4ASNA

Tubr from bacillus megaterium pbm400
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
b'SDYFEEVMRKLTIEDVSILGWLFQNEANAVFKAIKKSSIADELEYSTANFRKTLNKLEAIHFIGTVTGGKEHKLYLTEYGQQAVQQAIHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUBR
publication title Superstructure of the Centromeric Complex of Tubzrc Plasmid Partitioning Systems.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transcription
total genus 31
structure length 90
sequence length 90
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4asnA00
2R7DA 4BYYA 3FHZA 1LQ1A 2IP2A 2DU9A 2KJCA 3GO5A 4XLNF 2XASA 5F1RA 2BV6A 2R7FA 1TQIA 1T98A 5D4RA 3TOBA 1A04A 3HHHA 4HLYA 1J75A 5KK1A 4UUVA 2HDCA 4RAYA 3RKXA 1B59A 4OIPF 4HX7A 5AIPA 3JAMK 4P5OA 1V4RA 1ULYA 2BBYA 4WXDA 1WQ2A 3GZ6A 5AONA 1BI1A 2E1CA 1KA8A 2W84A 1J2XA 1U2WA 2CQKA 1WSUA 1JXSA 4OOIA 2XKPA 2JZYA 2O3FA 4RGRA 1OYIA 1ZLKA 3I71A 4LK0F 4HYEA 3WTVC 3ZMSA 1GHCA 1S8NA 2X4HA 4MNUA 4MTDA 5LBQA 2Z33A 1O7FA 2OU2A 3H3ZA 3C1DA 5BOXA 2MD5A 5L3GA 2R3SA 4NB5A 4MEYF 1SD4A 3ZN1A 2V6CA 2OQRA 1OR7A 2A6EF 2PMUA 2GA1A 1I5ZA 2RGVA 3FF5A 4OMYA 3MAJA 2CW0F 4U0YA 2L01A 2RNJA 4BHCA 1ZHFA 3W6KB 1QNTA 4ZH4F 3IRQA 2M5WA 4L5IA 5E8GA 2EFNA 1P92A 1ODDA 1P6RA 1R36A 5IT3A 2G7UA 5LEKA 3SQNA 5FB2A 4MQVA 2Y48A 4L9JA 3P9CA 3ABUA 5EEGA 3V7CA 1L3LA 4E70A 4L9NA 2QQ9A 3TDZC 3ABTA 5HS7A 5JI6A 3EDPA 4M6YA 2P5KA 5FFXA 3GXOA 4AWXB 1IN6A 3CLOA 2VONA 4FX0A 2L4AA 1PP7U 1TLHB 2K86A 1B9NA 2HQRA 3IKVA 4QWQA 4IXAA 2QQBA 1F5TA 1K78B 4G6DA 1W7PB 4P9FA 4OU0A 1E17A 1JHFA 2FMLA 2K4JA 5JHUA 3I54A 4I2OA 2Z99A 3M7GA 2G9WA 2Z5UA 2OA4A 2ZNYA 4Q4ZF 3J81Z 3E97A 1FYKA 3P7NA 2PJPA 2CG4A 2W24A 1XMAA 3HOSA 4DNCA 3R0JA 3EQLF 1ZGAA 4WF2A 1K78A 5JVTA 1W7PA 4CGZA 1Z1DA 5ILSA 4NHJA 4N9HA 4CO8A 4XLPF 3FZVA 2QWWA 2IJLA 1FP1D 2P6SA 1MJAA 1NHAA 3J7AO 3FXRA 3TGNA 3J80Z 2WV0A 3R6SA 1YTYA 3I4PA 1ZARA 3QRFF 3EYYA 2EFOA 4G6QA 3FM3A 2CSOA 4R1HA 4EM1A 3B02A 4UHTA 2D1VA 3V7RA 1H0MA 4RS8A 4M9XA 4XSZF 2GXGA 2V1UA 4M6XA 1I27A 3GFJA 2UZKA 2QYOA 3OV8A 3FWEA 2MC3A 3U9GA 1ZG3A 2D1HA 1LDDA 1LB2A 3BDDA 1OKRA 1ZRDA 2FE3A 3KP2A 5E1XA 3F22A 1TW2A 3Q5FA 5DEQA 3B73A 3KP6A 1Z9CA 2QUFA 4PGGA 1IXRC 5CVUA 1X3UA 1T6SA 2NS0A 5F64A 4I02A 2YX7A 4M73A 3KLOA 1P4XA 2ESNA 3KE2A 4EQQA 3REOA 2FEZA 1G3WA 3HSRA 5A2QK 1IXSB 1HXDA 2O03A 2ZMEB 4XRFA 3RPUA 2RQPA 1F9NA 4O3MA 2JPCA 1OYWA 2KIFA 5BQTA 1FY7A 2UXNA 3DV8A 1FSHA 1RNLA 3RYPA 3F3XA 3E5XA 4UXNA 1IRFA 4KUMA 2V1XA 4JK1X 1R23A 1XGNA 4M9ZA 1HW2A 3T8RA 4LG0B 3BWGA 3RYRA 1QZYA 3EYIA 1HKSA 2K02A 2EK5A 4M9SA 1HW1A 2XVCA 4XBFA 2ZMEA 4U0VA 1BI3A 2ISYA 2RN7A 4HBLA 3BPVA 5ILUA 4HDVA 4L9TA 2A61A 3ZMTA 1B1BA 4LG0A 4EM2A 1KU7A 2M1BA 2XAGA 1XCVA 4LD5A 1R5GA 5CYVA 1ON2A 5H6QA 3TQNA 2CWEA 4GO1A 4LB5A 2W85A 4HF2A 3BJOA 1SD7A 3T0YA 4ESBA 2EV0A 1G3YA 4UVCA 3RI4A 3CUQC 3L09A 1XCBA 4A6DA 1MZBA 5LRRA 3KP4A 4KYWA 2M45A 2JTVA 1YO5C 1SD6A 4L5JA 2DK8A 5F6FA 2NNNA 4ZYDA 3TOAA 1EH7A 2CGPA 1GXQA 2ZNZA 2ZBKA 2DW4A 3WU0A 2JPBA 3H3UA 2Q8KA 3WTYC 2FF4A 3ELKA 2XUBA 2A07F 3P9KA 3BP8A 3I64A 2IVMA 5ICGA 1B6AA 4O6JA 5DV5A 5LHHA 2J5PA 4HLXA 1ZAOA 1G3SA 2DTRA 5ICCA 1SFEA 4ASNA 1S6LA 1QO0D 4BNCA 2L3DA 4WXCA 2Z3YA 3V8KA 3HUGA 1BI2A 1SMTA 5ILVA 1XMKA 4IRIA 2O0YA 5E1ZB 4YFKF 4OIRF 1R00A 2F2EA 4GYIA 1MJBA 2DO7A 2M87A 3WG9A 2VC0A 4HAMA 3G3ZA 2XV4S 3KFWX 3SFZA 3HHGA 1TQMA 3ML6A 2A68F 5CLSA 1ON1A 2GAUA 2RDPA 4WX9A 2H09A 1G6NA 4U7BA 2L54A 3RKWA 2FSWA 3CDHA 1ZYRF 2BGCA 3ISPA 5KVRA 2KIMA 4RGSA 4G7OF 4ENKA 2VOPA 2D45A 3KETA 1DUXC 1AWCA 4BAYA 5JFRA 3C18A 2L4MA 2H6BA 3ZQ7A 2MLGA 4UV9A 4KMFA 2ZXJA 2XAQA 5D5XB 4OIQF 2QLZA 1USSA 5ICFA 2K7LA 3O6BB 2RV8A 4G94A 5FD6A 1ZRCA 2FBKA 1CGPA 2A3SA 2IA2A 5D5VB 5DUKA 1OMIA 3I53A 5HVQC 2XIGA 1WWXA 5H6RA 3J81K 1K79A 1EH8A 3IL2A 2P5VA 1HKTA 2Y75A 4JQFA 3QPTA 4HZFA 1Q1HA 1STZA 1U8RA 3NRVA 1BC7C 3WTSC 2VE9A 4R79A 3GX4X 2AXLA 5L3CA 5DCFA 4BHBA 1SAXA 2NRAC 1UHWA 4EJVA 1PUEE 3O2PE 5JR3A 2FBHA 2HR3A 2OD5A 2IPQX 5D6FA 2ETHA 2DBBA 1FX7A 1LEAA 2DPDA 2VT2A 2YSRA 1J9IA 1Z6RA 1UHMA 2PFBA 4MHGA 3ZMZA 3K0LA 2XAJA 3VB2A 2GA2A 4HF0A 3TO7A 5LLQA 3WE3A 1YQAA 3L7WA 1OPCA 2E1NA 3WTXC 1WI9A 5D5WB 1VTNC 5HDGA 2JRTA 4CHUA 2K4BA 4WK8F 1DP7P 1FNNA 2EB7A 3E5QA 4LJZF 4GYGA 2P4WA 3EUHA 3HSFA 2VC1A 2VE8A 3LA7A 1OYYA 3P9IA 4HW0A 2QVOA 1BOAA 3WE2A 1DDNA 3GF2A 1Y0UA 3E6CC 5FFZA 1JGSA 4IJAA 3QU6A 4LK1F 4HOBA 3TDUC 2QQAA 3VEPA 2MH2A 4H0EA 1O3RA 1QZZA 5IT9K 3I59B 1UFMA 4EV0A 2EJRA 1J59A 3G73A 3HRTA 2B0LA 5CVVA 2QZ8A 2GIVA 2PQ8A 2V9VA 2VXZA 3BPXA 3GLXA 1YIOA 3KEOA 4GGGA 2WWYA 4YFNF 1S29A 4UVAA 2QBYB 1HQCA 3KP3A 2O8XA 4OMZA 2E7WA 2STWA 2P7VB 1AOYA 1F4KA 3M9AA 5J6XA 3ZMUA 3I59A 3VODA 4ENNA 1IAWA 4M71A 2P5LC 2FNPA 4BXUA 1XGMA 4BQAA 4MQ9F 5FLXK 1FWZA 2EA4A 1RIOH 4CDGA 5CVRA 4O5VA 1LVAA 1USTA 2L02A 1PDNC 1DPUA 1G4DA 2EFQA 2JSCA 2QBYA 3TO9A 3E5UA 3CJNA 1TW3A 3RKYA 1JE8A 3C3WA 3JW4A 2EFPA 4L18B 3RJPA 3IWZA 2PI0A 1G3TA 3VFZA 2FA5A 4D0PA 3GWZA 2HZTA 3LAPA 2P7CB 5HLHA 3F8CA 4I0BA 1U78A 1E2XA 2GXBA 1UB9A 4LLLA 3CUOA 5LEJA 3LA2A 1XSDA 1LDJA 3DKWA 1RI7A 3MCZA 4AIHA 5ERIA 2HTSA 3Q9SA 1S3JA 1KU3A 4HF1A 4F7ZA 1EV7A 5K5OA 1T2KA 1LNWA 5L3BA 1XDSA 1FP2A 2XKOA 3HTUA 2EA2A 3F6VA 1KU9A 5FGMA 1R58A 1FZPB 3SHFA 2STTA 2HYFA 3QOPA 5BPIA 2PEXA 5HS9A 1ZLJA 5DDGA 2V79A 3K69A 5E18F 3F6OA 3KP5A 4KIGA 1Z6TA 4MGRA 3VOEA 1YW9A 3GUDA 4WCGA 5K5RA 3WGGA 1R1UA 2WC2A 3KLNA 2LF8A 1KQ0A 1XN7A 1REPC 1BJAA 5D4SA 2W25A 3MZYA 2Q2EA 4S04A 2HS5A 3BOQA 3F72A 1IW7F 1SFUA 3Q9VA 1T38A 4YFXF 5EEHA 3K2ZA 2DFIA 3JSPA 4YIFA 5CJ9A 3FM5A 2CO5A 4LFUA 4L0YB 1FBSA 1LDKB 1PP8F 2ESHA 4KDPA 3HOTA 2XGXA 3KCCA 4UVBA 3ZMDA 1MKMA 4U0WA 1YS7A 2VBYA 4Q48A 5FO5A 4ZYEA 2CFXA 3CO7C 4OIOF 4LLNA 2ELHA 3HRMA 5ICEA 1YYVA 2VBXA 4P96A 3GFMA 4G7HF 4B8XA 2G7HA 5E8IA 3LAJA 1S7OA 1Z7UA 5TJJA 4RB0A 3CUQB 2XAFA 1JHHA 3M8FA 1RUOA 2E7XA 2Y0MA 5D5UB 1KYWA 1BN5A 1I1SA 4RB3C 4HDUA 3V4GA 1KQ9A 3ECHA 2LF7A 3MFKA 2DAOA 4S05A 2UWMA 2DLLA 1U3EM 1R22A 4PGHA 2GZWA 2ZJ2A 2PMHA 1FLIA 2M8EA 1U5TB 1D5VA 3QU3A 4ESFA 2FXAA 1FPQA 1GXPA 3DPTA 2VBZA 1IN5A 5D8KB 3CUQA 1ZG5A 4UNOA 3OOPA 3KEQA 1IZ1A 3COAC 1IRGA 2DQRA 5LRSA 1W5TA 4L0ZB 2ZO4A 3KP7A 2OBPA 2COMA 3IHUA 2OQGA 4ON0A 3V8LA 4LGWA 2BEOA 3V7SA 3WTWC 1U5TA 2EV5A 4XSXF 3R61A 5A2QZ 5DD8A 2F5DA 5K1YA 3GFIA 1MDMB 3IRRA 3R0AA 3C7JA 1XB4A 2DK5A 1W7PD 3WTZA 5K5QA 3QP6A 4QLCU 4Q5SF 4LB6B 4A6EA 1XSVA 3LQRA 1J7KA 4RGXA 4K2EA 2A5YB 4KN7X 4WXHA 2HEOA 3T5XA 2DPUA 2PN6A 4A2UA 1YFHA 4EM0B 2ACJA 2MH9A 4OINF 1D3YA 1MDMA 2NNYA 1O3QA 3WODF 1FOKA 6PAXA 4RB2C 2BE5F 3R60A 1YLFA 5DYMA 2EFWA 2YX4A 4EVIA 3LWFA 2TDXA 2H6CA 1WRJA 5D8LB 3GYHX 2NAZA 4U7DA 4N9IA 4A0YA 3I58A 1QGPA 3FX3A 4I09A 4RGUA 1HKQA 4LMYA 4L9VA 1FYLA 3F8BA 3MQ0A 4YIIA 3R4KA 4U88A 1I1GA 3WGIA 2C6YA 3RDIA 3TO6A 1UCRA 1QQIA 1WKMA 4CICA 1C0WA 3N97A 3LSTA 3U1DA 3LA3A 1TTYA 2H94A 3E6MA 5LHIA 2WTEA 4A12A 3DFGA 1B4AA 4EGYA 3D5LA 1RZ4A 4EMSA 3K1MA 4R8HA 3WTUC 2K27A 3FMSA 3WTTC 1YG2A 5CVJA 3BZ6A 3JSOA 3RPQA 2FOKA 4KFCA 1XDUA 4Y15A 5HDNA 5H20A 3IKTA 1O7LA 4FT8A 2ZCWA 2P6TA 1I6XA 2HFHA 3J80K 4M72A 4HA8A 5HLIA 4GCVA 1KYZA 2VOOA 2MLKA 1FBQA 1T39A 4KA4A 1H9TA 1YW7A 5LGNA 4P9UA 3KZYA 1R7JA 1EH6A 2LNBA 4A5MA 3BY6A 4KIFA 2Z9OA 2VT3A 4FHTA 4IRGA 1P4AA 3IC7A 2IW5A 3PFIA 5HDKA 4IVNA 3MEXA 1J0RA 1XGOA 3E6BA 3JTGA 1O57A 3RTRA 3CO6C 4Z2YA 3BJAA 2FU4A 2HOEA 1MD0A 1V3FA 4IF4A 5FD5A 4EJOA 3DPLC 3F21A 3JAMZ 2UXXA 1MJ9A 2LKPA 4ZYGA 2HTJA 4EJWA 4KT5C 2X0LA 4P55A 2KRFA 5E1WA 3KZZA 3N4MA 5BPDA 2XROA 2ZFWA 1XGSA 1KQ8A 3I0TA 2IT0A 2OAZA 5ED4A 3WU1B 3QPHA 2FNAA 2LDUA 1L0OC 4IHTA 3L2CA 5E20A 4ENMA 1FSEA 1J5YA 2HGCA 5TRDA 4LLGF 3ZPLA 2XRNA 1GVJA 5J8CA 3L9FA 3K1NA 2W57A 4HX4A 3E6DA 4YG2F 1ONVA 2RVCA 2A69F 3T1BA 4IHSA 2J5OA 1IUYA 4PDKA 4EJUA 1IN8A 1P2FA 2ISZA 2GWRA 1LEBA 3SZPA 4ENJA 2HQNA 3CTAA 5DCMB 1IN7A 2PG4A 3MWMA 3IWFA 5CVIA 1B9MA 3F8NA 1IXCA 4FX4A 2O61A 2YU3A 2AS5F 3EETA 4AIKA 3GFLA 3ECOA 2OZUA 1SD5A 5J8FA 3GZ5A 4ETSA 3M8EA 4AVPA 4I01A 1S7AA 1FBUA 3LQQA 3F8FA 3BROA 4GXOA 4KICA 5BMZA 2V1DA 3F23A 3WGHA 1XD7A 2XAHA 5LGTA 2PLYA 4ZYHA 1HW5A 3HIFA 5DCMA 1O3SA 3HRSA 4HV5A 4UV8A 2KJBA 3QAHA 4A0ZA 3U2RA 5IT9Z 2HYGD 3ZN0A 3K9TA 5HLGA 1SFXA 4M74A 5LGUA 2QENA 4BH9A 2P8TA 4Y13A 1TBXA 2F5FA 5HS8A 1D8JA 1H9GA 1F1ZA 3BJ6A 3D0SA 3DF8A 4AIJA 2HWVA 3HRUA 3FMRA 4ESJA 1XSXA 4A0XA 1DPRA 2MA3A 3PQKA 4EGZA 4IRHA 3DXJF 4I0AA 1O3TA 4HQMA 5DUIA 2VODA 3H92A 3HSEA 5D6EA 1K6OA 4KNYA 1U6GA 3GEZA 5FLXZ 3AAFA 1YW8A 1ZREA 3T8TA 2O6GE 4DQ2A 2GQQA 1FT9A 5L3FA 5BS6A 3K1PA 3DP7A 3SZTA 2FBIA 4CZZA 1QBJA 1HSTA 2IRFG 2KIUA 1LJ9A 5HOOA 1BI0A 2FQ3A 4MEXF 4ZZDA 1W4MA 2MBFA 5L3DA 3QP5A 2JT1A 2XHKA 4KIBA 4TV7A 4G9YA 2KKOA 2H27A 4RAZA 3ROUA 3E3VA 2BYVE 2DI3A 4HQEA 2OZ6A 2M30A 1BBYA 1IF1A 2HKOA 4HX8A 5AIQA 1HBXG 5LHGA 1ZG1A 3FXQA 1K7AA 2DQLA 3SXYA 4EJTA 2VBWA 4I98B 2Q0OA 3MZHA 1Z05A 1ZN2A 3NQOA 2QM3A 1R1VA 3M1EA 4G8XA 1ZH5A 2D2WA 3FMQA 4ZZLA 2NYXA 4JBAA 2F5CA 3V8JA 4I7HA 3ERED 1KU2A 1ZGJA 1TNSA 3DEUA 2F5EA 2EWNA 3ZMVA 2CYYA 2DT5A 1IN4A 1SMYF 1QPMA 1BM9A 2YPRA 3W6JB 1FYMA 1W5SA 4G7ZF 5DD4A 3ULQB 5E17F 4NQWA 3ZP5A 1R5HA 4CYDA 2FMYA 1BC8C 4B09A 3JTHA 4BHPA 5L3EA 1U5TC 4A5NA 2LSOA 1CF7B 2ADUA 3PQJA 2VN2A 3S2WA 1P4WA 2A6HF 2EV6A 3DQVC 3RIRA 2IA0A 4CXFA 1ZRFA 4AD9A 3F8MA 3FXUA 3HYIA 3O3KA 1HSJA 2RC4A 4Q47A 3L00A 1Z91A 2HKXA 2RKHA 3HTSB 1RUNA 1TQPA 4N0BA 3NEUA 4KMUX 4WWCA 1D8KA 1T0FA 4IPAA 4PCQA 3LFKA 1MGTA 3I5UA 1CF7A 4Y17A 2PBIA 3GVAA 4KN4X 1TNTA 2YR2A 1YS6A 1R1TA 1BIBA 4HV6A 4PZJA 1KGSA 2ZKZA 2IA1A 3GW2A 4MTEA 4RB1A 3TKYA 2FRHA 1FC3A 1BIAA
chains in the Genus database with same CATH superfamily
2IS2A 2R7DA 4BYYA 2RNGA 2DA7A 3FHZA 1LQ1A 1ZQ3P 2HPMA 2IP2A 2DU9A 2KJCA 3GO5A 4W97A 1YJWI 4XLNF 1EF4A 4CSWA 2XASA 1VQMI 3GTKJ 5F1RA 2BV6A 2R7FA 4UUSB 1TQIA 1T98A 3PIOF 4XQFA 1YJ9I 5D4RA 2E34A 3TOBA 2K9QA 3HPGA 2ELKA 4E7KA 2OUMA 1A04A 2XDVA 2L0KA 3HHHA 4HLYA 1J75A 2KPMA 3GBGA 2GOXB 5EGOA 5KK1A 4UUVA 1BA5A 2R7TA 2HDCA 4XK4A 1T08B 4RAYA 3RKXA 1B59A 4OIPF 2XB0X 4HX7A 1DU6A 5AIPA 2Q1ZB 3JAMK 1ZR4A 1MBKA 4F91B 4P5OA 3BG3A 4PFPA 3WG7H 1V4RA 4C2TA 1GUUA 3KZIC 3OYMA 1K83J 2VJIA 1ULYA 2BBYA 4WXDA 3KX2A 1WQ2A 3GZ6A 5AONA 1BI1A 2E1CA 2CQNA 5EG0B 3CDIA 1KA8A 3B6CA 2W84A 1J2XA 2NS7A 1U2WA 2DMUA 2CQKA 4UUSA 5K7ZA 1WSUA 1JXSA 2M8GX 4OOIA 2XKPA 4HSTA 2JZYA 2JA7J 2O3FA 4RGRA 1TWAJ 2ID3A 4DYRA 2DXIA 1OYIA 3QQAA 1ZLKA 3I71A 4LK0F 2KRCA 4HYEA 3WTVC 3ZMSA 3HOXJ 1GHCA 4W1UA 1S8NA 4CZCA 2X4HA 4MNUA 1YIJI 4MTDA 2DT6A 3I9V2 3ZR8X 5LBQA 2Z33A 1O7FA 2OU2A 3H0GJ 3IH2A 1HLVA 1A35A 3H3ZA 3C1DA 5B5EC 5BOXA 1Y1VJ 3G4SI 3A2KA 2MD5A 1D0YA 1R6RA 4XOPA 3L1PA 5L3GA 2R3SA 4NB5A 4MEYF 4A3DJ 1SD4A 4RA2A 3W2VA 3S16J 3BR0A 3ZN1A 2V6CA 5EG0A 2OQRA 3PUFA 1OR7A 2A6EF 2PMUA 2GA1A 1I5ZA 2RGVA 3FF5A 4OMYA 3MAJA 2CW0F 3LMMA 4U0YA 2L01A 2RNJA 4H4KC 4BHCA 3RZOJ 1ZHFA 3W6KB 3C2GA 1QNTA 1WVRA 5EJCA 4E7HA 4JP0A 5GP9A 3JRCA 4ZH4F 3IRQA 2M5WA 3A4CA 1DU0A 4L5IA 5E8GA 3CCLI 2WAQN 2EFNA 1ZK8A 5F1JA 1P92A 2CW8A 5GADJ 1ODDA 1Y39A 3ZQIA 3VYUB 1SAUA 1P6RA 2FD5A 4AIDA 5KCMA 1R36A 3AL0B 2CJJA 3A1YA 2G7UA 5IT3A 2VQCA 5LEKA 4J00A 3SQNA 2L9RA 3GLLA 4AYBN 5FB2A 2X48A 3OIQA 1FOWA 4MQVA 2Y48A 5J1UA 4DZPA 4RLFA 2X9DA 2M7BA 4L9JA 3P9CA 4PJJA 3ABUA 5DS9A 5EEGA 3V7CA 2WA0A 1L3LA 4E70A 4L9NA 2QQ9A 3TDZC 3ABTA 2DOAA 5HS7A 1YX3A 5CQGA 5JI6A 3EDPA 4M6YA 1IC8A 2P5KA 3BT9A 2ICWG 3GXOA 5FFXA 1FJLA 4AWXB 1IN6A 3CLOA 4AC0A 4C3HJ 2NOGA 2VONA 2VJJA 2O5RA 1IJWC 4FX0A 2VPRA 3S1MJ 1H8AC 2L4AA 1FIAA 2AO9A 3SYTA 4BS9A 5GAHJ 1PP7U 3D5RC 2JA2A 4PSWA 1TLHB 2K86A 1XTAA 3ASNH 1B9NA 2HQRA 3IKVA 3MZ8A 4GDFA 4JX6A 1MMSA 4QWQA 4IXAA 2QQBA 1F5TA 1K78B 4G6DA 1W7PB 3FKJA 4P9FA 2WADA 4OU0A 1E17A 2HU9A 1JHFA 2FMLA 4I6ZA 4UY8I 2K4JA 2KZVA 5JHUA 3I54A 4I2OA 4XL9A 1VZ0A 2Z99A 3M7GA 5HLTA 4BE1A 2G9WA 2Z5UA 2OA4A 3CCJI 2DN0A 2ZNYA 1XG1A 2JVGA 2KL4A 5EF6A 4V2FA 3J81Z 4Q4ZF 5B3SH 4DYQA 3E97A 2IGOA 3PL8A 5K7FA 1FYKA 1UHSA 3P7NA 4FCYA 1D1BA 2PJPA 1O4XA 2CG4A 1Y8RB 2W24A 1MBGA 1XMAA 1DGRM 1OCTC 1FMWA 1S5LC 4B44A 3HOSA 3FXMA 2QEXI 4DNCA 3L2VA 4XLEA 3R0JA 3EQLF 1ZGAA 4WF2A 1K78A 5GTHC 3ONQA 5JVTA 1VQ4I 1HC8A 1W7PA 3M07A 4CGZA 1RESA 1Z1DA 5ILSA 4NHJA 1MNDA 4N9HA 4CO8A 4XLPF 3G71I 3FZVA 2QWWA 2IJLA 1FP1D 2E5NA 2P6SA 3OR2C 3HL2A 1MJAA 4RAGA 1UELB 2K40A 1NHAA 1WGXA 3J7AO 3FXRA 3TGNA 3J80Z 4ZTFA 3DTIA 2WV0A 3R6SA 1YTYA 3I4PA 1B8IA 2EIKH 2QA4I 1ZARA 3QRFF 5JLWA 3EYYA 2EFOA 1XC5A 2E2IJ 4Y52J 4G6QA 2LD5A 3FM3A 2CSOA 1ACIA 4IKFA 4R1HA 2A5WA 4EM1A 3B02A 4UHTA 2IGNA 2D1VA 3V7RA 1NG6A 1H0MA 5IYCJ 3FBNB 2IAIA 4RS8A 3DEEA 4M9XA 2PMZN 1X2NA 4XSZF 1P7JA 2GXGA 1D5YA 4RM3A 3JRHA 3OSGA 2V1UA 4M6XA 2ZSIB 1I27A 4CUGA 4QIWN 2FX0A 3GFJA 3L2WA 5B1BH 2LREA 3J7YJ 2AQEA 2UZKA 2QYOA 3OV8A 2E1MC 1UJ8A 3FISA 3FWEA 2A6TA 2ZXWH 3ZQHA 2MC3A 2Y9ZA 4E7LA 3U9GA 2O8KA 3DTEA 3J7AY 1ZG3A 2D1HA 4XLCA 3OYIA 3E1SA 1LDDA 1LB2A 3BDDA 1OKRA 2NS8A 2M0CA 1ZRDA 1P7IA 2FE3A 3KP2A 2CV0A 3HEFA 3FK7A 1V54H 3BR1A 1RKTA 3LSGA 5E1XA 2Y69H 5M5XJ 1WJFA 4BE0A 9ANTA 4I76A 3F22A 1TW2A 3Q5FA 2JN6A 5DEQA 3B73A 4Y7NJ 3KP6A 1V55H 1Z9CA 1X19A 3GTGJ 1U8BA 2K9MA 2QUFA 5EEAA 4PGGA 1Z77A 1IXRC 5CVUA 1X3UA 1T6SA 3M1CA 1FEXA 2VKDA 2NS0A 1OCOH 1NTCA 5F64A 4I02A 4XR6A 3K7AJ 4A3CJ 1ETVA 2YX7A 4BKXA 2X6OA 4M73A 3BZKA 3KLOA 1P4XA 2BXYA 5FKKA 1WJEA 2ESNA 3SFIA 2ELJA 2EZKA 1G8XA 4IOAF 3KE2A 5C4JJ 4EQQA 4BGDA 3REOA 2FEZA 1A6QA 1G3WA 1MMAA 2K3PA 3HSRA 2KQRA 2R7QA 3QYBA 3TMOA 2D5VA 5A2QK 4LOCA 1IXSB 1HXDA 1W5CC 1P9QC 2HYJA 4A69C 2O03A 4C3IJ 1WJAA 2ZMEB 4XRFA 4AYBA 4HEA2 3RPUA 2RQPA 2E19A 4LITA 3GCMA 1F9NA 5M3FJ 3CLQA 1E0EA 1W1WE 2IS6A 4O3MA 2JPCA 1OYWA 2KIFA 5BQTA 3C2HA 2XGCA 1IGNA 1FY7A 2UXNA 5J47A 5FLMJ 3DV8A 2DDAA 1FSHA 1RNLA 2LFBA 3RYPA 3F3XA 2IS4A 3E5XA 4UXNA 1IRFA 4KUMA 2V1XA 2KIQA 2OV7A 2L7FP 3PUBA 3DBHB 4JK1X 1R23A 1XGNA 4M9ZA 1HW2A 2O7OA 2MGQA 1JGGA 1U9OA 3T8RA 4LG0B 3BWGA 3RYRA 3S3MA 1QZYA 4FETA 3EYIA 1HOMA 1BR4A 1HKSA 2K02A 2XPWA 2EK5A 2LKSA 4M9SA 4YEJA 3JRAA 4J19A 1HW1A 2VPLA 2XVCA 3OYAA 4XBFA 3ZXSA 1T95A 2VUMJ 2ZMEA 1QA6A 2UV1A 3HBLA 2G0EA 1H89C 1K6YA 1JT0A 3W3CA 2BOLA 1LVKA 2CUJA 2VKVA 4MFEA 4U0VA 2LG4A 3ABKH 3GTLJ 1Y56A 2HNHA 3OL3A 3VYTB 1BI3A 3MN2A 3AG2H 2CW7A 1LE8B 3SJMA 2ISYA 2CV1A 2UUZA 2YS9A 2RN7A 4HBLA 5IP7J 4KT6A 5C3EJ 1ETXA 3BPVA 5ILUA 4HDVA 4L9TA 1VI0A 2A61A 3ZMTA 1B1BA 4LG0A 4EM2A 1KU7A 2M1BA 4XN0A 3BTIA 2X1EA 5JHFA 2XAGA 1XCVA 3IV5A 4LD5A 2JVHA 1R5GA 4XLAA 5CYVA 1ON2A 5H6QA 3DLLF 3KYCB 3TQNA 1GV5A 2CWEA 4GO1A 4LB5A 3OOUA 2W85A 1VFCA 4HF2A 3BJOA 1N75A 1SD7A 3T0YA 4ESBA 2H1KA 2EV0A 2R5ZB 1ETQA 4F52A 1G3YA 4UVCA 3RI4A 1TWFJ 3CUQC 3L09A 1XCBA 4A6DA 2DODA 1MZBA 5LRRA 3KP4A 3RCOA 4FTHA 1IRXA 4KYWA 2KHMA 2KISA 2M45A 1X4OA 2JTVA 1YO5C 5KAIC 1ITYA 3PSFA 2HXIA 3OMYA 1DQUA 1VQOI 1SD6A 4L5JA 3EUKL 3NARA 2DK8A 5F6FA 2NNNA 4ZYDA 3TOAA 3HUGB 2DYSH 1EH7A 2CGPA 1GXQA 4PJLA 1ZR2A 4ZDLA 2ZNZA 2ZBKA 2DW4A 3WU0A 3IAM2 2JPBA 3H3UA 2Q8KA 4UB8C 2I10A 3WTYC 2FF4A 3ELKA 2XUBA 5HNHA 1UG2A 1F36A 2LH9A 3NAUA 2A07F 3P9KA 2XF7A 3BP8A 2L9VA 2R7ZJ 1EJ9A 3I64A 5F27A 2IVMA 5ICGA 2YU9J 1B6AA 4O6JA 2MC4A 5DV5A 5LHHA 2HVSA 2V26A 2MYSA 3A03A 2CUFA 2J5PA 2R5ZA 1E3HA 2PMZA 3LSKA 2JUGA 2RREA 3PFYA 2H8RA 2JWTA 4HLXA 3PM1A 1ZAOA 1G3SA 1SVLA 2ZFUA 1F43A 1EKEA 2DTRA 3CJRB 5ICCA 4BXXJ 1SFEA 4IOCF 4ASNA 1LUJB 1S6LA 2TCTA 1QO0D 1BR2A 4BNCA 5HODA 2L3DA 4WXCA 1I3QJ 3K2AA 2PJRB 2Z3YA 3V8KA 3HUGA 1BI2A 1Y1WJ 5FKLA 3OYJA 1SMTA 2XAUA 2OJED 1FMVA 3OYBA 1WPKA 2R7RA 5ILVA 1XMKA 2E5ZA 3OY9A 4IRIA 2O0YA 5E1ZB 1T0FC 4YFKF 4OIRF 1R00A 4RBOA 2W82A 4ZYAA 2F2EA 4GYIA 1MJBA 2GIZA 2DO7A 2M87A 3WG9A 2VC0A 4HAMA 3G3ZA 1R4MB 2R4GA 2XV4S 3KFWX 4I99C 3HHGA 3SFZA 4A3FJ 1TQMA 3ML6A 4PUSA 2BY0A 3QPLA 2A68F 4FQGA 2W00A 2JA5J 5CLSA 1ON1A 2GAUA 2RDPA 5F0HA 4WX9A 4PJMA 3H0DA 1VQNI 2L9NA 1TP4A 2JMWA 2H09A 3JRGA 2VKEA 1G6NA 4U7BA 2KFDA 5GPCA 2K3FA 2L54A 1KZHA 1R71A 4DGWB 3K4MA 3CF2A 2GBYA 1NG7A 3LSIA 1UG0A 3SDBA 1TWCJ 3BTJA 1IUFA 3RKWA 1JT6A 3H5AA 2FSWA 3CDHA 3GTQJ 1ZYRF 4PJ0C 2DA2A 2WBMA 1T8IA 3HOUJ 4FASD 2BGCA 3ISPA 5KVRA 2HOTA 3V42A 2KIMA 1G59A 3CCYA 4RGSA 4G7OF 4ENKA 5LFAA 2VOPA 2D45A 3KETA 3L2RA 3ABLH 1X1CA 1AWCA 1DUXC 4XLFA 4AVZA 4BAYA 1AHDP 5E3MA 4IHYA 5JFRA 3DEWA 4ZDOA 3C18A 3H5NA 2L4MA 5F08A 1W36D 1MBEA 2EBIA 2H6BA 3JR9A 4A3JJ 3ZQ7A 1MMDA 3LOCA 3LNQA 2JQ7A 3S1RJ 2MLGA 1UAAA 4UV9A 2AHQA 4KMFA 4NNJA 2ZXJA 2XGEA 2XAQA 2OF7A 5D5XB 1RR8C 1SFKA 4NC6A 4OIQF 4XM3A 3HM5A 2R7OA 3OYLA 2QLZA 3A01B 2EZHA 1USSA 1YX5A 5ICFA 2LY2A 2K7LA 1FOXA 3S2DJ 3O6BB 2RV8A 4G94A 4E7ZA 5FD6A 5FKMA 2CH0A 1ZRCA 3SDGA 2FBKA 2R7XA 1CGPA 2HPIA 2A3SA 2IA2A 5D5VB 1WH5A 5DUKA 1OMIA 2DA3A 3L2UA 3RSNA 3I53A 1UMQA 5HVQC 3VPRA 2XIGA 2Z1DA 4XONA 1U0JA 1WWXA 3HGYA 3HB9A 5H6RA 1IDZA 3J81K 1K79A 1EH8A 3IL2A 2P5VA 1HKTA 1IDYA 2Y75A 4JQFA 4XNFA 3SEZA 3FBIB 3QPTA 4HZFA 2GXAA 1Q1HA 4F3QA 1STZA 1VQPI 2OCCH 1U8RA 3NRVA 1BC7C 3WTSC 2VE9A 4R79A 3CJTB 3GX4X 2AXLA 5L3CA 5DCFA 4BHBA 1SAXA 2NRAC 1UHWA 2E71A 4YRVA 4EJVA 1PUEE 3O2PE 5JR3A 2FBHA 2EINH 2HR3A 4XKWA 3S14J 5M5YJ 4BJ5C 2IXSA 2OD5A 3A01A 2IPQX 1SFOJ 5D6FA 1R4NB 2DBBA 2ETHA 5J4VA 1FX7A 1LEAA 2DPDA 4F92B 2VT2A 2DMTA 2YSRA 1OR7C 4B4CA 2JSPA 2KZGA 1J9IA 1QHGA 1Z6RA 1UHMA 2PFBA 4MHGA 1GVDA 3K10A 3ZMZA 3K0LA 2JA6J 1ENHA 2XAJA 3VB2A 2GA2A 1S72I 4HF0A 3LSPA 1E3PA 3TO7A 5LLQA 5CPRB 2CU7A 2R7VA 1WI3A 3WE3A 5FJ8J 1ETOA 1OISA 1YQAA 3L7WA 1DGWY 3H9GA 3HGGA 1OPCA 3DCFA 2QSHX 2E1NA 3G2BA 3CJQB 3WTXC 1WI9A 3MMYB 4NUBA 2QSGX 2O9LA 2RAEA 3WHCA 2A05A 5D5WB 2W1OA 1VTNC 5HDGA 2MG4A 2JRTA 4CHUA 2K4BA 4WK8F 1DP7P 1Y6IA 1FNNA 2EB7A 3DKYA 3E5QA 3OYDA 4LJZF 2VXDA 4GYGA 3ZQCA 2P4WA 3HG9A 3EUHA 3HSFA 1HCRA 3TW6A 2M4KA 2K9SA 2VC1A 2VE8A 1QZEA 1RKWA 4A93J 1VQ9I 3LA7A 1OYYA 3P9IA 4HW0A 2QVOA 1BOAA 3H9JA 2W4SA 5FKNA 4B3XA 5JVGF 3WE2A 1RR7A 1DDNA 2R7SA 3M4OJ 3FXLA 3GF2A 5F04A 2EZIA 1Y0UA 2F4MB 3E6CC 5FFZA 1JGSA 3DBLB 4BDYA 4IJAA 2BVMA 4HPQA 1G2HA 1N25A 3QU6A 1V5EA 4LK1F 4HOBA 3TDUC 2QQAA 2QGUA 3VEPA 1JKOC 2MH2A 4HNTA 2WY7Q 4H0EA 2B7EA 4HSRA 1O3RA 1SEUA 1JJ8C 1QZZA 5IT9K 3I59B 4DYCA 1LFUP 2EH3A 3ESWB 2M9HA 1UFMA 1Z67A 4EV0A 2EJRA 1J59A 3G73A 1GDTA 3I56I 1X3WB 1X2MA 3HRTA 2B0LA 4BBSJ 4JX5A 5CVVA 2QZ8A 2GIVA 4D5FA 2PQ8A 2DDBA 2V9VA 2VXZA 4J01A 3BG5A 3BPXA 3HC7A 5DM6F 3HKZA 3GLXA 1JKRC 1YIOA 3KEOA 3KIOA 4XKVA 2NVUB 4F55A 5JLXA 4GGGA 2X6XA 2DJNA 1QHHD 2H8WA 2WWYA 3I4NJ 2E60A 1POGA 3NWTA 4DJAA 4YFNF 4LIUA 1S29A 4UVAA 1OJLA 2IEKA 2QBYB 3BR6A 1HQCA 1RETA 3KP3A 1VQ7I 5GTIC 1QRYA 5J40A 2O8XA 2I5UA 4C9YA 4OMZA 2E7WA 1IV6A 1RPWA 2STWA 2P7VB 2VQLA 1AOYA 1F4KA 3M9AA 3DU5A 1K61A 5J6XA 3ZMUA 2Y30A 3HOVJ 4E6KG 3I59A 3A0HC 3VODA 4ENNA 1IAWA 4M71A 2P5LC 1YITI 2FNPA 4BXUA 5B66C 3CCVI 1XGMA 4BQAA 4MQ9F 5FLXK 4XRSG 1FWZA 2EA4A 5DTDA 1RIOH 3VWBA 4XIDA 2VI6A 4CDGA 5CVRA 4IEJA 1Z0XA 2DFFA 2XF6A 4O5VA 1LVAA 1USTA 2L02A 3VYRB 1PDNC 1DPUA 1G4DA 2EFQA 2JSCA 1RC9A 2QBYA 3TO9A 3E5UA 2QCOA 3CJNA 1TW3A 3QODA 3CCEI 2M4GA 3FDYA 5GAEJ 2I8DA 3W2WA 2HI3A 4HRIA 4U87A 3FKIJ 3RKYA 1JE8A 2Y31A 2QSFX 3C3WA 3JW4A 3KYDB 1FOYA 4G12A 2EFPA 2KMUA 2R92J 3DTKA 5FRNA 1D0XA 3RJPA 3IWZA 2PI0A 4L18B 1G3TA 3VFZA 2FA5A 4PFOA 4D0PA 3GWZA 4CYCB 2HZTA 3LAPA 4ZTJA 4A3GJ 2P7CB 3JRFA 5HLHA 3F8CA 4I0BA 1U78A 4M3DA 2GOMA 3E7LA 1TL8A 1E2XA 2GXBA 2HXOA 1UB9A 2CRGA 4LLLA 2XRLA 1FIPA 3CUOA 4BEHB 5LEJA 4MFDA 2OTJI 3LA2A 1LPQA 3QYEA 1XSDA 1LDJA 1JJ6C 3DKWA 1RI7A 3MCZA 4AIHA 1SVOA 3AKZA 2X51A 1ERDA 4CCNA 5ERIA 3F9KA 2HTSA 3Q9SA 1MMGA 3LSJA 3CMMA 1S3JA 4M3BA 2HDDA 4C30A 1XPXA 5FKOA 1KU3A 3PO2J 4HF1A 4F7ZA 1EV7A 5K5OA 1T2KA 4OWRB 1W36C 2ZC2A 3GMEA 1LNWA 1QU3A 5K7HA 2KDZA 5L3BA 1XDSA 1FP2A 1X3ZB 2XKOA 4F93B 3HTUA 1WZ2A 2Q2EB 2F4OB 4CYCA 2EA2A 3F6VA 2GM4A 1KU9A 3AFHA 5FGMA 1R58A 3KEYA 1FZPB 3SHFA 3EPZA 2LLKA 2BHYA 3PSIA 2STTA 2HYFA 3QOPA 5BPIA 1LKXA 3BCAA 4PJNA 2PEXA 4BEHA 2BHZA 5HS9A 1ZLJA 5DDGA 2V79A 1T56A 3K69A 5E18F 3F6OA 3KP5A 3CMEI 4KIGA 1Z6TA 4P1WA 1PUFB 4MGRA 1JTYA 3VOEA 1VQ5I 3UNGC 2R5YB 3OYKA 2ZJPF 1YW9A 3BTLA 3GUDA 4WCGA 5K5RA 2IBDA 2X6YA 1Q1VA 4ZJZA 3WGGA 3BR3A 1R1UA 2WC2A 4Y33A 1N78A 1SANA 1K4SA 3KLNA 2LF8A 3FIWA 4G6TB 1KQ0A 1XN7A 2VLAA 1REPC 2XSDC 1BJAA 5D4SA 2W25A 5H2FC 3MZYA 2JJ7A 2Q2EA 1YJNI 4S04A 2HS5A 5GAGJ 3BOQA 3F72A 3MD2A 4BY7J 1IW7F 1SFUA 3ZCOA 3Q9VA 2DMQA 4M3GA 1T38A 4YFXF 2EIJH 5EEHA 2NVXJ 3K2ZA 4X0GA 2DFIA 2W7NA 3JSPA 4YIFA 2E2JJ 4DBRA 5CJ9A 3U21A 1JTXA 3FM5A 2CO5A 4PK4A 3CZ6A 4LFUA 4L0YB 1PUFA 3M3YJ 5IPAA 1FBSA 2K9NA 1D0ZA 3FXKA 1LDKB 3JRIA 2R5YA 2Y0SA 1PP8F 5M3MJ 2ESHA 3S17J 1WH7A 4A3BJ 4KDPA 3HOTA 2XGXA 4IL6C 4RDUA 5IP9J 1JKPC 1FTTA 3H3VK 2Y9YA 1X4PA 3KCCA 1NK2P 1PYVA 3D5SC 4XMYA 4UVBA 3ZMDA 1MKMA 1WJBA 4U0WA 1BW6A 1YS7A 3GZNB 2VBYA 4Q48A 2L9SA 3OIPA 3CC2I 5FO5A 4IHWA 4ZYEA 3X2QH 2CFXA 3CO7C 4BDZA 2ZMEC 1V5GA 4OIOF 4HG2A 1ZTRA 4BE2A 3GTMJ 3FXOA 4LLNA 4UUTA 2ELHA 3K4KA 1BJZA 4II2A 3HRMA 5ICEA 1YYVA 3S32A 2VBXA 3U1KA 4P96A 2RQQA 3GFMA 4G7HF 4B8XA 2AXTC 2G7HA 3RKQA 2EPFA 1JI8A 5E8IA 3LAJA 1S7OA 4BU2A 1Z7UA 4KITB 5TJJA 4RB0A 4YIRX 3CUQB 2ZJRF 2XAFA 2LC2A 1JHHA 3M8FA 2R7WA 2LY1A 1RUOA 2E7XA 2Y0MA 5D5UB 1KYWA 2JRMA 1BN5A 1I1SA 1A36A 4RB3C 4HDUA 3V4GA 1KQ9A 2AQFA 2E2HJ 3ECHA 3BC8A 2LF7A 2COBA 3MFKA 4X1EA 3MKYB 3G1LA 3N05A 4CCOA 1D1AA 5DM7F 2DAOA 4S05A 1HA8A 2UWMA 2DLLA 1U3EM 1R22A 4PGHA 2GLOA 1OCPA 2GZWA 2V1NA 2ZJ2A 1BL0A 3JRBA 2PMHA 4JYKA 1FLIA 5J4YA 4ANJA 4L5EA 4IX7A 5C4XJ 2M8EA 3LSHA 2FOWA 4RM2A 1U5TB 3W2AA 4Y4RA 4IQ4A 1D5VA 3QU3A 4BJTA 4M3EA 4ESFA 2MFZA 2FXAA 1LE8A 2OCEA 1FPQA 1X1PA 1GXPA 1BR1A 2VBZA 3DPTA 3GTOJ 1IN5A 4BQOA 1IRZA 2F5VA 1JUPA 5D8KB 3CUQA 3A02A 1ZG5A 3S1NJ 4UNOA 2MW8A 3IUOA 3E0JB 1U9NA 4DW6A 1I39A 3O8GA 1A6IA 3OOPA 2H1LA 3KEQA 1IZ1A 3P5JA 4MLOA 1T33A 3EUAA 2DQRA 3I55I 3COAC 1M1EB 5LRSA 2LKXA 1IRGA 1W5TA 4CCJA 4DZJA 2DYRH 4L0ZB 2ZO4A 3KP7A 2MABA 2OBPA 2COMA 3BQZA 3IHUA 2ID6A 2OQGA 4C2MJ 1ETWA 4ON0A 1R5ID 3V8LA 4LGWA 2BEOA 3V7SA 3WTWC 2LR8A 1U5TA 1NK3P 2EV5A 2E36A 4XSXF 3R61A 3G1OA 5DD8A 5A2QZ 2F5DA 1MNEA 5K1YA 3TP0A 4ZDPA 5HNFA 4BACA 3HDDA 3GFIA 2KRHA 2B63J 1MDMB 2XF5A 3IRRA 3WU2C 3R0AA 3MVPA 3C7JA 3HKZN 2CS3A 1WJCA 1XX5A 1XB4A 5FLVA 1Z21A 1YOVB 2DK5A 3HXLA 1W7PD 3WTZA 2Z16A 5EZGA 5K5QA 2NXNB 3QP6A 4QLCU 3TEDA 2L5QA 3H5RA 4Q5SF 2L7MP 4LB6B 1AA7A 4AUXA 2HZDA 4A6EA 1XSVA 3VSKA 3LQRA 1J7KA 2QKLB 1Y8QB 4RGXA 4E7IA 4D1QA 1TT5B 2A5YB 4K2EA 4KN7X 2LP0A 4WXHA 2HEOA 1XS9A 1X1BA 2LY9A 3T5XA 2DPUA 2VKHA 2PN6A 3M8JA 4A2UA 1YFHA 4EM0B 4BL0B 2ACJA 2MSYA 2MH9A 4FE4A 4M3FA 4D9JA 1FTZA 5J1RA 4OINF 1WHUA 1XMXA 1D3YA 1NH3A 1MDMA 2PJRA 4M6VA 2NNYA 2BY3A 3WODF 1O3QA 1QPIA 1FOKA 2X1DA 6PAXA 4RB2C 1KONA 1Y0NA 2HVQA 2BE5F 3R60A 3BZCA 5FROA 4CCKA 3S3OA 1YLFA 3IAS2 3AG4H 3CF5F 5DYMA 3AG3H 2WY8Q 4C3JJ 2BVLA 2EFWA 2YX4A 2V9PA 4EVIA 3LWFA 1MH4A 1S9HA 2TDXA 2H6CA 4B1RA 1LFPA 1WRJA 4DIQA 1OFCX 5D8LB 1UZCA 3GYHX 5F0CA 2KLOA 4CH7A 4HNVA 2CV2A 2NAZA 3ABMH 4N9IA 4U7DA 5B1AH 4A0YA 3OYNA 5M5WJ 2VL8A 3I58A 1QGPA 1MW7A 3FX3A 3CMYA 3OYHA 4I09A 4RGUA 1HKQA 4LMYA 4XKCA 4ZC3A 4L9VA 3HJEA 1FYLA 3F8BA 2VB6A 3MQ0A 1OCRH 4YIIA 2BZTA 3CDLA 3R4KA 4U88A 4QSHA 1ZKGA 1I1GA 3WGIA 2C6YA 3RDIA 3TO6A 1UCRA 1QQIA 1WKMA 2XPVA 4CICA 3BG7A 1C0WA 2XSJC 3KPHA 3J7ZI 2M34A 3N97A 3LSTA 3U1DA 3LA3A 4JOMA 1TTYA 2ZB9A 4KISA 3DPUA 4BBRJ 2H94A 3S1QJ 3E6MA 5LHIA 1MSEC 2WTEA 2IGMA 4E4HA 2XC7A 4A12A 3DFGA 1B4AA 3Q3SA 4HNUA 3HPHA 4EGYA 4PSXA 3O8HA 4GFBA 3D5LA 1RZ4A 3MKWB 4EMSA 3K1MA 4R8HA 3WTUC 5E79C 2K27A 3VSLA 3FMSA 4XLHA 3WTTC 1YG2A 5CVJA 4LIVA 3HOWJ 1VQ6I 3BZ6A 3ASOH 1J09A 3JSOA 4OAYA 4DBQA 3RPUD 3RPQA 1VNDA 2FOKA 2HOSA 4KFCA 1XDUA 3LL7A 4Y15A 5HDNA 5H20A 3IKTA 1WJ5A 1O7LA 3K4LA 4FT8A 2ZCWA 3PNTA 3G1MA 3HOZJ 4MO7A 1W0TA 2DT7B 2WB1A 2P6TA 1I6XA 1I50J 2HFHA 3PNVA 3J80K 3OYCA 3ZQFA 4M72A 1IV8A 4HA8A 5J1YA 2DFHA 5HLIA 4GCVA 2L2OA 1KYZA 2VOOA 2MLKA 1FBQA 2WAEA 2VJ5A 4KA4A 1T39A 1H9TA 4XRMA 2BXZA 2X6WA 1YW7A 3S2HJ 3FK6A 5LGNA 1JUSA 3CD6I 4P9UA 3KZYA 1R7JA 1EH6A 5LD2C 4YELA 3G6EI 2LNBA 3EUHC 4A5MA 2DA6A 2ECBA 3BY6A 4KIFA 3ZRGA 4B47A 2Z9OA 3AG1H 3BLYA 2VT3A 4FHTA 2LVSA 4IRGA 1P4AA 1HDDC 2K9LA 2DA5A 3IC7A 2IW5A 3PFIA 3ZOBA 1EA3A 1N77A 5IY5H 5HDKA 3OS0A 3Q0VA 4IVNA 3MEXA 2DA1A 1J0RA 4IHVA 3FHNA 1XGOA 2Y0SN 2X1CA 1TC3C 3B6AA 3E6BA 3WHBA 3JTGA 2DOFA 5FRMA 4BY1J 4JX4A 2OTLI 2W48A 1O57A 2JK3A 3RTRA 3CO6C 4IO9F 1APLC 3OWTA 4Z2YA 2TRTA 3FXJA 1Z3YA 5E3LA 3S15J 4XORA 3CC7I 3BJAA 2EIMH 2ME6A 3AL0C 2LTPA 2FU4A 2QQ8A 2WV1A 2HOEA 1MD0A 2V9KA 1YE9A 2KP6A 1V3FA 4IF4A 2LYCA 5FD5A 4EJOA 2K5CA 3DPLC 1VQKI 3MKLA 3F21A 3JAMZ 3I4MJ 2UXXA 1MJ9A 2HQ5A 4A3MJ 2LKPA 1H88C 1PVEA 4ZYGA 2HTJA 1ORKA 4EJWA 4KT5C 5E3NA 1BIAA 2X0LA 4P55A 2KRFA 2E1OA 5E1WA 2VJ4A 3KZZA 2DOEA 3N4MA 5BPDA 2XROA 3MKZA 2ZFWA 1XGSA 1KQ8A 3I0TA 3OYFA 2IT0A 4FE7A 3S93A 2OAZA 4Y3OA 5ED4A 3OYEA 1WFXA 3WU1B 4X6AJ 3QPHA 1X1DA 2FNAA 1BOBA 2CQ7A 2LDUA 2QF7A 4IHXA 1L0OC 3BR5A 2X85A 3ZQLA 3CCQI 4IHTA 3L2CA 2M0MA 5E20A 4ENMA 1FSEA 2NVYJ 1J5YA 4LG3A 3ZGKA 1BW5A 1B8IB 2HGCA 2MD0A 2M2EA 3VDXA 5TRDA 2IS1A 3H1CA 4LLGF 1VQ8I 3ZPLA 2XRNA 1GVJA 5J8CA 3L9FA 3JRDA 3W6VA 3CP2A 3K1NA 2W57A 3LFUA 4HX4A 2EQRA 3BTCA 3E6DA 2ECCA 4YG2F 1ONVA 2RVCA 4V2GA 3K70D 2A69F 4RAFA 5C44J 3T1BA 4IHSA 2CQXA 1V5FA 2J5OA 1IUYA 4PDKA 1YRNB 4EJUA 3IH4A 3CP8A 3BQYA 1IN8A 2CQQA 1P2FA 3OYGA 2ISZA 2DTZA 2GWRA 1LEBA 4A3IJ 1R9TJ 1B72B 3SZPA 3IP4B 3CCMI 4ENJA 5IYDJ 2HQNA 3CTAA 5DCMB 4E7JA 2R7UA 3BCBA 1IN7A 2LK2A 2PG4A 3K4NA 2E1MB 3DLAA 1I6HJ 4ITVA 3MWMA 4QPOA 3F0CA 3IWFA 1OLTA 1VQLI 1CQTA 5CVIA 1B9MA 2P81A 3F8NA 1MIJA 1IXCA 4FX4A 2O61A 2JUCA 2YU3A 2AS5F 3EETA 4XN3A 4CCLA 4AIKA 3GFLA 3ECOA 3TW7A 3QYFA 2OZUA 1SD5A 2BY1A 5J8FA 3GZ5A 4ETSA 3M8EA 4AVPA 1AU7A 5EZHA 4I01A 4BUPA 1S7AA 1FBUA 3LQQA 3F8FA 3BROA 4XICA 4GXOA 1YRNA 4KICA 4OAZA 5BMZA 2V1DA 2NVTJ 3F23A 2F4IA 3WGHA 1SC7A 3PO3J 1AKHB 1Z7LA 2Y2ZA 1XD7A 1A31A 2XAHA 5LGTA 1B72A 2PLYA 4ZYHA 1HW5A 3HIFA 5DCMA 1ZGWA 2E35A 4RMNA 1O3SA 2LRDA 3HRSA 4HV5A 3GTPJ 4UV8A 3I3LA 2M7AA 1RRJA 2HDWA 2VIXA 2KJBA 1ETKA 2HOAA 2HQAA 3QAHA 3QWLA 3K6GA 4A0ZA 3LSMA 3U2RA 5IT9Z 2HYGD 5CKTA 3OR1C 3ZN0A 3K9TA 5HLGA 1SFXA 4V19K 4M74A 3PJRA 5LGUA 5BNGA 2QENA 3CCUI 4BH9A 2P8TA 1SVMA 4Y13A 1TBXA 1S7EA 2F5FA 5HS8A 3LSRA 1D8JA 1H9GA 1OQYA 3JCUC 1F1ZA 3OS2A 3BR2A 5IYBJ 1AKHA 3HOYJ 3BJ6A 3D0SA 2NOJB 4CCMA 5KAFC 2R0QC 2XB5A 2ZJQF 3DF8A 3ERMA 4AIJA 1IO2A 2HWVA 3HRUA 3FMRA 3UR3C 1XSXA 3K4JA 4A0XA 4ESJA 1X58A 3OIOA 3DU6A 2WAQA 2LBFB 1DPRA 3DKXA 1W0UA 2MA3A 2OPTA 3PQKA 4EGZA 4IRHA 3DXJF 4I0AA 2K85A 2IGKA 2LOOA 1O3TA 1WCMJ 1OCZH 5KHDA 1TWGJ 2FUG2 3H36A 4HQMA 4E7SA 5DUIA 5KNLA 4C2UA 2VODA 1MMNA 3H92A 3HSEA 5D6EA 2CMPA 4BQNA 4Z6YA 3CCRI 1K6OA 1HF0A 1PJRA 1U6GA 2DMPA 4KNYA 3GEZA 5FLXZ 3AAFA 1YW8A 1ZREA 1MBHA 3QOEA 3T8TA 2O6GE 4DQ2A 3SZGA 2GQQA 1FT9A 4XKBA 4DOZA 5L3FA 4NDLA 5BS6A 3K1PA 3DBRB 1TWHJ 3DP7A 1GV2A 1MBJA 2VQHA 3SZTA 2EZLA 2FBIA 2DCEA 3DWLE 4CZZA 4GRIA 1HSTA 1QBJA 2IRFG 2KIUA 4XRSA 2P0WA 5TISC 3ZQGA 1LJ9A 5HOOA 1D1CA 4S0HB 1BI0A 2L7ZA 2FQ3A 4MEXF 2VQGA 4ZZDA 1W4MA 2V6EA 1Z3XA 2CUZA 2MBFA 5L3DA 3QP5A 2LBFA 2JT1A 1R49A 2XHKA 4KIBA 4D5CA 2ZXHA 4TV7A 1TZLA 4ABZA 1A5JA 4G9YA 2KKOA 2H27A 2DMNA 4RAZA 3ROUA 3H35A 3E3VA 3L2QA 2BYVE 2M3AA 4EEFG 3RQIA 2DI3A 4HQEA 2VASA 2OZ6A 4B43A 3TP3A 2M30A 1BBYA 1IF1A 4NBQA 3D1NI 2HKOA 4HX8A 2V4JC 1YI2I 4KJZA 5AIQA 1HBXG 5LHGA 1ZG1A 1K4TA 3K4BA 3FXQA 4NQWB 1K7AA 2DQLA 3SXYA 4EJTA 2VBWA 2R93J 4I98B 2WB1N 2Q0OA 3MZHA 1JUMA 4BJ6C 2B9SA 1Z05A 1ZN2A 3NQOA 2QM3A 4A3EJ 3OSFA 2BW3B 1HDPA 1R1VA 3M1EA 3PNYA 4G8XA 1ZH5A 2D2WA 3FMQA 4ZZLA 2NYXA 4JBAA 2F5CA 2BY2A 3NWSA 3V8JA 4I7HA 2DFEA 3ERED 1X1AA 1KU2A 1ZGJA 3C2BA 3JREA 1TNSA 1TT0A 3DEUA 1E3OC 2F5EA 1VF9A 1WJDA 2EWNA 3ZMVA 2WAFA 2XPUA 2PX9A 4MIMA 2CYYA 2DT5A 4NC8A 1IN4A 5EDNA 1SMYF 1QPMA 1BM9A 3GTJJ 3K4CA 3VYSB 2YPRA 3W6JB 4RLQA 1FYMA 1W5SA 4G7ZF 5DD4A 1DP3A 3CMAI 3ULQB 3S8PA 2EILH 5E17F 3ZQQA 4NQWA 2KT0A 1I3AA 2CFOA 4IZZA 3ZP5A 1R5HA 4CYDA 4A3KJ 2FMYA 4N4OB 2V7FA 4N4NB 3OS1A 2FQ4A 1BC8C 4B09A 2ZXIA 2BW3A 3JTHA 4AM3A 2DA4A 4BHPA 4CA0A 5L3EA 2LMDA 2ME0A 4D7NA 1U5TC 4A5NA 2LSOA 2Z2SB 1CF7B 3BG9A 5IP6A 2ADUA 1QVTA 3PQJA 3PIPF 2YUSA 3K70C 4QTRA 1JKQC 2VN2A 3S2WA 1P4WA 1ZELA 2A6HF 4EATA 2EV6A 3DQVC 3Q0WA 3RIRA 3BG6A 2IA0A 4CXFA 1ZRFA 5J3LA 2ZSHB 4AD9A 3S3NA 3F8MA 4BQQA 2KDOA 2OC6A 3FXUA 3HYIA 3O3KA 3RQ4A 5TGTA 3HZJA 4B48A 1HSJA 1MBFA 1GT0C 5CQEA 2RC4A 4IQJA 4Q47A 3CESA 1LFBA 1ETYA 3L00A 1Z91A 2HKXA 2RKHA 3CCSI 3HTSB 1RUNA 1TQPA 2DJIA 4N0BA 3NEUA 1OCCH 1GLNA 4NC7A 2L7KA 2QKMB 4B3AA 1MH3A 4KMUX 4WWCA 1D8KA 3IH3A 4FISA 3SEQA 1T0FA 4IPAA 4D7MA 4PCQA 4BXFA 5E3OA 3UKGA 1MSFC 5IOYA 4QPQA 3A0BC 3LFKA 3OL4A 3QPSA 1MGTA 3RZDJ 5EYRA 3CQZJ 3I5UA 1CF7A 2HVRA 3H9QA 2NVQJ 1YHQI 2JA8J 2CUEA 4Y17A 5GPAA 2FJ1A 2PBIA 1MNMC 5EGOB 3GVAA 3Q0UA 4II3A 4KN4X 5F0FA 3TBIA 1TNTA 2F48A 1IG7A 3KYLA 4XOTA 2YR2A 1YS6A 2F6CA 4A3LJ 1R1TA 3TL4X 1BIBA 4HV6A 4PZJA 1KGSA 2ZKZA 5IOZA 2IA1A 2N8GA 4UB6C 3GW2A 4MTEA 4RB1A 3TKYA 4AU7A 2FRHA 1FC3A 2XGDA 1QVUA 3CC4I
chains in the Genus database with same CATH topology
2R7DA 4BYYA 3FHZA 1LQ1A 2IP2A 2DU9A 2KJCA 3GO5A 4XLNF 2XASA 5F1RA 2BV6A 2R7FA 1TQIA 1T98A 5D4RA 3TOBA 1A04A 3HHHA 4HLYA 1J75A 5KK1A 4UUVA 2HDCA 4RAYA 3RKXA 1B59A 4OIPF 4HX7A 5AIPA 3JAMK 4P5OA 1V4RA 1ULYA 2BBYA 4WXDA 1WQ2A 3GZ6A 5AONA 1BI1A 2E1CA 1KA8A 2W84A 1J2XA 1U2WA 2CQKA 1WSUA 1JXSA 4OOIA 2XKPA 2JZYA 2O3FA 4RGRA 1OYIA 1ZLKA 3I71A 4LK0F 4HYEA 3WTVC 3ZMSA 1GHCA 1S8NA 2X4HA 4MNUA 4MTDA 5LBQA 2Z33A 1O7FA 2OU2A 3H3ZA 3C1DA 5BOXA 2MD5A 5L3GA 2R3SA 4NB5A 4MEYF 1SD4A 3ZN1A 2V6CA 2OQRA 1OR7A 2A6EF 2PMUA 2GA1A 1I5ZA 2RGVA 3FF5A 4OMYA 3MAJA 2CW0F 4U0YA 2L01A 2RNJA 4BHCA 1ZHFA 3W6KB 1QNTA 4ZH4F 3IRQA 2M5WA 4L5IA 5E8GA 2EFNA 1P92A 1ODDA 1P6RA 1R36A 5IT3A 2G7UA 5LEKA 3SQNA 5FB2A 4MQVA 2Y48A 4L9JA 3P9CA 3ABUA 5EEGA 3V7CA 1L3LA 4E70A 4L9NA 2QQ9A 3TDZC 3ABTA 5HS7A 5JI6A 3EDPA 4M6YA 2P5KA 5FFXA 3GXOA 4AWXB 1IN6A 3CLOA 2VONA 4FX0A 2L4AA 1PP7U 1TLHB 2K86A 1B9NA 2HQRA 3IKVA 4QWQA 4IXAA 2QQBA 1F5TA 1K78B 4G6DA 1W7PB 4P9FA 4OU0A 1E17A 1JHFA 2FMLA 2K4JA 5JHUA 3I54A 4I2OA 2Z99A 3M7GA 2G9WA 2Z5UA 2OA4A 2ZNYA 4Q4ZF 3J81Z 3E97A 1FYKA 3P7NA 2PJPA 2CG4A 2W24A 1XMAA 3HOSA 4DNCA 3R0JA 3EQLF 1ZGAA 4WF2A 1K78A 5JVTA 1W7PA 4CGZA 1Z1DA 5ILSA 4NHJA 4N9HA 4CO8A 4XLPF 3FZVA 2QWWA 2IJLA 1FP1D 2P6SA 1MJAA 1NHAA 3J7AO 3FXRA 3TGNA 3J80Z 2WV0A 3R6SA 1YTYA 3I4PA 1ZARA 3QRFF 3EYYA 2EFOA 4G6QA 3FM3A 2CSOA 4R1HA 4EM1A 3B02A 4UHTA 2D1VA 3V7RA 1H0MA 4RS8A 4M9XA 4XSZF 2GXGA 2V1UA 4M6XA 1I27A 3GFJA 2UZKA 2QYOA 3OV8A 3FWEA 2MC3A 3U9GA 1ZG3A 2D1HA 1LDDA 1LB2A 3BDDA 1OKRA 1ZRDA 2FE3A 3KP2A 5E1XA 3F22A 1TW2A 3Q5FA 5DEQA 3B73A 3KP6A 1Z9CA 2QUFA 4PGGA 1IXRC 5CVUA 1X3UA 1T6SA 2NS0A 5F64A 4I02A 2YX7A 4M73A 3KLOA 1P4XA 2ESNA 3KE2A 4EQQA 3REOA 2FEZA 1G3WA 3HSRA 5A2QK 1IXSB 1HXDA 2O03A 2ZMEB 4XRFA 3RPUA 2RQPA 1F9NA 4O3MA 2JPCA 1OYWA 2KIFA 5BQTA 1FY7A 2UXNA 3DV8A 1FSHA 1RNLA 3RYPA 3F3XA 3E5XA 4UXNA 1IRFA 4KUMA 2V1XA 4JK1X 1R23A 1XGNA 4M9ZA 1HW2A 3T8RA 4LG0B 3BWGA 3RYRA 1QZYA 3EYIA 1HKSA 2K02A 2EK5A 4M9SA 1HW1A 2XVCA 4XBFA 2ZMEA 4U0VA 1BI3A 2ISYA 2RN7A 4HBLA 3BPVA 5ILUA 4HDVA 4L9TA 2A61A 3ZMTA 1B1BA 4LG0A 4EM2A 1KU7A 2M1BA 2XAGA 1XCVA 4LD5A 1R5GA 5CYVA 1ON2A 5H6QA 3TQNA 2CWEA 4GO1A 4LB5A 2W85A 4HF2A 3BJOA 1SD7A 3T0YA 4ESBA 2EV0A 1G3YA 4UVCA 3RI4A 3CUQC 3L09A 1XCBA 4A6DA 1MZBA 5LRRA 3KP4A 4KYWA 2M45A 2JTVA 1YO5C 1SD6A 4L5JA 2DK8A 5F6FA 2NNNA 4ZYDA 3TOAA 1EH7A 2CGPA 1GXQA 2ZNZA 2ZBKA 2DW4A 3WU0A 2JPBA 3H3UA 2Q8KA 3WTYC 2FF4A 3ELKA 2XUBA 2A07F 3P9KA 3BP8A 3I64A 2IVMA 5ICGA 1B6AA 4O6JA 5DV5A 5LHHA 2J5PA 4HLXA 1ZAOA 1G3SA 2DTRA 5ICCA 1SFEA 4ASNA 1S6LA 1QO0D 4BNCA 2L3DA 4WXCA 2Z3YA 3V8KA 3HUGA 1BI2A 1SMTA 5ILVA 1XMKA 4IRIA 2O0YA 5E1ZB 4YFKF 4OIRF 1R00A 2F2EA 4GYIA 1MJBA 2DO7A 2M87A 3WG9A 2VC0A 4HAMA 3G3ZA 2XV4S 3KFWX 3SFZA 3HHGA 1TQMA 3ML6A 2A68F 5CLSA 1ON1A 2GAUA 2RDPA 4WX9A 2H09A 1G6NA 4U7BA 2L54A 3RKWA 2FSWA 3CDHA 1ZYRF 2BGCA 3ISPA 5KVRA 2KIMA 4RGSA 4G7OF 4ENKA 2VOPA 2D45A 3KETA 1DUXC 1AWCA 4BAYA 5JFRA 3C18A 2L4MA 2H6BA 3ZQ7A 2MLGA 4UV9A 4KMFA 2ZXJA 2XAQA 5D5XB 4OIQF 2QLZA 1USSA 5ICFA 2K7LA 3O6BB 2RV8A 4G94A 5FD6A 1ZRCA 2FBKA 1CGPA 2A3SA 2IA2A 5D5VB 5DUKA 1OMIA 3I53A 5HVQC 2XIGA 1WWXA 5H6RA 3J81K 1K79A 1EH8A 3IL2A 2P5VA 1HKTA 2Y75A 4JQFA 3QPTA 4HZFA 1Q1HA 1STZA 1U8RA 3NRVA 1BC7C 3WTSC 2VE9A 4R79A 3GX4X 2AXLA 5L3CA 5DCFA 4BHBA 1SAXA 2NRAC 1UHWA 4EJVA 1PUEE 3O2PE 5JR3A 2FBHA 2HR3A 2OD5A 2IPQX 5D6FA 2ETHA 2DBBA 1FX7A 1LEAA 2DPDA 2VT2A 2YSRA 1J9IA 1Z6RA 1UHMA 2PFBA 4MHGA 3ZMZA 3K0LA 2XAJA 3VB2A 2GA2A 4HF0A 3TO7A 5LLQA 3WE3A 1YQAA 3L7WA 1OPCA 2E1NA 3WTXC 1WI9A 5D5WB 1VTNC 5HDGA 2JRTA 4CHUA 2K4BA 4WK8F 1DP7P 1FNNA 2EB7A 3E5QA 4LJZF 4GYGA 2P4WA 3EUHA 3HSFA 2VC1A 2VE8A 3LA7A 1OYYA 3P9IA 4HW0A 2QVOA 1BOAA 3WE2A 1DDNA 3GF2A 1Y0UA 3E6CC 5FFZA 1JGSA 4IJAA 3QU6A 4LK1F 4HOBA 3TDUC 2QQAA 3VEPA 2MH2A 4H0EA 1O3RA 1QZZA 5IT9K 3I59B 1UFMA 4EV0A 2EJRA 1J59A 3G73A 3HRTA 2B0LA 5CVVA 2QZ8A 2GIVA 2PQ8A 2V9VA 2VXZA 3BPXA 3GLXA 1YIOA 3KEOA 4GGGA 2WWYA 4YFNF 1S29A 4UVAA 2QBYB 1HQCA 3KP3A 2O8XA 4OMZA 2E7WA 2STWA 2P7VB 1AOYA 1F4KA 3M9AA 5J6XA 3ZMUA 3I59A 3VODA 4ENNA 1IAWA 4M71A 2P5LC 2FNPA 4BXUA 1XGMA 4BQAA 4MQ9F 5FLXK 1FWZA 2EA4A 1RIOH 4CDGA 5CVRA 4O5VA 1LVAA 1USTA 2L02A 1PDNC 1DPUA 1G4DA 2EFQA 2JSCA 2QBYA 3TO9A 3E5UA 3CJNA 1TW3A 3RKYA 1JE8A 3C3WA 3JW4A 2EFPA 4L18B 3RJPA 3IWZA 2PI0A 1G3TA 3VFZA 2FA5A 4D0PA 3GWZA 2HZTA 3LAPA 2P7CB 5HLHA 3F8CA 4I0BA 1U78A 1E2XA 2GXBA 1UB9A 4LLLA 3CUOA 5LEJA 3LA2A 1XSDA 1LDJA 3DKWA 1RI7A 3MCZA 4AIHA 5ERIA 2HTSA 3Q9SA 1S3JA 1KU3A 4HF1A 4F7ZA 1EV7A 5K5OA 1T2KA 1LNWA 5L3BA 1XDSA 1FP2A 2XKOA 3HTUA 2EA2A 3F6VA 1KU9A 5FGMA 1R58A 1FZPB 3SHFA 2STTA 2HYFA 3QOPA 5BPIA 2PEXA 5HS9A 1ZLJA 5DDGA 2V79A 3K69A 5E18F 3F6OA 3KP5A 4KIGA 1Z6TA 4MGRA 3VOEA 1YW9A 3GUDA 4WCGA 5K5RA 3WGGA 1R1UA 2WC2A 3KLNA 2LF8A 1KQ0A 1XN7A 1REPC 1BJAA 5D4SA 2W25A 3MZYA 2Q2EA 4S04A 2HS5A 3BOQA 3F72A 1IW7F 1SFUA 3Q9VA 1T38A 4YFXF 5EEHA 3K2ZA 2DFIA 3JSPA 4YIFA 5CJ9A 3FM5A 2CO5A 4LFUA 4L0YB 1FBSA 1LDKB 1PP8F 2ESHA 4KDPA 3HOTA 2XGXA 3KCCA 4UVBA 3ZMDA 1MKMA 4U0WA 1YS7A 2VBYA 4Q48A 5FO5A 4ZYEA 2CFXA 3CO7C 4OIOF 4LLNA 2ELHA 3HRMA 5ICEA 1YYVA 2VBXA 4P96A 3GFMA 4G7HF 4B8XA 2G7HA 5E8IA 3LAJA 1S7OA 1Z7UA 5TJJA 4RB0A 3CUQB 2XAFA 1JHHA 3M8FA 1RUOA 2E7XA 2Y0MA 5D5UB 1KYWA 1BN5A 1I1SA 4RB3C 4HDUA 3V4GA 1KQ9A 3ECHA 2LF7A 3MFKA 2DAOA 4S05A 2UWMA 2DLLA 1U3EM 1R22A 4PGHA 2GZWA 2ZJ2A 2PMHA 1FLIA 2M8EA 1U5TB 1D5VA 3QU3A 4ESFA 2FXAA 1FPQA 1GXPA 3DPTA 2VBZA 1IN5A 5D8KB 3CUQA 1ZG5A 4UNOA 3OOPA 3KEQA 1IZ1A 3COAC 1IRGA 2DQRA 5LRSA 1W5TA 4L0ZB 2ZO4A 3KP7A 2OBPA 2COMA 3IHUA 2OQGA 4ON0A 3V8LA 4LGWA 2BEOA 3V7SA 3WTWC 1U5TA 2EV5A 4XSXF 3R61A 5A2QZ 5DD8A 2F5DA 5K1YA 3GFIA 1MDMB 3IRRA 3R0AA 3C7JA 1XB4A 2DK5A 1W7PD 3WTZA 5K5QA 3QP6A 4QLCU 4Q5SF 4LB6B 4A6EA 1XSVA 3LQRA 1J7KA 4RGXA 4K2EA 2A5YB 4KN7X 4WXHA 2HEOA 3T5XA 2DPUA 2PN6A 4A2UA 1YFHA 4EM0B 2ACJA 2MH9A 4OINF 1D3YA 1MDMA 2NNYA 1O3QA 3WODF 1FOKA 6PAXA 4RB2C 2BE5F 3R60A 1YLFA 5DYMA 2EFWA 2YX4A 4EVIA 3LWFA 2TDXA 2H6CA 1WRJA 5D8LB 3GYHX 2NAZA 4U7DA 4N9IA 4A0YA 3I58A 1QGPA 3FX3A 4I09A 4RGUA 1HKQA 4LMYA 4L9VA 1FYLA 3F8BA 3MQ0A 4YIIA 3R4KA 4U88A 1I1GA 3WGIA 2C6YA 3RDIA 3TO6A 1UCRA 1QQIA 1WKMA 4CICA 1C0WA 3N97A 3LSTA 3U1DA 3LA3A 1TTYA 2H94A 3E6MA 5LHIA 2WTEA 4A12A 3DFGA 1B4AA 4EGYA 3D5LA 1RZ4A 4EMSA 3K1MA 4R8HA 3WTUC 2K27A 3FMSA 3WTTC 1YG2A 5CVJA 3BZ6A 3JSOA 3RPQA 2FOKA 4KFCA 1XDUA 4Y15A 5HDNA 5H20A 3IKTA 1O7LA 4FT8A 2ZCWA 2P6TA 1I6XA 2HFHA 3J80K 4M72A 4HA8A 5HLIA 4GCVA 1KYZA 2VOOA 2MLKA 1FBQA 1T39A 4KA4A 1H9TA 1YW7A 5LGNA 4P9UA 3KZYA 1R7JA 1EH6A 2LNBA 4A5MA 3BY6A 4KIFA 2Z9OA 2VT3A 4FHTA 4IRGA 1P4AA 3IC7A 2IW5A 3PFIA 5HDKA 4IVNA 3MEXA 1J0RA 1XGOA 3E6BA 3JTGA 1O57A 3RTRA 3CO6C 4Z2YA 3BJAA 2FU4A 2HOEA 1MD0A 1V3FA 4IF4A 5FD5A 4EJOA 3DPLC 3F21A 3JAMZ 2UXXA 1MJ9A 2LKPA 4ZYGA 2HTJA 4EJWA 4KT5C 2X0LA 4P55A 2KRFA 5E1WA 3KZZA 3N4MA 5BPDA 2XROA 2ZFWA 1XGSA 1KQ8A 3I0TA 2IT0A 2OAZA 5ED4A 3WU1B 3QPHA 2FNAA 2LDUA 1L0OC 4IHTA 3L2CA 5E20A 4ENMA 1FSEA 1J5YA 2HGCA 5TRDA 4LLGF 3ZPLA 2XRNA 1GVJA 5J8CA 3L9FA 3K1NA 2W57A 4HX4A 3E6DA 4YG2F 1ONVA 2RVCA 2A69F 3T1BA 4IHSA 2J5OA 1IUYA 4PDKA 4EJUA 1IN8A 1P2FA 2ISZA 2GWRA 1LEBA 3SZPA 4ENJA 2HQNA 3CTAA 5DCMB 1IN7A 2PG4A 3MWMA 3IWFA 5CVIA 1B9MA 3F8NA 1IXCA 4FX4A 2O61A 2YU3A 2AS5F 3EETA 4AIKA 3GFLA 3ECOA 2OZUA 1SD5A 5J8FA 3GZ5A 4ETSA 3M8EA 4AVPA 4I01A 1S7AA 1FBUA 3LQQA 3F8FA 3BROA 4GXOA 4KICA 5BMZA 2V1DA 3F23A 3WGHA 1XD7A 2XAHA 5LGTA 2PLYA 4ZYHA 1HW5A 3HIFA 5DCMA 1O3SA 3HRSA 4HV5A 4UV8A 2KJBA 3QAHA 4A0ZA 3U2RA 5IT9Z 2HYGD 3ZN0A 3K9TA 5HLGA 1SFXA 4M74A 5LGUA 2QENA 4BH9A 2P8TA 4Y13A 1TBXA 2F5FA 5HS8A 1D8JA 1H9GA 1F1ZA 3BJ6A 3D0SA 3DF8A 4AIJA 2HWVA 3HRUA 3FMRA 4ESJA 1XSXA 4A0XA 1DPRA 2MA3A 3PQKA 4EGZA 4IRHA 3DXJF 4I0AA 1O3TA 4HQMA 5DUIA 2VODA 3H92A 3HSEA 5D6EA 1K6OA 4KNYA 1U6GA 3GEZA 5FLXZ 3AAFA 1YW8A 1ZREA 3T8TA 2O6GE 4DQ2A 2GQQA 1FT9A 5L3FA 5BS6A 3K1PA 3DP7A 3SZTA 2FBIA 4CZZA 1QBJA 1HSTA 2IRFG 2KIUA 1LJ9A 5HOOA 1BI0A 2FQ3A 4MEXF 4ZZDA 1W4MA 2MBFA 5L3DA 3QP5A 2JT1A 2XHKA 4KIBA 4TV7A 4G9YA 2KKOA 2H27A 4RAZA 3ROUA 3E3VA 2BYVE 2DI3A 4HQEA 2OZ6A 2M30A 1BBYA 1IF1A 2HKOA 4HX8A 5AIQA 1HBXG 5LHGA 1ZG1A 3FXQA 1K7AA 2DQLA 3SXYA 4EJTA 2VBWA 4I98B 2Q0OA 3MZHA 1Z05A 1ZN2A 3NQOA 2QM3A 1R1VA 3M1EA 4G8XA 1ZH5A 2D2WA 3FMQA 4ZZLA 2NYXA 4JBAA 2F5CA 3V8JA 4I7HA 3ERED 1KU2A 1ZGJA 1TNSA 3DEUA 2F5EA 2EWNA 3ZMVA 2CYYA 2DT5A 1IN4A 1SMYF 1QPMA 1BM9A 2YPRA 3W6JB 1FYMA 1W5SA 4G7ZF 5DD4A 3ULQB 5E17F 4NQWA 3ZP5A 1R5HA 4CYDA 2FMYA 1BC8C 4B09A 3JTHA 4BHPA 5L3EA 1U5TC 4A5NA 2LSOA 1CF7B 2ADUA 3PQJA 2VN2A 3S2WA 1P4WA 2A6HF 2EV6A 3DQVC 3RIRA 2IA0A 4CXFA 1ZRFA 4AD9A 3F8MA 3FXUA 3HYIA 3O3KA 1HSJA 2RC4A 4Q47A 3L00A 1Z91A 2HKXA 2RKHA 3HTSB 1RUNA 1TQPA 4N0BA 3NEUA 4KMUX 4WWCA 1D8KA 1T0FA 4IPAA 4PCQA 3LFKA 1MGTA 3I5UA 1CF7A 4Y17A 2PBIA 3GVAA 4KN4X 1TNTA 2YR2A 1YS6A 1R1TA 1BIBA 4HV6A 4PZJA 1KGSA 2ZKZA 2IA1A 3GW2A 4MTEA 4RB1A 3TKYA 2FRHA 1FC3A 1BIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7D A;  4BYY A;  3FHZ A;  1LQ1 A;  2IP2 A;  2DU9 A;  2KJC A;  3GO5 A;  4XLN F;  2XAS A;  5F1R A;  2BV6 A;  2R7F A;  1TQI A;  1T98 A;  5D4R A;  3TOB A;  1A04 A;  3HHH A;  4HLY A;  1J75 A;  5KK1 A;  4UUV A;  2HDC A;  4RAY A;  3RKX A;  1B59 A;  4OIP F;  4HX7 A;  5AIP A;  3JAM K;  4P5O A;  1V4R A;  1ULY A;  2BBY A;  4WXD A;  1WQ2 A;  3GZ6 A;  5AON A;  1BI1 A;  2E1C A;  1KA8 A;  2W84 A;  1J2X A;  1U2W A;  2CQK A;  1WSU A;  1JXS A;  4OOI A;  2XKP A;  2JZY A;  2O3F A;  4RGR A;  1OYI A;  1ZLK A;  3I71 A;  4LK0 F;  4HYE A;  3WTV C;  3ZMS A;  1GHC A;  1S8N A;  2X4H A;  4MNU A;  4MTD A;  5LBQ A;  2Z33 A;  1O7F A;  2OU2 A;  3H3Z A;  3C1D A;  5BOX A;  2MD5 A;  5L3G A;  2R3S A;  4NB5 A;  4MEY F;  1SD4 A;  3ZN1 A;  2V6C A;  2OQR A;  1OR7 A;  2A6E F;  2PMU A;  2GA1 A;  1I5Z A;  2RGV A;  3FF5 A;  4OMY A;  3MAJ A;  2CW0 F;  4U0Y A;  2L01 A;  2RNJ A;  4BHC A;  1ZHF A;  3W6K B;  1QNT A;  4ZH4 F;  3IRQ A;  2M5W A;  4L5I A;  5E8G A;  2EFN A;  1P92 A;  1ODD A;  1P6R A;  1R36 A;  5IT3 A;  2G7U A;  5LEK A;  3SQN A;  5FB2 A;  4MQV A;  2Y48 A;  4L9J A;  3P9C A;  3ABU A;  5EEG A;  3V7C A;  1L3L A;  4E70 A;  4L9N A;  2QQ9 A;  3TDZ C;  3ABT A;  5HS7 A;  5JI6 A;  3EDP A;  4M6Y A;  2P5K A;  5FFX A;  3GXO A;  4AWX B;  1IN6 A;  3CLO A;  2VON A;  4FX0 A;  2L4A A;  1PP7 U;  1TLH B;  2K86 A;  1B9N A;  2HQR A;  3IKV A;  4QWQ A;  4IXA A;  2QQB A;  1F5T A;  1K78 B;  4G6D A;  1W7P B;  4P9F A;  4OU0 A;  1E17 A;  1JHF A;  2FML A;  2K4J A;  5JHU A;  3I54 A;  4I2O A;  2Z99 A;  3M7G A;  2G9W A;  2Z5U A;  2OA4 A;  2ZNY A;  4Q4Z F;  3J81 Z;  3E97 A;  1FYK A;  3P7N A;  2PJP A;  2CG4 A;  2W24 A;  1XMA A;  3HOS A;  4DNC A;  3R0J A;  3EQL F;  1ZGA A;  4WF2 A;  1K78 A;  5JVT A;  1W7P A;  4CGZ A;  1Z1D A;  5ILS A;  4NHJ A;  4N9H A;  4CO8 A;  4XLP F;  3FZV A;  2QWW A;  2IJL A;  1FP1 D;  2P6S A;  1MJA A;  1NHA A;  3J7A O;  3FXR A;  3TGN A;  3J80 Z;  2WV0 A;  3R6S A;  1YTY A;  3I4P A;  1ZAR A;  3QRF F;  3EYY A;  2EFO A;  4G6Q A;  3FM3 A;  2CSO A;  4R1H A;  4EM1 A;  3B02 A;  4UHT A;  2D1V A;  3V7R A;  1H0M A;  4RS8 A;  4M9X A;  4XSZ F;  2GXG A;  2V1U A;  4M6X A;  1I27 A;  3GFJ A;  2UZK A;  2QYO A;  3OV8 A;  3FWE A;  2MC3 A;  3U9G A;  1ZG3 A;  2D1H A;  1LDD A;  1LB2 A;  3BDD A;  1OKR A;  1ZRD A;  2FE3 A;  3KP2 A;  5E1X A;  3F22 A;  1TW2 A;  3Q5F A;  5DEQ A;  3B73 A;  3KP6 A;  1Z9C A;  2QUF A;  4PGG A;  1IXR C;  5CVU A;  1X3U A;  1T6S A;  2NS0 A;  5F64 A;  4I02 A;  2YX7 A;  4M73 A;  3KLO A;  1P4X A;  2ESN A;  3KE2 A;  4EQQ A;  3REO A;  2FEZ A;  1G3W A;  3HSR A;  5A2Q K;  1IXS B;  1HXD A;  2O03 A;  2ZME B;  4XRF A;  3RPU A;  2RQP A;  1F9N A;  4O3M A;  2JPC A;  1OYW A;  2KIF A;  5BQT A;  1FY7 A;  2UXN A;  3DV8 A;  1FSH A;  1RNL A;  3RYP A;  3F3X A;  3E5X A;  4UXN A;  1IRF A;  4KUM A;  2V1X A;  4JK1 X;  1R23 A;  1XGN A;  4M9Z A;  1HW2 A;  3T8R A;  4LG0 B;  3BWG A;  3RYR A;  1QZY A;  3EYI A;  1HKS A;  2K02 A;  2EK5 A;  4M9S A;  1HW1 A;  2XVC A;  4XBF A;  2ZME A;  4U0V A;  1BI3 A;  2ISY A;  2RN7 A;  4HBL A;  3BPV A;  5ILU A;  4HDV A;  4L9T A;  2A61 A;  3ZMT A;  1B1B A;  4LG0 A;  4EM2 A;  1KU7 A;  2M1B A;  2XAG A;  1XCV A;  4LD5 A;  1R5G A;  5CYV A;  1ON2 A;  5H6Q A;  3TQN A;  2CWE A;  4GO1 A;  4LB5 A;  2W85 A;  4HF2 A;  3BJO A;  1SD7 A;  3T0Y A;  4ESB A;  2EV0 A;  1G3Y A;  4UVC A;  3RI4 A;  3CUQ C;  3L09 A;  1XCB A;  4A6D A;  1MZB A;  5LRR A;  3KP4 A;  4KYW A;  2M45 A;  2JTV A;  1YO5 C;  1SD6 A;  4L5J A;  2DK8 A;  5F6F A;  2NNN A;  4ZYD A;  3TOA A;  1EH7 A;  2CGP A;  1GXQ A;  2ZNZ A;  2ZBK A;  2DW4 A;  3WU0 A;  2JPB A;  3H3U A;  2Q8K A;  3WTY C;  2FF4 A;  3ELK A;  2XUB A;  2A07 F;  3P9K A;  3BP8 A;  3I64 A;  2IVM A;  5ICG A;  1B6A A;  4O6J A;  5DV5 A;  5LHH A;  2J5P A;  4HLX A;  1ZAO A;  1G3S A;  2DTR A;  5ICC A;  1SFE A;  4ASN A;  1S6L A;  1QO0 D;  4BNC A;  2L3D A;  4WXC A;  2Z3Y A;  3V8K A;  3HUG A;  1BI2 A;  1SMT A;  5ILV A;  1XMK A;  4IRI A;  2O0Y A;  5E1Z B;  4YFK F;  4OIR F;  1R00 A;  2F2E A;  4GYI A;  1MJB A;  2DO7 A;  2M87 A;  3WG9 A;  2VC0 A;  4HAM A;  3G3Z A;  2XV4 S;  3KFW X;  3SFZ A;  3HHG A;  1TQM A;  3ML6 A;  2A68 F;  5CLS A;  1ON1 A;  2GAU A;  2RDP A;  4WX9 A;  2H09 A;  1G6N A;  4U7B A;  2L54 A;  3RKW A;  2FSW A;  3CDH A;  1ZYR F;  2BGC A;  3ISP A;  5KVR A;  2KIM A;  4RGS A;  4G7O F;  4ENK A;  2VOP A;  2D45 A;  3KET A;  1DUX C;  1AWC A;  4BAY A;  5JFR A;  3C18 A;  2L4M A;  2H6B A;  3ZQ7 A;  2MLG A;  4UV9 A;  4KMF A;  2ZXJ A;  2XAQ A;  5D5X B;  4OIQ F;  2QLZ A;  1USS A;  5ICF A;  2K7L A;  3O6B B;  2RV8 A;  4G94 A;  5FD6 A;  1ZRC A;  2FBK A;  1CGP A;  2A3S A;  2IA2 A;  5D5V B;  5DUK A;  1OMI A;  3I53 A;  5HVQ C;  2XIG A;  1WWX A;  5H6R A;  3J81 K;  1K79 A;  1EH8 A;  3IL2 A;  2P5V A;  1HKT A;  2Y75 A;  4JQF A;  3QPT A;  4HZF A;  1Q1H A;  1STZ A;  1U8R A;  3NRV A;  1BC7 C;  3WTS C;  2VE9 A;  4R79 A;  3GX4 X;  2AXL A;  5L3C A;  5DCF A;  4BHB A;  1SAX A;  2NRA C;  1UHW A;  4EJV A;  1PUE E;  3O2P E;  5JR3 A;  2FBH A;  2HR3 A;  2OD5 A;  2IPQ X;  5D6F A;  2ETH A;  2DBB A;  1FX7 A;  1LEA A;  2DPD A;  2VT2 A;  2YSR A;  1J9I A;  1Z6R A;  1UHM A;  2PFB A;  4MHG A;  3ZMZ A;  3K0L A;  2XAJ A;  3VB2 A;  2GA2 A;  4HF0 A;  3TO7 A;  5LLQ A;  3WE3 A;  1YQA A;  3L7W A;  1OPC A;  2E1N A;  3WTX C;  1WI9 A;  5D5W B;  1VTN C;  5HDG A;  2JRT A;  4CHU A;  2K4B A;  4WK8 F;  1DP7 P;  1FNN A;  2EB7 A;  3E5Q A;  4LJZ F;  4GYG A;  2P4W A;  3EUH A;  3HSF A;  2VC1 A;  2VE8 A;  3LA7 A;  1OYY A;  3P9I A;  4HW0 A;  2QVO A;  1BOA A;  3WE2 A;  1DDN A;  3GF2 A;  1Y0U A;  3E6C C;  5FFZ A;  1JGS A;  4IJA A;  3QU6 A;  4LK1 F;  4HOB A;  3TDU C;  2QQA A;  3VEP A;  2MH2 A;  4H0E A;  1O3R A;  1QZZ A;  5IT9 K;  3I59 B;  1UFM A;  4EV0 A;  2EJR A;  1J59 A;  3G73 A;  3HRT A;  2B0L A;  5CVV A;  2QZ8 A;  2GIV A;  2PQ8 A;  2V9V A;  2VXZ A;  3BPX A;  3GLX A;  1YIO A;  3KEO A;  4GGG A;  2WWY A;  4YFN F;  1S29 A;  4UVA A;  2QBY B;  1HQC A;  3KP3 A;  2O8X A;  4OMZ A;  2E7W A;  2STW A;  2P7V B;  1AOY A;  1F4K A;  3M9A A;  5J6X A;  3ZMU A;  3I59 A;  3VOD A;  4ENN A;  1IAW A;  4M71 A;  2P5L C;  2FNP A;  4BXU A;  1XGM A;  4BQA A;  4MQ9 F;  5FLX K;  1FWZ A;  2EA4 A;  1RIO H;  4CDG A;  5CVR A;  4O5V A;  1LVA A;  1UST A;  2L02 A;  1PDN C;  1DPU A;  1G4D A;  2EFQ A;  2JSC A;  2QBY A;  3TO9 A;  3E5U A;  3CJN A;  1TW3 A;  3RKY A;  1JE8 A;  3C3W A;  3JW4 A;  2EFP A;  4L18 B;  3RJP A;  3IWZ A;  2PI0 A;  1G3T A;  3VFZ A;  2FA5 A;  4D0P A;  3GWZ A;  2HZT A;  3LAP A;  2P7C B;  5HLH A;  3F8C A;  4I0B A;  1U78 A;  1E2X A;  2GXB A;  1UB9 A;  4LLL A;  3CUO A;  5LEJ A;  3LA2 A;  1XSD A;  1LDJ A;  3DKW A;  1RI7 A;  3MCZ A;  4AIH A;  5ERI A;  2HTS A;  3Q9S A;  1S3J A;  1KU3 A;  4HF1 A;  4F7Z A;  1EV7 A;  5K5O A;  1T2K A;  1LNW A;  5L3B A;  1XDS A;  1FP2 A;  2XKO A;  3HTU A;  2EA2 A;  3F6V A;  1KU9 A;  5FGM A;  1R58 A;  1FZP B;  3SHF A;  2STT A;  2HYF A;  3QOP A;  5BPI A;  2PEX A;  5HS9 A;  1ZLJ A;  5DDG A;  2V79 A;  3K69 A;  5E18 F;  3F6O A;  3KP5 A;  4KIG A;  1Z6T A;  4MGR A;  3VOE A;  1YW9 A;  3GUD A;  4WCG A;  5K5R A;  3WGG A;  1R1U A;  2WC2 A;  3KLN A;  2LF8 A;  1KQ0 A;  1XN7 A;  1REP C;  1BJA A;  5D4S A;  2W25 A;  3MZY A;  2Q2E A;  4S04 A;  2HS5 A;  3BOQ A;  3F72 A;  1IW7 F;  1SFU A;  3Q9V A;  1T38 A;  4YFX F;  5EEH A;  3K2Z A;  2DFI A;  3JSP A;  4YIF A;  5CJ9 A;  3FM5 A;  2CO5 A;  4LFU A;  4L0Y B;  1FBS A;  1LDK B;  1PP8 F;  2ESH A;  4KDP A;  3HOT A;  2XGX A;  3KCC A;  4UVB A;  3ZMD A;  1MKM A;  4U0W A;  1YS7 A;  2VBY A;  4Q48 A;  5FO5 A;  4ZYE A;  2CFX A;  3CO7 C;  4OIO F;  4LLN A;  2ELH A;  3HRM A;  5ICE A;  1YYV A;  2VBX A;  4P96 A;  3GFM A;  4G7H F;  4B8X A;  2G7H A;  5E8I A;  3LAJ A;  1S7O A;  1Z7U A;  5TJJ A;  4RB0 A;  3CUQ B;  2XAF A;  1JHH A;  3M8F A;  1RUO A;  2E7X A;  2Y0M A;  5D5U B;  1KYW A;  1BN5 A;  1I1S A;  4RB3 C;  4HDU A;  3V4G A;  1KQ9 A;  3ECH A;  2LF7 A;  3MFK A;  2DAO A;  4S05 A;  2UWM A;  2DLL A;  1U3E M;  1R22 A;  4PGH A;  2GZW A;  2ZJ2 A;  2PMH A;  1FLI A;  2M8E A;  1U5T B;  1D5V A;  3QU3 A;  4ESF A;  2FXA A;  1FPQ A;  1GXP A;  3DPT A;  2VBZ A;  1IN5 A;  5D8K B;  3CUQ A;  1ZG5 A;  4UNO A;  3OOP A;  3KEQ A;  1IZ1 A;  3COA C;  1IRG A;  2DQR A;  5LRS A;  1W5T A;  4L0Z B;  2ZO4 A;  3KP7 A;  2OBP A;  2COM A;  3IHU A;  2OQG A;  4ON0 A;  3V8L A;  4LGW A;  2BEO A;  3V7S A;  3WTW C;  1U5T A;  2EV5 A;  4XSX F;  3R61 A;  5A2Q Z;  5DD8 A;  2F5D A;  5K1Y A;  3GFI A;  1MDM B;  3IRR A;  3R0A A;  3C7J A;  1XB4 A;  2DK5 A;  1W7P D;  3WTZ A;  5K5Q A;  3QP6 A;  4QLC U;  4Q5S F;  4LB6 B;  4A6E A;  1XSV A;  3LQR A;  1J7K A;  4RGX A;  4K2E A;  2A5Y B;  4KN7 X;  4WXH A;  2HEO A;  3T5X A;  2DPU A;  2PN6 A;  4A2U A;  1YFH A;  4EM0 B;  2ACJ A;  2MH9 A;  4OIN F;  1D3Y A;  1MDM A;  2NNY A;  1O3Q A;  3WOD F;  1FOK A;  6PAX A;  4RB2 C;  2BE5 F;  3R60 A;  1YLF A;  5DYM A;  2EFW A;  2YX4 A;  4EVI A;  3LWF A;  2TDX A;  2H6C A;  1WRJ A;  5D8L B;  3GYH X;  2NAZ A;  4U7D A;  4N9I A;  4A0Y A;  3I58 A;  1QGP A;  3FX3 A;  4I09 A;  4RGU A;  1HKQ A;  4LMY A;  4L9V A;  1FYL A;  3F8B A;  3MQ0 A;  4YII A;  3R4K A;  4U88 A;  1I1G A;  3WGI A;  2C6Y A;  3RDI A;  3TO6 A;  1UCR A;  1QQI A;  1WKM A;  4CIC A;  1C0W A;  3N97 A;  3LST A;  3U1D A;  3LA3 A;  1TTY A;  2H94 A;  3E6M A;  5LHI A;  2WTE A;  4A12 A;  3DFG A;  1B4A A;  4EGY A;  3D5L A;  1RZ4 A;  4EMS A;  3K1M A;  4R8H A;  3WTU C;  2K27 A;  3FMS A;  3WTT C;  1YG2 A;  5CVJ A;  3BZ6 A;  3JSO A;  3RPQ A;  2FOK A;  4KFC A;  1XDU A;  4Y15 A;  5HDN A;  5H20 A;  3IKT A;  1O7L A;  4FT8 A;  2ZCW A;  2P6T A;  1I6X A;  2HFH A;  3J80 K;  4M72 A;  4HA8 A;  5HLI A;  4GCV A;  1KYZ A;  2VOO A;  2MLK A;  1FBQ A;  1T39 A;  4KA4 A;  1H9T A;  1YW7 A;  5LGN A;  4P9U A;  3KZY A;  1R7J A;  1EH6 A;  2LNB A;  4A5M A;  3BY6 A;  4KIF A;  2Z9O A;  2VT3 A;  4FHT A;  4IRG A;  1P4A A;  3IC7 A;  2IW5 A;  3PFI A;  5HDK A;  4IVN A;  3MEX A;  1J0R A;  1XGO A;  3E6B A;  3JTG A;  1O57 A;  3RTR A;  3CO6 C;  4Z2Y A;  3BJA A;  2FU4 A;  2HOE A;  1MD0 A;  1V3F A;  4IF4 A;  5FD5 A;  4EJO A;  3DPL C;  3F21 A;  3JAM Z;  2UXX A;  1MJ9 A;  2LKP A;  4ZYG A;  2HTJ A;  4EJW A;  4KT5 C;  2X0L A;  4P55 A;  2KRF A;  5E1W A;  3KZZ A;  3N4M A;  5BPD A;  2XRO A;  2ZFW A;  1XGS A;  1KQ8 A;  3I0T A;  2IT0 A;  2OAZ A;  5ED4 A;  3WU1 B;  3QPH A;  2FNA A;  2LDU A;  1L0O C;  4IHT A;  3L2C A;  5E20 A;  4ENM A;  1FSE A;  1J5Y A;  2HGC A;  5TRD A;  4LLG F;  3ZPL A;  2XRN A;  1GVJ A;  5J8C A;  3L9F A;  3K1N A;  2W57 A;  4HX4 A;  3E6D A;  4YG2 F;  1ONV A;  2RVC A;  2A69 F;  3T1B A;  4IHS A;  2J5O A;  1IUY A;  4PDK A;  4EJU A;  1IN8 A;  1P2F A;  2ISZ A;  2GWR A;  1LEB A;  3SZP A;  4ENJ A;  2HQN A;  3CTA A;  5DCM B;  1IN7 A;  2PG4 A;  3MWM A;  3IWF A;  5CVI A;  1B9M A;  3F8N A;  1IXC A;  4FX4 A;  2O61 A;  2YU3 A;  2AS5 F;  3EET A;  4AIK A;  3GFL A;  3ECO A;  2OZU A;  1SD5 A;  5J8F A;  3GZ5 A;  4ETS A;  3M8E A;  4AVP A;  4I01 A;  1S7A A;  1FBU A;  3LQQ A;  3F8F A;  3BRO A;  4GXO A;  4KIC A;  5BMZ A;  2V1D A;  3F23 A;  3WGH A;  1XD7 A;  2XAH A;  5LGT A;  2PLY A;  4ZYH A;  1HW5 A;  3HIF A;  5DCM A;  1O3S A;  3HRS A;  4HV5 A;  4UV8 A;  2KJB A;  3QAH A;  4A0Z A;  3U2R A;  5IT9 Z;  2HYG D;  3ZN0 A;  3K9T A;  5HLG A;  1SFX A;  4M74 A;  5LGU A;  2QEN A;  4BH9 A;  2P8T A;  4Y13 A;  1TBX A;  2F5F A;  5HS8 A;  1D8J A;  1H9G A;  1F1Z A;  3BJ6 A;  3D0S A;  3DF8 A;  4AIJ A;  2HWV A;  3HRU A;  3FMR A;  4ESJ A;  1XSX A;  4A0X A;  1DPR A;  2MA3 A;  3PQK A;  4EGZ A;  4IRH A;  3DXJ F;  4I0A A;  1O3T A;  4HQM A;  5DUI A;  2VOD A;  3H92 A;  3HSE A;  5D6E A;  1K6O A;  4KNY A;  1U6G A;  3GEZ A;  5FLX Z;  3AAF A;  1YW8 A;  1ZRE A;  3T8T A;  2O6G E;  4DQ2 A;  2GQQ A;  1FT9 A;  5L3F A;  5BS6 A;  3K1P A;  3DP7 A;  3SZT A;  2FBI A;  4CZZ A;  1QBJ A;  1HST A;  2IRF G;  2KIU A;  1LJ9 A;  5HOO A;  1BI0 A;  2FQ3 A;  4MEX F;  4ZZD A;  1W4M A;  2MBF A;  5L3D A;  3QP5 A;  2JT1 A;  2XHK A;  4KIB A;  4TV7 A;  4G9Y A;  2KKO A;  2H27 A;  4RAZ A;  3ROU A;  3E3V A;  2BYV E;  2DI3 A;  4HQE A;  2OZ6 A;  2M30 A;  1BBY A;  1IF1 A;  2HKO A;  4HX8 A;  5AIQ A;  1HBX G;  5LHG A;  1ZG1 A;  3FXQ A;  1K7A A;  2DQL A;  3SXY A;  4EJT A;  2VBW A;  4I98 B;  2Q0O A;  3MZH A;  1Z05 A;  1ZN2 A;  3NQO A;  2QM3 A;  1R1V A;  3M1E A;  4G8X A;  1ZH5 A;  2D2W A;  3FMQ A;  4ZZL A;  2NYX A;  4JBA A;  2F5C A;  3V8J A;  4I7H A;  3ERE D;  1KU2 A;  1ZGJ A;  1TNS A;  3DEU A;  2F5E A;  2EWN A;  3ZMV A;  2CYY A;  2DT5 A;  1IN4 A;  1SMY F;  1QPM A;  1BM9 A;  2YPR A;  3W6J B;  1FYM A;  1W5S A;  4G7Z F;  5DD4 A;  3ULQ B;  5E17 F;  4NQW A;  3ZP5 A;  1R5H A;  4CYD A;  2FMY A;  1BC8 C;  4B09 A;  3JTH A;  4BHP A;  5L3E A;  1U5T C;  4A5N A;  2LSO A;  1CF7 B;  2ADU A;  3PQJ A;  2VN2 A;  3S2W A;  1P4W A;  2A6H F;  2EV6 A;  3DQV C;  3RIR A;  2IA0 A;  4CXF A;  1ZRF A;  4AD9 A;  3F8M A;  3FXU A;  3HYI A;  3O3K A;  1HSJ A;  2RC4 A;  4Q47 A;  3L00 A;  1Z91 A;  2HKX A;  2RKH A;  3HTS B;  1RUN A;  1TQP A;  4N0B A;  3NEU A;  4KMU X;  4WWC A;  1D8K A;  1T0F A;  4IPA A;  4PCQ A;  3LFK A;  1MGT A;  3I5U A;  1CF7 A;  4Y17 A;  2PBI A;  3GVA A;  4KN4 X;  1TNT A;  2YR2 A;  1YS6 A;  1R1T A;  1BIB A;  4HV6 A;  4PZJ A;  1KGS A;  2ZKZ A;  2IA1 A;  3GW2 A;  4MTE A;  4RB1 A;  3TKY A;  2FRH A;  1FC3 A;  1BIA A; 
#chains in the Genus database with same CATH topology
 2IS2 A;  2R7D A;  4BYY A;  2RNG A;  2DA7 A;  3FHZ A;  1LQ1 A;  1ZQ3 P;  2HPM A;  2IP2 A;  2DU9 A;  2KJC A;  3GO5 A;  4W97 A;  1YJW I;  4XLN F;  1EF4 A;  4CSW A;  2XAS A;  1VQM I;  3GTK J;  5F1R A;  2BV6 A;  2R7F A;  4UUS B;  1TQI A;  1T98 A;  3PIO F;  4XQF A;  1YJ9 I;  5D4R A;  2E34 A;  3TOB A;  2K9Q A;  3HPG A;  2ELK A;  4E7K A;  2OUM A;  1A04 A;  2XDV A;  2L0K A;  3HHH A;  4HLY A;  1J75 A;  2KPM A;  3GBG A;  2GOX B;  5EGO A;  5KK1 A;  4UUV A;  1BA5 A;  2R7T A;  2HDC A;  4XK4 A;  1T08 B;  4RAY A;  3RKX A;  1B59 A;  4OIP F;  2XB0 X;  4HX7 A;  1DU6 A;  5AIP A;  2Q1Z B;  3JAM K;  1ZR4 A;  1MBK A;  4F91 B;  4P5O A;  3BG3 A;  4PFP A;  3WG7 H;  1V4R A;  4C2T A;  1GUU A;  3KZI C;  3OYM A;  1K83 J;  2VJI A;  1ULY A;  2BBY A;  4WXD A;  3KX2 A;  1WQ2 A;  3GZ6 A;  5AON A;  1BI1 A;  2E1C A;  2CQN A;  5EG0 B;  3CDI A;  1KA8 A;  3B6C A;  2W84 A;  1J2X A;  2NS7 A;  1U2W A;  2DMU A;  2CQK A;  4UUS A;  5K7Z A;  1WSU A;  1JXS A;  2M8G X;  4OOI A;  2XKP A;  4HST A;  2JZY A;  2JA7 J;  2O3F A;  4RGR A;  1TWA J;  2ID3 A;  4DYR A;  2DXI A;  1OYI A;  3QQA A;  1ZLK A;  3I71 A;  4LK0 F;  2KRC A;  4HYE A;  3WTV C;  3ZMS A;  3HOX J;  1GHC A;  4W1U A;  1S8N A;  4CZC A;  2X4H A;  4MNU A;  1YIJ I;  4MTD A;  2DT6 A;  3I9V 2;  3ZR8 X;  5LBQ A;  2Z33 A;  1O7F A;  2OU2 A;  3H0G J;  3IH2 A;  1HLV A;  1A35 A;  3H3Z A;  3C1D A;  5B5E C;  5BOX A;  1Y1V J;  3G4S I;  3A2K A;  2MD5 A;  1D0Y A;  1R6R A;  4XOP A;  3L1P A;  5L3G A;  2R3S A;  4NB5 A;  4MEY F;  4A3D J;  1SD4 A;  4RA2 A;  3W2V A;  3S16 J;  3BR0 A;  3ZN1 A;  2V6C A;  5EG0 A;  2OQR A;  3PUF A;  1OR7 A;  2A6E F;  2PMU A;  2GA1 A;  1I5Z A;  2RGV A;  3FF5 A;  4OMY A;  3MAJ A;  2CW0 F;  3LMM A;  4U0Y A;  2L01 A;  2RNJ A;  4H4K C;  4BHC A;  3RZO J;  1ZHF A;  3W6K B;  3C2G A;  1QNT A;  1WVR A;  5EJC A;  4E7H A;  4JP0 A;  5GP9 A;  3JRC A;  4ZH4 F;  3IRQ A;  2M5W A;  3A4C A;  1DU0 A;  4L5I A;  5E8G A;  3CCL I;  2WAQ N;  2EFN A;  1ZK8 A;  5F1J A;  1P92 A;  2CW8 A;  5GAD J;  1ODD A;  1Y39 A;  3ZQI A;  3VYU B;  1SAU A;  1P6R A;  2FD5 A;  4AID A;  5KCM A;  1R36 A;  3AL0 B;  2CJJ A;  3A1Y A;  2G7U A;  5IT3 A;  2VQC A;  5LEK A;  4J00 A;  3SQN A;  2L9R A;  3GLL A;  4AYB N;  5FB2 A;  2X48 A;  3OIQ A;  1FOW A;  4MQV A;  2Y48 A;  5J1U A;  4DZP A;  4RLF A;  2X9D A;  2M7B A;  4L9J A;  3P9C A;  4PJJ A;  3ABU A;  5DS9 A;  5EEG A;  3V7C A;  2WA0 A;  1L3L A;  4E70 A;  4L9N A;  2QQ9 A;  3TDZ C;  3ABT A;  2DOA A;  5HS7 A;  1YX3 A;  5CQG A;  5JI6 A;  3EDP A;  4M6Y A;  1IC8 A;  2P5K A;  3BT9 A;  2ICW G;  3GXO A;  5FFX A;  1FJL A;  4AWX B;  1IN6 A;  3CLO A;  4AC0 A;  4C3H J;  2NOG A;  2VON A;  2VJJ A;  2O5R A;  1IJW C;  4FX0 A;  2VPR A;  3S1M J;  1H8A C;  2L4A A;  1FIA A;  2AO9 A;  3SYT A;  4BS9 A;  5GAH J;  1PP7 U;  3D5R C;  2JA2 A;  4PSW A;  1TLH B;  2K86 A;  1XTA A;  3ASN H;  1B9N A;  2HQR A;  3IKV A;  3MZ8 A;  4GDF A;  4JX6 A;  1MMS A;  4QWQ A;  4IXA A;  2QQB A;  1F5T A;  1K78 B;  4G6D A;  1W7P B;  3FKJ A;  4P9F A;  2WAD A;  4OU0 A;  1E17 A;  2HU9 A;  1JHF A;  2FML A;  4I6Z A;  4UY8 I;  2K4J A;  2KZV A;  5JHU A;  3I54 A;  4I2O A;  4XL9 A;  1VZ0 A;  2Z99 A;  3M7G A;  5HLT A;  4BE1 A;  2G9W A;  2Z5U A;  2OA4 A;  3CCJ I;  2DN0 A;  2ZNY A;  1XG1 A;  2JVG A;  2KL4 A;  5EF6 A;  4V2F A;  3J81 Z;  4Q4Z F;  5B3S H;  4DYQ A;  3E97 A;  2IGO A;  3PL8 A;  5K7F A;  1FYK A;  1UHS A;  3P7N A;  4FCY A;  1D1B A;  2PJP A;  1O4X A;  2CG4 A;  1Y8R B;  2W24 A;  1MBG A;  1XMA A;  1DGR M;  1OCT C;  1FMW A;  1S5L C;  4B44 A;  3HOS A;  3FXM A;  2QEX I;  4DNC A;  3L2V A;  4XLE A;  3R0J A;  3EQL F;  1ZGA A;  4WF2 A;  1K78 A;  5GTH C;  3ONQ A;  5JVT A;  1VQ4 I;  1HC8 A;  1W7P A;  3M07 A;  4CGZ A;  1RES A;  1Z1D A;  5ILS A;  4NHJ A;  1MND A;  4N9H A;  4CO8 A;  4XLP F;  3G71 I;  3FZV A;  2QWW A;  2IJL A;  1FP1 D;  2E5N A;  2P6S A;  3OR2 C;  3HL2 A;  1MJA A;  4RAG A;  1UEL B;  2K40 A;  1NHA A;  1WGX A;  3J7A O;  3FXR A;  3TGN A;  3J80 Z;  4ZTF A;  3DTI A;  2WV0 A;  3R6S A;  1YTY A;  3I4P A;  1B8I A;  2EIK H;  2QA4 I;  1ZAR A;  3QRF F;  5JLW A;  3EYY A;  2EFO A;  1XC5 A;  2E2I J;  4Y52 J;  4G6Q A;  2LD5 A;  3FM3 A;  2CSO A;  1ACI A;  4IKF A;  4R1H A;  2A5W A;  4EM1 A;  3B02 A;  4UHT A;  2IGN A;  2D1V A;  3V7R A;  1NG6 A;  1H0M A;  5IYC J;  3FBN B;  2IAI A;  4RS8 A;  3DEE A;  4M9X A;  2PMZ N;  1X2N A;  4XSZ F;  1P7J A;  2GXG A;  1D5Y A;  4RM3 A;  3JRH A;  3OSG A;  2V1U A;  4M6X A;  2ZSI B;  1I27 A;  4CUG A;  4QIW N;  2FX0 A;  3GFJ A;  3L2W A;  5B1B H;  2LRE A;  3J7Y J;  2AQE A;  2UZK A;  2QYO A;  3OV8 A;  2E1M C;  1UJ8 A;  3FIS A;  3FWE A;  2A6T A;  2ZXW H;  3ZQH A;  2MC3 A;  2Y9Z A;  4E7L A;  3U9G A;  2O8K A;  3DTE A;  3J7A Y;  1ZG3 A;  2D1H A;  4XLC A;  3OYI A;  3E1S A;  1LDD A;  1LB2 A;  3BDD A;  1OKR A;  2NS8 A;  2M0C A;  1ZRD A;  1P7I A;  2FE3 A;  3KP2 A;  2CV0 A;  3HEF A;  3FK7 A;  1V54 H;  3BR1 A;  1RKT A;  3LSG A;  5E1X A;  2Y69 H;  5M5X J;  1WJF A;  4BE0 A;  9ANT A;  4I76 A;  3F22 A;  1TW2 A;  3Q5F A;  2JN6 A;  5DEQ A;  3B73 A;  4Y7N J;  3KP6 A;  1V55 H;  1Z9C A;  1X19 A;  3GTG J;  1U8B A;  2K9M A;  2QUF A;  5EEA A;  4PGG A;  1Z77 A;  1IXR C;  5CVU A;  1X3U A;  1T6S A;  3M1C A;  1FEX A;  2VKD A;  2NS0 A;  1OCO H;  1NTC A;  5F64 A;  4I02 A;  4XR6 A;  3K7A J;  4A3C J;  1ETV A;  2YX7 A;  4BKX A;  2X6O A;  4M73 A;  3BZK A;  3KLO A;  1P4X A;  2BXY A;  5FKK A;  1WJE A;  2ESN A;  3SFI A;  2ELJ A;  2EZK A;  1G8X A;  4IOA F;  3KE2 A;  5C4J J;  4EQQ A;  4BGD A;  3REO A;  2FEZ A;  1A6Q A;  1G3W A;  1MMA A;  2K3P A;  3HSR A;  2KQR A;  2R7Q A;  3QYB A;  3TMO A;  2D5V A;  5A2Q K;  4LOC A;  1IXS B;  1HXD A;  1W5C C;  1P9Q C;  2HYJ A;  4A69 C;  2O03 A;  4C3I J;  1WJA A;  2ZME B;  4XRF A;  4AYB A;  4HEA 2;  3RPU A;  2RQP A;  2E19 A;  4LIT A;  3GCM A;  1F9N A;  5M3F J;  3CLQ A;  1E0E A;  1W1W E;  2IS6 A;  4O3M A;  2JPC A;  1OYW A;  2KIF A;  5BQT A;  3C2H A;  2XGC A;  1IGN A;  1FY7 A;  2UXN A;  5J47 A;  5FLM J;  3DV8 A;  2DDA A;  1FSH A;  1RNL A;  2LFB A;  3RYP A;  3F3X A;  2IS4 A;  3E5X A;  4UXN A;  1IRF A;  4KUM A;  2V1X A;  2KIQ A;  2OV7 A;  2L7F P;  3PUB A;  3DBH B;  4JK1 X;  1R23 A;  1XGN A;  4M9Z A;  1HW2 A;  2O7O A;  2MGQ A;  1JGG A;  1U9O A;  3T8R A;  4LG0 B;  3BWG A;  3RYR A;  3S3M A;  1QZY A;  4FET A;  3EYI A;  1HOM A;  1BR4 A;  1HKS A;  2K02 A;  2XPW A;  2EK5 A;  2LKS A;  4M9S A;  4YEJ A;  3JRA A;  4J19 A;  1HW1 A;  2VPL A;  2XVC A;  3OYA A;  4XBF A;  3ZXS A;  1T95 A;  2VUM J;  2ZME A;  1QA6 A;  2UV1 A;  3HBL A;  2G0E A;  1H89 C;  1K6Y A;  1JT0 A;  3W3C A;  2BOL A;  1LVK A;  2CUJ A;  2VKV A;  4MFE A;  4U0V A;  2LG4 A;  3ABK H;  3GTL J;  1Y56 A;  2HNH A;  3OL3 A;  3VYT B;  1BI3 A;  3MN2 A;  3AG2 H;  2CW7 A;  1LE8 B;  3SJM A;  2ISY A;  2CV1 A;  2UUZ A;  2YS9 A;  2RN7 A;  4HBL A;  5IP7 J;  4KT6 A;  5C3E J;  1ETX A;  3BPV A;  5ILU A;  4HDV A;  4L9T A;  1VI0 A;  2A61 A;  3ZMT A;  1B1B A;  4LG0 A;  4EM2 A;  1KU7 A;  2M1B A;  4XN0 A;  3BTI A;  2X1E A;  5JHF A;  2XAG A;  1XCV A;  3IV5 A;  4LD5 A;  2JVH A;  1R5G A;  4XLA A;  5CYV A;  1ON2 A;  5H6Q A;  3DLL F;  3KYC B;  3TQN A;  1GV5 A;  2CWE A;  4GO1 A;  4LB5 A;  3OOU A;  2W85 A;  1VFC A;  4HF2 A;  3BJO A;  1N75 A;  1SD7 A;  3T0Y A;  4ESB A;  2H1K A;  2EV0 A;  2R5Z B;  1ETQ A;  4F52 A;  1G3Y A;  4UVC A;  3RI4 A;  1TWF J;  3CUQ C;  3L09 A;  1XCB A;  4A6D A;  2DOD A;  1MZB A;  5LRR A;  3KP4 A;  3RCO A;  4FTH A;  1IRX A;  4KYW A;  2KHM A;  2KIS A;  2M45 A;  1X4O A;  2JTV A;  1YO5 C;  5KAI C;  1ITY A;  3PSF A;  2HXI A;  3OMY A;  1DQU A;  1VQO I;  1SD6 A;  4L5J A;  3EUK L;  3NAR A;  2DK8 A;  5F6F A;  2NNN A;  4ZYD A;  3TOA A;  3HUG B;  2DYS H;  1EH7 A;  2CGP A;  1GXQ A;  4PJL A;  1ZR2 A;  4ZDL A;  2ZNZ A;  2ZBK A;  2DW4 A;  3WU0 A;  3IAM 2;  2JPB A;  3H3U A;  2Q8K A;  4UB8 C;  2I10 A;  3WTY C;  2FF4 A;  3ELK A;  2XUB A;  5HNH A;  1UG2 A;  1F36 A;  2LH9 A;  3NAU A;  2A07 F;  3P9K A;  2XF7 A;  3BP8 A;  2L9V A;  2R7Z J;  1EJ9 A;  3I64 A;  5F27 A;  2IVM A;  5ICG A;  2YU9 J;  1B6A A;  4O6J A;  2MC4 A;  5DV5 A;  5LHH A;  2HVS A;  2V26 A;  2MYS A;  3A03 A;  2CUF A;  2J5P A;  2R5Z A;  1E3H A;  2PMZ A;  3LSK A;  2JUG A;  2RRE A;  3PFY A;  2H8R A;  2JWT A;  4HLX A;  3PM1 A;  1ZAO A;  1G3S A;  1SVL A;  2ZFU A;  1F43 A;  1EKE A;  2DTR A;  3CJR B;  5ICC A;  4BXX J;  1SFE A;  4IOC F;  4ASN A;  1LUJ B;  1S6L A;  2TCT A;  1QO0 D;  1BR2 A;  4BNC A;  5HOD A;  2L3D A;  4WXC A;  1I3Q J;  3K2A A;  2PJR B;  2Z3Y A;  3V8K A;  3HUG A;  1BI2 A;  1Y1W J;  5FKL A;  3OYJ A;  1SMT A;  2XAU A;  2OJE D;  1FMV A;  3OYB A;  1WPK A;  2R7R A;  5ILV A;  1XMK A;  2E5Z A;  3OY9 A;  4IRI A;  2O0Y A;  5E1Z B;  1T0F C;  4YFK F;  4OIR F;  1R00 A;  4RBO A;  2W82 A;  4ZYA A;  2F2E A;  4GYI A;  1MJB A;  2GIZ A;  2DO7 A;  2M87 A;  3WG9 A;  2VC0 A;  4HAM A;  3G3Z A;  1R4M B;  2R4G A;  2XV4 S;  3KFW X;  4I99 C;  3HHG A;  3SFZ A;  4A3F J;  1TQM A;  3ML6 A;  4PUS A;  2BY0 A;  3QPL A;  2A68 F;  4FQG A;  2W00 A;  2JA5 J;  5CLS A;  1ON1 A;  2GAU A;  2RDP A;  5F0H A;  4WX9 A;  4PJM A;  3H0D A;  1VQN I;  2L9N A;  1TP4 A;  2JMW A;  2H09 A;  3JRG A;  2VKE A;  1G6N A;  4U7B A;  2KFD A;  5GPC A;  2K3F A;  2L54 A;  1KZH A;  1R71 A;  4DGW B;  3K4M A;  3CF2 A;  2GBY A;  1NG7 A;  3LSI A;  1UG0 A;  3SDB A;  1TWC J;  3BTJ A;  1IUF A;  3RKW A;  1JT6 A;  3H5A A;  2FSW A;  3CDH A;  3GTQ J;  1ZYR F;  4PJ0 C;  2DA2 A;  2WBM A;  1T8I A;  3HOU J;  4FAS D;  2BGC A;  3ISP A;  5KVR A;  2HOT A;  3V42 A;  2KIM A;  1G59 A;  3CCY A;  4RGS A;  4G7O F;  4ENK A;  5LFA A;  2VOP A;  2D45 A;  3KET A;  3L2R A;  3ABL H;  1X1C A;  1AWC A;  1DUX C;  4XLF A;  4AVZ A;  4BAY A;  1AHD P;  5E3M A;  4IHY A;  5JFR A;  3DEW A;  4ZDO A;  3C18 A;  3H5N A;  2L4M A;  5F08 A;  1W36 D;  1MBE A;  2EBI A;  2H6B A;  3JR9 A;  4A3J J;  3ZQ7 A;  1MMD A;  3LOC A;  3LNQ A;  2JQ7 A;  3S1R J;  2MLG A;  1UAA A;  4UV9 A;  2AHQ A;  4KMF A;  4NNJ A;  2ZXJ A;  2XGE A;  2XAQ A;  2OF7 A;  5D5X B;  1RR8 C;  1SFK A;  4NC6 A;  4OIQ F;  4XM3 A;  3HM5 A;  2R7O A;  3OYL A;  2QLZ A;  3A01 B;  2EZH A;  1USS A;  1YX5 A;  5ICF A;  2LY2 A;  2K7L A;  1FOX A;  3S2D J;  3O6B B;  2RV8 A;  4G94 A;  4E7Z A;  5FD6 A;  5FKM A;  2CH0 A;  1ZRC A;  3SDG A;  2FBK A;  2R7X A;  1CGP A;  2HPI A;  2A3S A;  2IA2 A;  5D5V B;  1WH5 A;  5DUK A;  1OMI A;  2DA3 A;  3L2U A;  3RSN A;  3I53 A;  1UMQ A;  5HVQ C;  3VPR A;  2XIG A;  2Z1D A;  4XON A;  1U0J A;  1WWX A;  3HGY A;  3HB9 A;  5H6R A;  1IDZ A;  3J81 K;  1K79 A;  1EH8 A;  3IL2 A;  2P5V A;  1HKT A;  1IDY A;  2Y75 A;  4JQF A;  4XNF A;  3SEZ A;  3FBI B;  3QPT A;  4HZF A;  2GXA A;  1Q1H A;  4F3Q A;  1STZ A;  1VQP I;  2OCC H;  1U8R A;  3NRV A;  1BC7 C;  3WTS C;  2VE9 A;  4R79 A;  3CJT B;  3GX4 X;  2AXL A;  5L3C A;  5DCF A;  4BHB A;  1SAX A;  2NRA C;  1UHW A;  2E71 A;  4YRV A;  4EJV A;  1PUE E;  3O2P E;  5JR3 A;  2FBH A;  2EIN H;  2HR3 A;  4XKW A;  3S14 J;  5M5Y J;  4BJ5 C;  2IXS A;  2OD5 A;  3A01 A;  2IPQ X;  1SFO J;  5D6F A;  1R4N B;  2DBB A;  2ETH A;  5J4V A;  1FX7 A;  1LEA A;  2DPD A;  4F92 B;  2VT2 A;  2DMT A;  2YSR A;  1OR7 C;  4B4C A;  2JSP A;  2KZG A;  1J9I A;  1QHG A;  1Z6R A;  1UHM A;  2PFB A;  4MHG A;  1GVD A;  3K10 A;  3ZMZ A;  3K0L A;  2JA6 J;  1ENH A;  2XAJ A;  3VB2 A;  2GA2 A;  1S72 I;  4HF0 A;  3LSP A;  1E3P A;  3TO7 A;  5LLQ A;  5CPR B;  2CU7 A;  2R7V A;  1WI3 A;  3WE3 A;  5FJ8 J;  1ETO A;  1OIS A;  1YQA A;  3L7W A;  1DGW Y;  3H9G A;  3HGG A;  1OPC A;  3DCF A;  2QSH X;  2E1N A;  3G2B A;  3CJQ B;  3WTX C;  1WI9 A;  3MMY B;  4NUB A;  2QSG X;  2O9L A;  2RAE A;  3WHC A;  2A05 A;  5D5W B;  2W1O A;  1VTN C;  5HDG A;  2MG4 A;  2JRT A;  4CHU A;  2K4B A;  4WK8 F;  1DP7 P;  1Y6I A;  1FNN A;  2EB7 A;  3DKY A;  3E5Q A;  3OYD A;  4LJZ F;  2VXD A;  4GYG A;  3ZQC A;  2P4W A;  3HG9 A;  3EUH A;  3HSF A;  1HCR A;  3TW6 A;  2M4K A;  2K9S A;  2VC1 A;  2VE8 A;  1QZE A;  1RKW A;  4A93 J;  1VQ9 I;  3LA7 A;  1OYY A;  3P9I A;  4HW0 A;  2QVO A;  1BOA A;  3H9J A;  2W4S A;  5FKN A;  4B3X A;  5JVG F;  3WE2 A;  1RR7 A;  1DDN A;  2R7S A;  3M4O J;  3FXL A;  3GF2 A;  5F04 A;  2EZI A;  1Y0U A;  2F4M B;  3E6C C;  5FFZ A;  1JGS A;  3DBL B;  4BDY A;  4IJA A;  2BVM A;  4HPQ A;  1G2H A;  1N25 A;  3QU6 A;  1V5E A;  4LK1 F;  4HOB A;  3TDU C;  2QQA A;  2QGU A;  3VEP A;  1JKO C;  2MH2 A;  4HNT A;  2WY7 Q;  4H0E A;  2B7E A;  4HSR A;  1O3R A;  1SEU A;  1JJ8 C;  1QZZ A;  5IT9 K;  3I59 B;  4DYC A;  1LFU P;  2EH3 A;  3ESW B;  2M9H A;  1UFM A;  1Z67 A;  4EV0 A;  2EJR A;  1J59 A;  3G73 A;  1GDT A;  3I56 I;  1X3W B;  1X2M A;  3HRT A;  2B0L A;  4BBS J;  4JX5 A;  5CVV A;  2QZ8 A;  2GIV A;  4D5F A;  2PQ8 A;  2DDB A;  2V9V A;  2VXZ A;  4J01 A;  3BG5 A;  3BPX A;  3HC7 A;  5DM6 F;  3HKZ A;  3GLX A;  1JKR C;  1YIO A;  3KEO A;  3KIO A;  4XKV A;  2NVU B;  4F55 A;  5JLX A;  4GGG A;  2X6X A;  2DJN A;  1QHH D;  2H8W A;  2WWY A;  3I4N J;  2E60 A;  1POG A;  3NWT A;  4DJA A;  4YFN F;  4LIU A;  1S29 A;  4UVA A;  1OJL A;  2IEK A;  2QBY B;  3BR6 A;  1HQC A;  1RET A;  3KP3 A;  1VQ7 I;  5GTI C;  1QRY A;  5J40 A;  2O8X A;  2I5U A;  4C9Y A;  4OMZ A;  2E7W A;  1IV6 A;  1RPW A;  2STW A;  2P7V B;  2VQL A;  1AOY A;  1F4K A;  3M9A A;  3DU5 A;  1K61 A;  5J6X A;  3ZMU A;  2Y30 A;  3HOV J;  4E6K G;  3I59 A;  3A0H C;  3VOD A;  4ENN A;  1IAW A;  4M71 A;  2P5L C;  1YIT I;  2FNP A;  4BXU A;  5B66 C;  3CCV I;  1XGM A;  4BQA A;  4MQ9 F;  5FLX K;  4XRS G;  1FWZ A;  2EA4 A;  5DTD A;  1RIO H;  3VWB A;  4XID A;  2VI6 A;  4CDG A;  5CVR A;  4IEJ A;  1Z0X A;  2DFF A;  2XF6 A;  4O5V A;  1LVA A;  1UST A;  2L02 A;  3VYR B;  1PDN C;  1DPU A;  1G4D A;  2EFQ A;  2JSC A;  1RC9 A;  2QBY A;  3TO9 A;  3E5U A;  2QCO A;  3CJN A;  1TW3 A;  3QOD A;  3CCE I;  2M4G A;  3FDY A;  5GAE J;  2I8D A;  3W2W A;  2HI3 A;  4HRI A;  4U87 A;  3FKI J;  3RKY A;  1JE8 A;  2Y31 A;  2QSF X;  3C3W A;  3JW4 A;  3KYD B;  1FOY A;  4G12 A;  2EFP A;  2KMU A;  2R92 J;  3DTK A;  5FRN A;  1D0X A;  3RJP A;  3IWZ A;  2PI0 A;  4L18 B;  1G3T A;  3VFZ A;  2FA5 A;  4PFO A;  4D0P A;  3GWZ A;  4CYC B;  2HZT A;  3LAP A;  4ZTJ A;  4A3G J;  2P7C B;  3JRF A;  5HLH A;  3F8C A;  4I0B A;  1U78 A;  4M3D A;  2GOM A;  3E7L A;  1TL8 A;  1E2X A;  2GXB A;  2HXO A;  1UB9 A;  2CRG A;  4LLL A;  2XRL A;  1FIP A;  3CUO A;  4BEH B;  5LEJ A;  4MFD A;  2OTJ I;  3LA2 A;  1LPQ A;  3QYE A;  1XSD A;  1LDJ A;  1JJ6 C;  3DKW A;  1RI7 A;  3MCZ A;  4AIH A;  1SVO A;  3AKZ A;  2X51 A;  1ERD A;  4CCN A;  5ERI A;  3F9K A;  2HTS A;  3Q9S A;  1MMG A;  3LSJ A;  3CMM A;  1S3J A;  4M3B A;  2HDD A;  4C30 A;  1XPX A;  5FKO A;  1KU3 A;  3PO2 J;  4HF1 A;  4F7Z A;  1EV7 A;  5K5O A;  1T2K A;  4OWR B;  1W36 C;  2ZC2 A;  3GME A;  1LNW A;  1QU3 A;  5K7H A;  2KDZ A;  5L3B A;  1XDS A;  1FP2 A;  1X3Z B;  2XKO A;  4F93 B;  3HTU A;  1WZ2 A;  2Q2E B;  2F4O B;  4CYC A;  2EA2 A;  3F6V A;  2GM4 A;  1KU9 A;  3AFH A;  5FGM A;  1R58 A;  3KEY A;  1FZP B;  3SHF A;  3EPZ A;  2LLK A;  2BHY A;  3PSI A;  2STT A;  2HYF A;  3QOP A;  5BPI A;  1LKX A;  3BCA A;  4PJN A;  2PEX A;  4BEH A;  2BHZ A;  5HS9 A;  1ZLJ A;  5DDG A;  2V79 A;  1T56 A;  3K69 A;  5E18 F;  3F6O A;  3KP5 A;  3CME I;  4KIG A;  1Z6T A;  4P1W A;  1PUF B;  4MGR A;  1JTY A;  3VOE A;  1VQ5 I;  3UNG C;  2R5Y B;  3OYK A;  2ZJP F;  1YW9 A;  3BTL A;  3GUD A;  4WCG A;  5K5R A;  2IBD A;  2X6Y A;  1Q1V A;  4ZJZ A;  3WGG A;  3BR3 A;  1R1U A;  2WC2 A;  4Y33 A;  1N78 A;  1SAN A;  1K4S A;  3KLN A;  2LF8 A;  3FIW A;  4G6T B;  1KQ0 A;  1XN7 A;  2VLA A;  1REP C;  2XSD C;  1BJA A;  5D4S A;  2W25 A;  5H2F C;  3MZY A;  2JJ7 A;  2Q2E A;  1YJN I;  4S04 A;  2HS5 A;  5GAG J;  3BOQ A;  3F72 A;  3MD2 A;  4BY7 J;  1IW7 F;  1SFU A;  3ZCO A;  3Q9V A;  2DMQ A;  4M3G A;  1T38 A;  4YFX F;  2EIJ H;  5EEH A;  2NVX J;  3K2Z A;  4X0G A;  2DFI A;  2W7N A;  3JSP A;  4YIF A;  2E2J J;  4DBR A;  5CJ9 A;  3U21 A;  1JTX A;  3FM5 A;  2CO5 A;  4PK4 A;  3CZ6 A;  4LFU A;  4L0Y B;  1PUF A;  3M3Y J;  5IPA A;  1FBS A;  2K9N A;  1D0Z A;  3FXK A;  1LDK B;  3JRI A;  2R5Y A;  2Y0S A;  1PP8 F;  5M3M J;  2ESH A;  3S17 J;  1WH7 A;  4A3B J;  4KDP A;  3HOT A;  2XGX A;  4IL6 C;  4RDU A;  5IP9 J;  1JKP C;  1FTT A;  3H3V K;  2Y9Y A;  1X4P A;  3KCC A;  1NK2 P;  1PYV A;  3D5S C;  4XMY A;  4UVB A;  3ZMD A;  1MKM A;  1WJB A;  4U0W A;  1BW6 A;  1YS7 A;  3GZN B;  2VBY A;  4Q48 A;  2L9S A;  3OIP A;  3CC2 I;  5FO5 A;  4IHW A;  4ZYE A;  3X2Q H;  2CFX A;  3CO7 C;  4BDZ A;  2ZME C;  1V5G A;  4OIO F;  4HG2 A;  1ZTR A;  4BE2 A;  3GTM J;  3FXO A;  4LLN A;  4UUT A;  2ELH A;  3K4K A;  1BJZ A;  4II2 A;  3HRM A;  5ICE A;  1YYV A;  3S32 A;  2VBX A;  3U1K A;  4P96 A;  2RQQ A;  3GFM A;  4G7H F;  4B8X A;  2AXT C;  2G7H A;  3RKQ A;  2EPF A;  1JI8 A;  5E8I A;  3LAJ A;  1S7O A;  4BU2 A;  1Z7U A;  4KIT B;  5TJJ A;  4RB0 A;  4YIR X;  3CUQ B;  2ZJR F;  2XAF A;  2LC2 A;  1JHH A;  3M8F A;  2R7W A;  2LY1 A;  1RUO A;  2E7X A;  2Y0M A;  5D5U B;  1KYW A;  2JRM A;  1BN5 A;  1I1S A;  1A36 A;  4RB3 C;  4HDU A;  3V4G A;  1KQ9 A;  2AQF A;  2E2H J;  3ECH A;  3BC8 A;  2LF7 A;  2COB A;  3MFK A;  4X1E A;  3MKY B;  3G1L A;  3N05 A;  4CCO A;  1D1A A;  5DM7 F;  2DAO A;  4S05 A;  1HA8 A;  2UWM A;  2DLL A;  1U3E M;  1R22 A;  4PGH A;  2GLO A;  1OCP A;  2GZW A;  2V1N A;  2ZJ2 A;  1BL0 A;  3JRB A;  2PMH A;  4JYK A;  1FLI A;  5J4Y A;  4ANJ A;  4L5E A;  4IX7 A;  5C4X J;  2M8E A;  3LSH A;  2FOW A;  4RM2 A;  1U5T B;  3W2A A;  4Y4R A;  4IQ4 A;  1D5V A;  3QU3 A;  4BJT A;  4M3E A;  4ESF A;  2MFZ A;  2FXA A;  1LE8 A;  2OCE A;  1FPQ A;  1X1P A;  1GXP A;  1BR1 A;  2VBZ A;  3DPT A;  3GTO J;  1IN5 A;  4BQO A;  1IRZ A;  2F5V A;  1JUP A;  5D8K B;  3CUQ A;  3A02 A;  1ZG5 A;  3S1N J;  4UNO A;  2MW8 A;  3IUO A;  3E0J B;  1U9N A;  4DW6 A;  1I39 A;  3O8G A;  1A6I A;  3OOP A;  2H1L A;  3KEQ A;  1IZ1 A;  3P5J A;  4MLO A;  1T33 A;  3EUA A;  2DQR A;  3I55 I;  3COA C;  1M1E B;  5LRS A;  2LKX A;  1IRG A;  1W5T A;  4CCJ A;  4DZJ A;  2DYR H;  4L0Z B;  2ZO4 A;  3KP7 A;  2MAB A;  2OBP A;  2COM A;  3BQZ A;  3IHU A;  2ID6 A;  2OQG A;  4C2M J;  1ETW A;  4ON0 A;  1R5I D;  3V8L A;  4LGW A;  2BEO A;  3V7S A;  3WTW C;  2LR8 A;  1U5T A;  1NK3 P;  2EV5 A;  2E36 A;  4XSX F;  3R61 A;  3G1O A;  5DD8 A;  5A2Q Z;  2F5D A;  1MNE A;  5K1Y A;  3TP0 A;  4ZDP A;  5HNF A;  4BAC A;  3HDD A;  3GFI A;  2KRH A;  2B63 J;  1MDM B;  2XF5 A;  3IRR A;  3WU2 C;  3R0A A;  3MVP A;  3C7J A;  3HKZ N;  2CS3 A;  1WJC A;  1XX5 A;  1XB4 A;  5FLV A;  1Z21 A;  1YOV B;  2DK5 A;  3HXL A;  1W7P D;  3WTZ A;  2Z16 A;  5EZG A;  5K5Q A;  2NXN B;  3QP6 A;  4QLC U;  3TED A;  2L5Q A;  3H5R A;  4Q5S F;  2L7M P;  4LB6 B;  1AA7 A;  4AUX A;  2HZD A;  4A6E A;  1XSV A;  3VSK A;  3LQR A;  1J7K A;  2QKL B;  1Y8Q B;  4RGX A;  4E7I A;  4D1Q A;  1TT5 B;  2A5Y B;  4K2E A;  4KN7 X;  2LP0 A;  4WXH A;  2HEO A;  1XS9 A;  1X1B A;  2LY9 A;  3T5X A;  2DPU A;  2VKH A;  2PN6 A;  3M8J A;  4A2U A;  1YFH A;  4EM0 B;  4BL0 B;  2ACJ A;  2MSY A;  2MH9 A;  4FE4 A;  4M3F A;  4D9J A;  1FTZ A;  5J1R A;  4OIN F;  1WHU A;  1XMX A;  1D3Y A;  1NH3 A;  1MDM A;  2PJR A;  4M6V A;  2NNY A;  2BY3 A;  3WOD F;  1O3Q A;  1QPI A;  1FOK A;  2X1D A;  6PAX A;  4RB2 C;  1KON A;  1Y0N A;  2HVQ A;  2BE5 F;  3R60 A;  3BZC A;  5FRO A;  4CCK A;  3S3O A;  1YLF A;  3IAS 2;  3AG4 H;  3CF5 F;  5DYM A;  3AG3 H;  2WY8 Q;  4C3J J;  2BVL A;  2EFW A;  2YX4 A;  2V9P A;  4EVI A;  3LWF A;  1MH4 A;  1S9H A;  2TDX A;  2H6C A;  4B1R A;  1LFP A;  1WRJ A;  4DIQ A;  1OFC X;  5D8L B;  1UZC A;  3GYH X;  5F0C A;  2KLO A;  4CH7 A;  4HNV A;  2CV2 A;  2NAZ A;  3ABM H;  4N9I A;  4U7D A;  5B1A H;  4A0Y A;  3OYN A;  5M5W J;  2VL8 A;  3I58 A;  1QGP A;  1MW7 A;  3FX3 A;  3CMY A;  3OYH A;  4I09 A;  4RGU A;  1HKQ A;  4LMY A;  4XKC A;  4ZC3 A;  4L9V A;  3HJE A;  1FYL A;  3F8B A;  2VB6 A;  3MQ0 A;  1OCR H;  4YII A;  2BZT A;  3CDL A;  3R4K A;  4U88 A;  4QSH A;  1ZKG A;  1I1G A;  3WGI A;  2C6Y A;  3RDI A;  3TO6 A;  1UCR A;  1QQI A;  1WKM A;  2XPV A;  4CIC A;  3BG7 A;  1C0W A;  2XSJ C;  3KPH A;  3J7Z I;  2M34 A;  3N97 A;  3LST A;  3U1D A;  3LA3 A;  4JOM A;  1TTY A;  2ZB9 A;  4KIS A;  3DPU A;  4BBR J;  2H94 A;  3S1Q J;  3E6M A;  5LHI A;  1MSE C;  2WTE A;  2IGM A;  4E4H A;  2XC7 A;  4A12 A;  3DFG A;  1B4A A;  3Q3S A;  4HNU A;  3HPH A;  4EGY A;  4PSX A;  3O8H A;  4GFB A;  3D5L A;  1RZ4 A;  3MKW B;  4EMS A;  3K1M A;  4R8H A;  3WTU C;  5E79 C;  2K27 A;  3VSL A;  3FMS A;  4XLH A;  3WTT C;  1YG2 A;  5CVJ A;  4LIV A;  3HOW J;  1VQ6 I;  3BZ6 A;  3ASO H;  1J09 A;  3JSO A;  4OAY A;  4DBQ A;  3RPU D;  3RPQ A;  1VND A;  2FOK A;  2HOS A;  4KFC A;  1XDU A;  3LL7 A;  4Y15 A;  5HDN A;  5H20 A;  3IKT A;  1WJ5 A;  1O7L A;  3K4L A;  4FT8 A;  2ZCW A;  3PNT A;  3G1M A;  3HOZ J;  4MO7 A;  1W0T A;  2DT7 B;  2WB1 A;  2P6T A;  1I6X A;  1I50 J;  2HFH A;  3PNV A;  3J80 K;  3OYC A;  3ZQF A;  4M72 A;  1IV8 A;  4HA8 A;  5J1Y A;  2DFH A;  5HLI A;  4GCV A;  2L2O A;  1KYZ A;  2VOO A;  2MLK A;  1FBQ A;  2WAE A;  2VJ5 A;  4KA4 A;  1T39 A;  1H9T A;  4XRM A;  2BXZ A;  2X6W A;  1YW7 A;  3S2H J;  3FK6 A;  5LGN A;  1JUS A;  3CD6 I;  4P9U A;  3KZY A;  1R7J A;  1EH6 A;  5LD2 C;  4YEL A;  3G6E I;  2LNB A;  3EUH C;  4A5M A;  2DA6 A;  2ECB A;  3BY6 A;  4KIF A;  3ZRG A;  4B47 A;  2Z9O A;  3AG1 H;  3BLY A;  2VT3 A;  4FHT A;  2LVS A;  4IRG A;  1P4A A;  1HDD C;  2K9L A;  2DA5 A;  3IC7 A;  2IW5 A;  3PFI A;  3ZOB A;  1EA3 A;  1N77 A;  5IY5 H;  5HDK A;  3OS0 A;  3Q0V A;  4IVN A;  3MEX A;  2DA1 A;  1J0R A;  4IHV A;  3FHN A;  1XGO A;  2Y0S N;  2X1C A;  1TC3 C;  3B6A A;  3E6B A;  3WHB A;  3JTG A;  2DOF A;  5FRM A;  4BY1 J;  4JX4 A;  2OTL I;  2W48 A;  1O57 A;  2JK3 A;  3RTR A;  3CO6 C;  4IO9 F;  1APL C;  3OWT A;  4Z2Y A;  2TRT A;  3FXJ A;  1Z3Y A;  5E3L A;  3S15 J;  4XOR A;  3CC7 I;  3BJA A;  2EIM H;  2ME6 A;  3AL0 C;  2LTP A;  2FU4 A;  2QQ8 A;  2WV1 A;  2HOE A;  1MD0 A;  2V9K A;  1YE9 A;  2KP6 A;  1V3F A;  4IF4 A;  2LYC A;  5FD5 A;  4EJO A;  2K5C A;  3DPL C;  1VQK I;  3MKL A;  3F21 A;  3JAM Z;  3I4M J;  2UXX A;  1MJ9 A;  2HQ5 A;  4A3M J;  2LKP A;  1H88 C;  1PVE A;  4ZYG A;  2HTJ A;  1ORK A;  4EJW A;  4KT5 C;  5E3N A;  1BIA A;  2X0L A;  4P55 A;  2KRF A;  2E1O A;  5E1W A;  2VJ4 A;  3KZZ A;  2DOE A;  3N4M A;  5BPD A;  2XRO A;  3MKZ A;  2ZFW A;  1XGS A;  1KQ8 A;  3I0T A;  3OYF A;  2IT0 A;  4FE7 A;  3S93 A;  2OAZ A;  4Y3O A;  5ED4 A;  3OYE A;  1WFX A;  3WU1 B;  4X6A J;  3QPH A;  1X1D A;  2FNA A;  1BOB A;  2CQ7 A;  2LDU A;  2QF7 A;  4IHX A;  1L0O C;  3BR5 A;  2X85 A;  3ZQL A;  3CCQ I;  4IHT A;  3L2C A;  2M0M A;  5E20 A;  4ENM A;  1FSE A;  2NVY J;  1J5Y A;  4LG3 A;  3ZGK A;  1BW5 A;  1B8I B;  2HGC A;  2MD0 A;  2M2E A;  3VDX A;  5TRD A;  2IS1 A;  3H1C A;  4LLG F;  1VQ8 I;  3ZPL A;  2XRN A;  1GVJ A;  5J8C A;  3L9F A;  3JRD A;  3W6V A;  3CP2 A;  3K1N A;  2W57 A;  3LFU A;  4HX4 A;  2EQR A;  3BTC A;  3E6D A;  2ECC A;  4YG2 F;  1ONV A;  2RVC A;  4V2G A;  3K70 D;  2A69 F;  4RAF A;  5C44 J;  3T1B A;  4IHS A;  2CQX A;  1V5F A;  2J5O A;  1IUY A;  4PDK A;  1YRN B;  4EJU A;  3IH4 A;  3CP8 A;  3BQY A;  1IN8 A;  2CQQ A;  1P2F A;  3OYG A;  2ISZ A;  2DTZ A;  2GWR A;  1LEB A;  4A3I J;  1R9T J;  1B72 B;  3SZP A;  3IP4 B;  3CCM I;  4ENJ A;  5IYD J;  2HQN A;  3CTA A;  5DCM B;  4E7J A;  2R7U A;  3BCB A;  1IN7 A;  2LK2 A;  2PG4 A;  3K4N A;  2E1M B;  3DLA A;  1I6H J;  4ITV A;  3MWM A;  4QPO A;  3F0C A;  3IWF A;  1OLT A;  1VQL I;  1CQT A;  5CVI A;  1B9M A;  2P81 A;  3F8N A;  1MIJ A;  1IXC A;  4FX4 A;  2O61 A;  2JUC A;  2YU3 A;  2AS5 F;  3EET A;  4XN3 A;  4CCL A;  4AIK A;  3GFL A;  3ECO A;  3TW7 A;  3QYF A;  2OZU A;  1SD5 A;  2BY1 A;  5J8F A;  3GZ5 A;  4ETS A;  3M8E A;  4AVP A;  1AU7 A;  5EZH A;  4I01 A;  4BUP A;  1S7A A;  1FBU A;  3LQQ A;  3F8F A;  3BRO A;  4XIC A;  4GXO A;  1YRN A;  4KIC A;  4OAZ A;  5BMZ A;  2V1D A;  2NVT J;  3F23 A;  2F4I A;  3WGH A;  1SC7 A;  3PO3 J;  1AKH B;  1Z7L A;  2Y2Z A;  1XD7 A;  1A31 A;  2XAH A;  5LGT A;  1B72 A;  2PLY A;  4ZYH A;  1HW5 A;  3HIF A;  5DCM A;  1ZGW A;  2E35 A;  4RMN A;  1O3S A;  2LRD A;  3HRS A;  4HV5 A;  3GTP J;  4UV8 A;  3I3L A;  2M7A A;  1RRJ A;  2HDW A;  2VIX A;  2KJB A;  1ETK A;  2HOA A;  2HQA A;  3QAH A;  3QWL A;  3K6G A;  4A0Z A;  3LSM A;  3U2R A;  5IT9 Z;  2HYG D;  5CKT A;  3OR1 C;  3ZN0 A;  3K9T A;  5HLG A;  1SFX A;  4V19 K;  4M74 A;  3PJR A;  5LGU A;  5BNG A;  2QEN A;  3CCU I;  4BH9 A;  2P8T A;  1SVM A;  4Y13 A;  1TBX A;  1S7E A;  2F5F A;  5HS8 A;  3LSR A;  1D8J A;  1H9G A;  1OQY A;  3JCU C;  1F1Z A;  3OS2 A;  3BR2 A;  5IYB J;  1AKH A;  3HOY J;  3BJ6 A;  3D0S A;  2NOJ B;  4CCM A;  5KAF C;  2R0Q C;  2XB5 A;  2ZJQ F;  3DF8 A;  3ERM A;  4AIJ A;  1IO2 A;  2HWV A;  3HRU A;  3FMR A;  3UR3 C;  1XSX A;  3K4J A;  4A0X A;  4ESJ A;  1X58 A;  3OIO A;  3DU6 A;  2WAQ A;  2LBF B;  1DPR A;  3DKX A;  1W0U A;  2MA3 A;  2OPT A;  3PQK A;  4EGZ A;  4IRH A;  3DXJ F;  4I0A A;  2K85 A;  2IGK A;  2LOO A;  1O3T A;  1WCM J;  1OCZ H;  5KHD A;  1TWG J;  2FUG 2;  3H36 A;  4HQM A;  4E7S A;  5DUI A;  5KNL A;  4C2U A;  2VOD A;  1MMN A;  3H92 A;  3HSE A;  5D6E A;  2CMP A;  4BQN A;  4Z6Y A;  3CCR I;  1K6O A;  1HF0 A;  1PJR A;  1U6G A;  2DMP A;  4KNY A;  3GEZ A;  5FLX Z;  3AAF A;  1YW8 A;  1ZRE A;  1MBH A;  3QOE A;  3T8T A;  2O6G E;  4DQ2 A;  3SZG A;  2GQQ A;  1FT9 A;  4XKB A;  4DOZ A;  5L3F A;  4NDL A;  5BS6 A;  3K1P A;  3DBR B;  1TWH J;  3DP7 A;  1GV2 A;  1MBJ A;  2VQH A;  3SZT A;  2EZL A;  2FBI A;  2DCE A;  3DWL E;  4CZZ A;  4GRI A;  1HST A;  1QBJ A;  2IRF G;  2KIU A;  4XRS A;  2P0W A;  5TIS C;  3ZQG A;  1LJ9 A;  5HOO A;  1D1C A;  4S0H B;  1BI0 A;  2L7Z A;  2FQ3 A;  4MEX F;  2VQG A;  4ZZD A;  1W4M A;  2V6E A;  1Z3X A;  2CUZ A;  2MBF A;  5L3D A;  3QP5 A;  2LBF A;  2JT1 A;  1R49 A;  2XHK A;  4KIB A;  4D5C A;  2ZXH A;  4TV7 A;  1TZL A;  4ABZ A;  1A5J A;  4G9Y A;  2KKO A;  2H27 A;  2DMN A;  4RAZ A;  3ROU A;  3H35 A;  3E3V A;  3L2Q A;  2BYV E;  2M3A A;  4EEF G;  3RQI A;  2DI3 A;  4HQE A;  2VAS A;  2OZ6 A;  4B43 A;  3TP3 A;  2M30 A;  1BBY A;  1IF1 A;  4NBQ A;  3D1N I;  2HKO A;  4HX8 A;  2V4J C;  1YI2 I;  4KJZ A;  5AIQ A;  1HBX G;  5LHG A;  1ZG1 A;  1K4T A;  3K4B A;  3FXQ A;  4NQW B;  1K7A A;  2DQL A;  3SXY A;  4EJT A;  2VBW A;  2R93 J;  4I98 B;  2WB1 N;  2Q0O A;  3MZH A;  1JUM A;  4BJ6 C;  2B9S A;  1Z05 A;  1ZN2 A;  3NQO A;  2QM3 A;  4A3E J;  3OSF A;  2BW3 B;  1HDP A;  1R1V A;  3M1E A;  3PNY A;  4G8X A;  1ZH5 A;  2D2W A;  3FMQ A;  4ZZL A;  2NYX A;  4JBA A;  2F5C A;  2BY2 A;  3NWS A;  3V8J A;  4I7H A;  2DFE A;  3ERE D;  1X1A A;  1KU2 A;  1ZGJ A;  3C2B A;  3JRE A;  1TNS A;  1TT0 A;  3DEU A;  1E3O C;  2F5E A;  1VF9 A;  1WJD A;  2EWN A;  3ZMV A;  2WAF A;  2XPU A;  2PX9 A;  4MIM A;  2CYY A;  2DT5 A;  4NC8 A;  1IN4 A;  5EDN A;  1SMY F;  1QPM A;  1BM9 A;  3GTJ J;  3K4C A;  3VYS B;  2YPR A;  3W6J B;  4RLQ A;  1FYM A;  1W5S A;  4G7Z F;  5DD4 A;  1DP3 A;  3CMA I;  3ULQ B;  3S8P A;  2EIL H;  5E17 F;  3ZQQ A;  4NQW A;  2KT0 A;  1I3A A;  2CFO A;  4IZZ A;  3ZP5 A;  1R5H A;  4CYD A;  4A3K J;  2FMY A;  4N4O B;  2V7F A;  4N4N B;  3OS1 A;  2FQ4 A;  1BC8 C;  4B09 A;  2ZXI A;  2BW3 A;  3JTH A;  4AM3 A;  2DA4 A;  4BHP A;  4CA0 A;  5L3E A;  2LMD A;  2ME0 A;  4D7N A;  1U5T C;  4A5N A;  2LSO A;  2Z2S B;  1CF7 B;  3BG9 A;  5IP6 A;  2ADU A;  1QVT A;  3PQJ A;  3PIP F;  2YUS A;  3K70 C;  4QTR A;  1JKQ C;  2VN2 A;  3S2W A;  1P4W A;  1ZEL A;  2A6H F;  4EAT A;  2EV6 A;  3DQV C;  3Q0W A;  3RIR A;  3BG6 A;  2IA0 A;  4CXF A;  1ZRF A;  5J3L A;  2ZSH B;  4AD9 A;  3S3N A;  3F8M A;  4BQQ A;  2KDO A;  2OC6 A;  3FXU A;  3HYI A;  3O3K A;  3RQ4 A;  5TGT A;  3HZJ A;  4B48 A;  1HSJ A;  1MBF A;  1GT0 C;  5CQE A;  2RC4 A;  4IQJ A;  4Q47 A;  3CES A;  1LFB A;  1ETY A;  3L00 A;  1Z91 A;  2HKX A;  2RKH A;  3CCS I;  3HTS B;  1RUN A;  1TQP A;  2DJI A;  4N0B A;  3NEU A;  1OCC H;  1GLN A;  4NC7 A;  2L7K A;  2QKM B;  4B3A A;  1MH3 A;  4KMU X;  4WWC A;  1D8K A;  3IH3 A;  4FIS A;  3SEQ A;  1T0F A;  4IPA A;  4D7M A;  4PCQ A;  4BXF A;  5E3O A;  3UKG A;  1MSF C;  5IOY A;  4QPQ A;  3A0B C;  3LFK A;  3OL4 A;  3QPS A;  1MGT A;  3RZD J;  5EYR A;  3CQZ J;  3I5U A;  1CF7 A;  2HVR A;  3H9Q A;  2NVQ J;  1YHQ I;  2JA8 J;  2CUE A;  4Y17 A;  5GPA A;  2FJ1 A;  2PBI A;  1MNM C;  5EGO B;  3GVA A;  3Q0U A;  4II3 A;  4KN4 X;  5F0F A;  3TBI A;  1TNT A;  2F48 A;  1IG7 A;  3KYL A;  4XOT A;  2YR2 A;  1YS6 A;  2F6C A;  4A3L J;  1R1T A;  3TL4 X;  1BIB A;  4HV6 A;  4PZJ A;  1KGS A;  2ZKZ A;  5IOZ A;  2IA1 A;  2N8G A;  4UB6 C;  3GW2 A;  4MTE A;  4RB1 A;  3TKY A;  4AU7 A;  2FRH A;  1FC3 A;  2XGD A;  1QVU A;  3CC4 I; 
#chains in the Genus database with same CATH homology
 2R7D A;  4BYY A;  3FHZ A;  1LQ1 A;  2IP2 A;  2DU9 A;  2KJC A;  3GO5 A;  4XLN F;  2XAS A;  5F1R A;  2BV6 A;  2R7F A;  1TQI A;  1T98 A;  5D4R A;  3TOB A;  1A04 A;  3HHH A;  4HLY A;  1J75 A;  5KK1 A;  4UUV A;  2HDC A;  4RAY A;  3RKX A;  1B59 A;  4OIP F;  4HX7 A;  5AIP A;  3JAM K;  4P5O A;  1V4R A;  1ULY A;  2BBY A;  4WXD A;  1WQ2 A;  3GZ6 A;  5AON A;  1BI1 A;  2E1C A;  1KA8 A;  2W84 A;  1J2X A;  1U2W A;  2CQK A;  1WSU A;  1JXS A;  4OOI A;  2XKP A;  2JZY A;  2O3F A;  4RGR A;  1OYI A;  1ZLK A;  3I71 A;  4LK0 F;  4HYE A;  3WTV C;  3ZMS A;  1GHC A;  1S8N A;  2X4H A;  4MNU A;  4MTD A;  5LBQ A;  2Z33 A;  1O7F A;  2OU2 A;  3H3Z A;  3C1D A;  5BOX A;  2MD5 A;  5L3G A;  2R3S A;  4NB5 A;  4MEY F;  1SD4 A;  3ZN1 A;  2V6C A;  2OQR A;  1OR7 A;  2A6E F;  2PMU A;  2GA1 A;  1I5Z A;  2RGV A;  3FF5 A;  4OMY A;  3MAJ A;  2CW0 F;  4U0Y A;  2L01 A;  2RNJ A;  4BHC A;  1ZHF A;  3W6K B;  1QNT A;  4ZH4 F;  3IRQ A;  2M5W A;  4L5I A;  5E8G A;  2EFN A;  1P92 A;  1ODD A;  1P6R A;  1R36 A;  5IT3 A;  2G7U A;  5LEK A;  3SQN A;  5FB2 A;  4MQV A;  2Y48 A;  4L9J A;  3P9C A;  3ABU A;  5EEG A;  3V7C A;  1L3L A;  4E70 A;  4L9N A;  2QQ9 A;  3TDZ C;  3ABT A;  5HS7 A;  5JI6 A;  3EDP A;  4M6Y A;  2P5K A;  5FFX A;  3GXO A;  4AWX B;  1IN6 A;  3CLO A;  2VON A;  4FX0 A;  2L4A A;  1PP7 U;  1TLH B;  2K86 A;  1B9N A;  2HQR A;  3IKV A;  4QWQ A;  4IXA A;  2QQB A;  1F5T A;  1K78 B;  4G6D A;  1W7P B;  4P9F A;  4OU0 A;  1E17 A;  1JHF A;  2FML A;  2K4J A;  5JHU A;  3I54 A;  4I2O A;  2Z99 A;  3M7G A;  2G9W A;  2Z5U A;  2OA4 A;  2ZNY A;  4Q4Z F;  3J81 Z;  3E97 A;  1FYK A;  3P7N A;  2PJP A;  2CG4 A;  2W24 A;  1XMA A;  3HOS A;  4DNC A;  3R0J A;  3EQL F;  1ZGA A;  4WF2 A;  1K78 A;  5JVT A;  1W7P A;  4CGZ A;  1Z1D A;  5ILS A;  4NHJ A;  4N9H A;  4CO8 A;  4XLP F;  3FZV A;  2QWW A;  2IJL A;  1FP1 D;  2P6S A;  1MJA A;  1NHA A;  3J7A O;  3FXR A;  3TGN A;  3J80 Z;  2WV0 A;  3R6S A;  1YTY A;  3I4P A;  1ZAR A;  3QRF F;  3EYY A;  2EFO A;  4G6Q A;  3FM3 A;  2CSO A;  4R1H A;  4EM1 A;  3B02 A;  4UHT A;  2D1V A;  3V7R A;  1H0M A;  4RS8 A;  4M9X A;  4XSZ F;  2GXG A;  2V1U A;  4M6X A;  1I27 A;  3GFJ A;  2UZK A;  2QYO A;  3OV8 A;  3FWE A;  2MC3 A;  3U9G A;  1ZG3 A;  2D1H A;  1LDD A;  1LB2 A;  3BDD A;  1OKR A;  1ZRD A;  2FE3 A;  3KP2 A;  5E1X A;  3F22 A;  1TW2 A;  3Q5F A;  5DEQ A;  3B73 A;  3KP6 A;  1Z9C A;  2QUF A;  4PGG A;  1IXR C;  5CVU A;  1X3U A;  1T6S A;  2NS0 A;  5F64 A;  4I02 A;  2YX7 A;  4M73 A;  3KLO A;  1P4X A;  2ESN A;  3KE2 A;  4EQQ A;  3REO A;  2FEZ A;  1G3W A;  3HSR A;  5A2Q K;  1IXS B;  1HXD A;  2O03 A;  2ZME B;  4XRF A;  3RPU A;  2RQP A;  1F9N A;  4O3M A;  2JPC A;  1OYW A;  2KIF A;  5BQT A;  1FY7 A;  2UXN A;  3DV8 A;  1FSH A;  1RNL A;  3RYP A;  3F3X A;  3E5X A;  4UXN A;  1IRF A;  4KUM A;  2V1X A;  4JK1 X;  1R23 A;  1XGN A;  4M9Z A;  1HW2 A;  3T8R A;  4LG0 B;  3BWG A;  3RYR A;  1QZY A;  3EYI A;  1HKS A;  2K02 A;  2EK5 A;  4M9S A;  1HW1 A;  2XVC A;  4XBF A;  2ZME A;  4U0V A;  1BI3 A;  2ISY A;  2RN7 A;  4HBL A;  3BPV A;  5ILU A;  4HDV A;  4L9T A;  2A61 A;  3ZMT A;  1B1B A;  4LG0 A;  4EM2 A;  1KU7 A;  2M1B A;  2XAG A;  1XCV A;  4LD5 A;  1R5G A;  5CYV A;  1ON2 A;  5H6Q A;  3TQN A;  2CWE A;  4GO1 A;  4LB5 A;  2W85 A;  4HF2 A;  3BJO A;  1SD7 A;  3T0Y A;  4ESB A;  2EV0 A;  1G3Y A;  4UVC A;  3RI4 A;  3CUQ C;  3L09 A;  1XCB A;  4A6D A;  1MZB A;  5LRR A;  3KP4 A;  4KYW A;  2M45 A;  2JTV A;  1YO5 C;  1SD6 A;  4L5J A;  2DK8 A;  5F6F A;  2NNN A;  4ZYD A;  3TOA A;  1EH7 A;  2CGP A;  1GXQ A;  2ZNZ A;  2ZBK A;  2DW4 A;  3WU0 A;  2JPB A;  3H3U A;  2Q8K A;  3WTY C;  2FF4 A;  3ELK A;  2XUB A;  2A07 F;  3P9K A;  3BP8 A;  3I64 A;  2IVM A;  5ICG A;  1B6A A;  4O6J A;  5DV5 A;  5LHH A;  2J5P A;  4HLX A;  1ZAO A;  1G3S A;  2DTR A;  5ICC A;  1SFE A;  4ASN A;  1S6L A;  1QO0 D;  4BNC A;  2L3D A;  4WXC A;  2Z3Y A;  3V8K A;  3HUG A;  1BI2 A;  1SMT A;  5ILV A;  1XMK A;  4IRI A;  2O0Y A;  5E1Z B;  4YFK F;  4OIR F;  1R00 A;  2F2E A;  4GYI A;  1MJB A;  2DO7 A;  2M87 A;  3WG9 A;  2VC0 A;  4HAM A;  3G3Z A;  2XV4 S;  3KFW X;  3SFZ A;  3HHG A;  1TQM A;  3ML6 A;  2A68 F;  5CLS A;  1ON1 A;  2GAU A;  2RDP A;  4WX9 A;  2H09 A;  1G6N A;  4U7B A;  2L54 A;  3RKW A;  2FSW A;  3CDH A;  1ZYR F;  2BGC A;  3ISP A;  5KVR A;  2KIM A;  4RGS A;  4G7O F;  4ENK A;  2VOP A;  2D45 A;  3KET A;  1DUX C;  1AWC A;  4BAY A;  5JFR A;  3C18 A;  2L4M A;  2H6B A;  3ZQ7 A;  2MLG A;  4UV9 A;  4KMF A;  2ZXJ A;  2XAQ A;  5D5X B;  4OIQ F;  2QLZ A;  1USS A;  5ICF A;  2K7L A;  3O6B B;  2RV8 A;  4G94 A;  5FD6 A;  1ZRC A;  2FBK A;  1CGP A;  2A3S A;  2IA2 A;  5D5V B;  5DUK A;  1OMI A;  3I53 A;  5HVQ C;  2XIG A;  1WWX A;  5H6R A;  3J81 K;  1K79 A;  1EH8 A;  3IL2 A;  2P5V A;  1HKT A;  2Y75 A;  4JQF A;  3QPT A;  4HZF A;  1Q1H A;  1STZ A;  1U8R A;  3NRV A;  1BC7 C;  3WTS C;  2VE9 A;  4R79 A;  3GX4 X;  2AXL A;  5L3C A;  5DCF A;  4BHB A;  1SAX A;  2NRA C;  1UHW A;  4EJV A;  1PUE E;  3O2P E;  5JR3 A;  2FBH A;  2HR3 A;  2OD5 A;  2IPQ X;  5D6F A;  2ETH A;  2DBB A;  1FX7 A;  1LEA A;  2DPD A;  2VT2 A;  2YSR A;  1J9I A;  1Z6R A;  1UHM A;  2PFB A;  4MHG A;  3ZMZ A;  3K0L A;  2XAJ A;  3VB2 A;  2GA2 A;  4HF0 A;  3TO7 A;  5LLQ A;  3WE3 A;  1YQA A;  3L7W A;  1OPC A;  2E1N A;  3WTX C;  1WI9 A;  5D5W B;  1VTN C;  5HDG A;  2JRT A;  4CHU A;  2K4B A;  4WK8 F;  1DP7 P;  1FNN A;  2EB7 A;  3E5Q A;  4LJZ F;  4GYG A;  2P4W A;  3EUH A;  3HSF A;  2VC1 A;  2VE8 A;  3LA7 A;  1OYY A;  3P9I A;  4HW0 A;  2QVO A;  1BOA A;  3WE2 A;  1DDN A;  3GF2 A;  1Y0U A;  3E6C C;  5FFZ A;  1JGS A;  4IJA A;  3QU6 A;  4LK1 F;  4HOB A;  3TDU C;  2QQA A;  3VEP A;  2MH2 A;  4H0E A;  1O3R A;  1QZZ A;  5IT9 K;  3I59 B;  1UFM A;  4EV0 A;  2EJR A;  1J59 A;  3G73 A;  3HRT A;  2B0L A;  5CVV A;  2QZ8 A;  2GIV A;  2PQ8 A;  2V9V A;  2VXZ A;  3BPX A;  3GLX A;  1YIO A;  3KEO A;  4GGG A;  2WWY A;  4YFN F;  1S29 A;  4UVA A;  2QBY B;  1HQC A;  3KP3 A;  2O8X A;  4OMZ A;  2E7W A;  2STW A;  2P7V B;  1AOY A;  1F4K A;  3M9A A;  5J6X A;  3ZMU A;  3I59 A;  3VOD A;  4ENN A;  1IAW A;  4M71 A;  2P5L C;  2FNP A;  4BXU A;  1XGM A;  4BQA A;  4MQ9 F;  5FLX K;  1FWZ A;  2EA4 A;  1RIO H;  4CDG A;  5CVR A;  4O5V A;  1LVA A;  1UST A;  2L02 A;  1PDN C;  1DPU A;  1G4D A;  2EFQ A;  2JSC A;  2QBY A;  3TO9 A;  3E5U A;  3CJN A;  1TW3 A;  3RKY A;  1JE8 A;  3C3W A;  3JW4 A;  2EFP A;  4L18 B;  3RJP A;  3IWZ A;  2PI0 A;  1G3T A;  3VFZ A;  2FA5 A;  4D0P A;  3GWZ A;  2HZT A;  3LAP A;  2P7C B;  5HLH A;  3F8C A;  4I0B A;  1U78 A;  1E2X A;  2GXB A;  1UB9 A;  4LLL A;  3CUO A;  5LEJ A;  3LA2 A;  1XSD A;  1LDJ A;  3DKW A;  1RI7 A;  3MCZ A;  4AIH A;  5ERI A;  2HTS A;  3Q9S A;  1S3J A;  1KU3 A;  4HF1 A;  4F7Z A;  1EV7 A;  5K5O A;  1T2K A;  1LNW A;  5L3B A;  1XDS A;  1FP2 A;  2XKO A;  3HTU A;  2EA2 A;  3F6V A;  1KU9 A;  5FGM A;  1R58 A;  1FZP B;  3SHF A;  2STT A;  2HYF A;  3QOP A;  5BPI A;  2PEX A;  5HS9 A;  1ZLJ A;  5DDG A;  2V79 A;  3K69 A;  5E18 F;  3F6O A;  3KP5 A;  4KIG A;  1Z6T A;  4MGR A;  3VOE A;  1YW9 A;  3GUD A;  4WCG A;  5K5R A;  3WGG A;  1R1U A;  2WC2 A;  3KLN A;  2LF8 A;  1KQ0 A;  1XN7 A;  1REP C;  1BJA A;  5D4S A;  2W25 A;  3MZY A;  2Q2E A;  4S04 A;  2HS5 A;  3BOQ A;  3F72 A;  1IW7 F;  1SFU A;  3Q9V A;  1T38 A;  4YFX F;  5EEH A;  3K2Z A;  2DFI A;  3JSP A;  4YIF A;  5CJ9 A;  3FM5 A;  2CO5 A;  4LFU A;  4L0Y B;  1FBS A;  1LDK B;  1PP8 F;  2ESH A;  4KDP A;  3HOT A;  2XGX A;  3KCC A;  4UVB A;  3ZMD A;  1MKM A;  4U0W A;  1YS7 A;  2VBY A;  4Q48 A;  5FO5 A;  4ZYE A;  2CFX A;  3CO7 C;  4OIO F;  4LLN A;  2ELH A;  3HRM A;  5ICE A;  1YYV A;  2VBX A;  4P96 A;  3GFM A;  4G7H F;  4B8X A;  2G7H A;  5E8I A;  3LAJ A;  1S7O A;  1Z7U A;  5TJJ A;  4RB0 A;  3CUQ B;  2XAF A;  1JHH A;  3M8F A;  1RUO A;  2E7X A;  2Y0M A;  5D5U B;  1KYW A;  1BN5 A;  1I1S A;  4RB3 C;  4HDU A;  3V4G A;  1KQ9 A;  3ECH A;  2LF7 A;  3MFK A;  2DAO A;  4S05 A;  2UWM A;  2DLL A;  1U3E M;  1R22 A;  4PGH A;  2GZW A;  2ZJ2 A;  2PMH A;  1FLI A;  2M8E A;  1U5T B;  1D5V A;  3QU3 A;  4ESF A;  2FXA A;  1FPQ A;  1GXP A;  3DPT A;  2VBZ A;  1IN5 A;  5D8K B;  3CUQ A;  1ZG5 A;  4UNO A;  3OOP A;  3KEQ A;  1IZ1 A;  3COA C;  1IRG A;  2DQR A;  5LRS A;  1W5T A;  4L0Z B;  2ZO4 A;  3KP7 A;  2OBP A;  2COM A;  3IHU A;  2OQG A;  4ON0 A;  3V8L A;  4LGW A;  2BEO A;  3V7S A;  3WTW C;  1U5T A;  2EV5 A;  4XSX F;  3R61 A;  5A2Q Z;  5DD8 A;  2F5D A;  5K1Y A;  3GFI A;  1MDM B;  3IRR A;  3R0A A;  3C7J A;  1XB4 A;  2DK5 A;  1W7P D;  3WTZ A;  5K5Q A;  3QP6 A;  4QLC U;  4Q5S F;  4LB6 B;  4A6E A;  1XSV A;  3LQR A;  1J7K A;  4RGX A;  4K2E A;  2A5Y B;  4KN7 X;  4WXH A;  2HEO A;  3T5X A;  2DPU A;  2PN6 A;  4A2U A;  1YFH A;  4EM0 B;  2ACJ A;  2MH9 A;  4OIN F;  1D3Y A;  1MDM A;  2NNY A;  1O3Q A;  3WOD F;  1FOK A;  6PAX A;  4RB2 C;  2BE5 F;  3R60 A;  1YLF A;  5DYM A;  2EFW A;  2YX4 A;  4EVI A;  3LWF A;  2TDX A;  2H6C A;  1WRJ A;  5D8L B;  3GYH X;  2NAZ A;  4U7D A;  4N9I A;  4A0Y A;  3I58 A;  1QGP A;  3FX3 A;  4I09 A;  4RGU A;  1HKQ A;  4LMY A;  4L9V A;  1FYL A;  3F8B A;  3MQ0 A;  4YII A;  3R4K A;  4U88 A;  1I1G A;  3WGI A;  2C6Y A;  3RDI A;  3TO6 A;  1UCR A;  1QQI A;  1WKM A;  4CIC A;  1C0W A;  3N97 A;  3LST A;  3U1D A;  3LA3 A;  1TTY A;  2H94 A;  3E6M A;  5LHI A;  2WTE A;  4A12 A;  3DFG A;  1B4A A;  4EGY A;  3D5L A;  1RZ4 A;  4EMS A;  3K1M A;  4R8H A;  3WTU C;  2K27 A;  3FMS A;  3WTT C;  1YG2 A;  5CVJ A;  3BZ6 A;  3JSO A;  3RPQ A;  2FOK A;  4KFC A;  1XDU A;  4Y15 A;  5HDN A;  5H20 A;  3IKT A;  1O7L A;  4FT8 A;  2ZCW A;  2P6T A;  1I6X A;  2HFH A;  3J80 K;  4M72 A;  4HA8 A;  5HLI A;  4GCV A;  1KYZ A;  2VOO A;  2MLK A;  1FBQ A;  1T39 A;  4KA4 A;  1H9T A;  1YW7 A;  5LGN A;  4P9U A;  3KZY A;  1R7J A;  1EH6 A;  2LNB A;  4A5M A;  3BY6 A;  4KIF A;  2Z9O A;  2VT3 A;  4FHT A;  4IRG A;  1P4A A;  3IC7 A;  2IW5 A;  3PFI A;  5HDK A;  4IVN A;  3MEX A;  1J0R A;  1XGO A;  3E6B A;  3JTG A;  1O57 A;  3RTR A;  3CO6 C;  4Z2Y A;  3BJA A;  2FU4 A;  2HOE A;  1MD0 A;  1V3F A;  4IF4 A;  5FD5 A;  4EJO A;  3DPL C;  3F21 A;  3JAM Z;  2UXX A;  1MJ9 A;  2LKP A;  4ZYG A;  2HTJ A;  4EJW A;  4KT5 C;  2X0L A;  4P55 A;  2KRF A;  5E1W A;  3KZZ A;  3N4M A;  5BPD A;  2XRO A;  2ZFW A;  1XGS A;  1KQ8 A;  3I0T A;  2IT0 A;  2OAZ A;  5ED4 A;  3WU1 B;  3QPH A;  2FNA A;  2LDU A;  1L0O C;  4IHT A;  3L2C A;  5E20 A;  4ENM A;  1FSE A;  1J5Y A;  2HGC A;  5TRD A;  4LLG F;  3ZPL A;  2XRN A;  1GVJ A;  5J8C A;  3L9F A;  3K1N A;  2W57 A;  4HX4 A;  3E6D A;  4YG2 F;  1ONV A;  2RVC A;  2A69 F;  3T1B A;  4IHS A;  2J5O A;  1IUY A;  4PDK A;  4EJU A;  1IN8 A;  1P2F A;  2ISZ A;  2GWR A;  1LEB A;  3SZP A;  4ENJ A;  2HQN A;  3CTA A;  5DCM B;  1IN7 A;  2PG4 A;  3MWM A;  3IWF A;  5CVI A;  1B9M A;  3F8N A;  1IXC A;  4FX4 A;  2O61 A;  2YU3 A;  2AS5 F;  3EET A;  4AIK A;  3GFL A;  3ECO A;  2OZU A;  1SD5 A;  5J8F A;  3GZ5 A;  4ETS A;  3M8E A;  4AVP A;  4I01 A;  1S7A A;  1FBU A;  3LQQ A;  3F8F A;  3BRO A;  4GXO A;  4KIC A;  5BMZ A;  2V1D A;  3F23 A;  3WGH A;  1XD7 A;  2XAH A;  5LGT A;  2PLY A;  4ZYH A;  1HW5 A;  3HIF A;  5DCM A;  1O3S A;  3HRS A;  4HV5 A;  4UV8 A;  2KJB A;  3QAH A;  4A0Z A;  3U2R A;  5IT9 Z;  2HYG D;  3ZN0 A;  3K9T A;  5HLG A;  1SFX A;  4M74 A;  5LGU A;  2QEN A;  4BH9 A;  2P8T A;  4Y13 A;  1TBX A;  2F5F A;  5HS8 A;  1D8J A;  1H9G A;  1F1Z A;  3BJ6 A;  3D0S A;  3DF8 A;  4AIJ A;  2HWV A;  3HRU A;  3FMR A;  4ESJ A;  1XSX A;  4A0X A;  1DPR A;  2MA3 A;  3PQK A;  4EGZ A;  4IRH A;  3DXJ F;  4I0A A;  1O3T A;  4HQM A;  5DUI A;  2VOD A;  3H92 A;  3HSE A;  5D6E A;  1K6O A;  4KNY A;  1U6G A;  3GEZ A;  5FLX Z;  3AAF A;  1YW8 A;  1ZRE A;  3T8T A;  2O6G E;  4DQ2 A;  2GQQ A;  1FT9 A;  5L3F A;  5BS6 A;  3K1P A;  3DP7 A;  3SZT A;  2FBI A;  4CZZ A;  1QBJ A;  1HST A;  2IRF G;  2KIU A;  1LJ9 A;  5HOO A;  1BI0 A;  2FQ3 A;  4MEX F;  4ZZD A;  1W4M A;  2MBF A;  5L3D A;  3QP5 A;  2JT1 A;  2XHK A;  4KIB A;  4TV7 A;  4G9Y A;  2KKO A;  2H27 A;  4RAZ A;  3ROU A;  3E3V A;  2BYV E;  2DI3 A;  4HQE A;  2OZ6 A;  2M30 A;  1BBY A;  1IF1 A;  2HKO A;  4HX8 A;  5AIQ A;  1HBX G;  5LHG A;  1ZG1 A;  3FXQ A;  1K7A A;  2DQL A;  3SXY A;  4EJT A;  2VBW A;  4I98 B;  2Q0O A;  3MZH A;  1Z05 A;  1ZN2 A;  3NQO A;  2QM3 A;  1R1V A;  3M1E A;  4G8X A;  1ZH5 A;  2D2W A;  3FMQ A;  4ZZL A;  2NYX A;  4JBA A;  2F5C A;  3V8J A;  4I7H A;  3ERE D;  1KU2 A;  1ZGJ A;  1TNS A;  3DEU A;  2F5E A;  2EWN A;  3ZMV A;  2CYY A;  2DT5 A;  1IN4 A;  1SMY F;  1QPM A;  1BM9 A;  2YPR A;  3W6J B;  1FYM A;  1W5S A;  4G7Z F;  5DD4 A;  3ULQ B;  5E17 F;  4NQW A;  3ZP5 A;  1R5H A;  4CYD A;  2FMY A;  1BC8 C;  4B09 A;  3JTH A;  4BHP A;  5L3E A;  1U5T C;  4A5N A;  2LSO A;  1CF7 B;  2ADU A;  3PQJ A;  2VN2 A;  3S2W A;  1P4W A;  2A6H F;  2EV6 A;  3DQV C;  3RIR A;  2IA0 A;  4CXF A;  1ZRF A;  4AD9 A;  3F8M A;  3FXU A;  3HYI A;  3O3K A;  1HSJ A;  2RC4 A;  4Q47 A;  3L00 A;  1Z91 A;  2HKX A;  2RKH A;  3HTS B;  1RUN A;  1TQP A;  4N0B A;  3NEU A;  4KMU X;  4WWC A;  1D8K A;  1T0F A;  4IPA A;  4PCQ A;  3LFK A;  1MGT A;  3I5U A;  1CF7 A;  4Y17 A;  2PBI A;  3GVA A;  4KN4 X;  1TNT A;  2YR2 A;  1YS6 A;  1R1T A;  1BIB A;  4HV6 A;  4PZJ A;  1KGS A;  2ZKZ A;  2IA1 A;  3GW2 A;  4MTE A;  4RB1 A;  3TKY A;  2FRH A;  1FC3 A;  1BIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...