3SA 1L3LA 1FBQA 1Z91A 1BC7C 4ZZDA 4G9YA 1ZRCA 3E5QA 5H20A 3T1BA 5FGMA 1LVAA 2FXAA 2VBXA 4MGRA 2K86A 5CVJA 3K1NA 3WGGA 1FT9A 1BN5A 4LMYA 4A2UA 1W7PD 4YFKF 4ENNA 1R22A 4RGUA 2NNYA 2XUBA 3G3ZA 4L5IA 1H9TA 2L02A 3U2RA 1QO0D 3COAC 3QAHA 4BAYA 1SD7A 2DK5A 1WKMA 3GZ6A 1FYLA 4KIBA 1H9GA 1VTNC 3WTTC 3I59A 3TOAA 1XGMA 2IPQX 2V1XA 4OIPF 2F5CA 2L4AA 1Z1DA 3GFJA 1WQ2A 2W85A 3QU6A 1QPMA 5LGUA 2JPBA 4EM2A 4OINF 2EJRA 5KVRA 3V7SA 2YU3A 5AIQA 2HZTA 1T39A 3ZPLA 2NRAC 5BOXA 1BIAA 1U78A 3RTRA 1PP7U 4KUMA 1K78B 1ZG1A 1BI1A 3C7JA 2VONA 5HDNA 2Y75A 2MA3A 1WSUA 2PI0A 2O61A 1TNSA 1U5TA 3RJPA 3F3XA 4EM0B 1IXSB 2HKOA 1WRJA 3E3VA 1USSA 2CO5A 5LRSA 4U7BA 4WXCA 2XAJA 4G7ZF 1XSVA 4KMFA 4EGZA 4NQWA 1AWCA 5L3BA 2GZWA 4ENMA 2X0LA 4I98B 2NS0A 4EMSA 3MFKA 4MTDA 1QZZA 1OYIA 3M7GA 3ZMVA 4UUVA 2LF7A 5BPIA 2OZUA 4HV5A 4HA8A 1G3YA 2F5EA 3J7AO 1U5TB 4A6EA 3S2WA 3HYIA 3IRRA 3GXOA 3NEUA 3T5XA 3ZMDA 1ZH5A 2KRFA 2HYFA 3RI4A 1FBSA 2FBKA 2P7VB 1STZA 3NRVA 4EV0A 4ON0A 3FZVA 1U2WA 1O3QA 3ZN0A 4OOIA 3I4PA 5HS8A 1KA8A 1XGNA 5ILUA 3KP2A 2XKPA 1BI0A 3JAMK 2VODA 2M30A 3F23A 1R5GA 3ML6A 2DLLA 4KN7X 2HS5A 3RDIA 2WC2A 5HLHA 1QBJA 4FX4A 3HHGA 4XRFA 2ZCWA 3DF8A 2ZMEA 3REOA 2LSOA 4LLGF 5FLXK 2IJLA 2DBBA 1K7AA 1SMYF 2DPDA 1IRFA 5BMZA 5D8KB 4XSZF 2BYVE 5A2QZ 5LEKA 3FMSA 3HUGA 4M73A 1IZ1A 3MEXA 3F21A 1P4WA 1ZGAA 5E17F 2EK5A 4M71A 1SFXA 3HTUA 2Z99A 2C6YA 2PJPA 3J80K 1AOYA 5LGTA 5H6QA 2NYXA 2D45A 3IKTA 3ZMUA 3WU0A 2CG4A 1S7AA 3AAFA 4U88A 5ICCA 4UNOA 4DQ2A 1F5TA 4UVCA 2ELHA 2ESNA 3K1MA 5DEQA 4OIQF 1B6AA 1YTYA 2YX4A 4L5JA 2BEOA 3ECHA 1RZ4A 5FFZA 3GX4X 4B09A 1IF1A 3Q9SA 3O3KA 1OMIA 1T98A 1KQ8A 1U3EM 2EFWA 4O6JA 2F2EA 5D5VB 1Z9CA 3BJOA 4EJWA 2XKOA 1XMAA 4R79A 1J9IA 4MTEA 1FWZA 2VN2A 3IL2A 1PDNC 2UXNA 5ILVA 3BJAA 4GO1A 4QWQA 4EGYA 4OMYA 2FE3A 2TDXA 3ZMSA 2IP2A 3GZ5A 3M8FA 3LFKA 3HOTA 3LWFA 1XCBA 5HDKA 5IT9K 2A5YB 4XLPF 5AIPA 4IF4A 3C3WA 2HOEA 5E8GA 4LGWA 1SFEA 2M87A 2KKOA 3DQVC 2HTJA 3U1DA 1O7FA 3KLNA 1MJ9A 4CYDA 2CQKA 2KIUA 3F8MA 5DCMA 4QLCU 2D1HA 3KP6A 4TV7A 2QQ9A 4IRGA 5ERIA 4HYEA 4OMZA 1XMKA 2GXBA 1HBXG 4HOBA 4MQVA 4IHSA 5J6XA 2YSRA 5TJJA 3KP7A 2ZNZA 2QBYA 4Y15A 1O3TA 1TW3A 1LNWA 2HGCA 1FX7A 2CSOA 3GF2A 4N9HA 4GCVA 1YFHA 4P96A 1TQMA 1W7PB 1DDNA 1OYWA 4IJAA 3K9TA 4GGGA 1IXCA 2MC3A 3HRUA 1DUXC 1BJAA 1LEAA 2H6BA 4A0ZA 2K7LA 2OQGA 1K6OA 1MD0A 4EJUA 3JSPA 3K0LA 1MZBA 1D8KA 2RGVA 1FPQA 3M9AA 1G6NA 3GLXA 1K79A 4ESJA 2CW0F 1YIOA 2V1DA 1KU3A 5K5RA 1YYVA 4IVNA 2RC4A 5L3GA 2KIFA 3G73A 1ZARA 1IAWA 1BC8C 3WTVC 2RN7A 2YX7A 3FXQA 3LA2A 3K2ZA 2VBYA 5K1YA 2PBIA 2RV8A 1IN5A 1EH8A 4ZYEA 4KIFA 4I2OA 4ZZLA 3KE2A 1XD7A 2HR3A 1MDMB 2YPRA 3GEZA 3ULQB 2J5PA 4NHJA 1P4AA 2F5FA 3RKXA 4UHTA 3V4GA 4L0YB 3E6DA 4L9VA 2P5KA 5HLGA 5TRDA 3KZYA 3E5UA 2W25A 3HOSA 5CVIA 3CUQC 5LBQA 4IXAA 4LG0B 2D1VA 1IN6A 4XBFA 1H0MA 3EETA 4H0EA 3ABTA 1S3JA 5K5OA 4M6XA 3I5UA 1S6LA 3HSEA 5HS7A 1Z7UA 4WK8F 2ISZA 2HQNA 1FYMA 2F5DA 2JTVA 2OBPA 4UVAA 3LA3A 4U7DA 1Z6TA 3V7CA 2EV0A 2QWWA 3WE2A 1I1SA 3TO6A 2A68F 5J8CA 1GHCA 2STTA 3EDPA 3B02A 3KZZA 3I64A 1R36A 1S29A 2R3SA 2ZFWA 2PLYA 3E6CC 2GQQA 5DCFA 4HW0A 5IT3A 3IHUA 2ZJ2A 4IRHA 3V8JA 1USTA 4KFCA 2A69F 1D3YA 2HEOA 3BOQA 3QP6A 1UB9A 2AS5F 3H92A 2XRNA 4WF2A 1F1ZA 4U0VA 2VC0A 3DXJF 1D5VA 1XDUA 3E6BA 3KP3A 2Q8KA 2QZ8A 1L0OC 4KMUX 2CGPA 4RGSA 3N4MA 4ETSA 1TBXA 2W84A 2IA1A 4LK0F 2W24A 4PDKA 5CYVA 4MEYF 5ILSA 1IN4A 5HOOA 4MNUA 4A5NA 2PFBA 2FSWA 2PMHA 1KU2A 1HXDA 3F22A 1K78A 4BHPA 3L09A 2GWRA 2HDCA 5LGNA 1D8JA 2EA4A 2VXZA 4HX8A 1IXRC 1QZYA 3LAPA 1IN8A 5LHIA 1FP1D 2A3SA 4O5VA 3RYRA 3TGNA 3DPLC 3MAJA 4EVIA 4ENKA 2NAZA 2LKPA 4Q4ZF 3L7WA 1ON1A 1U6GA 4G6DA 2Y0MA 3U9GA 1T38A 3IWZA 4AWXB 1KYZA 2CWEA 3I54A 1ZLKA 2WTEA 1F9NA 3CUQA 1XGSA 3RYPA 4S05A 1SD4A 5DUIA 4CICA 1ZG5A 1NHAA 3KFWX 3KLOA 2WV0A 3I53A 1HSTA 4HBLA 2MD5A 4JK1X 2Y48A 1LQ1A 1LJ9A 1TLHB 3E5XA 2L54A 1CGPA 4R1HA 3ZP5A 3BPVA 2MH9A 2NNNA 1SFUA 1KQ9A 2XIGA 2PMUA 1KQ0A 3PFIA 2ZXJA 4G7HF 4LB6B 3P9IA 2XVCA 3TQNA 2ESHA 1IW7F 1W5SA 3FXRA 4Y13A 3TDUC 4GYGA 2VOPA 3JW4A 3CO6C 3I71A 3HHHA 3J81K 3F6VA 5L3FA 1MKMA 1LDJA 4WCGA 2KIMA 3BPXA 2KJBA 5K5QA 5F6FA 2HWVA 4BNCA 2FOKA 4KA4A 1ZRDA 5FO5A 2JT1A 3GW2A 3ECOA 4N0BA 1IUYA 2FA5A 5DDGA 2K27A 3FMRA 4BYYA 2LNBA 5A2QK 2DAOA 3WTYC 4UVBA 2G9WA 4GYIA 1WI9A 1FP2A 5ICEA 3LQRA 3D5LA 3HRMA 2O6GE 4ASNA 3J80Z 1P92A 4PGHA 2H27A 3BJ6A 4A6DA 2D2WA 1UCRA 2JPCA 4Q5SF 3DV8A 4CZZA 2GA1A 2HYGD 4A0YA 1ZGJA 1MDMA 1J7KA 2FRHA 1J2XA 3I0TA 3Q5FA 2A6EF 2P6SA 3K69A 3IKVA 2A07F 4EQQA 3OOPA 1ON2A 2QLZA 2EV6A 3KCCA 1XSDA 1CF7B 4PZJA 3FM5A 2W57A 2B0LA 2EWNA 2P5LC 1ULYA 1YW9A 1LDDA 3M8EA 4EJVA 5D5WB 3KEOA 3QP5A 4LFUA 2G7HA 4HF1A 2XAGA 3V7RA 3ERED 2DO7A 3SQNA 4L9JA 3SXYA 3H3ZA 4YG2F 1YQAA 2EFNA 2E1NA 5DYMA 4ZH4F 2GAUA 3WTZA 2XGXA 2GIVA 2QYOA 3C18A 2E7WA 2OZ6A 2BBYA 5IT9Z 5ED4A 5ICFA 1MJBA 1GXPA 4BH9A 3VEPA 1ZHFA 2ZNYA 5F1RA 2P8TA 4LD5A 4UXNA 4OIOF 2BV6A 2P7CB 4MHGA 1IN7A 3TO7A 1B9NA 4YIFA 4O3MA 4PGGA 1TQPA 2RQPA 1FNNA 5JI6A 3HSRA 3RKYA 4IPAA 3R4KA 4S04A 4M9ZA 2QQBA 2H09A 3N97A 3QPHA 3VOEA 3VODA 3FX3A 2QUFA 3OV8A 1TNTA 1KGSA 2FMLA 4EJOA 4U0YA 4BXUA 1MJAA 1ZLJA 5DD4A 1E2XA 4BHBA 3D0SA 2RNJA 3MQ0A 4CXFA 1LB2A 2XASA 3CUOA 2H6CA 4R8HA 4IRIA 4I0AA 2H94A 2P4WA 4YFXF 4HQEA 2OAZA 4LK1F 3ISPA 1XB4A 4HLXA 3MZHA 2DW4A 4M74A 2A61A 4G94A 5D4SA 3GFMA 1U8RA 4JBAA 3JAMZ 3DPTA 3R61A 4A5MA 3MZYA 5JFRA 2RDPA 4JQFA 3I59B 4HF0A 4ESFA 2PG4A 1KU7A 3V8LA 5D4RA 4KIGA 3F8CA 4LLLA 2O8XA 2M5WA 3TKYA 3ZN1A 5E1WA 4L0ZB 5CVUA 3WGHA 4I0BA 5D6EA 4RS8A 1FYKA 4FX0A 2Z9OA 1B9MA 5AONA 2M45A 1RUOA 1G4DA 1GVJA 4KNYA 4G8XA 2Q0OA 4WX9A 2FNPA 4HX4A 3WU1B 3JTGA 5BPDA 3GUDA 4BQAA 1ZYRF 1SAXA 2FU4A 3QRFF 1T0FA 4GXOA 4RAYA 2XROA 2QENA 4XSXF 2HFHA 2HKXA 4KN4X 4G7OF 4RB3C 3BWGA 1G3SA 5EEGA 4CHUA 2JZYA 4MQ9F 1FOKA 4LJZF 1FC3A 1JXSA 4FHTA 1DPUA 3FMQA 2DFIA 3SZTA 1S7OA 1X3UA 2DI3A 1DP7P 4HV6A 2VC1A 5J8FA 4N9IA 2QQAA 1RNLA 2X4HA 2FMYA 4ZYDA 1ZRFA 1MGTA 2DK8A 3SZPA 3GYHX 1W5TA 4AVPA 1UHMA 5LLQA 3M1EA 1R00A 3RPUA 5JHUA 1ZG3A 4RB0A 1P6RA 1LEBA 3WGIA 2MBFA 3HRSA 2COMA 1BOAA 1DPRA 3NQOA 1HW1A 3R6SA 5L3CA 2VT3A 1S8NA 3LA7A 4CO8A 3QPTA 4OIRF 1KU9A 1HQCA 2P6TA 3FM3A 1LDKB 4KYWA 2UZKA 5DV5A 2ADUA 5CVRA 3HIFA 3RIRA 2K4JA 1XCVA 2BE5F 4UV9A 3BROA 5ICGA 2DQLA 5CJ9A 4B8XA 3WTXC 3TOBA 2O03A 3BDDA 1R5HA 2MLGA 3T0YA 2IA2A 4LLNA 3P9CA 4HQMA 3KETA 5LRRA 4EM1A 4G6QA 1OYYA 2ZBKA 4BHCA 4RB1A 2ZMEB 3DFGA 2ISYA 2E1CA 4FT8A 4MEXF 2L4MA 2VE9A 2L3DA 1CF7A 1HKQA 4CGZA 1TTYA 1V4RA 2DTRA 4KT5C 1R58A 3RKWA 1I1GA 2ZKZA 3RPQA 1FSEA 3BY6A 4P9FA 4YFNF 4AD9A 3TDZC 1ODDA 3BP8A 4F7ZA 3V8KA 2K02A 4CDGA 5E8IA 4HX7A 2OD5A 4IHTA 1T6SA 2P5VA 4DNCA 1YS6A 2O3FA 1B4AA 1XDSA 1XGOA 2XAQA 2VE8A 4WWCA 2OU2A 2WWYA 4I02A 2VBZA 3I58A 3BZ6A 1P2FA 3EYYA 5LEJA 2XV4S 2G7UA 2XHKA 2Q2EA 3WE3A 2IA0A 1GXQA 1JE8A 1SD6A 1Z05A 1HW5A 1EH6A 3FHZA 3W6JB 4OU0A 2IT0A 1J0RA 2OA4A 5DD8A 5CLSA 2V9VA 1JGSA 1P4XA 1FSHA 4I01A 2QVOA 1R7JA 4A0XA 5JR3A 2FQ3A 2MH2A 5FD5A 5D5XB 1HKSA 5BQTA 4AIKA 3ROUA 2EFOA 5L3DA 4E70A 3K1PA 5HS9A 1Q1HA 1C0WA 4AIJA 3IRQA 1R23A 2FNAA 5CVVA 1HKTA 4ENJA 3EQLF 1YS7A 2VT2A 4HZFA 3CDHA 1YG2A 1HW2A 3GFIA 5FD6A 1OKRA 3FF5A 4AIHA 3GFLA 1V3FA 4KDPA 4P5OA 5FLXZ 5DCMB 1RIOH 5D5UB 3HSFA 4D0PA 2OQRA 4ESBA 2FBIA 1J59A 1OPCA 4M72A 5H6RA 3FWEA 3GWZA 2EV5A 2K4BA 4K2EA 4ZYGA 3ZMZA 3P7NA 3R0JA 2V79A 3HTSB 1TW2A 5EEHA 3L2CA 1YO5C 1YW8A 2QBYB 3VFZA 3P9KA 2HTSA 2J5OA 3E97A 1BI3A 1T2KA 2XAFA 1REPC 3IC7A 2M1BA 2JRTA 1J5YA 4M9XA 1KYWA 3PQKA 1R1TA 1YW7A 2PN6A 3LQQA 3CLOA 4Y17A 4M9SA 1SMTA 1FZPB 3WTSC 3DEUA 1JHHA 2UWMA 2AXLA 3KP4A 3ZMTA 3L9FA 4WXHA 5KK1A 1QGPA 2DPUA 1BBYA 3W6KB 4UV8A 1Y0UA 3WTWC 4ZYHA 4Q48A 3VB2A 3DKWA 1QQIA 5L3EA 4U0WA 5E20A 1XN7A 1B1BA 4L18B 2CYYA 1I27A 4EJTA 2V1UA 5FB2A 3EYIA 5E18F 5E1ZB 3F8NA 2EFQA 2JSCA 3F72A 3KEQA 2FF4A 5D6FA 2STWA 2DQRA 2Z5UA 2ZO4A 6PAXA 1XSXA 1EH7A 2IW5A 1FY7A 2M8EA 3WTUC 5DUKA 3SHFA 1BI2A 1ZAOA 3KP5A 3QOPA 4M6YA 1W4MA 4NB5A 3JSOA 2EB7A 3H3UA 3WODF 3F8BA 1BM9A 4KICA 1I6XA 1FLIA 4A12A 1RI7A 4RB2C 4HAMA 2RVCA 4XLNF 2IVMA 1O3RA 1BIBA 4Q47A 2VOOA 4RGXA 2DT5A 4YIIA 5BS6A 1UHWA 1R1UA 2EFPA 1FBUA 1EV7A 3L00A 1ZN2A 4HLYA 2R7FA 1W7PA 5LHGA 1G3WA 3SFZA 3F6OA 4PCQA 3F8FA 2MLKA 1IRGA 4HF2A 4Z2YA 1ONVA 1YLFA 2ACJA 2FEZA 2RKHA 2R7DA 3MCZA 2Z33A 3FXUA 1QNTA 1B59A 3J81Z 1HSJA 1O57A 5LHHA 2GA2A 1UFMA 4RAZA 3T8TA 1PP8F 2ETHA 5JVTA 3ZQ7A 1E17A 5HLIA 1JHFA 2YR2A 1A04A 1O7LA 3R0AA 4I09A 3GVAA 5FFXA 4RGRA 3T8RA 1J75A 2XAHA 3ELKA 4P55A 2PEXA 1RUNA 3CJNA 2E7XA 5D8LB 2CFXA 2KJCA 2HQRA 1PUEE 5HVQC 2A6HF 1I5ZA 5HDGA 4P9UA 1G3TA 2LF8A 3TO9A 3HRTA 4I7HA 3ABUA 4L9NA 1OR7A 1ZREA 3O2PE 4LG0A 1SD5A 3EUHA 3R60A 3C1DA 3MWMA 3QU3A 3B73A 1U5TC 3IWFA 3CO7C 2L01A 3CTAA 2O0YA 2UXXA 2IRFG 4LB5A 3O6BB 5E1XA 5F64A 2BGCA 3PQJA 3GO5A 1TQIA 1Z6RA 2DU9A 4WXDA 2EA2A 2FBHA 3LSTA 4L9TA 3Q9VA 1WWXA 1R1VA 4HDVA 2PQ8A 2VBWA 2GXGA 1F4KA
chains in the Genus database with same CATH superfamily
2DOEA 2LDUA 3W2WA 2HDWA 4BU2A 3CUQB 3WG9A 2VQLA 2Z3YA 3E6MA 2QM3A 2WAQA 4L5EA 1T08B 2V6CA 3DP7A 3VPRA 4HDUA 3B6AA 5IPAA 3LAJA 1UZCA 4IQJA 3JTHA 3S32A 1O3SA 1ZTRA 1L3LA 1FBQA 1Z91A 3OSFA 1BC7C 1GV5A 3G1OA 4ZZDA 4G9YA 1ZRCA 2FOWA 3E5QA 5H20A 1IUFA 2DMQA 1LVAA 5FGMA 3T1BA 2FXAA 2VBXA 4MGRA 2K86A 5CVJA 1ERDA 3K1NA 3WGGA 2VKVA 1FT9A 1BN5A 4LMYA 1WVRA 2EZKA 4A2UA 1W7PD 2IBDA 4PJNA 1XMXA 1QVTA 4YFKF 2MW8A 4ENNA 1R22A 4RGUA 4B44A 3FK7A 2NNYA 3QQAA 2XUBA 3G3ZA 4L5IA 2MC4A 3RKQA 3HKZN 1H9TA 2L02A 3U2RA 1M1EB 1R9TJ 1QO0D 3COAC 1LPQA 3QAHA 1Y6IA 4BAYA 5KNLA 2LYCA 1SD7A 3DTKA 5FKLA 2NVQJ 2DK5A 3MKWB 1X1BA 1WKMA 3GZ6A 3IUOA 1FYLA 2QSHX 4KIBA 1W36C 1H9GA 3M8JA 1VTNC 3ZOBA 3WTTC 3I59A 1HC8A 3TOAA 1XGMA 2IPQX 2V1XA 4OIPF 2F5CA 2L4AA 1Z1DA 1VQKI 3GFJA 1WQ2A 2HU9A 4QTRA 2DYSH 3MKLA 2W85A 3QU6A 1YX5A 1QPMA 5LGUA 2JPBA 3UR3C 2ZSIB 4EM2A 2XGDA 3HM5A 4XORA 2EJRA 4PFPA 2TRTA 4OINF 5FKOA 1B8IA 5F0CA 5KVRA 2OF7A 3V7SA 4BACA 2YU3A 5AIQA 1B72A 1PJRA 3BG3A 4AUXA 2DT6A 2HZTA 1T39A 3ZPLA 1E3OC 4XRSG 2BY1A 1RETA 2NRAC 5C44J 1NG6A 5BOXA 1BIAA 1UG0A 2ZJRF 3D5SC 3CCVI 4XRMA 3RTRA 1U78A 1PP7U 4KUMA 1K78B 3ERMA 1ZG1A 1A6IA 1BI1A 1D1AA 2MABA 2LBFB 1AKHA 1ZK8A 3SYTA 4A3LJ 3C7JA 2VONA 1FIAA 5DTDA 5HDNA 2Y75A 1YI2I 4HEA2 2MA3A 4OAYA 1WSUA 2IXSA 3UKGA 2PI0A 1A35A 1F43A 3M4OJ 1Z77A 2O61A 4CCMA 1TNSA 3CJQB 1U5TA 2JJ7A 4UB6C 3OYBA 1E3HA 2VXDA 3RJPA 3F3XA 4EM0B 1IXSB 2HKOA 2VJ4A 2HVQA 1NK3P 1WRJA 3E3VA 3ZR8X 2PMZA 1USSA 5EGOA 2CO5A 5LRSA 4U7BA 1MW7A 4WXCA 2XAJA 3CCJI 4G7ZF 2E71A 1XSVA 4KMFA 4EGZA 1VZ0A 1LE8B 3NWSA 3OMYA 4NQWA 1AWCA 4BXFA 1RC9A 1IDZA 5L3BA 9ANTA 3QYFA 2GZWA 3A03A 4FE4A 4EATA 4C3HJ 4AVZA 3FXOA 4ENMA 2X0LA 3MMYB 2NS0A 4I98B 3H9JA 4EMSA 1P9QC 3MFKA 1OISA 3PSFA 5F04A 5E79C 5J4YA 1X3WB 1ENHA 4X6AJ 2BY2A 4MTDA 1QZZA 3BZKA 1OYIA 4BY7J 3S3NA 3M7GA 4BEHA 3ZMVA 1XTAA 4UUVA 2LF7A 5BPIA 1V5FA 2OCEA 4DW6A 2I10A 2OZUA 4HV5A 1ETOA 4JP0A 4HA8A 2M7BA 3G71I 2DYRH 1TWGJ 4I6ZA 3OIOA 2F4IA 3HOXJ 1G3YA 2F5EA 3J7AO 4M3DA 2R7XA 1U5TB 1UJ8A 3CDLA 4JX4A 4A6EA 1HDDC 3DWLE 3IAS2 3HYIA 3S2WA 4JX6A 2JRMA 1GT0C 2K9LA 1YX3A 4AU7A 1UG2A 2MSYA 3IRRA 1E3PA 4CYCB 2ME0A 3GXOA 3NEUA 3ZQCA 2WAQN 3T5XA 2XPWA 3ZMDA 1ZH5A 2KRFA 2HYFA 3RI4A 1FBSA 5FLVA 2FBKA 2P7VB 2EIMH 3DLAA 1STZA 3NRVA 3CC4I 2FUG2 1X4OA 4EV0A 1WJEA 4ON0A 3H1CA 3FZVA 1DQUA 1U2WA 2Z2SB 4QSHA 3ZN0A 1O3QA 1IV6A 1FIPA 4OOIA 5J3LA 3BCAA 3S93A 3I4PA 2AQFA 2YS9A 1MBGA 4LOCA 5HS8A 1PUFA 2R7RA 1KA8A 1XGNA 2WB1N 1GLNA 5ILUA 3KP2A 4F55A 1I3QJ 2XKPA 1BI0A 2XPVA 3JAMK 5GAGJ 2VODA 1LFPA 2BVLA 2M30A 3F23A 1R5GA 3ML6A 2NOGA 3SDGA 2DLLA 4KN7X 3HL2A 2HS5A 5CKTA 3IH4A 3RDIA 1ZGWA 2HQ5A 2WC2A 4B3XA 5HLHA 1QBJA 4FX4A 4W1UA 4A3EJ 3HHGA 1TL8A 2CQXA 4XRFA 2ZCWA 3DF8A 2ZMEA 3ESWB 1Z0XA 3REOA 2LSOA 2DDAA 2FD5A 2R5YA 4C2UA 4LLGF 5FLXK 1D1BA 3PUBA 3GBGA 1WJBA 2IJLA 2XC7A 2DBBA 4S0HB 3OOUA 1K7AA 4YELA 1SMYF 2DPDA 1IRFA 3ASOH 3ZQFA 5BMZA 5D8KB 3CZ6A 4XSZF 2BYVE 3H9GA 5A2QZ 5LEKA 3CF5F 2LC2A 3HOWJ 3BZCA 3FMSA 3HUGA 4M73A 1K4TA 4LIVA 3JR9A 3OY9A 1IZ1A 5CQGA 3MEXA 3F21A 1P4WA 5JLXA 1VQPI 1ZGAA 3ZQGA 3JRBA 5E17F 2X51A 4BBSJ 2EK5A 4M71A 1SFXA 2QCOA 3S8PA 2X6OA 3HTUA 4IO9F 2Z99A 2Z1DA 3QYEA 5IY5H 2C6YA 2V6EA 2PJPA 3HBLA 3J80K 1AOYA 3W3CA 4E4HA 2M0MA 1MH4A 5LGTA 2V7FA 5H6QA 1RKTA 2NYXA 5EG0B 2D45A 3IKTA 2TCTA 3CP8A 5CQEA 3ZMUA 2X6YA 4E6KG 4UUTA 2HZDA 2BVMA 1JTYA 5FKNA 3WU0A 2CG4A 1S7AA 4JX5A 1YJWI 3LSKA 3AAFA 5LD2C 2KFDA 3BTJA 4U88A 5ICCA 1TP4A 4UNOA 4DQ2A 1F5TA 1XPXA 1WJCA 4UVCA 2ELHA 2ESNA 3CDIA 3K1MA 2JQ7A 5DEQA 4OIQF 4X1EA 1B6AA 3QPLA 2LVSA 3TEDA 4GRIA 1YTYA 2YX4A 4IHXA 2O8KA 4L5JA 4XLFA 4BKXA 2BEOA 3ECHA 5B66C 3PFYA 3UNGC 1RZ4A 5FFZA 3GX4X 2ICWG 4B09A 1IF1A 1WH5A 3Q9SA 2HVSA 3O3KA 1OMIA 1T98A 4HSRA 2LY9A 1KQ8A 3S2HJ 1U3EM 2EFWA 1Y8RB 2F2EA 4O6JA 5D5VB 1R4MB 4DYRA 4E7HA 1Z9CA 2KQRA 4ANJA 3BJOA 2EZLA 3PIOF 1F36A 1OR7C 1TWCJ 4CH7A 5J47A 4EJWA 2E60A 2XKOA 2L0KA 1XMAA 2MGQA 4R79A 2HPMA 1Z21A 1FWZA 4MTEA 4MO7A 1K4SA 2VN2A 1J9IA 3IL2A 1PDNC 2UXNA 5ILVA 3BJAA 4RAFA 5EZHA 4GO1A 4QWQA 3PUFA 4EGYA 2FE3A 1D5YA 4OMYA 1U9NA 2NOJB 2TDXA 2PJRA 3ZMSA 2IP2A 3GZ5A 1R6RA 2BXYA 1V54H 2X6WA 3M8FA 3LFKA 1I6HJ 3SEQA 1LVKA 3LWFA 1XCBA 5HDKA 3HOTA 2A5YB 5IT9K 2AQEA 4FQGA 2XF6A 4XLPF 2JSPA 5AIPA 4IF4A 2K5CA 3C3WA 2HOEA 5E8GA 4LGWA 1SFEA 2M87A 2KKOA 1HLVA 3DQVC 2KPMA 1VQ5I 2HTJA 4A3FJ 2L9NA 3I55I 3U1DA 1O7FA 3KLNA 1MJ9A 4ZDLA 1X2MA 4CYDA 3BG7A 1BR1A 2CQKA 3HOUJ 1JKPC 2E2JJ 4ZDOA 2VPLA 2KRCA 1JUSA 4CCLA 2KIUA 3F8MA 2DN0A 5DCMA 4QLCU 2QEXI 2HQAA 2HXOA 2D1HA 3KP6A 4TV7A 2QQ9A 4IRGA 1X58A 3K4KA 5ERIA 4HYEA 5JVGF 2JMWA 4OMZA 1XMKA 3KIOA 2GXBA 4Y4RA 1MMSA 1HBXG 3CC2I 4FASD 4MLOA 2DFHA 2E5ZA 4HOBA 4MQVA 1HF0A 3MD2A 3OIPA 4IHSA 2R7SA 2R93J 5J6XA 2YSRA 2ZMEC 5TJJA 1NG7A 2BY3A 3KP7A 2ZNZA 2Y2ZA 2QBYA 1MIJA 4Y15A 1O3TA 1TW3A 1LNWA 2GXAA 3FXKA 5F08A 1FX7A 2CSOA 2HGCA 4OWRB 1VQ9I 3GF2A 4N9HA 4GCVA 4NC6A 1IJWC 1YFHA 4P96A 4X0GA 1TQMA 3OYEA 4ABZA 3TW7A 3M07A 1W7PB 1DDNA 1OYWA 4IJAA 3CCQI 3K9TA 4GGGA 1IXCA 2MC3A 3HRUA 1DUXC 1BJAA 4KT6A 2PX9A 1LEAA 1ITYA 2H6BA 4LIUA 1Y8QB 5E3LA 4A0ZA 2H8RA 2K7LA 2OQGA 2ZC2A 3BC8A 1K6OA 3K4LA 1MD0A 4EJUA 3JSPA 1DP3A 5EZGA 3K0LA 1MZBA 3L2UA 2ECBA 1D8KA 2RGVA 3M3YJ 2M9HA 2K9QA 4DJAA 3ASNH 1FPQA 2KISA 3M9AA 2DA3A 5EF6A 1VQ6I 2FQ4A 3JRFA 1BW5A 1G6NA 2E36A 3GLXA 1YHQI 1K79A 3DKXA 3Q0VA 1MSFC 3FHNA 4AIDA 2WY8Q 4M3FA 4ESJA 4A3DJ 1RKWA 2CW0F 1YIOA 2V1DA 1P7IA 4BQNA 4M6VA 1KU3A 1R71A 5K5RA 2K9MA 1YYVA 4XLEA 3I3LA 4IVNA 2ZSHB 1YITI 2GBYA 1J09A 1MMGA 2RC4A 5F1JA 5L3GA 5KAFC 2KIFA 2KMUA 4XL9A 3G73A 1ZARA 1IAWA 1BC8C 2XF7A 3WTVC 1RPWA 2RN7A 4V19K 2YX7A 1WGXA 3FXQA 3LA2A 3K4NA 2L2OA 3K2ZA 3BR6A 2CV2A 1N75A 2VBYA 5K1YA 2PBIA 3NARA 1HOMA 2RV8A 3PNTA 2F4MB 4B3AA 2A6TA 4CCJA 2XDVA 1WJAA 1IN5A 5GP9A 2W7NA 4IHWA 1EH8A 4ZYEA 1SEUA 4KIFA 4I2OA 4ZZLA 3KE2A 1XD7A 3J7AY 2HR3A 1MDMB 2YPRA 3GEZA 2DCEA 3ULQB 3OYMA 2K9NA 2J5PA 4NHJA 1P4AA 1RESA 2IS6A 2F5FA 3RKXA 1VFCA 3OYJA 2QKMB 3BLYA 4UHTA 3D1NI 3V4GA 4L0YB 3E6DA 3A2KA 1BOBA 3CJTB 4L9VA 2P5KA 4F92B 5HLGA 5TRDA 3KZYA 3E5UA 2W25A 3HOSA 5CVIA 3CUQC 2CQQA 2VASA 2KZVA 5LBQA 3LL7A 4IXAA 5GTIC 4LG0B 1FTTA 2D1VA 1IN6A 2R92J 4XBFA 3CCYA 3VSKA 1T33A 2ELJA 3EETA 1H0MA 3SFIA 4H0EA 3K70C 1ACIA 3ABTA 2XB0X 4PFOA 3RZDJ 1S3JA 5K5OA 3OR2C 4FTHA 2K85A 3HKZA 2UUZA 2Y31A 4AYBA 3KYCB 1OCPA 2OC6A 3SJMA 4M6XA 4B47A 3I5UA 5GPCA 1S6LA 1IO2A 3HSEA 5HS7A 3QPSA 1Z7UA 4WK8F 1JTXA 2ISZA 5HNHA 2LH9A 1WJ5A 1I39A 2HQNA 1N77A 3CLQA 1FYMA 2F5DA 1YE9A 3PIPF 3CF2A 3JREA 2JTVA 2OBPA 4UVAA 3LA3A 4U7DA 3OS0A 4I76A 2XAUA 1Z6TA 3V7CA 5HNFA 2EV0A 2QWWA 5LFAA 3WE2A 2A05A 1I1SA 1RR7A 3P5JA 2A68F 3TO6A 1XC5A 1VQMI 1HDPA 5J8CA 1GHCA 2STTA 3EDPA 3HEFA 3B02A 3KZZA 1MNEA 2OTJI 3I64A 3HJEA 1R36A 1S29A 2R3SA 2ZFWA 2PLYA 2K3FA 3E6CC 1X2NA 2GQQA 3S16J 5DCFA 1Z3YA 3E7LA 2A5WA 4HW0A 5IT3A 3IHUA 2IS4A 2XSDC 1AA7A 3CQZJ 5K7ZA 4ZC3A 2ZJ2A 4IHYA 4NDLA 3M1CA 4IRHA 4NNJA 3V8JA 1NTCA 2E5NA 3GTLJ 1USTA 5C3EJ 4KFCA 2A69F 3TL4X 1SVOA 1D3YA 5BNGA 2HNHA 2HEOA 3BOQA 2QGUA 3QP6A 1UB9A 3ZQLA 1D0YA 3IP4B 3TP0A 2AS5F 1R5ID 1DGRM 3H92A 2XRNA 4WF2A 2F48A 1F1ZA 4U0VA 4B4CA 2VC0A 3DXJF 4J19A 1D5VA 5FJ8J 4A3JJ 4CZCA 1XDUA 2OCCH 2FJ1A 3E6BA 3KP3A 2KRHA 2QZ8A 2Q8KA 1L0OC 4H4KC 4KMUX 2CGPA 4RGSA 3N4MA 4ETSA 1TBXA 3A01A 1FMWA 2IA1A 2W84A 4IHVA 1LUJB 1W5CC 2R7ZJ 4LK0F 2W24A 4PDKA 5CYVA 4MEYF 5ILSA 2E2HJ 3C2GA 2LR8A 1IN4A 1ETXA 5HOOA 4MNUA 4A5NA 2PFBA 2WBMA 4RBOA 4GDFA 2FSWA 2PMHA 1KU2A 4IOCF 5IP9J 1TT5B 1HXDA 4NBQA 5DM6F 3F22A 1K78A 4BHPA 1S7EA 2K3PA 2Y0SN 2VLAA 2LBFA 1AKHB 1S72I 3L09A 1Y1WJ 2GWRA 4P1WA 3LSJA 2HDCA 5LGNA 1D8JA 2EA4A 3DLLF 4Y3OA 1OFCX 1LKXA 2VXZA 4HX8A 1IXRC 1QZYA 3BG5A 3HC7A 3LAPA 2ID3A 1IN8A 1IRZA 4E7ZA 5LHIA 3HOYJ 1FP1D 2A3SA 1ZR2A 1N78A 2Y0SA 4O5VA 3DBLB 3K10A 3RYRA 3JRHA 3GZNB 3TGNA 5E3NA 2XF5A 1MH3A 4D9JA 3DPLC 3MAJA 1WJDA 4XMYA 4EVIA 3OS2A 2DMUA 3G2BA 4ENKA 3LSGA 1OCZH 2NAZA 2JA8J 2LKPA 1T56A 1OJLA 4Q4ZF 2X48A 3L7WA 1ON1A 2ID6A 1U6GA 3LFUA 4G6DA 2Y0MA 3OSGA 3U9GA 1T38A 3IWZA 4AWXB 1KYZA 2CWEA 3I54A 4NQWB 4E7JA 1ZLKA 3GTQJ 2WTEA 1R49A 4DOZA 1F9NA 3CUQA 2O9LA 1XGSA 2GIZA 4Y7NJ 2CW8A 2EBIA 3RYPA 2XSJC 4S05A 1WI3A 2KT0A 4IL6C 1V5EA 4JYKA 1SD4A 5DUIA 3BG6A 3S1RJ 3MN2A 4UUSB 3K4CA 4CICA 3BR0A 1RR8C 1ZG5A 3RCOA 4AYBN 4B1RA 3L2RA 5FKMA 1NH3A 2HI3A 1NHAA 1X19A 1MMNA 3KFWX 1FEXA 2WAEA 3KLOA 2WV0A 3I53A 1HSTA 2V1NA 4HBLA 2MD5A 4ZYAA 4JK1X 2Y48A 1LQ1A 1LJ9A 1TLHB 1ZKGA 2LY2A 2L54A 3E5XA 2X85A 4V2FA 4J01A 1CGPA 4R1HA 1A5JA 2L9RA 3ZP5A 3I9V2 3BPVA 3K4MA 4N4OB 2MH9A 2NNNA 3X2QH 2LD5A 1SFUA 1KQ9A 2LP0A 2XIGA 2PMUA 4HNTA 1KQ0A 2DTZA 3PFIA 2ZXJA 1V5GA 2CV0A 4G7HF 4LB6B 3P9IA 2XVCA 3S3OA 1WHUA 2VIXA 2CUFA 3TQNA 2DDBA 2ZJQF 2ESHA 1IW7F 1H89C 2GOMA 1W5SA 3FXRA 4Y13A 3TDUC 5K7HA 4GYGA 2VOPA 3JW4A 3CO6C 3I71A 1Y1VJ 3HHHA 3H3VK 3J81K 4XKCA 3F6VA 5L3FA 1MKMA 3U1KA 3WG7H 1HCRA 1LDJA 4WCGA 4II2A 4XK4A 2KIMA 3BPXA 2KJBA 3RPUD 5K5QA 5F6FA 1PUFB 2HWVA 1A6QA 1VQLI 4IQ4A 4BNCA 2CH0A 2FOKA 2CFOA 5HLTA 1ETYA 2IGKA 4KA4A 1VQ7I 3S15J 4IZZA 5FO5A 5GADJ 1ZRDA 2JT1A 3JRAA 3GW2A 5IP6A 3ECOA 4N0BA 1IUYA 2JVGA 3BR1A 3BR2A 1S9HA 1FTZA 2QF7A 3KYDB 2JK3A 3SZGA 2HOSA 2FA5A 5DDGA 2K27A 2ME6A 3DCFA 3FMRA 4BYYA 2R5YB 4LITA 4F3QA 1PYVA 2EQRA 1V55H 2R0QC 3RZOJ 2LNBA 2E1MB 5A2QK 2DAOA 1UHSA 2ELKA 2ZFUA 5FKKA 2QSFX 4D1QA 1IRXA 2K9SA 4C2TA 3KPHA 3WTYC 2ZXIA 4UVBA 3EUHC 2G9WA 4XKVA 2ZXWH 5EJCA 2DFFA 4GYIA 1WI9A 1FP2A 5ICEA 1T95A 3TBIA 3LQRA 3D5LA 3E1SA 1QHGA 3HRMA 2MG4A 2XB5A 3NAUA 2O6GE 4ASNA 2DFEA 4D5CA 3J80Z 1P92A 4PGHA 2H27A 2DXIA 3BJ6A 4I99C 3J7ZI 4A6DA 3ONQA 4PJMA 4A3GJ 2D2WA 1UCRA 2JPCA 2OJED 3N05A 4Q5SF 4BE2A 3DV8A 4CZZA 3FBIB 2GA1A 2HYGD 4BJ6C 4A0YA 2Y69H 3MVPA 1ZGJA 1MDMA 1J7KA 3VYRB 2FRHA 1J2XA 3PSIA 3ZRGA 3I0TA 3PNYA 2R7WA 1EA3A 3Q5FA 2A6EF 2P6SA 3K69A 4MFEA 1KONA 2CMPA 3OYDA 1XG1A 1Y39A 3IKVA 2A07F 4EQQA 3FDYA 2EH3A 3E0JB 3OOPA 4CSWA 1U8BA 2E2IJ 1ON2A 2QLZA 2EV6A 1TT0A 3KCCA 1XSDA 1D0ZA 1JT6A 1CF7B 4PZJA 3JRIA 3FM5A 2VB6A 2X1EA 3ZQQA 2W57A 2B0LA 3VYUB 1TWHJ 2EWNA 4AC0A 2P5LC 1ULYA 1YW9A 1LDDA 3M8EA 4EJVA 5D5WB 1MSEC 3KEOA 1WCMJ 4W97A 3QP5A 4LFUA 3CMYA 4BL0B 4PSWA 4ZDPA 2G7HA 3K4BA 1LFUP 4HF1A 1JKOC 2XAGA 3IAM2 1VQOI 2LK2A 4XICA 1Z7LA 3V7RA 4ZTFA 3ERED 3ZQHA 2DO7A 3DPUA 3IH3A 4M3EA 4XIDA 2QA4I 4C3JJ 3SQNA 2KHMA 4L9JA 3H0GJ 2EINH 3GTKJ 3SXYA 3H3ZA 2LMDA 2FX0A 4YG2F 1YQAA 4EEFG 2EFNA 2LKSA 2E1NA 1ZQ3P 1K6YA 1Q1VA 5DYMA 2GAUA 4ZH4F 1ETQA 2F6CA 3FIWA 2XGXA 3F9KA 3WTZA 1VQ4I 2GIVA 2QYOA 3C18A 2E7WA 3H9QA 2OZ6A 2BBYA 2RAEA 5IT9Z 5ED4A 1FOWA 3AG2H 1TZLA 5ICFA 1MJBA 2H1LA 1GXPA 4BH9A 1IG7A 3VEPA 2Y30A 1ZHFA 2ZNYA 4XN0A 5F1RA 2P8TA 4LD5A 5IYBJ 4YRVA 4UXNA 4Z6YA 2DJNA 2KDZA 4OIOF 5M5XJ 1JKRC 2BV6A 2P7CB 2RQQA 4KITB 2HXIA 4MHGA 1IN7A 4JOMA 2DOAA 2DOFA 3DKYA 3A0HC 3C2HA 3CCSI 3TO7A 1B9NA 4YIFA 4O3MA 4PGGA 5H2FC 2H1KA 4UB8C 3H5AA 1TQPA 2ZXHA 2RQPA 2VL8A 2Y9YA 1FNNA 3S1NJ 1CQTA 1A36A 4Y33A 1NK2P 3VWBA 5JI6A 2EIKH 3ABLH 3BQYA 3PM1A 3HSRA 3RKYA 4IPAA 3EUKL 3R4KA 4S04A 4M9ZA 1EJ9A 2LREA 3SDBA 4N4NB 3S2DJ 2QQBA 1SAUA 2H09A 1GVDA 3LSMA 3AG3H 3N97A 3QPHA 3VOEA 4DYQA 3VODA 3LSPA 3FX3A 2LLKA 2XGEA 3AG1H 3JRDA 4A3CJ 2X1DA 2QUFA 3OV8A 1TNTA 1KGSA 2FMLA 4EJOA 4U0YA 4U87A 3W2AA 4BXUA 1MJAA 1ZLJA 3HOZJ 4RAGA 5DD4A 1E2XA 4BHBA 3D0SA 2RNJA 3KZIC 2Y9ZA 2E34A 4OAZA 3PO3J 3MQ0A 4CXFA 1LB2A 2V9PA 3AL0C 1BA5A 2XASA 3CUOA 1MBJA 1YIJI 2H6CA 4RM2A 2EZIA 3ABKH 4R8HA 3DU6A 3G1MA 3GTMJ 4D7MA 3BR3A 3G1LA 4II3A 1FOYA 4IRIA 1ETVA 4I0AA 2F5VA 2H94A 2P4WA 3FKJA 3B6CA 5TGTA 2ECCA 4YFXF 1VQ8I 4HQEA 2VI6A 3L2WA 2OAZA 4LK1F 3A0BC 3ISPA 1QPIA 2JA5J 1XB4A 4HLXA 5IOZA 3MZHA 2R7VA 2DW4A 3W2VA 3BR5A 4M74A 2A61A 1G2HA 3OL4A 1X1DA 4G94A 3I4NJ 5D4SA 2R7OA 3ZQIA 4UY8I 1ZELA 2EZHA 3GFMA 4BS9A 1U8RA 3FKIJ 3CCRI 4JBAA 3JAMZ 5KAIC 3DPTA 3R61A 2CS3A 2L7MP 4D5FA 3TW6A 2KLOA 4A5MA 1IGNA 2IS2A 3MZYA 5JFRA 2RDPA 4JQFA 5K7FA 4A3KJ 3HB9A 2GM4A 1GUUA 3I59B 2OTLI 3LSHA 1ZR4A 1ETWA 2IS1A 2L7KA 4HF0A 2HYJA 2I8DA 2KP6A 4ESFA 3A1YA 2E1MC 5J40A 2V26A 1EKEA 2PG4A 2CV1A 1MNMC 1KU7A 3V8LA 5D4RA 4KIGA 3F8CA 4LLLA 1B8IB 2QQ8A 2O8XA 2B7EA 2GLOA 4XOTA 5B5EC 2M5WA 3TKYA 3ZN1A 5E1WA 4L0ZB 5CVUA 3WGHA 4I0BA 5D6EA 4RS8A 1QHHD 2M0CA 2BHYA 2DT7B 1FYKA 4FX0A 4KJZA 4UUSA 3L1PA 2Z9OA 1B9MA 3CP2A 5AONA 5FROA 2M45A 3RSNA 2E19A 1RUOA 2IGMA 3MKZA 2IEKA 1G4DA 1GVJA 1X1CA 4KNYA 4G8XA 2Q0OA 4XN3A 3TP3A 2LKXA 1MBKA 4WX9A 2FNPA 2HOTA 4HX4A 3WU1B 4YIRX 3JTGA 3QYBA 2L5QA 3FBNB 4XKBA 5BPDA 3ZGKA 3GUDA 4IEJA 4BQAA 1ZYRF 2I5UA 3K4JA 1SAXA 2FU4A 3QRFF 1T0FA 4GXOA 4HPQA 1W0UA 4RAYA 4DIQA 2XROA 5EGOB 2LFBA 3J7YJ 2VKDA 2QENA 4XSXF 2HFHA 5M5WJ 3H5RA 2HKXA 4KN4X 4G7OF 3HPGA 5C4JJ 1MMDA 4M3BA 3H0DA 2CQNA 3RQIA 4RB3C 2OPTA 1KZHA 3BWGA 1G3SA 1PVEA 5EEGA 2D5VA 4CHUA 2JZYA 4MQ9F 3GLLA 1FOKA 4LJZF 1FC3A 1JXSA 4FHTA 1DPUA 3FMQA 2DFIA 2ZB9A 3SZTA 1YOVB 1S7OA 2CUEA 1N25A 4QIWN 1X3UA 2R5ZB 2DI3A 2MYSA 1DP7P 1SVLA 4HV6A 2NS7A 2VC1A 4E7KA 1AU7A 5J8FA 3VYTB 1K83J 4N9IA 2QQAA 1RNLA 3K6GA 4MFDA 3VYSB 2X4HA 4BJ5C 3OS1A 1WH7A 2FMYA 4ZYDA 1ZRFA 1MGTA 2DK8A 1SC7A 2WA0A 3SZPA 1W5TA 3LSRA 3GYHX 2DODA 1ETKA 4AVPA 1UHMA 5LLQA 3M1EA 1R00A 1MNDA 1WPKA 2NVYJ 3RPUA 1ZG3A 4RB0A 1P6RA 5JHUA 4HSTA 1LEBA 3WGIA 2MBFA 1W1WE 3HRSA 1YJNI 2COMA 1BOAA 4CYCA 1DPRA 3NQOA 1HW1A 3R6SA 5L3CA 3LNQA 2VT3A 1S8NA 2VKEA 3LA7A 4CO8A 2M4KA 1QVUA 2DMTA 2VPRA 3QPTA 2RREA 4RLQA 4OIRF 1KU9A 3H36A 1HQCA 2JVHA 4PK4A 5M3FJ 2P6TA 3FM3A 5EYRA 3HXLA 3QOEA 1LDKB 2WAFA 1MMAA 4KYWA 3C2BA 2UZKA 3OIQA 2K40A 5DV5A 4C9YA 2ADUA 3CCEI 2W00A 5CVRA 3HIFA 1OCTC 3W6VA 1B72B 3RIRA 2K4JA 3CCLI 1P7JA 3VDXA 1BL0A 1XCVA 2BE5F 3DU5A 4UV9A 1XS9A 3BROA 5ICGA 1OCCH 2DQLA 4GFBA 5CJ9A 3D5RC 4B8XA 3WTXC 1O4XA 1Y0NA 4PUSA 3TOBA 3ZCOA 3K70D 2O03A 3BDDA 3A01B 1R5HA 2MLGA 4CCKA 3T0YA 2IA2A 4LLNA 4FE7A 3P9CA 5TISC 4HQMA 4XONA 1JT0A 3BQZA 2VQHA 3KETA 2W4SA 2M7AA 4PJJA 1GV2A 1BW6A 2XGCA 3A4CA 5LRRA 4EM1A 3PO2J 4G6QA 4XLHA 1OYYA 2ZBKA 4BHCA 2E1OA 4MIMA 4RB1A 2ZMEB 4ZJZA 3DFGA 2ISYA 2E1CA 1I3AA 3OYNA 1DGWY 2JN6A 4FT8A 4DZJA 4MEXF 2L4MA 2VE9A 2L3DA 1CF7A 1HKQA 2EPFA 4CGZA 3HG9A 3G6EI 1OCRH 4F52A 3LOCA 1TTYA 1V4RA 2DTRA 1GDTA 4KT5C 4C30A 4BQOA 1R58A 3RKWA 5J1RA 1I1GA 2ZKZA 2LY1A 3RPQA 1FSEA 3CCUI 2M8GX 3BY6A 4P9FA 1QZEA 4YFNF 4AD9A 3DBRB 1T0FC 1TWAJ 3TDZC 3EUAA 2L7FP 4XOPA 4DZPA 1ODDA 2JUCA 3OYGA 3S1MJ 2M2EA 3BP8A 2V9KA 4CA0A 4F7ZA 3I56I 3HOVJ 4RM3A 3V8KA 2K02A 4CDGA 2H8WA 3I4MJ 2DA6A 5E8IA 4CUGA 4HX7A 2M3AA 1ORKA 2OD5A 3FK6A 4IHTA 2BW3B 2NS8A 5E3OA 1T6SA 2P5VA 4DNCA 1WJFA 1YS6A 1IDYA 3K7AJ 1QA6A 4F93B 2O3FA 2L9SA 1SFOJ 5EG0A 1QRYA 1W0TA 1SANA 3OWTA 1B4AA 4RLFA 4BEHB 1XDSA 2DA1A 1XGOA 1JI8A 2XAQA 2VE8A 3MZ8A 2VQCA 4WWCA 2LTPA 2OU2A 2WWYA 4CCNA 4XKWA 1TC3C 4I02A 2VBZA 2KZGA 2NVTJ 3I58A 1JGGA 3GCMA 3BZ6A 3CJRB 3LSIA 1P2FA 5DS9A 2NXNB 3EYYA 1Z67A 2WADA 5LEJA 5EEAA 3AG4H 2XV4S 3DEEA 2G7UA 2XHKA 1BR2A 2Q2EA 2DMNA 3WE3A 2IA0A 2YU9J 1GXQA 1JE8A 3KYLA 1SD6A 1Z05A 2JWTA 3U21A 3V42A 2AHQA 3O8HA 2Q1ZB 2CJJA 1HW5A 1JUPA 5IP7J 1EH6A 2W1OA 3FHZA 1DU6A 1JKQC 3W6JB 3FXJA 4OU0A 3ABMH 2IT0A 1J0RA 4CCOA 2OA4A 5J4VA 1UMQA 5DD8A 4KISA 5CLSA 5IYCJ 3BG9A 4HNVA 3KEYA 2V9VA 1JGSA 3QODA 1P4XA 1FSHA 1K61A 4I01A 2QVOA 2X9DA 1HA8A 1R7JA 4A0XA 2P81A 3GTGJ 5B1AH 5B1BH 5JR3A 3OYIA 2BZTA 2FQ3A 2MH2A 5FD5A 3QWLA 5D5XB 1HKSA 5BQTA 2BW3A 4AIKA 5GAHJ 1FJLA 3AL0B 3ROUA 2EFOA 3CMMA 5L3DA 4E70A 3K1PA 5HS9A 1Q1HA 4E7LA 1C0WA 1G8XA 4AIJA 3IRQA 1R23A 2O7OA 4XRSA 2PJRB 2FNAA 3OYAA 3RQ4A 3OYLA 4C2MJ 5CVVA 5KCMA 1HKTA 4A93J 1OCOH 1Y56A 4ENJA 2OV7A 3EQLF 1YS7A 2LRDA 2VT2A 4HZFA 3CDHA 3IV5A 1YG2A 2WV1A 3JRGA 4IX7A 2LG4A 1TWFJ 1HW2A 5FLMJ 1POGA 2XRLA 5FD6A 3GFIA 1OKRA 4C3IJ 3DEWA 3FF5A 4FETA 4AIHA 1UAAA 4NC8A 3GFLA 1V3FA 2ZJPF 4KDPA 4P5OA 5FLXZ 3WHBA 4BBRJ 5DCMB 1RIOH 2E35A 3OYHA 4HG2A 5D5UB 1JJ8C 3HSFA 1H8AC 2CRGA 4D0PA 1D1CA 3BTCA 2OQRA 4ESBA 2DA4A 2FBIA 1J59A 1OPCA 4M72A 3OYFA 5H6RA 3FWEA 3GWZA 5E3MA 4BE0A 3HGYA 4LG3A 2EV5A 2GOXB 2K4BA 3JCUC 2W82A 4K2EA 4ZYGA 3GTPJ 1YRNB 5GPAA 3ZMZA 4D7NA 3CD6I 3P7NA 3R0JA 3CMAI 2V79A 2NVUB 5HODA 3HTSB 1TW2A 5EEHA 2BOLA 3L2CA 1YO5C 3VSLA 1YW8A 2QBYB 4XNFA 1S5LC 3P9KA 2HTSA 3VFZA 3CC7I 5F0FA 2J5OA 1LFBA 3GMEA 3HZJA 2VKHA 3E97A 4BXXJ 1BI3A 1T2KA 3S14J 2XAFA 1REPC 2M34A 5B3SH 2JUGA 4PJ0C 3IC7A 2M1BA 1RRJA 2QKLB 2JRTA 2BXZA 1J5YA 4M9XA 3DTEA 3SEZA 1QU3A 1KYWA 2BY0A 1VNDA 3FISA 3K2AA 3PQKA 4B43A 4Y52J 4YEJA 1R1TA 1YW7A 2PN6A 3LQQA 3WHCA 3CLOA 2CW7A 4Y17A 2YUSA 3A02A 2CUJA 4M9SA 1BR4A 2HDDA 1SMTA 3LMMA 1FZPB 3WTSC 1OQYA 3DEUA 1OLTA 3AFHA 2B9SA 1JHHA 2UWMA 2R7QA 4HRIA 2AXLA 3KP4A 2X6XA 2IAIA 3ZMTA 2OUMA 3H35A 2CQ7A 3L9FA 4BY1J 4XM3A 4WXHA 5KK1A 5DM7F 1QGPA 2DPUA 1BBYA 4J00A 3W6KB 4UV8A 4FCYA 1Y0UA 3WTWC 2KL4A 4Q48A 4ZYHA 3VB2A 2XPUA 1YRNA 3MKYB 1T8IA 3DKWA 4A3BJ 1QQIA 5L3EA 2L9VA 4U0WA 5E20A 1XN7A 3GTOJ 1B1BA 4L18B 2WY7Q 4XR6A 4BUPA 1LE8A 3OYCA 2CYYA 1I27A 4EJTA 2V1UA 2NVXJ 2IGOA 2LOOA 4QPOA 4XQFA 5FB2A 4E7SA 5E18F 3EYIA 1BJZA 5E1ZB 1A31A 3F8NA 2VJIA 2AXTC 1MBFA 2EFQA 4RMNA 2JSCA 4A3IJ 3F72A 1MBHA 3KEQA 3Q0UA 1AHDP 3IH2A 2FF4A 4BQQA 3DBHB 5D6FA 2DQRA 2STWA 5F27A 2Z5UA 2ZO4A 3CMEI 4DGWB 2R4GA 6PAXA 1XSXA 3OL3A 1APLC 2HVRA 1EH7A 2IW5A 2VQGA 1FY7A 2AO9A 4IOAF 2M8EA 4FISA 3WTUC 3S3MA 2KIQA 2R5ZA 3ZXSA 5DUKA 5C4XJ 3SHFA 1BI2A 4BGDA 1I50J 2DA2A 1ZAOA 3KP5A 1UELB 3QOPA 4RA2A 1WZ2A 4M6YA 1X4PA 3NWTA 5J1UA 5JLWA 1W4MA 5FRNA 4NB5A 3JSOA 2EB7A 3H3UA 3WODF 5IOYA 5GAEJ 3F8BA 3FXMA 1BM9A 4KICA 2R7UA 3OR1C 4BDZA 1I6XA 1FLIA 2DJIA 4DBQA 4A12A 1RI7A 4RB2C 4HAMA 2VJ5A 2RVCA 4XLNF 2HOAA 2IVMA 1U0JA 3OYKA 1H88C 2M4GA 3HPHA 1O3RA 1BIBA 3H5NA 4DYCA 4Q47A 2VOOA 4RGXA 2DT5A 4YIIA 5BS6A 3EPZA 1D0XA 1UHWA 4E7IA 1R1UA 2EFPA 1FBUA 1EV7A 3L00A 1G59A 4BE1A 2F4OB 1ZN2A 3F0CA 1MBEA 4A69C 2B63J 1VF9A 4BJTA 4M3GA 4HLYA 2R7FA 3PJRA 1W7PA 5LHGA 1G3WA 5M3MJ 4V2GA 2KDOA 2IGNA 1FMVA 3DTIA 3SFZA 3F6OA 3BTLA 4PCQA 2WB1A 3F8FA 2L7ZA 1R4NB 2MLKA 1IRGA 4HF2A 3L2QA 4Z2YA 1ONVA 1YLFA 2VJJA 4A3MJ 5M5YJ 1Z3XA 2ACJA 2FEZA 1IC8A 4IKFA 1EF4A 1X3ZB 2RKHA 2UV1A 2R7DA 3O8GA 4NUBA 3MCZA 2Z16A 2Z33A 2O5RA 3FXUA 5JHFA 1QNTA 1B59A 3J81Z 1HSJA 1O57A 5LHHA 2X1CA 2DA5A 1UFMA 2GA2A 4RAZA 3CCMI 2EIJH 3HUGB 4AM3A 3BTIA 1JUMA 4BDYA 2G0EA 3T8TA 1PP8F 2ETHA 5JVTA 1WFXA 5J1YA 3AKZA 1SFKA 2W48A 3ZQ7A 1E17A 4PJLA 3S17J 5F0HA 5HLIA 1JHFA 2JA2A 2EILH 2YR2A 4ITVA 2R7TA 4RDUA 2MD0A 1A04A 1O7LA 3HDDA 1VI0A 3R0AA 3BCBA 4I09A 3GTJJ 3GVAA 5FFXA 3Q0WA 4RGRA 3HGGA 1VQNI 4F91B 3T8RA 1YJ9I 4PSXA 1J75A 4QPQA 2XAHA 2CUZA 3TMOA 2CU7A 3ELKA 1X1PA 4P55A 3WU2C 2PEXA 1E0EA 2P0WA 5CPRB 2RNGA 4G6TB 3CJNA 3JRCA 1JJ6C 4XLAA 1RUNA 2E7XA 2N8GA 2PMZN 5D8LB 2CFXA 1DU0A 3S1QJ 2KJCA 2HQRA 4XLCA 1IV8A 3CESA 1SVMA 1PUEE 5HVQC 2A6HF 1I5ZA 5HDGA 2HPIA 4P9UA 1G3TA 2JA6J 2LF8A 3TO9A 1X1AA 3HRTA 4G12A 4I7HA 3ABUA 1FOXA 2COBA 4L9NA 1OR7A 2DA7A 1ZREA 3O2PE 4LG0A 1SD5A 4HNUA 3EUHA 3G4SI 2Q2EB 3R60A 4B48A 3C1DA 1W36D 3MWMA 3QU3A 1XX5A 5KHDA 3B73A 1U5TC 3IWFA 3CO7C 2L01A 3CTAA 2BHZA 2O0YA 2UXXA 3FXLA 2IRFG 4LB5A 3O6BB 5E1XA 5F64A 2BGCA 2JA7J 3PQJA 2VUMJ 4ZTJA 3GO5A 1TQIA 2DMPA 3BT9A 5FRMA 1U9OA 1Z6RA 2DU9A 4WXDA 4NC7A 2EA2A 2FBHA 3LSTA 4L9TA 5IYDJ 3KX2A 1WWXA 3Q9VA 2V4JC 1R1VA 4HDVA 3L2VA 2MFZA 4DBRA 3Q3SA 3PL8A 5GTHC 2QSGX 5EDNA 2PQ8A 2VBWA 2GXGA 3PNVA 1F4KA
chains in the Genus database with same CATH topology
2LDUA 3CUQB 3WG9A 2Z3YA 3E6MA 2QM3A 2V6CA 3DP7A 4HDUA 3LAJA 3JTHA 1O3SA 1L3LA 1FBQA 1Z91A 1BC7C 4ZZDA 4G9YA 1ZRCA 3E5QA 5H20A 3T1BA 5FGMA 1LVAA 2FXAA 2VBXA 4MGRA 2K86A 5CVJA 3K1NA 3WGGA 1FT9A 1BN5A 4LMYA 4A2UA 1W7PD 4YFKF 4ENNA 1R22A 4RGUA 2NNYA 2XUBA 3G3ZA 4L5IA 1H9TA 2L02A 3U2RA 1QO0D 3COAC 3QAHA 4BAYA 1SD7A 2DK5A 1WKMA 3GZ6A 1FYLA 4KIBA 1H9GA 1VTNC 3WTTC 3I59A 3TOAA 1XGMA 2IPQX 2V1XA 4OIPF 2F5CA 2L4AA 1Z1DA 3GFJA 1WQ2A 2W85A 3QU6A 1QPMA 5LGUA 2JPBA 4EM2A 4OINF 2EJRA 5KVRA 3V7SA 2YU3A 5AIQA 2HZTA 1T39A 3ZPLA 2NRAC 5BOXA 1BIAA 1U78A 3RTRA 1PP7U 4KUMA 1K78B 1ZG1A 1BI1A 3C7JA 2VONA 5HDNA 2Y75A 2MA3A 1WSUA 2PI0A 2O61A 1TNSA 1U5TA 3RJPA 3F3XA 4EM0B 1IXSB 2HKOA 1WRJA 3E3VA 1USSA 2CO5A 5LRSA 4U7BA 4WXCA 2XAJA 4G7ZF 1XSVA 4KMFA 4EGZA 4NQWA 1AWCA 5L3BA 2GZWA 4ENMA 2X0LA 4I98B 2NS0A 4EMSA 3MFKA 4MTDA 1QZZA 1OYIA 3M7GA 3ZMVA 4UUVA 2LF7A 5BPIA 2OZUA 4HV5A 4HA8A 1G3YA 2F5EA 3J7AO 1U5TB 4A6EA 3S2WA 3HYIA 3IRRA 3GXOA 3NEUA 3T5XA 3ZMDA 1ZH5A 2KRFA 2HYFA 3RI4A 1FBSA 2FBKA 2P7VB 1STZA 3NRVA 4EV0A 4ON0A 3FZVA 1U2WA 1O3QA 3ZN0A 4OOIA 3I4PA 5HS8A 1KA8A 1XGNA 5ILUA 3KP2A 2XKPA 1BI0A 3JAMK 2VODA 2M30A 3F23A 1R5GA 3ML6A 2DLLA 4KN7X 2HS5A 3RDIA 2WC2A 5HLHA 1QBJA 4FX4A 3HHGA 4XRFA 2ZCWA 3DF8A 2ZMEA 3REOA 2LSOA 4LLGF 5FLXK 2IJLA 2DBBA 1K7AA 1SMYF 2DPDA 1IRFA 5BMZA 5D8KB 4XSZF 2BYVE 5A2QZ 5LEKA 3FMSA 3HUGA 4M73A 1IZ1A 3MEXA 3F21A 1P4WA 1ZGAA 5E17F 2EK5A 4M71A 1SFXA 3HTUA 2Z99A 2C6YA 2PJPA 3J80K 1AOYA 5LGTA 5H6QA 2NYXA 2D45A 3IKTA 3ZMUA 3WU0A 2CG4A 1S7AA 3AAFA 4U88A 5ICCA 4UNOA 4DQ2A 1F5TA 4UVCA 2ELHA 2ESNA 3K1MA 5DEQA 4OIQF 1B6AA 1YTYA 2YX4A 4L5JA 2BEOA 3ECHA 1RZ4A 5FFZA 3GX4X 4B09A 1IF1A 3Q9SA 3O3KA 1OMIA 1T98A 1KQ8A 1U3EM 2EFWA 4O6JA 2F2EA 5D5VB 1Z9CA 3BJOA 4EJWA 2XKOA 1XMAA 4R79A 1J9IA 4MTEA 1FWZA 2VN2A 3IL2A 1PDNC 2UXNA 5ILVA 3BJAA 4GO1A 4QWQA 4EGYA 4OMYA 2FE3A 2TDXA 3ZMSA 2IP2A 3GZ5A 3M8FA 3LFKA 3HOTA 3LWFA 1XCBA 5HDKA 5IT9K 2A5YB 4XLPF 5AIPA 4IF4A 3C3WA 2HOEA 5E8GA 4LGWA 1SFEA 2M87A 2KKOA 3DQVC 2HTJA 3U1DA 1O7FA 3KLNA 1MJ9A 4CYDA 2CQKA 2KIUA 3F8MA 5DCMA 4QLCU 2D1HA 3KP6A 4TV7A 2QQ9A 4IRGA 5ERIA 4HYEA 4OMZA 1XMKA 2GXBA 1HBXG 4HOBA 4MQVA 4IHSA 5J6XA 2YSRA 5TJJA 3KP7A 2ZNZA 2QBYA 4Y15A 1O3TA 1TW3A 1LNWA 2HGCA 1FX7A 2CSOA 3GF2A 4N9HA 4GCVA 1YFHA 4P96A 1TQMA 1W7PB 1DDNA 1OYWA 4IJAA 3K9TA 4GGGA 1IXCA 2MC3A 3HRUA 1DUXC 1BJAA 1LEAA 2H6BA 4A0ZA 2K7LA 2OQGA 1K6OA 1MD0A 4EJUA 3JSPA 3K0LA 1MZBA 1D8KA 2RGVA 1FPQA 3M9AA 1G6NA 3GLXA 1K79A 4ESJA 2CW0F 1YIOA 2V1DA 1KU3A 5K5RA 1YYVA 4IVNA 2RC4A 5L3GA 2KIFA 3G73A 1ZARA 1IAWA 1BC8C 3WTVC 2RN7A 2YX7A 3FXQA 3LA2A 3K2ZA 2VBYA 5K1YA 2PBIA 2RV8A 1IN5A 1EH8A 4ZYEA 4KIFA 4I2OA 4ZZLA 3KE2A 1XD7A 2HR3A 1MDMB 2YPRA 3GEZA 3ULQB 2J5PA 4NHJA 1P4AA 2F5FA 3RKXA 4UHTA 3V4GA 4L0YB 3E6DA 4L9VA 2P5KA 5HLGA 5TRDA 3KZYA 3E5UA 2W25A 3HOSA 5CVIA 3CUQC 5LBQA 4IXAA 4LG0B 2D1VA 1IN6A 4XBFA 1H0MA 3EETA 4H0EA 3ABTA 1S3JA 5K5OA 4M6XA 3I5UA 1S6LA 3HSEA 5HS7A 1Z7UA 4WK8F 2ISZA 2HQNA 1FYMA 2F5DA 2JTVA 2OBPA 4UVAA 3LA3A 4U7DA 1Z6TA 3V7CA 2EV0A 2QWWA 3WE2A 1I1SA 3TO6A 2A68F 5J8CA 1GHCA 2STTA 3EDPA 3B02A 3KZZA 3I64A 1R36A 1S29A 2R3SA 2ZFWA 2PLYA 3E6CC 2GQQA 5DCFA 4HW0A 5IT3A 3IHUA 2ZJ2A 4IRHA 3V8JA 1USTA 4KFCA 2A69F 1D3YA 2HEOA 3BOQA 3QP6A 1UB9A 2AS5F 3H92A 2XRNA 4WF2A 1F1ZA 4U0VA 2VC0A 3DXJF 1D5VA 1XDUA 3E6BA 3KP3A 2Q8KA 2QZ8A 1L0OC 4KMUX 2CGPA 4RGSA 3N4MA 4ETSA 1TBXA 2W84A 2IA1A 4LK0F 2W24A 4PDKA 5CYVA 4MEYF 5ILSA 1IN4A 5HOOA 4MNUA 4A5NA 2PFBA 2FSWA 2PMHA 1KU2A 1HXDA 3F22A 1K78A 4BHPA 3L09A 2GWRA 2HDCA 5LGNA 1D8JA 2EA4A 2VXZA 4HX8A 1IXRC 1QZYA 3LAPA 1IN8A 5LHIA 1FP1D 2A3SA 4O5VA 3RYRA 3TGNA 3DPLC 3MAJA 4EVIA 4ENKA 2NAZA 2LKPA 4Q4ZF 3L7WA 1ON1A 1U6GA 4G6DA 2Y0MA 3U9GA 1T38A 3IWZA 4AWXB 1KYZA 2CWEA 3I54A 1ZLKA 2WTEA 1F9NA 3CUQA 1XGSA 3RYPA 4S05A 1SD4A 5DUIA 4CICA 1ZG5A 1NHAA 3KFWX 3KLOA 2WV0A 3I53A 1HSTA 4HBLA 2MD5A 4JK1X 2Y48A 1LQ1A 1LJ9A 1TLHB 3E5XA 2L54A 1CGPA 4R1HA 3ZP5A 3BPVA 2MH9A 2NNNA 1SFUA 1KQ9A 2XIGA 2PMUA 1KQ0A 3PFIA 2ZXJA 4G7HF 4LB6B 3P9IA 2XVCA 3TQNA 2ESHA 1IW7F 1W5SA 3FXRA 4Y13A 3TDUC 4GYGA 2VOPA 3JW4A 3CO6C 3I71A 3HHHA 3J81K 3F6VA 5L3FA 1MKMA 1LDJA 4WCGA 2KIMA 3BPXA 2KJBA 5K5QA 5F6FA 2HWVA 4BNCA 2FOKA 4KA4A 1ZRDA 5FO5A 2JT1A 3GW2A 3ECOA 4N0BA 1IUYA 2FA5A 5DDGA 2K27A 3FMRA 4BYYA 2LNBA 5A2QK 2DAOA 3WTYC 4UVBA 2G9WA 4GYIA 1WI9A 1FP2A 5ICEA 3LQRA 3D5LA 3HRMA 2O6GE 4ASNA 3J80Z 1P92A 4PGHA 2H27A 3BJ6A 4A6DA 2D2WA 1UCRA 2JPCA 4Q5SF 3DV8A 4CZZA 2GA1A 2HYGD 4A0YA 1ZGJA 1MDMA 1J7KA 2FRHA 1J2XA 3I0TA 3Q5FA 2A6EF 2P6SA 3K69A 3IKVA 2A07F 4EQQA 3OOPA 1ON2A 2QLZA 2EV6A 3KCCA 1XSDA 1CF7B 4PZJA 3FM5A 2W57A 2B0LA 2EWNA 2P5LC 1ULYA 1YW9A 1LDDA 3M8EA 4EJVA 5D5WB 3KEOA 3QP5A 4LFUA 2G7HA 4HF1A 2XAGA 3V7RA 3ERED 2DO7A 3SQNA 4L9JA 3SXYA 3H3ZA 4YG2F 1YQAA 2EFNA 2E1NA 5DYMA 4ZH4F 2GAUA 3WTZA 2XGXA 2GIVA 2QYOA 3C18A 2E7WA 2OZ6A 2BBYA 5IT9Z 5ED4A 5ICFA 1MJBA 1GXPA 4BH9A 3VEPA 1ZHFA 2ZNYA 5F1RA 2P8TA 4LD5A 4UXNA 4OIOF 2BV6A 2P7CB 4MHGA 1IN7A 3TO7A 1B9NA 4YIFA 4O3MA 4PGGA 1TQPA 2RQPA 1FNNA 5JI6A 3HSRA 3RKYA 4IPAA 3R4KA 4S04A 4M9ZA 2QQBA 2H09A 3N97A 3QPHA 3VOEA 3VODA 3FX3A 2QUFA 3OV8A 1TNTA 1KGSA 2FMLA 4EJOA 4U0YA 4BXUA 1MJAA 1ZLJA 5DD4A 1E2XA 4BHBA 3D0SA 2RNJA 3MQ0A 4CXFA 1LB2A 2XASA 3CUOA 2H6CA 4R8HA 4IRIA 4I0AA 2H94A 2P4WA 4YFXF 4HQEA 2OAZA 4LK1F 3ISPA 1XB4A 4HLXA 3MZHA 2DW4A 4M74A 2A61A 4G94A 5D4SA 3GFMA 1U8RA 4JBAA 3JAMZ 3DPTA 3R61A 4A5MA 3MZYA 5JFRA 2RDPA 4JQFA 3I59B 4HF0A 4ESFA 2PG4A 1KU7A 3V8LA 5D4RA 4KIGA 3F8CA 4LLLA 2O8XA 2M5WA 3TKYA 3ZN1A 5E1WA 4L0ZB 5CVUA 3WGHA 4I0BA 5D6EA 4RS8A 1FYKA 4FX0A 2Z9OA 1B9MA 5AONA 2M45A 1RUOA 1G4DA 1GVJA 4KNYA 4G8XA 2Q0OA 4WX9A 2FNPA 4HX4A 3WU1B 3JTGA 5BPDA 3GUDA 4BQAA 1ZYRF 1SAXA 2FU4A 3QRFF 1T0FA 4GXOA 4RAYA 2XROA 2QENA 4XSXF 2HFHA 2HKXA 4KN4X 4G7OF 4RB3C 3BWGA 1G3SA 5EEGA 4CHUA 2JZYA 4MQ9F 1FOKA 4LJZF 1FC3A 1JXSA 4FHTA 1DPUA 3FMQA 2DFIA 3SZTA 1S7OA 1X3UA 2DI3A 1DP7P 4HV6A 2VC1A 5J8FA 4N9IA 2QQAA 1RNLA 2X4HA 2FMYA 4ZYDA 1ZRFA 1MGTA 2DK8A 3SZPA 3GYHX 1W5TA 4AVPA 1UHMA 5LLQA 3M1EA 1R00A 3RPUA 5JHUA 1ZG3A 4RB0A 1P6RA 1LEBA 3WGIA 2MBFA 3HRSA 2COMA 1BOAA 1DPRA 3NQOA 1HW1A 3R6SA 5L3CA 2VT3A 1S8NA 3LA7A 4CO8A 3QPTA 4OIRF 1KU9A 1HQCA 2P6TA 3FM3A 1LDKB 4KYWA 2UZKA 5DV5A 2ADUA 5CVRA 3HIFA 3RIRA 2K4JA 1XCVA 2BE5F 4UV9A 3BROA 5ICGA 2DQLA 5CJ9A 4B8XA 3WTXC 3TOBA 2O03A 3BDDA 1R5HA 2MLGA 3T0YA 2IA2A 4LLNA 3P9CA 4HQMA 3KETA 5LRRA 4EM1A 4G6QA 1OYYA 2ZBKA 4BHCA 4RB1A 2ZMEB 3DFGA 2ISYA 2E1CA 4FT8A 4MEXF 2L4MA 2VE9A 2L3DA 1CF7A 1HKQA 4CGZA 1TTYA 1V4RA 2DTRA 4KT5C 1R58A 3RKWA 1I1GA 2ZKZA 3RPQA 1FSEA 3BY6A 4P9FA 4YFNF 4AD9A 3TDZC 1ODDA 3BP8A 4F7ZA 3V8KA 2K02A 4CDGA 5E8IA 4HX7A 2OD5A 4IHTA 1T6SA 2P5VA 4DNCA 1YS6A 2O3FA 1B4AA 1XDSA 1XGOA 2XAQA 2VE8A 4WWCA 2OU2A 2WWYA 4I02A 2VBZA 3I58A 3BZ6A 1P2FA 3EYYA 5LEJA 2XV4S 2G7UA 2XHKA 2Q2EA 3WE3A 2IA0A 1GXQA 1JE8A 1SD6A 1Z05A 1HW5A 1EH6A 3FHZA 3W6JB 4OU0A 2IT0A 1J0RA 2OA4A 5DD8A 5CLSA 2V9VA 1JGSA 1P4XA 1FSHA 4I01A 2QVOA 1R7JA 4A0XA 5JR3A 2FQ3A 2MH2A 5FD5A 5D5XB 1HKSA 5BQTA 4AIKA 3ROUA 2EFOA 5L3DA 4E70A 3K1PA 5HS9A 1Q1HA 1C0WA 4AIJA 3IRQA 1R23A 2FNAA 5CVVA 1HKTA 4ENJA 3EQLF 1YS7A 2VT2A 4HZFA 3CDHA 1YG2A 1HW2A 3GFIA 5FD6A 1OKRA 3FF5A 4AIHA 3GFLA 1V3FA 4KDPA 4P5OA 5FLXZ 5DCMB 1RIOH 5D5UB 3HSFA 4D0PA 2OQRA 4ESBA 2FBIA 1J59A 1OPCA 4M72A 5H6RA 3FWEA 3GWZA 2EV5A 2K4BA 4K2EA 4ZYGA 3ZMZA 3P7NA 3R0JA 2V79A 3HTSB 1TW2A 5EEHA 3L2CA 1YO5C 1YW8A 2QBYB 3VFZA 3P9KA 2HTSA 2J5OA 3E97A 1BI3A 1T2KA 2XAFA 1REPC 3IC7A 2M1BA 2JRTA 1J5YA 4M9XA 1KYWA 3PQKA 1R1TA 1YW7A 2PN6A 3LQQA 3CLOA 4Y17A 4M9SA 1SMTA 1FZPB 3WTSC 3DEUA 1JHHA 2UWMA 2AXLA 3KP4A 3ZMTA 3L9FA 4WXHA 5KK1A 1QGPA 2DPUA 1BBYA 3W6KB 4UV8A 1Y0UA 3WTWC 4ZYHA 4Q48A 3VB2A 3DKWA 1QQIA 5L3EA 4U0WA 5E20A 1XN7A 1B1BA 4L18B 2CYYA 1I27A 4EJTA 2V1UA 5FB2A 3EYIA 5E18F 5E1ZB 3F8NA 2EFQA 2JSCA 3F72A 3KEQA 2FF4A 5D6FA 2STWA 2DQRA 2Z5UA 2ZO4A 6PAXA 1XSXA 1EH7A 2IW5A 1FY7A 2M8EA 3WTUC 5DUKA 3SHFA 1BI2A 1ZAOA 3KP5A 3QOPA 4M6YA 1W4MA 4NB5A 3JSOA 2EB7A 3H3UA 3WODF 3F8BA 1BM9A 4KICA 1I6XA 1FLIA 4A12A 1RI7A 4RB2C 4HAMA 2RVCA 4XLNF 2IVMA 1O3RA 1BIBA 4Q47A 2VOOA 4RGXA 2DT5A 4YIIA 5BS6A 1UHWA 1R1UA 2EFPA 1FBUA 1EV7A 3L00A 1ZN2A 4HLYA 2R7FA 1W7PA 5LHGA 1G3WA 3SFZA 3F6OA 4PCQA 3F8FA 2MLKA 1IRGA 4HF2A 4Z2YA 1ONVA 1YLFA 2ACJA 2FEZA 2RKHA 2R7DA 3MCZA 2Z33A 3FXUA 1QNTA 1B59A 3J81Z 1HSJA 1O57A 5LHHA 2GA2A 1UFMA 4RAZA 3T8TA 1PP8F 2ETHA 5JVTA 3ZQ7A 1E17A 5HLIA 1JHFA 2YR2A 1A04A 1O7LA 3R0AA 4I09A 3GVAA 5FFXA 4RGRA 3T8RA 1J75A 2XAHA 3ELKA 4P55A 2PEXA 1RUNA 3CJNA 2E7XA 5D8LB 2CFXA 2KJCA 2HQRA 1PUEE 5HVQC 2A6HF 1I5ZA 5HDGA 4P9UA 1G3TA 2LF8A 3TO9A 3HRTA 4I7HA 3ABUA 4L9NA 1OR7A 1ZREA 3O2PE 4LG0A 1SD5A 3EUHA 3R60A 3C1DA 3MWMA 3QU3A 3B73A 1U5TC 3IWFA 3CO7C 2L01A 3CTAA 2O0YA 2UXXA 2IRFG 4LB5A 3O6BB 5E1XA 5F64A 2BGCA 3PQJA 3GO5A 1TQIA 1Z6RA 2DU9A 4WXDA 2EA2A 2FBHA 3LSTA 4L9TA 3Q9VA 1WWXA 1R1VA 4HDVA 2PQ8A 2VBWA 2GXGA 1F4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LDU A;  3CUQ B;  3WG9 A;  2Z3Y A;  3E6M A;  2QM3 A;  2V6C A;  3DP7 A;  4HDU A;  3LAJ A;  3JTH A;  1O3S A;  1L3L A;  1FBQ A;  1Z91 A;  1BC7 C;  4ZZD A;  4G9Y A;  1ZRC A;  3E5Q A;  5H20 A;  3T1B A;  5FGM A;  1LVA A;  2FXA A;  2VBX A;  4MGR A;  2K86 A;  5CVJ A;  3K1N A;  3WGG A;  1FT9 A;  1BN5 A;  4LMY A;  4A2U A;  1W7P D;  4YFK F;  4ENN A;  1R22 A;  4RGU A;  2NNY A;  2XUB A;  3G3Z A;  4L5I A;  1H9T A;  2L02 A;  3U2R A;  1QO0 D;  3COA C;  3QAH A;  4BAY A;  1SD7 A;  2DK5 A;  1WKM A;  3GZ6 A;  1FYL A;  4KIB A;  1H9G A;  1VTN C;  3WTT C;  3I59 A;  3TOA A;  1XGM A;  2IPQ X;  2V1X A;  4OIP F;  2F5C A;  2L4A A;  1Z1D A;  3GFJ A;  1WQ2 A;  2W85 A;  3QU6 A;  1QPM A;  5LGU A;  2JPB A;  4EM2 A;  4OIN F;  2EJR A;  5KVR A;  3V7S A;  2YU3 A;  5AIQ A;  2HZT A;  1T39 A;  3ZPL A;  2NRA C;  5BOX A;  1BIA A;  1U78 A;  3RTR A;  1PP7 U;  4KUM A;  1K78 B;  1ZG1 A;  1BI1 A;  3C7J A;  2VON A;  5HDN A;  2Y75 A;  2MA3 A;  1WSU A;  2PI0 A;  2O61 A;  1TNS A;  1U5T A;  3RJP A;  3F3X A;  4EM0 B;  1IXS B;  2HKO A;  1WRJ A;  3E3V A;  1USS A;  2CO5 A;  5LRS A;  4U7B A;  4WXC A;  2XAJ A;  4G7Z F;  1XSV A;  4KMF A;  4EGZ A;  4NQW A;  1AWC A;  5L3B A;  2GZW A;  4ENM A;  2X0L A;  4I98 B;  2NS0 A;  4EMS A;  3MFK A;  4MTD A;  1QZZ A;  1OYI A;  3M7G A;  3ZMV A;  4UUV A;  2LF7 A;  5BPI A;  2OZU A;  4HV5 A;  4HA8 A;  1G3Y A;  2F5E A;  3J7A O;  1U5T B;  4A6E A;  3S2W A;  3HYI A;  3IRR A;  3GXO A;  3NEU A;  3T5X A;  3ZMD A;  1ZH5 A;  2KRF A;  2HYF A;  3RI4 A;  1FBS A;  2FBK A;  2P7V B;  1STZ A;  3NRV A;  4EV0 A;  4ON0 A;  3FZV A;  1U2W A;  1O3Q A;  3ZN0 A;  4OOI A;  3I4P A;  5HS8 A;  1KA8 A;  1XGN A;  5ILU A;  3KP2 A;  2XKP A;  1BI0 A;  3JAM K;  2VOD A;  2M30 A;  3F23 A;  1R5G A;  3ML6 A;  2DLL A;  4KN7 X;  2HS5 A;  3RDI A;  2WC2 A;  5HLH A;  1QBJ A;  4FX4 A;  3HHG A;  4XRF A;  2ZCW A;  3DF8 A;  2ZME A;  3REO A;  2LSO A;  4LLG F;  5FLX K;  2IJL A;  2DBB A;  1K7A A;  1SMY F;  2DPD A;  1IRF A;  5BMZ A;  5D8K B;  4XSZ F;  2BYV E;  5A2Q Z;  5LEK A;  3FMS A;  3HUG A;  4M73 A;  1IZ1 A;  3MEX A;  3F21 A;  1P4W A;  1ZGA A;  5E17 F;  2EK5 A;  4M71 A;  1SFX A;  3HTU A;  2Z99 A;  2C6Y A;  2PJP A;  3J80 K;  1AOY A;  5LGT A;  5H6Q A;  2NYX A;  2D45 A;  3IKT A;  3ZMU A;  3WU0 A;  2CG4 A;  1S7A A;  3AAF A;  4U88 A;  5ICC A;  4UNO A;  4DQ2 A;  1F5T A;  4UVC A;  2ELH A;  2ESN A;  3K1M A;  5DEQ A;  4OIQ F;  1B6A A;  1YTY A;  2YX4 A;  4L5J A;  2BEO A;  3ECH A;  1RZ4 A;  5FFZ A;  3GX4 X;  4B09 A;  1IF1 A;  3Q9S A;  3O3K A;  1OMI A;  1T98 A;  1KQ8 A;  1U3E M;  2EFW A;  4O6J A;  2F2E A;  5D5V B;  1Z9C A;  3BJO A;  4EJW A;  2XKO A;  1XMA A;  4R79 A;  1J9I A;  4MTE A;  1FWZ A;  2VN2 A;  3IL2 A;  1PDN C;  2UXN A;  5ILV A;  3BJA A;  4GO1 A;  4QWQ A;  4EGY A;  4OMY A;  2FE3 A;  2TDX A;  3ZMS A;  2IP2 A;  3GZ5 A;  3M8F A;  3LFK A;  3HOT A;  3LWF A;  1XCB A;  5HDK A;  5IT9 K;  2A5Y B;  4XLP F;  5AIP A;  4IF4 A;  3C3W A;  2HOE A;  5E8G A;  4LGW A;  1SFE A;  2M87 A;  2KKO A;  3DQV C;  2HTJ A;  3U1D A;  1O7F A;  3KLN A;  1MJ9 A;  4CYD A;  2CQK A;  2KIU A;  3F8M A;  5DCM A;  4QLC U;  2D1H A;  3KP6 A;  4TV7 A;  2QQ9 A;  4IRG A;  5ERI A;  4HYE A;  4OMZ A;  1XMK A;  2GXB A;  1HBX G;  4HOB A;  4MQV A;  4IHS A;  5J6X A;  2YSR A;  5TJJ A;  3KP7 A;  2ZNZ A;  2QBY A;  4Y15 A;  1O3T A;  1TW3 A;  1LNW A;  2HGC A;  1FX7 A;  2CSO A;  3GF2 A;  4N9H A;  4GCV A;  1YFH A;  4P96 A;  1TQM A;  1W7P B;  1DDN A;  1OYW A;  4IJA A;  3K9T A;  4GGG A;  1IXC A;  2MC3 A;  3HRU A;  1DUX C;  1BJA A;  1LEA A;  2H6B A;  4A0Z A;  2K7L A;  2OQG A;  1K6O A;  1MD0 A;  4EJU A;  3JSP A;  3K0L A;  1MZB A;  1D8K A;  2RGV A;  1FPQ A;  3M9A A;  1G6N A;  3GLX A;  1K79 A;  4ESJ A;  2CW0 F;  1YIO A;  2V1D A;  1KU3 A;  5K5R A;  1YYV A;  4IVN A;  2RC4 A;  5L3G A;  2KIF A;  3G73 A;  1ZAR A;  1IAW A;  1BC8 C;  3WTV C;  2RN7 A;  2YX7 A;  3FXQ A;  3LA2 A;  3K2Z A;  2VBY A;  5K1Y A;  2PBI A;  2RV8 A;  1IN5 A;  1EH8 A;  4ZYE A;  4KIF A;  4I2O A;  4ZZL A;  3KE2 A;  1XD7 A;  2HR3 A;  1MDM B;  2YPR A;  3GEZ A;  3ULQ B;  2J5P A;  4NHJ A;  1P4A A;  2F5F A;  3RKX A;  4UHT A;  3V4G A;  4L0Y B;  3E6D A;  4L9V A;  2P5K A;  5HLG A;  5TRD A;  3KZY A;  3E5U A;  2W25 A;  3HOS A;  5CVI A;  3CUQ C;  5LBQ A;  4IXA A;  4LG0 B;  2D1V A;  1IN6 A;  4XBF A;  1H0M A;  3EET A;  4H0E A;  3ABT A;  1S3J A;  5K5O A;  4M6X A;  3I5U A;  1S6L A;  3HSE A;  5HS7 A;  1Z7U A;  4WK8 F;  2ISZ A;  2HQN A;  1FYM A;  2F5D A;  2JTV A;  2OBP A;  4UVA A;  3LA3 A;  4U7D A;  1Z6T A;  3V7C A;  2EV0 A;  2QWW A;  3WE2 A;  1I1S A;  3TO6 A;  2A68 F;  5J8C A;  1GHC A;  2STT A;  3EDP A;  3B02 A;  3KZZ A;  3I64 A;  1R36 A;  1S29 A;  2R3S A;  2ZFW A;  2PLY A;  3E6C C;  2GQQ A;  5DCF A;  4HW0 A;  5IT3 A;  3IHU A;  2ZJ2 A;  4IRH A;  3V8J A;  1UST A;  4KFC A;  2A69 F;  1D3Y A;  2HEO A;  3BOQ A;  3QP6 A;  1UB9 A;  2AS5 F;  3H92 A;  2XRN A;  4WF2 A;  1F1Z A;  4U0V A;  2VC0 A;  3DXJ F;  1D5V A;  1XDU A;  3E6B A;  3KP3 A;  2Q8K A;  2QZ8 A;  1L0O C;  4KMU X;  2CGP A;  4RGS A;  3N4M A;  4ETS A;  1TBX A;  2W84 A;  2IA1 A;  4LK0 F;  2W24 A;  4PDK A;  5CYV A;  4MEY F;  5ILS A;  1IN4 A;  5HOO A;  4MNU A;  4A5N A;  2PFB A;  2FSW A;  2PMH A;  1KU2 A;  1HXD A;  3F22 A;  1K78 A;  4BHP A;  3L09 A;  2GWR A;  2HDC A;  5LGN A;  1D8J A;  2EA4 A;  2VXZ A;  4HX8 A;  1IXR C;  1QZY A;  3LAP A;  1IN8 A;  5LHI A;  1FP1 D;  2A3S A;  4O5V A;  3RYR A;  3TGN A;  3DPL C;  3MAJ A;  4EVI A;  4ENK A;  2NAZ A;  2LKP A;  4Q4Z F;  3L7W A;  1ON1 A;  1U6G A;  4G6D A;  2Y0M A;  3U9G A;  1T38 A;  3IWZ A;  4AWX B;  1KYZ A;  2CWE A;  3I54 A;  1ZLK A;  2WTE A;  1F9N A;  3CUQ A;  1XGS A;  3RYP A;  4S05 A;  1SD4 A;  5DUI A;  4CIC A;  1ZG5 A;  1NHA A;  3KFW X;  3KLO A;  2WV0 A;  3I53 A;  1HST A;  4HBL A;  2MD5 A;  4JK1 X;  2Y48 A;  1LQ1 A;  1LJ9 A;  1TLH B;  3E5X A;  2L54 A;  1CGP A;  4R1H A;  3ZP5 A;  3BPV A;  2MH9 A;  2NNN A;  1SFU A;  1KQ9 A;  2XIG A;  2PMU A;  1KQ0 A;  3PFI A;  2ZXJ A;  4G7H F;  4LB6 B;  3P9I A;  2XVC A;  3TQN A;  2ESH A;  1IW7 F;  1W5S A;  3FXR A;  4Y13 A;  3TDU C;  4GYG A;  2VOP A;  3JW4 A;  3CO6 C;  3I71 A;  3HHH A;  3J81 K;  3F6V A;  5L3F A;  1MKM A;  1LDJ A;  4WCG A;  2KIM A;  3BPX A;  2KJB A;  5K5Q A;  5F6F A;  2HWV A;  4BNC A;  2FOK A;  4KA4 A;  1ZRD A;  5FO5 A;  2JT1 A;  3GW2 A;  3ECO A;  4N0B A;  1IUY A;  2FA5 A;  5DDG A;  2K27 A;  3FMR A;  4BYY A;  2LNB A;  5A2Q K;  2DAO A;  3WTY C;  4UVB A;  2G9W A;  4GYI A;  1WI9 A;  1FP2 A;  5ICE A;  3LQR A;  3D5L A;  3HRM A;  2O6G E;  4ASN A;  3J80 Z;  1P92 A;  4PGH A;  2H27 A;  3BJ6 A;  4A6D A;  2D2W A;  1UCR A;  2JPC A;  4Q5S F;  3DV8 A;  4CZZ A;  2GA1 A;  2HYG D;  4A0Y A;  1ZGJ A;  1MDM A;  1J7K A;  2FRH A;  1J2X A;  3I0T A;  3Q5F A;  2A6E F;  2P6S A;  3K69 A;  3IKV A;  2A07 F;  4EQQ A;  3OOP A;  1ON2 A;  2QLZ A;  2EV6 A;  3KCC A;  1XSD A;  1CF7 B;  4PZJ A;  3FM5 A;  2W57 A;  2B0L A;  2EWN A;  2P5L C;  1ULY A;  1YW9 A;  1LDD A;  3M8E A;  4EJV A;  5D5W B;  3KEO A;  3QP5 A;  4LFU A;  2G7H A;  4HF1 A;  2XAG A;  3V7R A;  3ERE D;  2DO7 A;  3SQN A;  4L9J A;  3SXY A;  3H3Z A;  4YG2 F;  1YQA A;  2EFN A;  2E1N A;  5DYM A;  4ZH4 F;  2GAU A;  3WTZ A;  2XGX A;  2GIV A;  2QYO A;  3C18 A;  2E7W A;  2OZ6 A;  2BBY A;  5IT9 Z;  5ED4 A;  5ICF A;  1MJB A;  1GXP A;  4BH9 A;  3VEP A;  1ZHF A;  2ZNY A;  5F1R A;  2P8T A;  4LD5 A;  4UXN A;  4OIO F;  2BV6 A;  2P7C B;  4MHG A;  1IN7 A;  3TO7 A;  1B9N A;  4YIF A;  4O3M A;  4PGG A;  1TQP A;  2RQP A;  1FNN A;  5JI6 A;  3HSR A;  3RKY A;  4IPA A;  3R4K A;  4S04 A;  4M9Z A;  2QQB A;  2H09 A;  3N97 A;  3QPH A;  3VOE A;  3VOD A;  3FX3 A;  2QUF A;  3OV8 A;  1TNT A;  1KGS A;  2FML A;  4EJO A;  4U0Y A;  4BXU A;  1MJA A;  1ZLJ A;  5DD4 A;  1E2X A;  4BHB A;  3D0S A;  2RNJ A;  3MQ0 A;  4CXF A;  1LB2 A;  2XAS A;  3CUO A;  2H6C A;  4R8H A;  4IRI A;  4I0A A;  2H94 A;  2P4W A;  4YFX F;  4HQE A;  2OAZ A;  4LK1 F;  3ISP A;  1XB4 A;  4HLX A;  3MZH A;  2DW4 A;  4M74 A;  2A61 A;  4G94 A;  5D4S A;  3GFM A;  1U8R A;  4JBA A;  3JAM Z;  3DPT A;  3R61 A;  4A5M A;  3MZY A;  5JFR A;  2RDP A;  4JQF A;  3I59 B;  4HF0 A;  4ESF A;  2PG4 A;  1KU7 A;  3V8L A;  5D4R A;  4KIG A;  3F8C A;  4LLL A;  2O8X A;  2M5W A;  3TKY A;  3ZN1 A;  5E1W A;  4L0Z B;  5CVU A;  3WGH A;  4I0B A;  5D6E A;  4RS8 A;  1FYK A;  4FX0 A;  2Z9O A;  1B9M A;  5AON A;  2M45 A;  1RUO A;  1G4D A;  1GVJ A;  4KNY A;  4G8X A;  2Q0O A;  4WX9 A;  2FNP A;  4HX4 A;  3WU1 B;  3JTG A;  5BPD A;  3GUD A;  4BQA A;  1ZYR F;  1SAX A;  2FU4 A;  3QRF F;  1T0F A;  4GXO A;  4RAY A;  2XRO A;  2QEN A;  4XSX F;  2HFH A;  2HKX A;  4KN4 X;  4G7O F;  4RB3 C;  3BWG A;  1G3S A;  5EEG A;  4CHU A;  2JZY A;  4MQ9 F;  1FOK A;  4LJZ F;  1FC3 A;  1JXS A;  4FHT A;  1DPU A;  3FMQ A;  2DFI A;  3SZT A;  1S7O A;  1X3U A;  2DI3 A;  1DP7 P;  4HV6 A;  2VC1 A;  5J8F A;  4N9I A;  2QQA A;  1RNL A;  2X4H A;  2FMY A;  4ZYD A;  1ZRF A;  1MGT A;  2DK8 A;  3SZP A;  3GYH X;  1W5T A;  4AVP A;  1UHM A;  5LLQ A;  3M1E A;  1R00 A;  3RPU A;  5JHU A;  1ZG3 A;  4RB0 A;  1P6R A;  1LEB A;  3WGI A;  2MBF A;  3HRS A;  2COM A;  1BOA A;  1DPR A;  3NQO A;  1HW1 A;  3R6S A;  5L3C A;  2VT3 A;  1S8N A;  3LA7 A;  4CO8 A;  3QPT A;  4OIR F;  1KU9 A;  1HQC A;  2P6T A;  3FM3 A;  1LDK B;  4KYW A;  2UZK A;  5DV5 A;  2ADU A;  5CVR A;  3HIF A;  3RIR A;  2K4J A;  1XCV A;  2BE5 F;  4UV9 A;  3BRO A;  5ICG A;  2DQL A;  5CJ9 A;  4B8X A;  3WTX C;  3TOB A;  2O03 A;  3BDD A;  1R5H A;  2MLG A;  3T0Y A;  2IA2 A;  4LLN A;  3P9C A;  4HQM A;  3KET A;  5LRR A;  4EM1 A;  4G6Q A;  1OYY A;  2ZBK A;  4BHC A;  4RB1 A;  2ZME B;  3DFG A;  2ISY A;  2E1C A;  4FT8 A;  4MEX F;  2L4M A;  2VE9 A;  2L3D A;  1CF7 A;  1HKQ A;  4CGZ A;  1TTY A;  1V4R A;  2DTR A;  4KT5 C;  1R58 A;  3RKW A;  1I1G A;  2ZKZ A;  3RPQ A;  1FSE A;  3BY6 A;  4P9F A;  4YFN F;  4AD9 A;  3TDZ C;  1ODD A;  3BP8 A;  4F7Z A;  3V8K A;  2K02 A;  4CDG A;  5E8I A;  4HX7 A;  2OD5 A;  4IHT A;  1T6S A;  2P5V A;  4DNC A;  1YS6 A;  2O3F A;  1B4A A;  1XDS A;  1XGO A;  2XAQ A;  2VE8 A;  4WWC A;  2OU2 A;  2WWY A;  4I02 A;  2VBZ A;  3I58 A;  3BZ6 A;  1P2F A;  3EYY A;  5LEJ A;  2XV4 S;  2G7U A;  2XHK A;  2Q2E A;  3WE3 A;  2IA0 A;  1GXQ A;  1JE8 A;  1SD6 A;  1Z05 A;  1HW5 A;  1EH6 A;  3FHZ A;  3W6J B;  4OU0 A;  2IT0 A;  1J0R A;  2OA4 A;  5DD8 A;  5CLS A;  2V9V A;  1JGS A;  1P4X A;  1FSH A;  4I01 A;  2QVO A;  1R7J A;  4A0X A;  5JR3 A;  2FQ3 A;  2MH2 A;  5FD5 A;  5D5X B;  1HKS A;  5BQT A;  4AIK A;  3ROU A;  2EFO A;  5L3D A;  4E70 A;  3K1P A;  5HS9 A;  1Q1H A;  1C0W A;  4AIJ A;  3IRQ A;  1R23 A;  2FNA A;  5CVV A;  1HKT A;  4ENJ A;  3EQL F;  1YS7 A;  2VT2 A;  4HZF A;  3CDH A;  1YG2 A;  1HW2 A;  3GFI A;  5FD6 A;  1OKR A;  3FF5 A;  4AIH A;  3GFL A;  1V3F A;  4KDP A;  4P5O A;  5FLX Z;  5DCM B;  1RIO H;  5D5U B;  3HSF A;  4D0P A;  2OQR A;  4ESB A;  2FBI A;  1J59 A;  1OPC A;  4M72 A;  5H6R A;  3FWE A;  3GWZ A;  2EV5 A;  2K4B A;  4K2E A;  4ZYG A;  3ZMZ A;  3P7N A;  3R0J A;  2V79 A;  3HTS B;  1TW2 A;  5EEH A;  3L2C A;  1YO5 C;  1YW8 A;  2QBY B;  3VFZ A;  3P9K A;  2HTS A;  2J5O A;  3E97 A;  1BI3 A;  1T2K A;  2XAF A;  1REP C;  3IC7 A;  2M1B A;  2JRT A;  1J5Y A;  4M9X A;  1KYW A;  3PQK A;  1R1T A;  1YW7 A;  2PN6 A;  3LQQ A;  3CLO A;  4Y17 A;  4M9S A;  1SMT A;  1FZP B;  3WTS C;  3DEU A;  1JHH A;  2UWM A;  2AXL A;  3KP4 A;  3ZMT A;  3L9F A;  4WXH A;  5KK1 A;  1QGP A;  2DPU A;  1BBY A;  3W6K B;  4UV8 A;  1Y0U A;  3WTW C;  4ZYH A;  4Q48 A;  3VB2 A;  3DKW A;  1QQI A;  5L3E A;  4U0W A;  5E20 A;  1XN7 A;  1B1B A;  4L18 B;  2CYY A;  1I27 A;  4EJT A;  2V1U A;  5FB2 A;  3EYI A;  5E18 F;  5E1Z B;  3F8N A;  2EFQ A;  2JSC A;  3F72 A;  3KEQ A;  2FF4 A;  5D6F A;  2STW A;  2DQR A;  2Z5U A;  2ZO4 A;  6PAX A;  1XSX A;  1EH7 A;  2IW5 A;  1FY7 A;  2M8E A;  3WTU C;  5DUK A;  3SHF A;  1BI2 A;  1ZAO A;  3KP5 A;  3QOP A;  4M6Y A;  1W4M A;  4NB5 A;  3JSO A;  2EB7 A;  3H3U A;  3WOD F;  3F8B A;  1BM9 A;  4KIC A;  1I6X A;  1FLI A;  4A12 A;  1RI7 A;  4RB2 C;  4HAM A;  2RVC A;  4XLN F;  2IVM A;  1O3R A;  1BIB A;  4Q47 A;  2VOO A;  4RGX A;  2DT5 A;  4YII A;  5BS6 A;  1UHW A;  1R1U A;  2EFP A;  1FBU A;  1EV7 A;  3L00 A;  1ZN2 A;  4HLY A;  2R7F A;  1W7P A;  5LHG A;  1G3W A;  3SFZ A;  3F6O A;  4PCQ A;  3F8F A;  2MLK A;  1IRG A;  4HF2 A;  4Z2Y A;  1ONV A;  1YLF A;  2ACJ A;  2FEZ A;  2RKH A;  2R7D A;  3MCZ A;  2Z33 A;  3FXU A;  1QNT A;  1B59 A;  3J81 Z;  1HSJ A;  1O57 A;  5LHH A;  2GA2 A;  1UFM A;  4RAZ A;  3T8T A;  1PP8 F;  2ETH A;  5JVT A;  3ZQ7 A;  1E17 A;  5HLI A;  1JHF A;  2YR2 A;  1A04 A;  1O7L A;  3R0A A;  4I09 A;  3GVA A;  5FFX A;  4RGR A;  3T8R A;  1J75 A;  2XAH A;  3ELK A;  4P55 A;  2PEX A;  1RUN A;  3CJN A;  2E7X A;  5D8L B;  2CFX A;  2KJC A;  2HQR A;  1PUE E;  5HVQ C;  2A6H F;  1I5Z A;  5HDG A;  4P9U A;  1G3T A;  2LF8 A;  3TO9 A;  3HRT A;  4I7H A;  3ABU A;  4L9N A;  1OR7 A;  1ZRE A;  3O2P E;  4LG0 A;  1SD5 A;  3EUH A;  3R60 A;  3C1D A;  3MWM A;  3QU3 A;  3B73 A;  1U5T C;  3IWF A;  3CO7 C;  2L01 A;  3CTA A;  2O0Y A;  2UXX A;  2IRF G;  4LB5 A;  3O6B B;  5E1X A;  5F64 A;  2BGC A;  3PQJ A;  3GO5 A;  1TQI A;  1Z6R A;  2DU9 A;  4WXD A;  2EA2 A;  2FBH A;  3LST A;  4L9T A;  3Q9V A;  1WWX A;  1R1V A;  4HDV A;  2PQ8 A;  2VBW A;  2GXG A;  1F4K A; 
#chains in the Genus database with same CATH topology
 2DOE A;  2LDU A;  3W2W A;  2HDW A;  4BU2 A;  3CUQ B;  3WG9 A;  2VQL A;  2Z3Y A;  3E6M A;  2QM3 A;  2WAQ A;  4L5E A;  1T08 B;  2V6C A;  3DP7 A;  3VPR A;  4HDU A;  3B6A A;  5IPA A;  3LAJ A;  1UZC A;  4IQJ A;  3JTH A;  3S32 A;  1O3S A;  1ZTR A;  1L3L A;  1FBQ A;  1Z91 A;  3OSF A;  1BC7 C;  1GV5 A;  3G1O A;  4ZZD A;  4G9Y A;  1ZRC A;  2FOW A;  3E5Q A;  5H20 A;  1IUF A;  2DMQ A;  1LVA A;  5FGM A;  3T1B A;  2FXA A;  2VBX A;  4MGR A;  2K86 A;  5CVJ A;  1ERD A;  3K1N A;  3WGG A;  2VKV A;  1FT9 A;  1BN5 A;  4LMY A;  1WVR A;  2EZK A;  4A2U A;  1W7P D;  2IBD A;  4PJN A;  1XMX A;  1QVT A;  4YFK F;  2MW8 A;  4ENN A;  1R22 A;  4RGU A;  4B44 A;  3FK7 A;  2NNY A;  3QQA A;  2XUB A;  3G3Z A;  4L5I A;  2MC4 A;  3RKQ A;  3HKZ N;  1H9T A;  2L02 A;  3U2R A;  1M1E B;  1R9T J;  1QO0 D;  3COA C;  1LPQ A;  3QAH A;  1Y6I A;  4BAY A;  5KNL A;  2LYC A;  1SD7 A;  3DTK A;  5FKL A;  2NVQ J;  2DK5 A;  3MKW B;  1X1B A;  1WKM A;  3GZ6 A;  3IUO A;  1FYL A;  2QSH X;  4KIB A;  1W36 C;  1H9G A;  3M8J A;  1VTN C;  3ZOB A;  3WTT C;  3I59 A;  1HC8 A;  3TOA A;  1XGM A;  2IPQ X;  2V1X A;  4OIP F;  2F5C A;  2L4A A;  1Z1D A;  1VQK I;  3GFJ A;  1WQ2 A;  2HU9 A;  4QTR A;  2DYS H;  3MKL A;  2W85 A;  3QU6 A;  1YX5 A;  1QPM A;  5LGU A;  2JPB A;  3UR3 C;  2ZSI B;  4EM2 A;  2XGD A;  3HM5 A;  4XOR A;  2EJR A;  4PFP A;  2TRT A;  4OIN F;  5FKO A;  1B8I A;  5F0C A;  5KVR A;  2OF7 A;  3V7S A;  4BAC A;  2YU3 A;  5AIQ A;  1B72 A;  1PJR A;  3BG3 A;  4AUX A;  2DT6 A;  2HZT A;  1T39 A;  3ZPL A;  1E3O C;  4XRS G;  2BY1 A;  1RET A;  2NRA C;  5C44 J;  1NG6 A;  5BOX A;  1BIA A;  1UG0 A;  2ZJR F;  3D5S C;  3CCV I;  4XRM A;  3RTR A;  1U78 A;  1PP7 U;  4KUM A;  1K78 B;  3ERM A;  1ZG1 A;  1A6I A;  1BI1 A;  1D1A A;  2MAB A;  2LBF B;  1AKH A;  1ZK8 A;  3SYT A;  4A3L J;  3C7J A;  2VON A;  1FIA A;  5DTD A;  5HDN A;  2Y75 A;  1YI2 I;  4HEA 2;  2MA3 A;  4OAY A;  1WSU A;  2IXS A;  3UKG A;  2PI0 A;  1A35 A;  1F43 A;  3M4O J;  1Z77 A;  2O61 A;  4CCM A;  1TNS A;  3CJQ B;  1U5T A;  2JJ7 A;  4UB6 C;  3OYB A;  1E3H A;  2VXD A;  3RJP A;  3F3X A;  4EM0 B;  1IXS B;  2HKO A;  2VJ4 A;  2HVQ A;  1NK3 P;  1WRJ A;  3E3V A;  3ZR8 X;  2PMZ A;  1USS A;  5EGO A;  2CO5 A;  5LRS A;  4U7B A;  1MW7 A;  4WXC A;  2XAJ A;  3CCJ I;  4G7Z F;  2E71 A;  1XSV A;  4KMF A;  4EGZ A;  1VZ0 A;  1LE8 B;  3NWS A;  3OMY A;  4NQW A;  1AWC A;  4BXF A;  1RC9 A;  1IDZ A;  5L3B A;  9ANT A;  3QYF A;  2GZW A;  3A03 A;  4FE4 A;  4EAT A;  4C3H J;  4AVZ A;  3FXO A;  4ENM A;  2X0L A;  3MMY B;  2NS0 A;  4I98 B;  3H9J A;  4EMS A;  1P9Q C;  3MFK A;  1OIS A;  3PSF A;  5F04 A;  5E79 C;  5J4Y A;  1X3W B;  1ENH A;  4X6A J;  2BY2 A;  4MTD A;  1QZZ A;  3BZK A;  1OYI A;  4BY7 J;  3S3N A;  3M7G A;  4BEH A;  3ZMV A;  1XTA A;  4UUV A;  2LF7 A;  5BPI A;  1V5F A;  2OCE A;  4DW6 A;  2I10 A;  2OZU A;  4HV5 A;  1ETO A;  4JP0 A;  4HA8 A;  2M7B A;  3G71 I;  2DYR H;  1TWG J;  4I6Z A;  3OIO A;  2F4I A;  3HOX J;  1G3Y A;  2F5E A;  3J7A O;  4M3D A;  2R7X A;  1U5T B;  1UJ8 A;  3CDL A;  4JX4 A;  4A6E A;  1HDD C;  3DWL E;  3IAS 2;  3HYI A;  3S2W A;  4JX6 A;  2JRM A;  1GT0 C;  2K9L A;  1YX3 A;  4AU7 A;  1UG2 A;  2MSY A;  3IRR A;  1E3P A;  4CYC B;  2ME0 A;  3GXO A;  3NEU A;  3ZQC A;  2WAQ N;  3T5X A;  2XPW A;  3ZMD A;  1ZH5 A;  2KRF A;  2HYF A;  3RI4 A;  1FBS A;  5FLV A;  2FBK A;  2P7V B;  2EIM H;  3DLA A;  1STZ A;  3NRV A;  3CC4 I;  2FUG 2;  1X4O A;  4EV0 A;  1WJE A;  4ON0 A;  3H1C A;  3FZV A;  1DQU A;  1U2W A;  2Z2S B;  4QSH A;  3ZN0 A;  1O3Q A;  1IV6 A;  1FIP A;  4OOI A;  5J3L A;  3BCA A;  3S93 A;  3I4P A;  2AQF A;  2YS9 A;  1MBG A;  4LOC A;  5HS8 A;  1PUF A;  2R7R A;  1KA8 A;  1XGN A;  2WB1 N;  1GLN A;  5ILU A;  3KP2 A;  4F55 A;  1I3Q J;  2XKP A;  1BI0 A;  2XPV A;  3JAM K;  5GAG J;  2VOD A;  1LFP A;  2BVL A;  2M30 A;  3F23 A;  1R5G A;  3ML6 A;  2NOG A;  3SDG A;  2DLL A;  4KN7 X;  3HL2 A;  2HS5 A;  5CKT A;  3IH4 A;  3RDI A;  1ZGW A;  2HQ5 A;  2WC2 A;  4B3X A;  5HLH A;  1QBJ A;  4FX4 A;  4W1U A;  4A3E J;  3HHG A;  1TL8 A;  2CQX A;  4XRF A;  2ZCW A;  3DF8 A;  2ZME A;  3ESW B;  1Z0X A;  3REO A;  2LSO A;  2DDA A;  2FD5 A;  2R5Y A;  4C2U A;  4LLG F;  5FLX K;  1D1B A;  3PUB A;  3GBG A;  1WJB A;  2IJL A;  2XC7 A;  2DBB A;  4S0H B;  3OOU A;  1K7A A;  4YEL A;  1SMY F;  2DPD A;  1IRF A;  3ASO H;  3ZQF A;  5BMZ A;  5D8K B;  3CZ6 A;  4XSZ F;  2BYV E;  3H9G A;  5A2Q Z;  5LEK A;  3CF5 F;  2LC2 A;  3HOW J;  3BZC A;  3FMS A;  3HUG A;  4M73 A;  1K4T A;  4LIV A;  3JR9 A;  3OY9 A;  1IZ1 A;  5CQG A;  3MEX A;  3F21 A;  1P4W A;  5JLX A;  1VQP I;  1ZGA A;  3ZQG A;  3JRB A;  5E17 F;  2X51 A;  4BBS J;  2EK5 A;  4M71 A;  1SFX A;  2QCO A;  3S8P A;  2X6O A;  3HTU A;  4IO9 F;  2Z99 A;  2Z1D A;  3QYE A;  5IY5 H;  2C6Y A;  2V6E A;  2PJP A;  3HBL A;  3J80 K;  1AOY A;  3W3C A;  4E4H A;  2M0M A;  1MH4 A;  5LGT A;  2V7F A;  5H6Q A;  1RKT A;  2NYX A;  5EG0 B;  2D45 A;  3IKT A;  2TCT A;  3CP8 A;  5CQE A;  3ZMU A;  2X6Y A;  4E6K G;  4UUT A;  2HZD A;  2BVM A;  1JTY A;  5FKN A;  3WU0 A;  2CG4 A;  1S7A A;  4JX5 A;  1YJW I;  3LSK A;  3AAF A;  5LD2 C;  2KFD A;  3BTJ A;  4U88 A;  5ICC A;  1TP4 A;  4UNO A;  4DQ2 A;  1F5T A;  1XPX A;  1WJC A;  4UVC A;  2ELH A;  2ESN A;  3CDI A;  3K1M A;  2JQ7 A;  5DEQ A;  4OIQ F;  4X1E A;  1B6A A;  3QPL A;  2LVS A;  3TED A;  4GRI A;  1YTY A;  2YX4 A;  4IHX A;  2O8K A;  4L5J A;  4XLF A;  4BKX A;  2BEO A;  3ECH A;  5B66 C;  3PFY A;  3UNG C;  1RZ4 A;  5FFZ A;  3GX4 X;  2ICW G;  4B09 A;  1IF1 A;  1WH5 A;  3Q9S A;  2HVS A;  3O3K A;  1OMI A;  1T98 A;  4HSR A;  2LY9 A;  1KQ8 A;  3S2H J;  1U3E M;  2EFW A;  1Y8R B;  2F2E A;  4O6J A;  5D5V B;  1R4M B;  4DYR A;  4E7H A;  1Z9C A;  2KQR A;  4ANJ A;  3BJO A;  2EZL A;  3PIO F;  1F36 A;  1OR7 C;  1TWC J;  4CH7 A;  5J47 A;  4EJW A;  2E60 A;  2XKO A;  2L0K A;  1XMA A;  2MGQ A;  4R79 A;  2HPM A;  1Z21 A;  1FWZ A;  4MTE A;  4MO7 A;  1K4S A;  2VN2 A;  1J9I A;  3IL2 A;  1PDN C;  2UXN A;  5ILV A;  3BJA A;  4RAF A;  5EZH A;  4GO1 A;  4QWQ A;  3PUF A;  4EGY A;  2FE3 A;  1D5Y A;  4OMY A;  1U9N A;  2NOJ B;  2TDX A;  2PJR A;  3ZMS A;  2IP2 A;  3GZ5 A;  1R6R A;  2BXY A;  1V54 H;  2X6W A;  3M8F A;  3LFK A;  1I6H J;  3SEQ A;  1LVK A;  3LWF A;  1XCB A;  5HDK A;  3HOT A;  2A5Y B;  5IT9 K;  2AQE A;  4FQG A;  2XF6 A;  4XLP F;  2JSP A;  5AIP A;  4IF4 A;  2K5C A;  3C3W A;  2HOE A;  5E8G A;  4LGW A;  1SFE A;  2M87 A;  2KKO A;  1HLV A;  3DQV C;  2KPM A;  1VQ5 I;  2HTJ A;  4A3F J;  2L9N A;  3I55 I;  3U1D A;  1O7F A;  3KLN A;  1MJ9 A;  4ZDL A;  1X2M A;  4CYD A;  3BG7 A;  1BR1 A;  2CQK A;  3HOU J;  1JKP C;  2E2J J;  4ZDO A;  2VPL A;  2KRC A;  1JUS A;  4CCL A;  2KIU A;  3F8M A;  2DN0 A;  5DCM A;  4QLC U;  2QEX I;  2HQA A;  2HXO A;  2D1H A;  3KP6 A;  4TV7 A;  2QQ9 A;  4IRG A;  1X58 A;  3K4K A;  5ERI A;  4HYE A;  5JVG F;  2JMW A;  4OMZ A;  1XMK A;  3KIO A;  2GXB A;  4Y4R A;  1MMS A;  1HBX G;  3CC2 I;  4FAS D;  4MLO A;  2DFH A;  2E5Z A;  4HOB A;  4MQV A;  1HF0 A;  3MD2 A;  3OIP A;  4IHS A;  2R7S A;  2R93 J;  5J6X A;  2YSR A;  2ZME C;  5TJJ A;  1NG7 A;  2BY3 A;  3KP7 A;  2ZNZ A;  2Y2Z A;  2QBY A;  1MIJ A;  4Y15 A;  1O3T A;  1TW3 A;  1LNW A;  2GXA A;  3FXK A;  5F08 A;  1FX7 A;  2CSO A;  2HGC A;  4OWR B;  1VQ9 I;  3GF2 A;  4N9H A;  4GCV A;  4NC6 A;  1IJW C;  1YFH A;  4P96 A;  4X0G A;  1TQM A;  3OYE A;  4ABZ A;  3TW7 A;  3M07 A;  1W7P B;  1DDN A;  1OYW A;  4IJA A;  3CCQ I;  3K9T A;  4GGG A;  1IXC A;  2MC3 A;  3HRU A;  1DUX C;  1BJA A;  4KT6 A;  2PX9 A;  1LEA A;  1ITY A;  2H6B A;  4LIU A;  1Y8Q B;  5E3L A;  4A0Z A;  2H8R A;  2K7L A;  2OQG A;  2ZC2 A;  3BC8 A;  1K6O A;  3K4L A;  1MD0 A;  4EJU A;  3JSP A;  1DP3 A;  5EZG A;  3K0L A;  1MZB A;  3L2U A;  2ECB A;  1D8K A;  2RGV A;  3M3Y J;  2M9H A;  2K9Q A;  4DJA A;  3ASN H;  1FPQ A;  2KIS A;  3M9A A;  2DA3 A;  5EF6 A;  1VQ6 I;  2FQ4 A;  3JRF A;  1BW5 A;  1G6N A;  2E36 A;  3GLX A;  1YHQ I;  1K79 A;  3DKX A;  3Q0V A;  1MSF C;  3FHN A;  4AID A;  2WY8 Q;  4M3F A;  4ESJ A;  4A3D J;  1RKW A;  2CW0 F;  1YIO A;  2V1D A;  1P7I A;  4BQN A;  4M6V A;  1KU3 A;  1R71 A;  5K5R A;  2K9M A;  1YYV A;  4XLE A;  3I3L A;  4IVN A;  2ZSH B;  1YIT I;  2GBY A;  1J09 A;  1MMG A;  2RC4 A;  5F1J A;  5L3G A;  5KAF C;  2KIF A;  2KMU A;  4XL9 A;  3G73 A;  1ZAR A;  1IAW A;  1BC8 C;  2XF7 A;  3WTV C;  1RPW A;  2RN7 A;  4V19 K;  2YX7 A;  1WGX A;  3FXQ A;  3LA2 A;  3K4N A;  2L2O A;  3K2Z A;  3BR6 A;  2CV2 A;  1N75 A;  2VBY A;  5K1Y A;  2PBI A;  3NAR A;  1HOM A;  2RV8 A;  3PNT A;  2F4M B;  4B3A A;  2A6T A;  4CCJ A;  2XDV A;  1WJA A;  1IN5 A;  5GP9 A;  2W7N A;  4IHW A;  1EH8 A;  4ZYE A;  1SEU A;  4KIF A;  4I2O A;  4ZZL A;  3KE2 A;  1XD7 A;  3J7A Y;  2HR3 A;  1MDM B;  2YPR A;  3GEZ A;  2DCE A;  3ULQ B;  3OYM A;  2K9N A;  2J5P A;  4NHJ A;  1P4A A;  1RES A;  2IS6 A;  2F5F A;  3RKX A;  1VFC A;  3OYJ A;  2QKM B;  3BLY A;  4UHT A;  3D1N I;  3V4G A;  4L0Y B;  3E6D A;  3A2K A;  1BOB A;  3CJT B;  4L9V A;  2P5K A;  4F92 B;  5HLG A;  5TRD A;  3KZY A;  3E5U A;  2W25 A;  3HOS A;  5CVI A;  3CUQ C;  2CQQ A;  2VAS A;  2KZV A;  5LBQ A;  3LL7 A;  4IXA A;  5GTI C;  4LG0 B;  1FTT A;  2D1V A;  1IN6 A;  2R92 J;  4XBF A;  3CCY A;  3VSK A;  1T33 A;  2ELJ A;  3EET A;  1H0M A;  3SFI A;  4H0E A;  3K70 C;  1ACI A;  3ABT A;  2XB0 X;  4PFO A;  3RZD J;  1S3J A;  5K5O A;  3OR2 C;  4FTH A;  2K85 A;  3HKZ A;  2UUZ A;  2Y31 A;  4AYB A;  3KYC B;  1OCP A;  2OC6 A;  3SJM A;  4M6X A;  4B47 A;  3I5U A;  5GPC A;  1S6L A;  1IO2 A;  3HSE A;  5HS7 A;  3QPS A;  1Z7U A;  4WK8 F;  1JTX A;  2ISZ A;  5HNH A;  2LH9 A;  1WJ5 A;  1I39 A;  2HQN A;  1N77 A;  3CLQ A;  1FYM A;  2F5D A;  1YE9 A;  3PIP F;  3CF2 A;  3JRE A;  2JTV A;  2OBP A;  4UVA A;  3LA3 A;  4U7D A;  3OS0 A;  4I76 A;  2XAU A;  1Z6T A;  3V7C A;  5HNF A;  2EV0 A;  2QWW A;  5LFA A;  3WE2 A;  2A05 A;  1I1S A;  1RR7 A;  3P5J A;  2A68 F;  3TO6 A;  1XC5 A;  1VQM I;  1HDP A;  5J8C A;  1GHC A;  2STT A;  3EDP A;  3HEF A;  3B02 A;  3KZZ A;  1MNE A;  2OTJ I;  3I64 A;  3HJE A;  1R36 A;  1S29 A;  2R3S A;  2ZFW A;  2PLY A;  2K3F A;  3E6C C;  1X2N A;  2GQQ A;  3S16 J;  5DCF A;  1Z3Y A;  3E7L A;  2A5W A;  4HW0 A;  5IT3 A;  3IHU A;  2IS4 A;  2XSD C;  1AA7 A;  3CQZ J;  5K7Z A;  4ZC3 A;  2ZJ2 A;  4IHY A;  4NDL A;  3M1C A;  4IRH A;  4NNJ A;  3V8J A;  1NTC A;  2E5N A;  3GTL J;  1UST A;  5C3E J;  4KFC A;  2A69 F;  3TL4 X;  1SVO A;  1D3Y A;  5BNG A;  2HNH A;  2HEO A;  3BOQ A;  2QGU A;  3QP6 A;  1UB9 A;  3ZQL A;  1D0Y A;  3IP4 B;  3TP0 A;  2AS5 F;  1R5I D;  1DGR M;  3H92 A;  2XRN A;  4WF2 A;  2F48 A;  1F1Z A;  4U0V A;  4B4C A;  2VC0 A;  3DXJ F;  4J19 A;  1D5V A;  5FJ8 J;  4A3J J;  4CZC A;  1XDU A;  2OCC H;  2FJ1 A;  3E6B A;  3KP3 A;  2KRH A;  2QZ8 A;  2Q8K A;  1L0O C;  4H4K C;  4KMU X;  2CGP A;  4RGS A;  3N4M A;  4ETS A;  1TBX A;  3A01 A;  1FMW A;  2IA1 A;  2W84 A;  4IHV A;  1LUJ B;  1W5C C;  2R7Z J;  4LK0 F;  2W24 A;  4PDK A;  5CYV A;  4MEY F;  5ILS A;  2E2H J;  3C2G A;  2LR8 A;  1IN4 A;  1ETX A;  5HOO A;  4MNU A;  4A5N A;  2PFB A;  2WBM A;  4RBO A;  4GDF A;  2FSW A;  2PMH A;  1KU2 A;  4IOC F;  5IP9 J;  1TT5 B;  1HXD A;  4NBQ A;  5DM6 F;  3F22 A;  1K78 A;  4BHP A;  1S7E A;  2K3P A;  2Y0S N;  2VLA A;  2LBF A;  1AKH B;  1S72 I;  3L09 A;  1Y1W J;  2GWR A;  4P1W A;  3LSJ A;  2HDC A;  5LGN A;  1D8J A;  2EA4 A;  3DLL F;  4Y3O A;  1OFC X;  1LKX A;  2VXZ A;  4HX8 A;  1IXR C;  1QZY A;  3BG5 A;  3HC7 A;  3LAP A;  2ID3 A;  1IN8 A;  1IRZ A;  4E7Z A;  5LHI A;  3HOY J;  1FP1 D;  2A3S A;  1ZR2 A;  1N78 A;  2Y0S A;  4O5V A;  3DBL B;  3K10 A;  3RYR A;  3JRH A;  3GZN B;  3TGN A;  5E3N A;  2XF5 A;  1MH3 A;  4D9J A;  3DPL C;  3MAJ A;  1WJD A;  4XMY A;  4EVI A;  3OS2 A;  2DMU A;  3G2B A;  4ENK A;  3LSG A;  1OCZ H;  2NAZ A;  2JA8 J;  2LKP A;  1T56 A;  1OJL A;  4Q4Z F;  2X48 A;  3L7W A;  1ON1 A;  2ID6 A;  1U6G A;  3LFU A;  4G6D A;  2Y0M A;  3OSG A;  3U9G A;  1T38 A;  3IWZ A;  4AWX B;  1KYZ A;  2CWE A;  3I54 A;  4NQW B;  4E7J A;  1ZLK A;  3GTQ J;  2WTE A;  1R49 A;  4DOZ A;  1F9N A;  3CUQ A;  2O9L A;  1XGS A;  2GIZ A;  4Y7N J;  2CW8 A;  2EBI A;  3RYP A;  2XSJ C;  4S05 A;  1WI3 A;  2KT0 A;  4IL6 C;  1V5E A;  4JYK A;  1SD4 A;  5DUI A;  3BG6 A;  3S1R J;  3MN2 A;  4UUS B;  3K4C A;  4CIC A;  3BR0 A;  1RR8 C;  1ZG5 A;  3RCO A;  4AYB N;  4B1R A;  3L2R A;  5FKM A;  1NH3 A;  2HI3 A;  1NHA A;  1X19 A;  1MMN A;  3KFW X;  1FEX A;  2WAE A;  3KLO A;  2WV0 A;  3I53 A;  1HST A;  2V1N A;  4HBL A;  2MD5 A;  4ZYA A;  4JK1 X;  2Y48 A;  1LQ1 A;  1LJ9 A;  1TLH B;  1ZKG A;  2LY2 A;  2L54 A;  3E5X A;  2X85 A;  4V2F A;  4J01 A;  1CGP A;  4R1H A;  1A5J A;  2L9R A;  3ZP5 A;  3I9V 2;  3BPV A;  3K4M A;  4N4O B;  2MH9 A;  2NNN A;  3X2Q H;  2LD5 A;  1SFU A;  1KQ9 A;  2LP0 A;  2XIG A;  2PMU A;  4HNT A;  1KQ0 A;  2DTZ A;  3PFI A;  2ZXJ A;  1V5G A;  2CV0 A;  4G7H F;  4LB6 B;  3P9I A;  2XVC A;  3S3O A;  1WHU A;  2VIX A;  2CUF A;  3TQN A;  2DDB A;  2ZJQ F;  2ESH A;  1IW7 F;  1H89 C;  2GOM A;  1W5S A;  3FXR A;  4Y13 A;  3TDU C;  5K7H A;  4GYG A;  2VOP A;  3JW4 A;  3CO6 C;  3I71 A;  1Y1V J;  3HHH A;  3H3V K;  3J81 K;  4XKC A;  3F6V A;  5L3F A;  1MKM A;  3U1K A;  3WG7 H;  1HCR A;  1LDJ A;  4WCG A;  4II2 A;  4XK4 A;  2KIM A;  3BPX A;  2KJB A;  3RPU D;  5K5Q A;  5F6F A;  1PUF B;  2HWV A;  1A6Q A;  1VQL I;  4IQ4 A;  4BNC A;  2CH0 A;  2FOK A;  2CFO A;  5HLT A;  1ETY A;  2IGK A;  4KA4 A;  1VQ7 I;  3S15 J;  4IZZ A;  5FO5 A;  5GAD J;  1ZRD A;  2JT1 A;  3JRA A;  3GW2 A;  5IP6 A;  3ECO A;  4N0B A;  1IUY A;  2JVG A;  3BR1 A;  3BR2 A;  1S9H A;  1FTZ A;  2QF7 A;  3KYD B;  2JK3 A;  3SZG A;  2HOS A;  2FA5 A;  5DDG A;  2K27 A;  2ME6 A;  3DCF A;  3FMR A;  4BYY A;  2R5Y B;  4LIT A;  4F3Q A;  1PYV A;  2EQR A;  1V55 H;  2R0Q C;  3RZO J;  2LNB A;  2E1M B;  5A2Q K;  2DAO A;  1UHS A;  2ELK A;  2ZFU A;  5FKK A;  2QSF X;  4D1Q A;  1IRX A;  2K9S A;  4C2T A;  3KPH A;  3WTY C;  2ZXI A;  4UVB A;  3EUH C;  2G9W A;  4XKV A;  2ZXW H;  5EJC A;  2DFF A;  4GYI A;  1WI9 A;  1FP2 A;  5ICE A;  1T95 A;  3TBI A;  3LQR A;  3D5L A;  3E1S A;  1QHG A;  3HRM A;  2MG4 A;  2XB5 A;  3NAU A;  2O6G E;  4ASN A;  2DFE A;  4D5C A;  3J80 Z;  1P92 A;  4PGH A;  2H27 A;  2DXI A;  3BJ6 A;  4I99 C;  3J7Z I;  4A6D A;  3ONQ A;  4PJM A;  4A3G J;  2D2W A;  1UCR A;  2JPC A;  2OJE D;  3N05 A;  4Q5S F;  4BE2 A;  3DV8 A;  4CZZ A;  3FBI B;  2GA1 A;  2HYG D;  4BJ6 C;  4A0Y A;  2Y69 H;  3MVP A;  1ZGJ A;  1MDM A;  1J7K A;  3VYR B;  2FRH A;  1J2X A;  3PSI A;  3ZRG A;  3I0T A;  3PNY A;  2R7W A;  1EA3 A;  3Q5F A;  2A6E F;  2P6S A;  3K69 A;  4MFE A;  1KON A;  2CMP A;  3OYD A;  1XG1 A;  1Y39 A;  3IKV A;  2A07 F;  4EQQ A;  3FDY A;  2EH3 A;  3E0J B;  3OOP A;  4CSW A;  1U8B A;  2E2I J;  1ON2 A;  2QLZ A;  2EV6 A;  1TT0 A;  3KCC A;  1XSD A;  1D0Z A;  1JT6 A;  1CF7 B;  4PZJ A;  3JRI A;  3FM5 A;  2VB6 A;  2X1E A;  3ZQQ A;  2W57 A;  2B0L A;  3VYU B;  1TWH J;  2EWN A;  4AC0 A;  2P5L C;  1ULY A;  1YW9 A;  1LDD A;  3M8E A;  4EJV A;  5D5W B;  1MSE C;  3KEO A;  1WCM J;  4W97 A;  3QP5 A;  4LFU A;  3CMY A;  4BL0 B;  4PSW A;  4ZDP A;  2G7H A;  3K4B A;  1LFU P;  4HF1 A;  1JKO C;  2XAG A;  3IAM 2;  1VQO I;  2LK2 A;  4XIC A;  1Z7L A;  3V7R A;  4ZTF A;  3ERE D;  3ZQH A;  2DO7 A;  3DPU A;  3IH3 A;  4M3E A;  4XID A;  2QA4 I;  4C3J J;  3SQN A;  2KHM A;  4L9J A;  3H0G J;  2EIN H;  3GTK J;  3SXY A;  3H3Z A;  2LMD A;  2FX0 A;  4YG2 F;  1YQA A;  4EEF G;  2EFN A;  2LKS A;  2E1N A;  1ZQ3 P;  1K6Y A;  1Q1V A;  5DYM A;  2GAU A;  4ZH4 F;  1ETQ A;  2F6C A;  3FIW A;  2XGX A;  3F9K A;  3WTZ A;  1VQ4 I;  2GIV A;  2QYO A;  3C18 A;  2E7W A;  3H9Q A;  2OZ6 A;  2BBY A;  2RAE A;  5IT9 Z;  5ED4 A;  1FOW A;  3AG2 H;  1TZL A;  5ICF A;  1MJB A;  2H1L A;  1GXP A;  4BH9 A;  1IG7 A;  3VEP A;  2Y30 A;  1ZHF A;  2ZNY A;  4XN0 A;  5F1R A;  2P8T A;  4LD5 A;  5IYB J;  4YRV A;  4UXN A;  4Z6Y A;  2DJN A;  2KDZ A;  4OIO F;  5M5X J;  1JKR C;  2BV6 A;  2P7C B;  2RQQ A;  4KIT B;  2HXI A;  4MHG A;  1IN7 A;  4JOM A;  2DOA A;  2DOF A;  3DKY A;  3A0H C;  3C2H A;  3CCS I;  3TO7 A;  1B9N A;  4YIF A;  4O3M A;  4PGG A;  5H2F C;  2H1K A;  4UB8 C;  3H5A A;  1TQP A;  2ZXH A;  2RQP A;  2VL8 A;  2Y9Y A;  1FNN A;  3S1N J;  1CQT A;  1A36 A;  4Y33 A;  1NK2 P;  3VWB A;  5JI6 A;  2EIK H;  3ABL H;  3BQY A;  3PM1 A;  3HSR A;  3RKY A;  4IPA A;  3EUK L;  3R4K A;  4S04 A;  4M9Z A;  1EJ9 A;  2LRE A;  3SDB A;  4N4N B;  3S2D J;  2QQB A;  1SAU A;  2H09 A;  1GVD A;  3LSM A;  3AG3 H;  3N97 A;  3QPH A;  3VOE A;  4DYQ A;  3VOD A;  3LSP A;  3FX3 A;  2LLK A;  2XGE A;  3AG1 H;  3JRD A;  4A3C J;  2X1D A;  2QUF A;  3OV8 A;  1TNT A;  1KGS A;  2FML A;  4EJO A;  4U0Y A;  4U87 A;  3W2A A;  4BXU A;  1MJA A;  1ZLJ A;  3HOZ J;  4RAG A;  5DD4 A;  1E2X A;  4BHB A;  3D0S A;  2RNJ A;  3KZI C;  2Y9Z A;  2E34 A;  4OAZ A;  3PO3 J;  3MQ0 A;  4CXF A;  1LB2 A;  2V9P A;  3AL0 C;  1BA5 A;  2XAS A;  3CUO A;  1MBJ A;  1YIJ I;  2H6C A;  4RM2 A;  2EZI A;  3ABK H;  4R8H A;  3DU6 A;  3G1M A;  3GTM J;  4D7M A;  3BR3 A;  3G1L A;  4II3 A;  1FOY A;  4IRI A;  1ETV A;  4I0A A;  2F5V A;  2H94 A;  2P4W A;  3FKJ A;  3B6C A;  5TGT A;  2ECC A;  4YFX F;  1VQ8 I;  4HQE A;  2VI6 A;  3L2W A;  2OAZ A;  4LK1 F;  3A0B C;  3ISP A;  1QPI A;  2JA5 J;  1XB4 A;  4HLX A;  5IOZ A;  3MZH A;  2R7V A;  2DW4 A;  3W2V A;  3BR5 A;  4M74 A;  2A61 A;  1G2H A;  3OL4 A;  1X1D A;  4G94 A;  3I4N J;  5D4S A;  2R7O A;  3ZQI A;  4UY8 I;  1ZEL A;  2EZH A;  3GFM A;  4BS9 A;  1U8R A;  3FKI J;  3CCR I;  4JBA A;  3JAM Z;  5KAI C;  3DPT A;  3R61 A;  2CS3 A;  2L7M P;  4D5F A;  3TW6 A;  2KLO A;  4A5M A;  1IGN A;  2IS2 A;  3MZY A;  5JFR A;  2RDP A;  4JQF A;  5K7F A;  4A3K J;  3HB9 A;  2GM4 A;  1GUU A;  3I59 B;  2OTL I;  3LSH A;  1ZR4 A;  1ETW A;  2IS1 A;  2L7K A;  4HF0 A;  2HYJ A;  2I8D A;  2KP6 A;  4ESF A;  3A1Y A;  2E1M C;  5J40 A;  2V26 A;  1EKE A;  2PG4 A;  2CV1 A;  1MNM C;  1KU7 A;  3V8L A;  5D4R A;  4KIG A;  3F8C A;  4LLL A;  1B8I B;  2QQ8 A;  2O8X A;  2B7E A;  2GLO A;  4XOT A;  5B5E C;  2M5W A;  3TKY A;  3ZN1 A;  5E1W A;  4L0Z B;  5CVU A;  3WGH A;  4I0B A;  5D6E A;  4RS8 A;  1QHH D;  2M0C A;  2BHY A;  2DT7 B;  1FYK A;  4FX0 A;  4KJZ A;  4UUS A;  3L1P A;  2Z9O A;  1B9M A;  3CP2 A;  5AON A;  5FRO A;  2M45 A;  3RSN A;  2E19 A;  1RUO A;  2IGM A;  3MKZ A;  2IEK A;  1G4D A;  1GVJ A;  1X1C A;  4KNY A;  4G8X A;  2Q0O A;  4XN3 A;  3TP3 A;  2LKX A;  1MBK A;  4WX9 A;  2FNP A;  2HOT A;  4HX4 A;  3WU1 B;  4YIR X;  3JTG A;  3QYB A;  2L5Q A;  3FBN B;  4XKB A;  5BPD A;  3ZGK A;  3GUD A;  4IEJ A;  4BQA A;  1ZYR F;  2I5U A;  3K4J A;  1SAX A;  2FU4 A;  3QRF F;  1T0F A;  4GXO A;  4HPQ A;  1W0U A;  4RAY A;  4DIQ A;  2XRO A;  5EGO B;  2LFB A;  3J7Y J;  2VKD A;  2QEN A;  4XSX F;  2HFH A;  5M5W J;  3H5R A;  2HKX A;  4KN4 X;  4G7O F;  3HPG A;  5C4J J;  1MMD A;  4M3B A;  3H0D A;  2CQN A;  3RQI A;  4RB3 C;  2OPT A;  1KZH A;  3BWG A;  1G3S A;  1PVE A;  5EEG A;  2D5V A;  4CHU A;  2JZY A;  4MQ9 F;  3GLL A;  1FOK A;  4LJZ F;  1FC3 A;  1JXS A;  4FHT A;  1DPU A;  3FMQ A;  2DFI A;  2ZB9 A;  3SZT A;  1YOV B;  1S7O A;  2CUE A;  1N25 A;  4QIW N;  1X3U A;  2R5Z B;  2DI3 A;  2MYS A;  1DP7 P;  1SVL A;  4HV6 A;  2NS7 A;  2VC1 A;  4E7K A;  1AU7 A;  5J8F A;  3VYT B;  1K83 J;  4N9I A;  2QQA A;  1RNL A;  3K6G A;  4MFD A;  3VYS B;  2X4H A;  4BJ5 C;  3OS1 A;  1WH7 A;  2FMY A;  4ZYD A;  1ZRF A;  1MGT A;  2DK8 A;  1SC7 A;  2WA0 A;  3SZP A;  1W5T A;  3LSR A;  3GYH X;  2DOD A;  1ETK A;  4AVP A;  1UHM A;  5LLQ A;  3M1E A;  1R00 A;  1MND A;  1WPK A;  2NVY J;  3RPU A;  1ZG3 A;  4RB0 A;  1P6R A;  5JHU A;  4HST A;  1LEB A;  3WGI A;  2MBF A;  1W1W E;  3HRS A;  1YJN I;  2COM A;  1BOA A;  4CYC A;  1DPR A;  3NQO A;  1HW1 A;  3R6S A;  5L3C A;  3LNQ A;  2VT3 A;  1S8N A;  2VKE A;  3LA7 A;  4CO8 A;  2M4K A;  1QVU A;  2DMT A;  2VPR A;  3QPT A;  2RRE A;  4RLQ A;  4OIR F;  1KU9 A;  3H36 A;  1HQC A;  2JVH A;  4PK4 A;  5M3F J;  2P6T A;  3FM3 A;  5EYR A;  3HXL A;  3QOE A;  1LDK B;  2WAF A;  1MMA A;  4KYW A;  3C2B A;  2UZK A;  3OIQ A;  2K40 A;  5DV5 A;  4C9Y A;  2ADU A;  3CCE I;  2W00 A;  5CVR A;  3HIF A;  1OCT C;  3W6V A;  1B72 B;  3RIR A;  2K4J A;  3CCL I;  1P7J A;  3VDX A;  1BL0 A;  1XCV A;  2BE5 F;  3DU5 A;  4UV9 A;  1XS9 A;  3BRO A;  5ICG A;  1OCC H;  2DQL A;  4GFB A;  5CJ9 A;  3D5R C;  4B8X A;  3WTX C;  1O4X A;  1Y0N A;  4PUS A;  3TOB A;  3ZCO A;  3K70 D;  2O03 A;  3BDD A;  3A01 B;  1R5H A;  2MLG A;  4CCK A;  3T0Y A;  2IA2 A;  4LLN A;  4FE7 A;  3P9C A;  5TIS C;  4HQM A;  4XON A;  1JT0 A;  3BQZ A;  2VQH A;  3KET A;  2W4S A;  2M7A A;  4PJJ A;  1GV2 A;  1BW6 A;  2XGC A;  3A4C A;  5LRR A;  4EM1 A;  3PO2 J;  4G6Q A;  4XLH A;  1OYY A;  2ZBK A;  4BHC A;  2E1O A;  4MIM A;  4RB1 A;  2ZME B;  4ZJZ A;  3DFG A;  2ISY A;  2E1C A;  1I3A A;  3OYN A;  1DGW Y;  2JN6 A;  4FT8 A;  4DZJ A;  4MEX F;  2L4M A;  2VE9 A;  2L3D A;  1CF7 A;  1HKQ A;  2EPF A;  4CGZ A;  3HG9 A;  3G6E I;  1OCR H;  4F52 A;  3LOC A;  1TTY A;  1V4R A;  2DTR A;  1GDT A;  4KT5 C;  4C30 A;  4BQO A;  1R58 A;  3RKW A;  5J1R A;  1I1G A;  2ZKZ A;  2LY1 A;  3RPQ A;  1FSE A;  3CCU I;  2M8G X;  3BY6 A;  4P9F A;  1QZE A;  4YFN F;  4AD9 A;  3DBR B;  1T0F C;  1TWA J;  3TDZ C;  3EUA A;  2L7F P;  4XOP A;  4DZP A;  1ODD A;  2JUC A;  3OYG A;  3S1M J;  2M2E A;  3BP8 A;  2V9K A;  4CA0 A;  4F7Z A;  3I56 I;  3HOV J;  4RM3 A;  3V8K A;  2K02 A;  4CDG A;  2H8W A;  3I4M J;  2DA6 A;  5E8I A;  4CUG A;  4HX7 A;  2M3A A;  1ORK A;  2OD5 A;  3FK6 A;  4IHT A;  2BW3 B;  2NS8 A;  5E3O A;  1T6S A;  2P5V A;  4DNC A;  1WJF A;  1YS6 A;  1IDY A;  3K7A J;  1QA6 A;  4F93 B;  2O3F A;  2L9S A;  1SFO J;  5EG0 A;  1QRY A;  1W0T A;  1SAN A;  3OWT A;  1B4A A;  4RLF A;  4BEH B;  1XDS A;  2DA1 A;  1XGO A;  1JI8 A;  2XAQ A;  2VE8 A;  3MZ8 A;  2VQC A;  4WWC A;  2LTP A;  2OU2 A;  2WWY A;  4CCN A;  4XKW A;  1TC3 C;  4I02 A;  2VBZ A;  2KZG A;  2NVT J;  3I58 A;  1JGG A;  3GCM A;  3BZ6 A;  3CJR B;  3LSI A;  1P2F A;  5DS9 A;  2NXN B;  3EYY A;  1Z67 A;  2WAD A;  5LEJ A;  5EEA A;  3AG4 H;  2XV4 S;  3DEE A;  2G7U A;  2XHK A;  1BR2 A;  2Q2E A;  2DMN A;  3WE3 A;  2IA0 A;  2YU9 J;  1GXQ A;  1JE8 A;  3KYL A;  1SD6 A;  1Z05 A;  2JWT A;  3U21 A;  3V42 A;  2AHQ A;  3O8H A;  2Q1Z B;  2CJJ A;  1HW5 A;  1JUP A;  5IP7 J;  1EH6 A;  2W1O A;  3FHZ A;  1DU6 A;  1JKQ C;  3W6J B;  3FXJ A;  4OU0 A;  3ABM H;  2IT0 A;  1J0R A;  4CCO A;  2OA4 A;  5J4V A;  1UMQ A;  5DD8 A;  4KIS A;  5CLS A;  5IYC J;  3BG9 A;  4HNV A;  3KEY A;  2V9V A;  1JGS A;  3QOD A;  1P4X A;  1FSH A;  1K61 A;  4I01 A;  2QVO A;  2X9D A;  1HA8 A;  1R7J A;  4A0X A;  2P81 A;  3GTG J;  5B1A H;  5B1B H;  5JR3 A;  3OYI A;  2BZT A;  2FQ3 A;  2MH2 A;  5FD5 A;  3QWL A;  5D5X B;  1HKS A;  5BQT A;  2BW3 A;  4AIK A;  5GAH J;  1FJL A;  3AL0 B;  3ROU A;  2EFO A;  3CMM A;  5L3D A;  4E70 A;  3K1P A;  5HS9 A;  1Q1H A;  4E7L A;  1C0W A;  1G8X A;  4AIJ A;  3IRQ A;  1R23 A;  2O7O A;  4XRS A;  2PJR B;  2FNA A;  3OYA A;  3RQ4 A;  3OYL A;  4C2M J;  5CVV A;  5KCM A;  1HKT A;  4A93 J;  1OCO H;  1Y56 A;  4ENJ A;  2OV7 A;  3EQL F;  1YS7 A;  2LRD A;  2VT2 A;  4HZF A;  3CDH A;  3IV5 A;  1YG2 A;  2WV1 A;  3JRG A;  4IX7 A;  2LG4 A;  1TWF J;  1HW2 A;  5FLM J;  1POG A;  2XRL A;  5FD6 A;  3GFI A;  1OKR A;  4C3I J;  3DEW A;  3FF5 A;  4FET A;  4AIH A;  1UAA A;  4NC8 A;  3GFL A;  1V3F A;  2ZJP F;  4KDP A;  4P5O A;  5FLX Z;  3WHB A;  4BBR J;  5DCM B;  1RIO H;  2E35 A;  3OYH A;  4HG2 A;  5D5U B;  1JJ8 C;  3HSF A;  1H8A C;  2CRG A;  4D0P A;  1D1C A;  3BTC A;  2OQR A;  4ESB A;  2DA4 A;  2FBI A;  1J59 A;  1OPC A;  4M72 A;  3OYF A;  5H6R A;  3FWE A;  3GWZ A;  5E3M A;  4BE0 A;  3HGY A;  4LG3 A;  2EV5 A;  2GOX B;  2K4B A;  3JCU C;  2W82 A;  4K2E A;  4ZYG A;  3GTP J;  1YRN B;  5GPA A;  3ZMZ A;  4D7N A;  3CD6 I;  3P7N A;  3R0J A;  3CMA I;  2V79 A;  2NVU B;  5HOD A;  3HTS B;  1TW2 A;  5EEH A;  2BOL A;  3L2C A;  1YO5 C;  3VSL A;  1YW8 A;  2QBY B;  4XNF A;  1S5L C;  3P9K A;  2HTS A;  3VFZ A;  3CC7 I;  5F0F A;  2J5O A;  1LFB A;  3GME A;  3HZJ A;  2VKH A;  3E97 A;  4BXX J;  1BI3 A;  1T2K A;  3S14 J;  2XAF A;  1REP C;  2M34 A;  5B3S H;  2JUG A;  4PJ0 C;  3IC7 A;  2M1B A;  1RRJ A;  2QKL B;  2JRT A;  2BXZ A;  1J5Y A;  4M9X A;  3DTE A;  3SEZ A;  1QU3 A;  1KYW A;  2BY0 A;  1VND A;  3FIS A;  3K2A A;  3PQK A;  4B43 A;  4Y52 J;  4YEJ A;  1R1T A;  1YW7 A;  2PN6 A;  3LQQ A;  3WHC A;  3CLO A;  2CW7 A;  4Y17 A;  2YUS A;  3A02 A;  2CUJ A;  4M9S A;  1BR4 A;  2HDD A;  1SMT A;  3LMM A;  1FZP B;  3WTS C;  1OQY A;  3DEU A;  1OLT A;  3AFH A;  2B9S A;  1JHH A;  2UWM A;  2R7Q A;  4HRI A;  2AXL A;  3KP4 A;  2X6X A;  2IAI A;  3ZMT A;  2OUM A;  3H35 A;  2CQ7 A;  3L9F A;  4BY1 J;  4XM3 A;  4WXH A;  5KK1 A;  5DM7 F;  1QGP A;  2DPU A;  1BBY A;  4J00 A;  3W6K B;  4UV8 A;  4FCY A;  1Y0U A;  3WTW C;  2KL4 A;  4Q48 A;  4ZYH A;  3VB2 A;  2XPU A;  1YRN A;  3MKY B;  1T8I A;  3DKW A;  4A3B J;  1QQI A;  5L3E A;  2L9V A;  4U0W A;  5E20 A;  1XN7 A;  3GTO J;  1B1B A;  4L18 B;  2WY7 Q;  4XR6 A;  4BUP A;  1LE8 A;  3OYC A;  2CYY A;  1I27 A;  4EJT A;  2V1U A;  2NVX J;  2IGO A;  2LOO A;  4QPO A;  4XQF A;  5FB2 A;  4E7S A;  5E18 F;  3EYI A;  1BJZ A;  5E1Z B;  1A31 A;  3F8N A;  2VJI A;  2AXT C;  1MBF A;  2EFQ A;  4RMN A;  2JSC A;  4A3I J;  3F72 A;  1MBH A;  3KEQ A;  3Q0U A;  1AHD P;  3IH2 A;  2FF4 A;  4BQQ A;  3DBH B;  5D6F A;  2DQR A;  2STW A;  5F27 A;  2Z5U A;  2ZO4 A;  3CME I;  4DGW B;  2R4G A;  6PAX A;  1XSX A;  3OL3 A;  1APL C;  2HVR A;  1EH7 A;  2IW5 A;  2VQG A;  1FY7 A;  2AO9 A;  4IOA F;  2M8E A;  4FIS A;  3WTU C;  3S3M A;  2KIQ A;  2R5Z A;  3ZXS A;  5DUK A;  5C4X J;  3SHF A;  1BI2 A;  4BGD A;  1I50 J;  2DA2 A;  1ZAO A;  3KP5 A;  1UEL B;  3QOP A;  4RA2 A;  1WZ2 A;  4M6Y A;  1X4P A;  3NWT A;  5J1U A;  5JLW A;  1W4M A;  5FRN A;  4NB5 A;  3JSO A;  2EB7 A;  3H3U A;  3WOD F;  5IOY A;  5GAE J;  3F8B A;  3FXM A;  1BM9 A;  4KIC A;  2R7U A;  3OR1 C;  4BDZ A;  1I6X A;  1FLI A;  2DJI A;  4DBQ A;  4A12 A;  1RI7 A;  4RB2 C;  4HAM A;  2VJ5 A;  2RVC A;  4XLN F;  2HOA A;  2IVM A;  1U0J A;  3OYK A;  1H88 C;  2M4G A;  3HPH A;  1O3R A;  1BIB A;  3H5N A;  4DYC A;  4Q47 A;  2VOO A;  4RGX A;  2DT5 A;  4YII A;  5BS6 A;  3EPZ A;  1D0X A;  1UHW A;  4E7I A;  1R1U A;  2EFP A;  1FBU A;  1EV7 A;  3L00 A;  1G59 A;  4BE1 A;  2F4O B;  1ZN2 A;  3F0C A;  1MBE A;  4A69 C;  2B63 J;  1VF9 A;  4BJT A;  4M3G A;  4HLY A;  2R7F A;  3PJR A;  1W7P A;  5LHG A;  1G3W A;  5M3M J;  4V2G A;  2KDO A;  2IGN A;  1FMV A;  3DTI A;  3SFZ A;  3F6O A;  3BTL A;  4PCQ A;  2WB1 A;  3F8F A;  2L7Z A;  1R4N B;  2MLK A;  1IRG A;  4HF2 A;  3L2Q A;  4Z2Y A;  1ONV A;  1YLF A;  2VJJ A;  4A3M J;  5M5Y J;  1Z3X A;  2ACJ A;  2FEZ A;  1IC8 A;  4IKF A;  1EF4 A;  1X3Z B;  2RKH A;  2UV1 A;  2R7D A;  3O8G A;  4NUB A;  3MCZ A;  2Z16 A;  2Z33 A;  2O5R A;  3FXU A;  5JHF A;  1QNT A;  1B59 A;  3J81 Z;  1HSJ A;  1O57 A;  5LHH A;  2X1C A;  2DA5 A;  1UFM A;  2GA2 A;  4RAZ A;  3CCM I;  2EIJ H;  3HUG B;  4AM3 A;  3BTI A;  1JUM A;  4BDY A;  2G0E A;  3T8T A;  1PP8 F;  2ETH A;  5JVT A;  1WFX A;  5J1Y A;  3AKZ A;  1SFK A;  2W48 A;  3ZQ7 A;  1E17 A;  4PJL A;  3S17 J;  5F0H A;  5HLI A;  1JHF A;  2JA2 A;  2EIL H;  2YR2 A;  4ITV A;  2R7T A;  4RDU A;  2MD0 A;  1A04 A;  1O7L A;  3HDD A;  1VI0 A;  3R0A A;  3BCB A;  4I09 A;  3GTJ J;  3GVA A;  5FFX A;  3Q0W A;  4RGR A;  3HGG A;  1VQN I;  4F91 B;  3T8R A;  1YJ9 I;  4PSX A;  1J75 A;  4QPQ A;  2XAH A;  2CUZ A;  3TMO A;  2CU7 A;  3ELK A;  1X1P A;  4P55 A;  3WU2 C;  2PEX A;  1E0E A;  2P0W A;  5CPR B;  2RNG A;  4G6T B;  3CJN A;  3JRC A;  1JJ6 C;  4XLA A;  1RUN A;  2E7X A;  2N8G A;  2PMZ N;  5D8L B;  2CFX A;  1DU0 A;  3S1Q J;  2KJC A;  2HQR A;  4XLC A;  1IV8 A;  3CES A;  1SVM A;  1PUE E;  5HVQ C;  2A6H F;  1I5Z A;  5HDG A;  2HPI A;  4P9U A;  1G3T A;  2JA6 J;  2LF8 A;  3TO9 A;  1X1A A;  3HRT A;  4G12 A;  4I7H A;  3ABU A;  1FOX A;  2COB A;  4L9N A;  1OR7 A;  2DA7 A;  1ZRE A;  3O2P E;  4LG0 A;  1SD5 A;  4HNU A;  3EUH A;  3G4S I;  2Q2E B;  3R60 A;  4B48 A;  3C1D A;  1W36 D;  3MWM A;  3QU3 A;  1XX5 A;  5KHD A;  3B73 A;  1U5T C;  3IWF A;  3CO7 C;  2L01 A;  3CTA A;  2BHZ A;  2O0Y A;  2UXX A;  3FXL A;  2IRF G;  4LB5 A;  3O6B B;  5E1X A;  5F64 A;  2BGC A;  2JA7 J;  3PQJ A;  2VUM J;  4ZTJ A;  3GO5 A;  1TQI A;  2DMP A;  3BT9 A;  5FRM A;  1U9O A;  1Z6R A;  2DU9 A;  4WXD A;  4NC7 A;  2EA2 A;  2FBH A;  3LST A;  4L9T A;  5IYD J;  3KX2 A;  1WWX A;  3Q9V A;  2V4J C;  1R1V A;  4HDV A;  3L2V A;  2MFZ A;  4DBR A;  3Q3S A;  3PL8 A;  5GTH C;  2QSG X;  5EDN A;  2PQ8 A;  2VBW A;  2GXG A;  3PNV A;  1F4K A; 
#chains in the Genus database with same CATH homology
 2LDU A;  3CUQ B;  3WG9 A;  2Z3Y A;  3E6M A;  2QM3 A;  2V6C A;  3DP7 A;  4HDU A;  3LAJ A;  3JTH A;  1O3S A;  1L3L A;  1FBQ A;  1Z91 A;  1BC7 C;  4ZZD A;  4G9Y A;  1ZRC A;  3E5Q A;  5H20 A;  3T1B A;  5FGM A;  1LVA A;  2FXA A;  2VBX A;  4MGR A;  2K86 A;  5CVJ A;  3K1N A;  3WGG A;  1FT9 A;  1BN5 A;  4LMY A;  4A2U A;  1W7P D;  4YFK F;  4ENN A;  1R22 A;  4RGU A;  2NNY A;  2XUB A;  3G3Z A;  4L5I A;  1H9T A;  2L02 A;  3U2R A;  1QO0 D;  3COA C;  3QAH A;  4BAY A;  1SD7 A;  2DK5 A;  1WKM A;  3GZ6 A;  1FYL A;  4KIB A;  1H9G A;  1VTN C;  3WTT C;  3I59 A;  3TOA A;  1XGM A;  2IPQ X;  2V1X A;  4OIP F;  2F5C A;  2L4A A;  1Z1D A;  3GFJ A;  1WQ2 A;  2W85 A;  3QU6 A;  1QPM A;  5LGU A;  2JPB A;  4EM2 A;  4OIN F;  2EJR A;  5KVR A;  3V7S A;  2YU3 A;  5AIQ A;  2HZT A;  1T39 A;  3ZPL A;  2NRA C;  5BOX A;  1BIA A;  1U78 A;  3RTR A;  1PP7 U;  4KUM A;  1K78 B;  1ZG1 A;  1BI1 A;  3C7J A;  2VON A;  5HDN A;  2Y75 A;  2MA3 A;  1WSU A;  2PI0 A;  2O61 A;  1TNS A;  1U5T A;  3RJP A;  3F3X A;  4EM0 B;  1IXS B;  2HKO A;  1WRJ A;  3E3V A;  1USS A;  2CO5 A;  5LRS A;  4U7B A;  4WXC A;  2XAJ A;  4G7Z F;  1XSV A;  4KMF A;  4EGZ A;  4NQW A;  1AWC A;  5L3B A;  2GZW A;  4ENM A;  2X0L A;  4I98 B;  2NS0 A;  4EMS A;  3MFK A;  4MTD A;  1QZZ A;  1OYI A;  3M7G A;  3ZMV A;  4UUV A;  2LF7 A;  5BPI A;  2OZU A;  4HV5 A;  4HA8 A;  1G3Y A;  2F5E A;  3J7A O;  1U5T B;  4A6E A;  3S2W A;  3HYI A;  3IRR A;  3GXO A;  3NEU A;  3T5X A;  3ZMD A;  1ZH5 A;  2KRF A;  2HYF A;  3RI4 A;  1FBS A;  2FBK A;  2P7V B;  1STZ A;  3NRV A;  4EV0 A;  4ON0 A;  3FZV A;  1U2W A;  1O3Q A;  3ZN0 A;  4OOI A;  3I4P A;  5HS8 A;  1KA8 A;  1XGN A;  5ILU A;  3KP2 A;  2XKP A;  1BI0 A;  3JAM K;  2VOD A;  2M30 A;  3F23 A;  1R5G A;  3ML6 A;  2DLL A;  4KN7 X;  2HS5 A;  3RDI A;  2WC2 A;  5HLH A;  1QBJ A;  4FX4 A;  3HHG A;  4XRF A;  2ZCW A;  3DF8 A;  2ZME A;  3REO A;  2LSO A;  4LLG F;  5FLX K;  2IJL A;  2DBB A;  1K7A A;  1SMY F;  2DPD A;  1IRF A;  5BMZ A;  5D8K B;  4XSZ F;  2BYV E;  5A2Q Z;  5LEK A;  3FMS A;  3HUG A;  4M73 A;  1IZ1 A;  3MEX A;  3F21 A;  1P4W A;  1ZGA A;  5E17 F;  2EK5 A;  4M71 A;  1SFX A;  3HTU A;  2Z99 A;  2C6Y A;  2PJP A;  3J80 K;  1AOY A;  5LGT A;  5H6Q A;  2NYX A;  2D45 A;  3IKT A;  3ZMU A;  3WU0 A;  2CG4 A;  1S7A A;  3AAF A;  4U88 A;  5ICC A;  4UNO A;  4DQ2 A;  1F5T A;  4UVC A;  2ELH A;  2ESN A;  3K1M A;  5DEQ A;  4OIQ F;  1B6A A;  1YTY A;  2YX4 A;  4L5J A;  2BEO A;  3ECH A;  1RZ4 A;  5FFZ A;  3GX4 X;  4B09 A;  1IF1 A;  3Q9S A;  3O3K A;  1OMI A;  1T98 A;  1KQ8 A;  1U3E M;  2EFW A;  4O6J A;  2F2E A;  5D5V B;  1Z9C A;  3BJO A;  4EJW A;  2XKO A;  1XMA A;  4R79 A;  1J9I A;  4MTE A;  1FWZ A;  2VN2 A;  3IL2 A;  1PDN C;  2UXN A;  5ILV A;  3BJA A;  4GO1 A;  4QWQ A;  4EGY A;  4OMY A;  2FE3 A;  2TDX A;  3ZMS A;  2IP2 A;  3GZ5 A;  3M8F A;  3LFK A;  3HOT A;  3LWF A;  1XCB A;  5HDK A;  5IT9 K;  2A5Y B;  4XLP F;  5AIP A;  4IF4 A;  3C3W A;  2HOE A;  5E8G A;  4LGW A;  1SFE A;  2M87 A;  2KKO A;  3DQV C;  2HTJ A;  3U1D A;  1O7F A;  3KLN A;  1MJ9 A;  4CYD A;  2CQK A;  2KIU A;  3F8M A;  5DCM A;  4QLC U;  2D1H A;  3KP6 A;  4TV7 A;  2QQ9 A;  4IRG A;  5ERI A;  4HYE A;  4OMZ A;  1XMK A;  2GXB A;  1HBX G;  4HOB A;  4MQV A;  4IHS A;  5J6X A;  2YSR A;  5TJJ A;  3KP7 A;  2ZNZ A;  2QBY A;  4Y15 A;  1O3T A;  1TW3 A;  1LNW A;  2HGC A;  1FX7 A;  2CSO A;  3GF2 A;  4N9H A;  4GCV A;  1YFH A;  4P96 A;  1TQM A;  1W7P B;  1DDN A;  1OYW A;  4IJA A;  3K9T A;  4GGG A;  1IXC A;  2MC3 A;  3HRU A;  1DUX C;  1BJA A;  1LEA A;  2H6B A;  4A0Z A;  2K7L A;  2OQG A;  1K6O A;  1MD0 A;  4EJU A;  3JSP A;  3K0L A;  1MZB A;  1D8K A;  2RGV A;  1FPQ A;  3M9A A;  1G6N A;  3GLX A;  1K79 A;  4ESJ A;  2CW0 F;  1YIO A;  2V1D A;  1KU3 A;  5K5R A;  1YYV A;  4IVN A;  2RC4 A;  5L3G A;  2KIF A;  3G73 A;  1ZAR A;  1IAW A;  1BC8 C;  3WTV C;  2RN7 A;  2YX7 A;  3FXQ A;  3LA2 A;  3K2Z A;  2VBY A;  5K1Y A;  2PBI A;  2RV8 A;  1IN5 A;  1EH8 A;  4ZYE A;  4KIF A;  4I2O A;  4ZZL A;  3KE2 A;  1XD7 A;  2HR3 A;  1MDM B;  2YPR A;  3GEZ A;  3ULQ B;  2J5P A;  4NHJ A;  1P4A A;  2F5F A;  3RKX A;  4UHT A;  3V4G A;  4L0Y B;  3E6D A;  4L9V A;  2P5K A;  5HLG A;  5TRD A;  3KZY A;  3E5U A;  2W25 A;  3HOS A;  5CVI A;  3CUQ C;  5LBQ A;  4IXA A;  4LG0 B;  2D1V A;  1IN6 A;  4XBF A;  1H0M A;  3EET A;  4H0E A;  3ABT A;  1S3J A;  5K5O A;  4M6X A;  3I5U A;  1S6L A;  3HSE A;  5HS7 A;  1Z7U A;  4WK8 F;  2ISZ A;  2HQN A;  1FYM A;  2F5D A;  2JTV A;  2OBP A;  4UVA A;  3LA3 A;  4U7D A;  1Z6T A;  3V7C A;  2EV0 A;  2QWW A;  3WE2 A;  1I1S A;  3TO6 A;  2A68 F;  5J8C A;  1GHC A;  2STT A;  3EDP A;  3B02 A;  3KZZ A;  3I64 A;  1R36 A;  1S29 A;  2R3S A;  2ZFW A;  2PLY A;  3E6C C;  2GQQ A;  5DCF A;  4HW0 A;  5IT3 A;  3IHU A;  2ZJ2 A;  4IRH A;  3V8J A;  1UST A;  4KFC A;  2A69 F;  1D3Y A;  2HEO A;  3BOQ A;  3QP6 A;  1UB9 A;  2AS5 F;  3H92 A;  2XRN A;  4WF2 A;  1F1Z A;  4U0V A;  2VC0 A;  3DXJ F;  1D5V A;  1XDU A;  3E6B A;  3KP3 A;  2Q8K A;  2QZ8 A;  1L0O C;  4KMU X;  2CGP A;  4RGS A;  3N4M A;  4ETS A;  1TBX A;  2W84 A;  2IA1 A;  4LK0 F;  2W24 A;  4PDK A;  5CYV A;  4MEY F;  5ILS A;  1IN4 A;  5HOO A;  4MNU A;  4A5N A;  2PFB A;  2FSW A;  2PMH A;  1KU2 A;  1HXD A;  3F22 A;  1K78 A;  4BHP A;  3L09 A;  2GWR A;  2HDC A;  5LGN A;  1D8J A;  2EA4 A;  2VXZ A;  4HX8 A;  1IXR C;  1QZY A;  3LAP A;  1IN8 A;  5LHI A;  1FP1 D;  2A3S A;  4O5V A;  3RYR A;  3TGN A;  3DPL C;  3MAJ A;  4EVI A;  4ENK A;  2NAZ A;  2LKP A;  4Q4Z F;  3L7W A;  1ON1 A;  1U6G A;  4G6D A;  2Y0M A;  3U9G A;  1T38 A;  3IWZ A;  4AWX B;  1KYZ A;  2CWE A;  3I54 A;  1ZLK A;  2WTE A;  1F9N A;  3CUQ A;  1XGS A;  3RYP A;  4S05 A;  1SD4 A;  5DUI A;  4CIC A;  1ZG5 A;  1NHA A;  3KFW X;  3KLO A;  2WV0 A;  3I53 A;  1HST A;  4HBL A;  2MD5 A;  4JK1 X;  2Y48 A;  1LQ1 A;  1LJ9 A;  1TLH B;  3E5X A;  2L54 A;  1CGP A;  4R1H A;  3ZP5 A;  3BPV A;  2MH9 A;  2NNN A;  1SFU A;  1KQ9 A;  2XIG A;  2PMU A;  1KQ0 A;  3PFI A;  2ZXJ A;  4G7H F;  4LB6 B;  3P9I A;  2XVC A;  3TQN A;  2ESH A;  1IW7 F;  1W5S A;  3FXR A;  4Y13 A;  3TDU C;  4GYG A;  2VOP A;  3JW4 A;  3CO6 C;  3I71 A;  3HHH A;  3J81 K;  3F6V A;  5L3F A;  1MKM A;  1LDJ A;  4WCG A;  2KIM A;  3BPX A;  2KJB A;  5K5Q A;  5F6F A;  2HWV A;  4BNC A;  2FOK A;  4KA4 A;  1ZRD A;  5FO5 A;  2JT1 A;  3GW2 A;  3ECO A;  4N0B A;  1IUY A;  2FA5 A;  5DDG A;  2K27 A;  3FMR A;  4BYY A;  2LNB A;  5A2Q K;  2DAO A;  3WTY C;  4UVB A;  2G9W A;  4GYI A;  1WI9 A;  1FP2 A;  5ICE A;  3LQR A;  3D5L A;  3HRM A;  2O6G E;  4ASN A;  3J80 Z;  1P92 A;  4PGH A;  2H27 A;  3BJ6 A;  4A6D A;  2D2W A;  1UCR A;  2JPC A;  4Q5S F;  3DV8 A;  4CZZ A;  2GA1 A;  2HYG D;  4A0Y A;  1ZGJ A;  1MDM A;  1J7K A;  2FRH A;  1J2X A;  3I0T A;  3Q5F A;  2A6E F;  2P6S A;  3K69 A;  3IKV A;  2A07 F;  4EQQ A;  3OOP A;  1ON2 A;  2QLZ A;  2EV6 A;  3KCC A;  1XSD A;  1CF7 B;  4PZJ A;  3FM5 A;  2W57 A;  2B0L A;  2EWN A;  2P5L C;  1ULY A;  1YW9 A;  1LDD A;  3M8E A;  4EJV A;  5D5W B;  3KEO A;  3QP5 A;  4LFU A;  2G7H A;  4HF1 A;  2XAG A;  3V7R A;  3ERE D;  2DO7 A;  3SQN A;  4L9J A;  3SXY A;  3H3Z A;  4YG2 F;  1YQA A;  2EFN A;  2E1N A;  5DYM A;  4ZH4 F;  2GAU A;  3WTZ A;  2XGX A;  2GIV A;  2QYO A;  3C18 A;  2E7W A;  2OZ6 A;  2BBY A;  5IT9 Z;  5ED4 A;  5ICF A;  1MJB A;  1GXP A;  4BH9 A;  3VEP A;  1ZHF A;  2ZNY A;  5F1R A;  2P8T A;  4LD5 A;  4UXN A;  4OIO F;  2BV6 A;  2P7C B;  4MHG A;  1IN7 A;  3TO7 A;  1B9N A;  4YIF A;  4O3M A;  4PGG A;  1TQP A;  2RQP A;  1FNN A;  5JI6 A;  3HSR A;  3RKY A;  4IPA A;  3R4K A;  4S04 A;  4M9Z A;  2QQB A;  2H09 A;  3N97 A;  3QPH A;  3VOE A;  3VOD A;  3FX3 A;  2QUF A;  3OV8 A;  1TNT A;  1KGS A;  2FML A;  4EJO A;  4U0Y A;  4BXU A;  1MJA A;  1ZLJ A;  5DD4 A;  1E2X A;  4BHB A;  3D0S A;  2RNJ A;  3MQ0 A;  4CXF A;  1LB2 A;  2XAS A;  3CUO A;  2H6C A;  4R8H A;  4IRI A;  4I0A A;  2H94 A;  2P4W A;  4YFX F;  4HQE A;  2OAZ A;  4LK1 F;  3ISP A;  1XB4 A;  4HLX A;  3MZH A;  2DW4 A;  4M74 A;  2A61 A;  4G94 A;  5D4S A;  3GFM A;  1U8R A;  4JBA A;  3JAM Z;  3DPT A;  3R61 A;  4A5M A;  3MZY A;  5JFR A;  2RDP A;  4JQF A;  3I59 B;  4HF0 A;  4ESF A;  2PG4 A;  1KU7 A;  3V8L A;  5D4R A;  4KIG A;  3F8C A;  4LLL A;  2O8X A;  2M5W A;  3TKY A;  3ZN1 A;  5E1W A;  4L0Z B;  5CVU A;  3WGH A;  4I0B A;  5D6E A;  4RS8 A;  1FYK A;  4FX0 A;  2Z9O A;  1B9M A;  5AON A;  2M45 A;  1RUO A;  1G4D A;  1GVJ A;  4KNY A;  4G8X A;  2Q0O A;  4WX9 A;  2FNP A;  4HX4 A;  3WU1 B;  3JTG A;  5BPD A;  3GUD A;  4BQA A;  1ZYR F;  1SAX A;  2FU4 A;  3QRF F;  1T0F A;  4GXO A;  4RAY A;  2XRO A;  2QEN A;  4XSX F;  2HFH A;  2HKX A;  4KN4 X;  4G7O F;  4RB3 C;  3BWG A;  1G3S A;  5EEG A;  4CHU A;  2JZY A;  4MQ9 F;  1FOK A;  4LJZ F;  1FC3 A;  1JXS A;  4FHT A;  1DPU A;  3FMQ A;  2DFI A;  3SZT A;  1S7O A;  1X3U A;  2DI3 A;  1DP7 P;  4HV6 A;  2VC1 A;  5J8F A;  4N9I A;  2QQA A;  1RNL A;  2X4H A;  2FMY A;  4ZYD A;  1ZRF A;  1MGT A;  2DK8 A;  3SZP A;  3GYH X;  1W5T A;  4AVP A;  1UHM A;  5LLQ A;  3M1E A;  1R00 A;  3RPU A;  5JHU A;  1ZG3 A;  4RB0 A;  1P6R A;  1LEB A;  3WGI A;  2MBF A;  3HRS A;  2COM A;  1BOA A;  1DPR A;  3NQO A;  1HW1 A;  3R6S A;  5L3C A;  2VT3 A;  1S8N A;  3LA7 A;  4CO8 A;  3QPT A;  4OIR F;  1KU9 A;  1HQC A;  2P6T A;  3FM3 A;  1LDK B;  4KYW A;  2UZK A;  5DV5 A;  2ADU A;  5CVR A;  3HIF A;  3RIR A;  2K4J A;  1XCV A;  2BE5 F;  4UV9 A;  3BRO A;  5ICG A;  2DQL A;  5CJ9 A;  4B8X A;  3WTX C;  3TOB A;  2O03 A;  3BDD A;  1R5H A;  2MLG A;  3T0Y A;  2IA2 A;  4LLN A;  3P9C A;  4HQM A;  3KET A;  5LRR A;  4EM1 A;  4G6Q A;  1OYY A;  2ZBK A;  4BHC A;  4RB1 A;  2ZME B;  3DFG A;  2ISY A;  2E1C A;  4FT8 A;  4MEX F;  2L4M A;  2VE9 A;  2L3D A;  1CF7 A;  1HKQ A;  4CGZ A;  1TTY A;  1V4R A;  2DTR A;  4KT5 C;  1R58 A;  3RKW A;  1I1G A;  2ZKZ A;  3RPQ A;  1FSE A;  3BY6 A;  4P9F A;  4YFN F;  4AD9 A;  3TDZ C;  1ODD A;  3BP8 A;  4F7Z A;  3V8K A;  2K02 A;  4CDG A;  5E8I A;  4HX7 A;  2OD5 A;  4IHT A;  1T6S A;  2P5V A;  4DNC A;  1YS6 A;  2O3F A;  1B4A A;  1XDS A;  1XGO A;  2XAQ A;  2VE8 A;  4WWC A;  2OU2 A;  2WWY A;  4I02 A;  2VBZ A;  3I58 A;  3BZ6 A;  1P2F A;  3EYY A;  5LEJ A;  2XV4 S;  2G7U A;  2XHK A;  2Q2E A;  3WE3 A;  2IA0 A;  1GXQ A;  1JE8 A;  1SD6 A;  1Z05 A;  1HW5 A;  1EH6 A;  3FHZ A;  3W6J B;  4OU0 A;  2IT0 A;  1J0R A;  2OA4 A;  5DD8 A;  5CLS A;  2V9V A;  1JGS A;  1P4X A;  1FSH A;  4I01 A;  2QVO A;  1R7J A;  4A0X A;  5JR3 A;  2FQ3 A;  2MH2 A;  5FD5 A;  5D5X B;  1HKS A;  5BQT A;  4AIK A;  3ROU A;  2EFO A;  5L3D A;  4E70 A;  3K1P A;  5HS9 A;  1Q1H A;  1C0W A;  4AIJ A;  3IRQ A;  1R23 A;  2FNA A;  5CVV A;  1HKT A;  4ENJ A;  3EQL F;  1YS7 A;  2VT2 A;  4HZF A;  3CDH A;  1YG2 A;  1HW2 A;  3GFI A;  5FD6 A;  1OKR A;  3FF5 A;  4AIH A;  3GFL A;  1V3F A;  4KDP A;  4P5O A;  5FLX Z;  5DCM B;  1RIO H;  5D5U B;  3HSF A;  4D0P A;  2OQR A;  4ESB A;  2FBI A;  1J59 A;  1OPC A;  4M72 A;  5H6R A;  3FWE A;  3GWZ A;  2EV5 A;  2K4B A;  4K2E A;  4ZYG A;  3ZMZ A;  3P7N A;  3R0J A;  2V79 A;  3HTS B;  1TW2 A;  5EEH A;  3L2C A;  1YO5 C;  1YW8 A;  2QBY B;  3VFZ A;  3P9K A;  2HTS A;  2J5O A;  3E97 A;  1BI3 A;  1T2K A;  2XAF A;  1REP C;  3IC7 A;  2M1B A;  2JRT A;  1J5Y A;  4M9X A;  1KYW A;  3PQK A;  1R1T A;  1YW7 A;  2PN6 A;  3LQQ A;  3CLO A;  4Y17 A;  4M9S A;  1SMT A;  1FZP B;  3WTS C;  3DEU A;  1JHH A;  2UWM A;  2AXL A;  3KP4 A;  3ZMT A;  3L9F A;  4WXH A;  5KK1 A;  1QGP A;  2DPU A;  1BBY A;  3W6K B;  4UV8 A;  1Y0U A;  3WTW C;  4ZYH A;  4Q48 A;  3VB2 A;  3DKW A;  1QQI A;  5L3E A;  4U0W A;  5E20 A;  1XN7 A;  1B1B A;  4L18 B;  2CYY A;  1I27 A;  4EJT A;  2V1U A;  5FB2 A;  3EYI A;  5E18 F;  5E1Z B;  3F8N A;  2EFQ A;  2JSC A;  3F72 A;  3KEQ A;  2FF4 A;  5D6F A;  2STW A;  2DQR A;  2Z5U A;  2ZO4 A;  6PAX A;  1XSX A;  1EH7 A;  2IW5 A;  1FY7 A;  2M8E A;  3WTU C;  5DUK A;  3SHF A;  1BI2 A;  1ZAO A;  3KP5 A;  3QOP A;  4M6Y A;  1W4M A;  4NB5 A;  3JSO A;  2EB7 A;  3H3U A;  3WOD F;  3F8B A;  1BM9 A;  4KIC A;  1I6X A;  1FLI A;  4A12 A;  1RI7 A;  4RB2 C;  4HAM A;  2RVC A;  4XLN F;  2IVM A;  1O3R A;  1BIB A;  4Q47 A;  2VOO A;  4RGX A;  2DT5 A;  4YII A;  5BS6 A;  1UHW A;  1R1U A;  2EFP A;  1FBU A;  1EV7 A;  3L00 A;  1ZN2 A;  4HLY A;  2R7F A;  1W7P A;  5LHG A;  1G3W A;  3SFZ A;  3F6O A;  4PCQ A;  3F8F A;  2MLK A;  1IRG A;  4HF2 A;  4Z2Y A;  1ONV A;  1YLF A;  2ACJ A;  2FEZ A;  2RKH A;  2R7D A;  3MCZ A;  2Z33 A;  3FXU A;  1QNT A;  1B59 A;  3J81 Z;  1HSJ A;  1O57 A;  5LHH A;  2GA2 A;  1UFM A;  4RAZ A;  3T8T A;  1PP8 F;  2ETH A;  5JVT A;  3ZQ7 A;  1E17 A;  5HLI A;  1JHF A;  2YR2 A;  1A04 A;  1O7L A;  3R0A A;  4I09 A;  3GVA A;  5FFX A;  4RGR A;  3T8R A;  1J75 A;  2XAH A;  3ELK A;  4P55 A;  2PEX A;  1RUN A;  3CJN A;  2E7X A;  5D8L B;  2CFX A;  2KJC A;  2HQR A;  1PUE E;  5HVQ C;  2A6H F;  1I5Z A;  5HDG A;  4P9U A;  1G3T A;  2LF8 A;  3TO9 A;  3HRT A;  4I7H A;  3ABU A;  4L9N A;  1OR7 A;  1ZRE A;  3O2P E;  4LG0 A;  1SD5 A;  3EUH A;  3R60 A;  3C1D A;  3MWM A;  3QU3 A;  3B73 A;  1U5T C;  3IWF A;  3CO7 C;  2L01 A;  3CTA A;  2O0Y A;  2UXX A;  2IRF G;  4LB5 A;  3O6B B;  5E1X A;  5F64 A;  2BGC A;  3PQJ A;  3GO5 A;  1TQI A;  1Z6R A;  2DU9 A;  4WXD A;  2EA2 A;  2FBH A;  3LST A;  4L9T A;  3Q9V A;  1WWX A;  1R1V A;  4HDV A;  2PQ8 A;  2VBW A;  2GXG A;  1F4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...