4ASZA

Crystal structure of apo trkb kinase domain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
299
structure length
289
Chain Sequence
GAMDTFVQHIKRHNIVLKRELGEFGKVFLAECYNLCKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Trka and Trkb Suggest Key Regions for Achieving Selective Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords BDNF/NT-3 GROWTH FACTORS RECEPTOR
total genus 95
structure length 289
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aszA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aszA01
4LMUA 4OT5A 2GDOA 2OKRA 4L9IA 2CHLA 3KU2A 1JSUA 2Y8OA 4F70A 1GZNA 2HWOA 5KMJA 4BDDA 3QQHA 2C6EA 3LCTA 4ZZNA 5HTCA 4H1MA 4FOBA 2PVKA 4XH6A 3R2BA 2IVVA 3A60A 3HNGA 3PVBA 3D9VA 1YDRE 2W9ZB 4HNIA 5ANDA 2NRYA 2GTMA 5K0XA 4FX3A 3R01A 3GOKA 5LCKA 4AFJA 2PVYA 3F5PA 2RFDA 4JG6A 5IQHA 3MSSA 2OZAA 4UYAA 4LRKA 3LJ1A 3UODA 2YDKA 5IEYA 2JFMA 4BR3A 2QOHA 4BYIA 2UUEA 1M52A 4ANLA 4DGGA 5DG5A 1XJDA 3D5WA 4AA4A 1Q99A 2O65A 3SW4A 2I0YA 1Z57A 2J9MA 4BCOA 2BMCA 4DEGA 4LUDA 4XJ0A 5DA3A 3CTQA 2IVSA 3FMKA 2PE2A 3IOPA 5DOSA 1YRPA 4QMQA 4TWNA 3D94A 5M06A 1H1PA 4RMZA 2UZVA 4YPDA 3L8SA 4M13A 3UYTA 5AX9A 3OROA 2V55A 3E88A 4JIKA 4G2FA 3TNIA 5AP3A 4BC6A 2UW9A 5BVDA 2ITUA 3QTUA 4D2TA 4CV9A 2I7QA 5HBEA 4NSTA 3GVUA 3I0OA 4JBOA 3Q52A 4U5JA 3WZEA 3TNHA 4BDAA 4O91A 3FMMA 4HCVA 4MF0A 4BDHA 3KB7A 2FGIA 3PVGA 4KS7A 3DBFA 3V04A 4A4XA 1WCCA 3PXFA 4C33A 5KX8A 3AT4A 2ZV9A 4KKGA 5DGZA 5IA3A 4JXFA 5HE0A 4F6SA 3G0EA 1WMKA 5J1VA 4RFMA 2R3GA 4TYEA 5HCZA 2UZTA 5F20A 1K9AA 5C8MA 3C5IA 1JKTA 2LAVA 4QMLA 4YJNA 4CKJA 3DDPA 1R78A 5CU6A 3FJQE 5C4LA 4FSRA 3NSZA 1FQ1B 4ZTSA 2C3IB 2YCQA 3OEFX 3KXNA 3BLQA 4E4LA 2AC5A 2X2KA 2YFXA 4DYMA 2CLQA 4FTUA 5C01A 4G3DA 5AA8A 3PZHA 4NM5A 2XK8A 4EK8A 5L6OA 3TZ7A 3ATSA 5CQWA 4BDFA 1ZOHA 1NVRA 1GNGA 3P23A 3V6RA 2PVNA 2I40A 2PSQA 4ITJA 4CFMA 3HECA 4MXCA 5K4JA 4L3LA 5D12A 1FGIA 3F3UA 3JS2A 2EU9A 5D1JA 3LXNA 3T3VA 4J96A 4Y85A 3IGGA 5H9BA 4BDJA 5M51A 1PXJA 4C4GA 4U41A 2CCIA 4MBJA 5B2KA 3VBTA 5IA2A 3JVRA 5EOLA 4YJTA 5BUJA 4QYYA 2Z7SA 4JOAA 4GUBA 4ZSLA 2XKDA 4YLLA 4BWXA 3PA3A 4TNBA 4UALA 5J87A 3VW6A 2CPKE 1SM2A 5CF5A 4G5PA 1ZMUA 3O2MA 2BHEA 3DS6A 4R5YA 1L8TA 3KEXA 3L9MA 5GHVA 1XO2B 4RIWB 5M4CA 4O83A 1A9UA 2BKZA 3O7LB 5JQ8A 1PXNA 4QYFA 3PJ8A 3IQ7A 3U8WA 2RG5A 1PXOA 3IECA 4JQ8A 5GIOE 4GMYA 5IQAA 3QTXA 3MH0A 4KA3A 2ZM4A 4M3QA 1PKGA 4YZNA 2IW9A 3NUXA 5AP0A 3G15A 3NVKI 1H1WA 5M07A 5AR7A 4FTQA 3ZZEA 1JAMA 2QLQA 2ETKA 4I0TA 4ZSEA 3A8WA 5CF6A 3R63A 4QMXA 5KNJA 1YWVA 1ZYCA 2GPHA 3RVGA 4LYNA 4IIRA 4FV2A 5FDPA 2JDOA 4RGJA 4MQ2A 4AP7A 2YIYA 5AWMA 5GJFA 2OIBA 2CKEA 5FEQA 3OD6X 5GJGA 3OMVA 3NUAA 3BLHA 4BWKA 4BB4A 4GU6A 4KRCA 5KHXA 3LFBA 3VUTA 2R7IA 5K0KA 2ITVA 3BHYA 2HELA 4E4MA 3NW7A 4FTJA 3CR0A 2QHNA 4YMJA 4FTAA 2WGJA 4LUEA 4OTHA 4AZFA 3DZQA 3SC1A 4QMZA 4TYIA 4WBBB 2ITTA 2BZIB 3FL4A 3KY2A 2XNOA 5LMKA 4PTEA 4EOPA 4AT5A 4E8AA 4RIXB 5AMNA 4QP6A 2W5HA 1YWRA 1RJBA 3AMBA 4NIFA 3KF7A 4FG9A 4USFA 5TOZA 4H05A 3TN8A 4LMNA 4E20A 4K2RA 3FBVA 1BL7A 3HAMA 3PYYA 3QTZA 4AQCA 4RIYA 2B9IA 4XBUA 4FBXA 3D2IA 4ANSA 5IMEA 2X39A 3C5UA 2BZHB 3O96A 2VWVA 3EZVA 4BZDA 3FE3A 3Q9YA 2W4OA 3LCSA 5CAQA 3WBLA 5AR3A 3UVQA 4F64A 4CXAA 2YDIA 4L44A 2BDFA 3UQCA 4ZSAA 1M14A 1Q97A 4NTSA 3HRBA 2WO6A 2G01A 1MRYA 2WMRA 5A14A 2EXEA 2ZVAA 2VO7A 3QFVA 4I5PA 3EJ1A 4K8AA 4PPCA 1YOLA 5J9ZA 3OCGA 3VS0A 4DLJA 3EN6A 5E1SA 2DQ7X 5TO8A 3OT3A 3NUYA 5D11A 1SVEA 4D0XA 3MS9A 5IPJA 4BIBA 2GS6A 4WBOA 2RF9A 3EOCA 3H0YA 3RMFA 4FK3A 2J50A 5AUVA 3VS3A 1KE9A 3R04A 2C69A 3AD6A 2UZBA 2YJRA 5FEDA 4F9AA 4E4XA 4F0IA 5CZHA 2F7EE 2R4BA 1IA9A 2YWVA 4O22A 3ZLWA 2VTTA 3UMWA 5ETFA 1JNKA 1ND4A 4EQUA 5KKRB 5EK7A 3V5PA 5KMOA 1W98A 2RFNA 2IVTA 4WD5A 3EN5A 5EG3A 1IASA 4O96A 3R9RA 3TNQB 4ZMEA 4MH7A 4OBOA 3KL8A 4GW8A 3VS5A 4BZOA 3NYNA 1O6KA 5HD4A 5M09A 2C6IA 5F1ZA 4JBPA 1Q5KA 3R8VA 1OI9A 2E9UA 2OXDA 3H30A 3NIEA 5TE0A 4E1ZA 4YTIA 2QOQA 3I6WA 4G1WA 4NIFB 3T9TA 4Y8DA 4O2ZA 3QZFA 3ZM4A 1JBPE 4PL5A 4FNWA 5EM6A 5GNKA 4CT2A 4IMYA 4GV1A 1XH9A 2ZDTA 2Y0AA 4GUEA 4U9AA 4QP8A 4EC9A 5BPYA 3ANQA 3NAXA 3ZEPA 3FMNA 4EH5A 1YW2A 3N4TA 3AOXA 4QMVA 4KIQA 4EH2A 1NVSA 5IQEA 4J71A 1KOAA 4IB1A 3G5DA 4RQVA 5EYDA 1EH4A 1B38A 3QQLA 5I3OA 2W4JA 3EN4A 4FSTA 3A8XA 3A7HA 4C2VA 4KBCA 4LRMA 4NKAA 3TT0A 3ZUVA 4AZVA 5EM5A 4D4VA 4U79A 5HG5A 3RWPA 2BZJA 4EBWA 4ZJVA 2OJFE 3AGMA 1XBAA 4V0GA 1BUHA 4ZP5A 4EOKA 3D5XA 2XEZA 3FQSA 4BKYA 2UZUE 5JN2A 3UPZA 4O0WA 3NAYA 3QXPA 2WTIA 4M12A 3BX5A 4B4LA 4E5WA 2XNMA 4L01A 4NU1A 4CTBA 2Q83A 5FUTA 2C6KA 5IQBA 3KK8A 4KD1A 4O0SA 3VS1A 2VN9A 4IXPA 2CLXA 4BTFA 3OW4A 3SG9A 1OM1A 2NPQA 3OHTA 3MPTA 1J91A 4KB8A 1UNHA 3NUPA 2WAJA 2WIPA 3WZJA 3NZ0A 3NYOA 4OR5A 4D2SA 2BKKA 4IFGA 2JKQA 3MYGA 2YCRA 4GSBA 3EQCA 4KBAA 2QOIA 1RQQA 4KIKA 1UU3A 1OZ1A 4IWPA 2JKOA 5TT7A 1U54A 4A9RA 2X0GA 3ZH8A 3JY9A 3NNVA 4O86A 2J7TA 3GT8A 4M7IA 3B2TA 4XLIA 2XVDA 3F5UA 4YBJA 2VUWA 4LI5A 5A54A 4YO6A 3PRIA 5K5XA 2OJ9A 1VR2A 3DU8A 2FUMA 3TJCA 1M2PA 4DGLC 2QNJA 2XM8A 2WZJA 2Y9QA 4PNIA 3UIUA 3RNYA 3R7OA 4I1ZA 4EQCA 5C26A 4D0WA 3PG1A 2NRUA 3HAVA 3Q5IA 3CJFA 3PPJA 2VWYA 3IDCA 3QL8A 2GQRA 1Q3WA 5AEPA 4XV1A 3RGFA 3FY2A 3SAYA 5CSPA 1GY3A 3W16A 4F1MA 3ORMA 4KUJA 4IZ7A 4I22A 3G33A 3R7IA 2OFUA 3WF9A 1U54B 3W2CA 3ZBFA 4BRXA 5JRSA 5JMSA 3SXSA 3HEGA 5K3YA 3S95A 3IO7A 4ACHA 3ID6C 2A1AB 2CNUA 3EMGA 3R71A 2BVAA 1QPCA 2HW6A 1JQHA 3FC1X 1H00A 2C1AA 2X4ZA 4TYHB 5IUGA 1H26A 3RZBA 3BYMA 4A4OA 3COIA 4YZBA 5E8VA 4C38A 4FGRA 4C4FA 5I9ZA 3TM0A 5KMIA 3KREA 2C0OA 2B54A 2FO0A 3A2CA 3CKXA 4YZMA 4XOZA 3R1YA 3OFMA 2VX0A 3ZLXA 2PZIA 2QU6A 3SHEA 4ERWA 5DRBA 1YQJA 3MA3A 3ZFXA 4DEEA 2YLFA 1I09A 3VBYA 3OXIA 3JY0A 3V8WA 2BRMA 2CN8A 5E91A 4TL0A 4FL1A 4DG0E 1XBBA 4FZFB 3BCEA 3DK7A 3OUKA 2VRXA 4I21A 4U43A 4BTMA 5CS6A 4D4YA 3Q4CA 3FYKX 3EFJA 4P4CA 4UX9A 1VYZA 3PSBA 3M42A 3QTRA 4M67A 2C5OA 5C4KA 5KZIA 3TXOA 3ZRMA 3F2RA 1YXSA 3PA4A 5L6WL 3CKWA 4FG8A 4G6LA 3MH1A 5LMKC 3LKMA 3MFRA 3EKNA 2ZYBA 5EH0A 2O8YA 3OWPA 3MW1A 4V04A 5J95A 4B99A 1XH7A 4GJ2A 3GOPA 4BCNA 3NLBA 2ITZA 4XRLA 3BV3A 2IZTA 2WMBA 3DOGA 3FHIA 4ZY4A 3AD4A 4DCAA 4D1ZA 2GFCA 4FGBA 4MCVA 4AA0A 2RFEA 4GT4A 4Y72A 4DFUA 2AUHA 2VTMA 3BV2A 2QOOA 3VULA 1Q3DA 4A7CA 2NP8A 4S30A 3T3UA 4BGHA 3E8NA 4FKQA 3QC4A 5KMNA 4HGTA 4IDTA 4XHKB 5CI6A 2HOGA 4HCUA 3NUUA 1W0XC 1YXUA 2W17A 2XIYA 3LIJA 4QMPA 2AC3A 3KMWA 4E6CA 4F1TA 1T46A 3ORZA 4Y95A 1F3MC 4J53A 1BMKA 5HORA 3EQRA 3UP2A 2XM9A 4YTFA 2WQBA 4J7BA 3VJOA 3KXZA 1PW2A 4QP2A 5HOAA 3ZDIA 3EN9A 4W4WA 5TF9A 2C5VA 4FSYA 4OTWA 3WF8A 3P86A 4L7SA 2OXYA 5E8SA 3IDBA 4G6OA 2WMVA 3ITZA 2ITXA 3R8MA 3RPRA 2PUNA 3ORTA 3DTCA 4ERKA 4F1OA 3NRMA 4RA5A 4JBQA 4K33A 3SDJA 4CMTA 5EKOA 2Z7LA 4ZEGA 4DFXE 5CASA 5CYIA 4GYGA 2WQNA 4FV4A 2C0TA 4WHZA 4PDPA 1ZZLA 4WRGA 4QMSA 5DT4A 2YM4A 1GZ8A 4TYJA 3BPRA 4RIYB 2ZV2A 3HDNA 4AF3A 5I4NA 3NNXA 4EOIA 3MVJA 3C4FA 3CQEA 5AP2A 3VRYA 4PX6A 2OICA 5DR9A 5A6NA 2OIDA 2WMXA 5HX6A 3KMUA 4KKEA 4AS0A 2G2HA 5T6KA 3Q2MA 3DTWA 3A4PA 4G3GA 5E8UA 4D1SA 3LAUA 5IH5A 3FC2A 3CC6A 3E8DA 5ICPA 5IEXA 3M2WA 1F0QA 3EQBA 4F7NA 4L52A 5CANA 2UVZA 2Z2WA 2EB3A 1WBVA 3KRXA 4G9CA 4F6UA 4YC6A 4NL0A 5EM8A 2VO6A 3SRVB 3WILA 5AAEA 3KULA 4XG7A 4K0YA 3RP9A 4KRDA 4MK0A 3QZIA 4PNKA 4IAZA 4D28A 4MBIA 5DH3A 3K3IA 3QKKA 3DA6A 1XR1A 3G90X 3JXWA 2W9FB 3EN7A 4YJOA 1UWHA 4DEIA 3DB6A 4JR3A 5EKNA 5DVRA 2IG7A 2QKRA 4PWNA 3RWQA 5KUPA 3P5KA 3QUPA 4RC3A 5JFXA 2YCFA 3PY0A 4J97A 5GZ9A 2JAVA 3HDMA 4UV0A 3RAHA 4L3PA 3PP1A 4YURA 5L4QA 5D9HA 3UNKA 5FTGA 5L8LA 5BQ0A 4N57A 3UC4A 2BAQA 5ANGA 4PP9A 5A46A 2YITA 5DT0A 3PFQA 3S00A 4FKOA 5TKDA 4N6ZA 3G9NA 1Z5MA 2ACXA 3C1XA 5I9YA 4IADA 1DI8A 4DC2A 4JG7A 4I6FA 1XH8A 3NUNA 3ZLYA 3G2FA 4CCBA 3BWFA 2VNWA 5TR6A 5B2MA 4A9TA 3UBDA 5DFPA 4FTKA 3VUMA 4L3JA 2C3KA 5FGKA 2HXLA 4PRJA 1OPJA 3FQHA 2G2FA 1NA7A 4HYUA 4ZOGA 2GHLA 3KK9A 4XNEA 5EFQA 2UW5A 2PE0A 4O7YA 3ZUTA 5GINE 3UVPA 3F3ZA 3NGAA 3BQRA 4UMRA 1O6YA 4I3ZA 3DBQA 2WTKC 4EC8A 4C61A 3VS4A 2YM3A 3PXYA 4LM5A 4YTCA 3HMNA 4UWYA 3V6SA 2J6MA 2ZJWA 4AGCA 3L8VA 3DBEA 3T9IA 3S3IA 3W8LA 4XV2A 4JLCA 5LVPA 3WZDA 3R6XA 2W05A 2JDTA 5LARA 3CPCA 4EL9A 2Y6MA 4HYHA 4BKJA 4R3CA 5FDXA 2GNIA 3PXRA 2JBPA 3T8OA 5FXRA 4WUNA 3ZXTA 2C6OA 4A4LA 5EQPA 4P2KA 3CSVA 3R21A 4X0MA 5LWMA 4DH5A 4LGHA 5C27A 4BCHA 2W96B 3AG9A 3FI4A 4TRLA 3W10A 4IWOA 4RPVA 4LGDA 1OITA 1JKSA 4H3BA 3UZRA 5DNRA 2GHGA 3FMDA 3QD2B 5HBHA 3TCPA 3A61A 5BX0A 3DJ5A 2YEXA 3NUSA 3QZHA 5CU2A 5L8JA 3ZZWA 1UA2A 2BAKA 3FZRA 3FLNC 3PG3A 1RW8A 3FLYA 3VBQA 4IANA 4AA5A 4EZ3A 2YM6A 4ZLZA 4YTHA 3QHRA 3EH9A 5IUIA 4TYHA 3VF8A 1G8SA 4YJUA 3VHEA 3CCNA 5KHWA 5FEEA 4M66A 3VJNA 2QG7A 4X6RA 2HXQA 2RKUA 3EFLA 4G3FA 1M2RA 2XEYA 2FSTX 5FBNC 3LFEA 1OIUA 2XK4A 2CGVA 5IU2A 3TKHA 5IQCA 2B53A 4M14A 5CXHA 3U54A 2UZWE 3PIZA 5DI1A 4YJPA 2PUUA 2P4IA 2Z02A 3DJ6A 3CTJA 2QG5A 3L9PA 2OW3A 3EWHA 3DY7A 5CWZA 2WQOA 3BYVA 2CN5A 2VNYA 4RIOA 4F65A 4ACCA 2VTOA 3L9NA 5I9XA 3P79A 5IA5A 2CDZA 3FMJA 4FV0A 3GU6A 4CFWA 3GU8A 3R7VA 2QKWB 2VWIA 4EK4A 3MB7A 1PYEA 5CZIA 3FSFA 4FI1A 2JAMA 5J9YA 5B7VA 1JKLA 3D7TB 3NEWA 5BVNA 2Y6OA 3AT2A 4DT8A 3R7EA 3D83A 2F7XE 2CNVA 2QOFA 3ZFMA 1OUKA 4DG2E 3PJ3A 4ZZOA 2GQGA 5I0BA 5HVYA 2Q0NA 1QPEA 3VBXA 3KN6A 4C3RA 1LUFA 3W1FA 3GC0A 4UY9A 5M4UA 1GZKA 4AU8A 2W1FA 3QAME 4I93A 2PU8A 1WVXA 3CQWA 3K3JA 4GVAA 4KWPA 5K5NA 1URCA 2F2CB 1MQBA 3EL8A 1KV2A 4UMPA 3KCKA 4WNOA 3Q96A 3E63A 4B0GA 5BUIA 4FT3A 2C6LA 4TT7A 4UMUA 5AFVA 3DBDA 1XQZA 2UW8A 4FIJA 4GK4A 2PVJA 1OL5A 4EONA 3RK5A 4FICA 4EKLA 5CEPA 3R22A 3UG2A 4GK3A 4OTQA 3V5TA 1IR3A 3I7CA 1H1RA 3LE6A 2QVSE 3F7ZA 3OBJA 5AR5A 3SKCA 4BCIA 4O82A 3MA6A 2XIZA 1ZMVA 1OMWA 3AC5A 3ANRA 4QPAA 3NR9A 3NNUA 3OT8A 5AV0A 1P4FA 1SVHA 4BBFA 4R3PA 3NDMA 3I79A 2JITA 2R3OA 3RAKA 2C3LA 5AIRA 1WVYA 4L6QA 4BDIA 1PYXA 4XG8A 2QD9A 5HGIA 4ANMA 5JQ5A 3DKOA 4P5ZA 5BVOA 4H58A 5IZFA 2B7AA 3MI9A 2ETRA 3RBWA 4DINA 2BFYA 1JOWB 1G5SA 2J90A 3ACJA 3IW7A 3MVHA 4IVDA 5ANJA 3VUHA 1OIYA 3R02A 3KMMA 4KABA 3MPAA 4RC2A 5AADA 4CFXA 2VTSA 5E9EA 4FSQA 3F2AA 2VWWA 4BIEA 4BDBA 5EYKA 3B8QA 4TKSA 2W1EA 2ZM1A 4U7ZA 4TWPA 2YM8A 5D7AA 2GNLA 3U4WA 3PE2A 2QOBA 4JG8A 4E6QA 2C6DA 4XG3A 5HVKA 3LOKA 4ZTNA 3VF9A 3QRKA 5CF4A 4FYNA 4C34A 3DAKA 3K5UA 4EZ7A 5I9VA 4APCA 2WNTA 3PPKA 4LL5A 4CRSA 2P33A 3PUPA 3IW5A 3VUIA 2GQSA 3FL5A 1VYWA 1OVEA 3NYVA 3PVUA 2FSLX 2R5TA 4R8QA 5BYLA 5IDPA 4CKIA 1FMKA 2XNBA 5JFWA 2VX1A 2QQ7A 2C0IA 4WNPA 3GFWA 4DF3A 5EQYA 4MNEA 4XUFA 4I4FA 5AV2A 3CPBA 5FWKK 3F88A 4WSYA 4L45A 1WBTA 3TEIA 4BGGA 2W1CA 4QYGA 3WYXA 2RIOA 1LPUA 5HEZA 2PPQA 1GZOA 4EOLA 1SNXA 3D7TA 5L8KA 4ORKA 3U87A 4MXAA 1TQIA 4X2FA 1G3NA 2PL0A 4WG4A 2OZAB 2QO7A 3GQLA 2J0MB 3IGOA 3Q4UA 2PUPA 2ONLA 3K54A 2WB8A 3ZRLA 2X8IA 2VO0A 3QD4A 5LOHA 3U4UA 4ACDA 4XLVA 2WTCA 3P08A 4JIAA 3KRJA 5CT7A 4UB7A 5DBXA 3PWDA 5D41A 3QCSA 2YJSA 4BCKA 4IFCA 4EK6A 2PYWA 5AV3A 5DRDA 2ZB1A 1LEWA 3HKOA 4UZHA 1J7UA 3BYUA 4CFNA 5GJDA 1OBDA 3PLAE 5FXQA 2QI8A 3P4KA 5J8IA 3QU0A 2UV2A 3RK7A 5ANOA 4APPA 3GENA 2P3GX 5EHLA 5EDPA 4C3FA 3FAAA 1ZARA 4FKSA 2VWXA 3VC4A 3I60A 4RG0A 5LVMA 3QCQA 1M17A 2J5FA 4BWPA 3VBWA 4EYMA 3EL7A 1MUOA 3ENMA 3V5QA 1MQ4A 3Q5ZA 2RL5A 5EW9A 4L7FA 4TNDA 5LCJA 2XIKA 2IO6A 4IVAA 4MXXA 4YHJA 2ERKA 1UU7A 4KS8A 4FIFA 4GG5A 2XMYA 2HZIA 4W9XA 4AOJA 2V22A 5CU0A 1Y6BA 1V0BA 3DNEA 5C03A 4FV7A 2R2PA 5B0XA 3MWUA 3QBNA 4NFMA 4YJQA 2IN6A 5CT0A 3C51A 2F49A 3A4OX 2YWPA 3GC8A 4FKVA 4K6ZA 4WG5A 4AAAA 4Q5EA 4QQ5A 2C68A 2JLDA 1L3RE 4O1OA 4E26A 5ACBC 3OTVA 4EUTA 2P0CA 3TDWA 4DFNA 3ZMMA 4DEDA 4ZSJA 3BKBA 3E8CA 5J9LA 5BVWA 4DCEA 2VTAA 4AW2A 2GTNA 3C0IA 4GVJA 3SD0A 2JDVA 4FUXA 3BU5A 2BTSA 3R9DA 2ZMCA 3PVWA 2FH9A 3Q9XA 5AIKA 4G31A 2J51A 4FG7A 3UOKA 1W8CA 2EXMA 5L2QA 3HP2A 3TI1A 4AOIA 1P5EA 3ORNA 2XZSA 4ONAA 2RFSA 1PMVA 4PY1A 3ZRKA 4X2GA 3P9JA 4W4YA 5LVLA 4GL9A 3U6IA 4O7NA 3RPVA 2BALA 4CFVA 3QLFA 2HIWA 2R3HA 2ZV8A 3IONA 3R83A 2F7ZE 1SVGA 4D9TA 4PDYA 1SZMA 4BDGA 4WNMA 2A0CX 3S2PA 2FYSA 4QYHA 1KUTA 5HG8A 4ASEA 3HVCA 5CQUA 3F9NA 4ZTHA 3UJGA 4FIHA 5DHJA 1J1CA 5HIBA 3DLSA 1G8AA 1WBNA 3QUEA 5AJQA 3GCQA 3LQ5A 4WIHA 5E8XA 4O7ZA 5AP4A 5CI7A 2B0QA 4RJ7A 1GOLA 3QQJA 3UNJA 4BHZA 4PDSA 2WTVA 5EOBA 1UU9A 5CX9A 1H08A 3FEGA 4ANNA 3TIYA 1GIIA 3W2PA 1Y91A 3MGYA 3DLZA 1W7HA 3ETAA 1J3HA 1URWA 4OTDA 5CAUA 4MYGA 1ATPE 2PZPA 3NS9A 2R3LA 1HCKA 4UXLA 5CLPA 4BCMA 2XRWA 2HENA 4HCTA 5AP5A 5EM7A 3U9NA 4MNFA 4ZXTA 3FZPA 4OTRA 4C37A 4FV1A 3SGCA 4FUYA 2UZEA 1YWNA 3EQIA 3UDBA 2VTHA 1Q24A 3EYHA 3FV8A 3II5A 1UWJA 4FIEA 2JIUA 2VTPA 4C8BA 4RX5A 2OJJA 4NYEA 3QX2A 5JKGA 4UMTA 5IDNA 4C35A 4MKCA 2B9JA 4YJSA 3KULB 2PVFA 3MV5A 2JDSA 4I6BA 2YLEA 1WZYA 3BHVA 5C9CA 4EHGA 1AQ1A 4F6WA 3TWJA 3EZRA 3VQHA 3WE8A 3N51A 4BI0A 4N0SA 3QLGA 4A9UA 5C1QB 2B1PA 1O6LA 1PXMA 1UKHA 3NCGA 2EWAA 4V01A 3R8ZA 1QPDA 3BEAA 2Z7QA 3HMIA 5HNBA 3RTPA 5AA9A 4CLJA 4XRJA 1U5QA 4QPSA 3R9NA 1LEZA 3LXKA 3UMXA 4QRCA 3ALNA 4DA5A 1IG1A 4CG9A 2UVXA 2X4FA 2QCSA 2DWBA 4DFLA 3OXTA 1Q8WA 4IHPA 3W2QA 3F66A 1IRKA 3FZSA 3H4JA 5IQGA 3MFTA 3MTLA 3QKLA 3DXQA 4AZTA 2W7XA 2O63A 3TKIA 5JZNA 1FMOE 2NO3A 4EI4A 3AC1A 4FKLA 4U3YA 3FSKA 5LJJA 2PWLA 4JS8A 3GNIB 3HYHA 3UGCA 1AD5A 3QRTA 3RK9A 4F9WA 2PMLX 5IISA 4RJ6A 1FVTA 4IJPA 5M55A 2X6DA 2YZAA 3E5AA 4LGGA 1XH4A 2XK7A 3CXWA 5E8TA 4FTOA 3WIKA 2XF0A 3FYJX 5H2UA 4DHFA 4YJRA 3U51A 1STCE 3RCJA 5T3QA 2PVMA 3ATTA 4C4EA 2VGOA 3FDNA 5DLSA 4EKKA 2V62A 2OK1A 3OW3A 3ZONA 3F69A 4U80A 4ZY6A 4F63A 3U9CA 4C59A 4BY9E 3BQCA 1J1BA 3EKKA 5CALA 3G6HA 5E4HA 3QKMA 4GCJA 2CKPA 5E90A 3C4CA 1NW1A 3OOMA 2ERZE 4GIHA 4RWLA 2V5QA 3V5LA 4MF1A 3RZFA 4PMTA 5CEQA 4QP1A 2OG8A 4DG3E 4QMWA 1QCFA 1R39A 4RWIA 3C7QA 3C0HA 5ACKA 1V1KA 3V8TA 1TKIA 4RWJA 4PL3A 1OB3A 4QPMA 3TV4A 3CJGA 1H27A 4HZRA 1P4OA 4ZJJA 3VUDA 3LMIA 3IW8A 5HKMA 1BKXA 2ITYA 4IWQA 4J8MA 3RALA 2W06A 4F9BA 4OW8A 1M7QA 4GS6A 2LGCA 4I0RA 3DJ7A 5LMBA 3GCSA 4W8EA 4FL2A 4ZLOA 4U42A 2YACA 4FKJA 4S33A 3VS7A 4AGWA 3KXXA 4CZTA 4TWOA 3ZUUA 4NT4A 3LM0A 4TWCA 3FI2A 4A06A 2HY0A 4EH6A 3KCFA 3MY5A 4FKGA 2W5AA 3L1SA 1UV5A 1OKYA 4FTCA 3QA8A 2OWBA 2PHKA 4MNEB 1GAGA 3AMAA 4X2JA 3VS6A 2WMQA 3AC8A 4EH7A 4EUUA 3PJ2A 3Q9ZA 3QALE 3QYWA 2P55A 1TQPA 2I0VA 5L2IA 5BVKA 4CFFA 3CGFA 5J5TA 4QNAA 4U97A 4EH3A 2R9SA 2BFXA 4LOOA 1F5QA 3EFWA 3KXMA 4WA9A 5HNIX 5L6PA 3OCSA 3FQEA 2BROA 3F3WA 1X8BA 4ANOA 3NX8A 3LCKA 4C2WA 3QRIA 1Q8TA 1BI7A 5FD2A 3RAIA 1APME 4HYIA 4MD8E 3ZO2A 2X7FA 3KKVA 4B8MA 4KIOA 5ANIA 5JEBA 3O50A 4IAIA 3W2SA 3E87A 4WSQA 3FPMA 4A07A 4X21A 3PXZA 4NFNA 4WG3A 4DGOA 3ZBXA 1A06A 4IE9A 2F2UA 2FA2A 2XNNA 3FLQA 2WEVA 3KA0A 4CQEA 2G2IA 2W1DA 4HVIA 3UIXA 3DNDA 4ZAUA 3I5NA 2UZDA 4N6YA 4F9YA 5KCVA 2VWUA 5DWRA 4ENXA 4RVKA 3D14A 5GZAA 1AGWA 1ZOGA 4FK6A 4OGRA 4II5A 4O21A 5AP6A 3OF0A 5HE2A 3TL8A 3UE4A 3UVRA 1R0PA 3LFAA 5EI6A 5FP6A 3I81A 4I41A 3ZC6A 2XUUA 4D1XA 1BL6A 4M69B 1PMUA 3QX4A 2QO2A 2R7BA 2XH5A 3UO5A 3UZPA 4ZS4A 4C4JA 4K1BA 3OCTA 4LQMA 4ZZMA 3FWQA 3D0EA 4BCPA 4FNXA 1UNGA 3NMUF 3I0QA 2BRBA 3DZOA 4HYSA 4IEBA 5HHWA 4RJ4A 1OUYA 3AXWA 2VTQA 4BF2A 4JQ7A 2JFLA 4OTGA 5ETCA 2PUIA 3PY1A 2QR8A 4QP4A 3C13A 3D5UA 3R28A 3L8XA 5IMXA 4JRNA 4FZ7A 5J7HA 1YOJA 3BHUA 2DUVA 4HOKA 4NM3A 4ASXA 4H39A 3VVHA 1QL6A 2X2LA 2V0DA 2XK6A 5H8BA 2XNPA 3L8PA 3VW8A 1I44A 4EHVA 4BCFA 2CGXA 3LFCA 3PJCA 4RC4A 3ALOA 1PHKA 4QNYA 3ZO4A 2W1IA 1KWPA 3W18A 4J52A 2C47A 4QMMA 3V5JA 2E9PA 3F5XA 4AACA 4D2VA 2HZNA 4HW7A 3RI1A 1M7NA 2H34A 4ITIA 4PPAA 2EVAA 5JZJA 2QR7A 4M69A 4AZEA 3M11A 1Y8GA 2KTYA 4FIGA 4XG4A 4YO4A 4FV9A 1DS5A 1Y57A 2VTLA 3P7BA 5FG8A 4EHEA 3BGPA 3E8EA 4QYEA 3D2KA 5BNJA 1K3AA 1QMZA 3GP0A 3MJ1A 3FMLA 4QD6A 4F09A 4UWCA 2PTKA 4OBPA 4W9WA 3UO6A 4O7VA 4KIPA 2V7OA 3R9OA 2GNFA 4YSJA 2OF4A 4R77A 3AD5A 5IA1A 1JPAA 4NH1A 5DIAA 2WD1A 4Y83A 4D5HA 2WEIA 1KE5A 4WT6A 4JX3A 4PQNA 4TN6A 3UIBA 3SRVA 2XK3A 4P7EA 4DEBA 4BDCA 4LFIA 4HPTE 3QTWA 5DT3A 4B9DA 3ZOSA 5CNOA 2HYYA 3BYOA 3R8UA 4O7TA 3TNWA 3ROYA 4HVSA 3FLSA 2WMWA 1ZYLA 3OXZA 2V7AA 3ZM9A 3OP5A 3HZTA 1OL7A 3HL7A 5E7RA 3R7YA 1YHSA 1XH5A 3IS5A 4OLIA 5IA0A 5EI2A 1FOTA 2OI4X 5HVJA 5CXZA 2WHBA 3OWLA 4FV3A 3C4XA 4FC0A 1PY5A 3HUCA 3ULZA 3GGFA 4FV8A 1YI4A 3W32A 4O84A 4E5BA 3GC9A 3QA0A 2HK5A 4O27B 4W8DA 5JRQA 3LMHA 3TTJA 5ITAA 3G0FA 2YM7A 2GNJA 2JGZA 4I6HA 4L43A 4XV9A 3GCUA 4AGDA 4AN9A 5AUTA 3HV4A 3ACKA 4AW1A 3UC3A 3SVVA 2EB2A 5AUWA 3R1NA 4C0TA 1YXTA 4FV6A 3OCBA 3PPZA 4IDVA 4FKIA 3Q9WA 4A9SA 4AOTA 2YIWA 2R3QA 4C62A 4IB3A 5IUHA 3ZSHA 4FKUA 4Q9SA 2OH0E 4JAIA 3U6JA 1YKRA 3KN5A 3FKOA 3ET7A 5BVEA 4AFEA 4OAUC 1OIRA 2WMAA 5EYCA 3TTIA 3D4QA 4L53A 3WE4A 3FPQA 2F9GA 4FV5A 2XNEA 4R1YA 3W2RA 2ITOA 4D5KA 1FPUA 4WUAA 3QZGA 2XNGA 2XYNA 4XP0A 1H24A 3UNZA 5FLFA 4DTAA 5AUYA 4AT4A 3QRUA 4GFOA 4Z3VA 1NT2A 2XRUA 4D2PA 1XH6A 2YABA 4J1RA 2CGUA 4GT3A 3NYXA 4BDEA 1NY3A 2CCHA 5M4IA 4YPSA 5JH6A 3PTGA 2R3JA 3Q53A 5AM7A 1Y6AA 4JJRA 5EDQA 4GH2A 3ODZX 3ZFYA 4JQEA 2C5YA 2XJ2A 3GU5A 4D9UA 2X7OA 4DBXA 5LMAA 4EZ5A 3W2OA 3TZ9A 5FM3A 4ASDA 2C1BA 2XCHA 2YIRA 4FVQA 4C4IA 1UVRA 5IKWA 2XIXA 3U55A 4MAOA 4EWHA 2UW3A 3PLSA 5F9EA 3OZ6A 5HO6A 5IA4A 3NPCA 4YP8A 2GNHA 1KE7A 2BRNA 3LFNA 3POOA 4IC7A 3DFCB 4ID7A 4PTGA 3HA6A 3SG8A 4ASZA 3BBWA 5F95A 4FTNA 2W5BA 3TG1A 2J5EA 4XG6A 1FINA 3TUBA 2UZNA 2WMTA 5J7BA 2UZLA 3GFEA 4F9CA 3R30A 3RCDA 4F7JA 2G1TA 1YI6A 4H3PA 4AX8A 1DAWA 4IX6A 2IWIA 2H9VA 1XHAA 2A19B 1PJKA 3TJDA 4EWQA 3FI8A 3D15A 5A9UA 3QQKA 2QLUA 1YVJA 3BBTB 4I5CA 4NJDA 4D2WA 1OL2A 2ZV7A 4KBKA 4NJ3A 4G34A 4ZMFA 4NK9A 4JDHA 2FB8A 5AUZA 5HBJA 1ERKA 3DQWA 3LQ3A 2W1ZA 3NVMB 4E6DA 5HO8A 4FNYA 4IX5A 5I3RA 4KKHA 4WNKA 4X6QC 2C30A 2JIIA 3PJ1A 5H8GA 4CZUA 4D4RA 4IAKA 1ZRZA 3DBCA 2VO3A 4JDJA 5D7VA 4HGEA 3ORPA 3WARA 4ZLYA 2E9NA 1WFCA 2XBAA 4FSMA 4CZYB 1REKA 3C9WA 5IQDA 5IQFA 3KXGA 3DCVA 3DPKA 5EW3A 3VWAA 1PKDA 3QD3A 2PVRA 4N4SA 2PK9A 5EHOA 4CEGA 2B55A 4D58A 3QCXA 3IOKA 2BPMA 4FNZA 4FE2A 2C3JA 2X81A 5EI8A 1YHWA 4O38A 4I4EA 3LFSA 4DBNA 1ZYJA 2REIA 4DFBA 4DE4A 3NNWA 4C02A 5M53A 1QPJA 4QTAA 4AG8A 4OTPA 3VO3A 1JWHA 4RX8A 3WF7A 4F7SA 3G6GA 4D2RA 3F5GA 2QU5A 2XCKA 3Q60A 4XEYA 3AC3A 3LPBA 1GIJA 3L9LA 2IZRA 2X9FA 3HUBA 3ZSGA 4EEVA 3B2WA 5HU3A 4C7TA 2R3RA 4UN0C 4FMQA 4PMPA 4KSPA 1HOWA 5CEOA 4X7QA 3U6HA 1YDTE 3BELA 2VX3A 4PF4A 1IEPA 5DPVA 5BVFA 4CSVA 4GFGA 2OF2A 5CEIA 4F0FA 2ITNA 4EBVA 4BCQA 4ANBA 5ETIA 3VN9A 3FLZA 4FEUA 3MH2A 4F4PA 3DK6A 2VZ6A 2Y4PA 2Y4IC 2EUFB 2IZSA 5A6OA 3HV6A 2X8EA 4FKTA 5AAGA 3OBGA 3MDYA 2UW7A 4QP3A 1GIHA 4FSUA 3E93A 4XP2A 1R1WA 1A48A 4IBMA 4DEHA 4DAWA 5L3AA 3C4EA 1NVQA 2YIXA 1Q8UA 4U81A 5L2TA 4GYIA 3Q6WA 3R8PA 5DMZA 2RG6A 3A7FA 4FT5A 3VUKA 4DH8A 2QOCA 2X7GA 2YCSA 3FKNA 4IACA 5JGDA 5E8YA 4AXAA 4EH4A 3I7BA 3GQIA 3HV7A 3DXPA 3EHAA 3PDTA 3QTIA 2R3NA 2KULA 4XYFA 4L68A 2BZKB 4YHTA 1GJOA 4TTHB 5JK3A 1ZLTA 3HV5A 3QWKA 3CIKA 3FY0A 1RE8A 2VGPA 4V0GB 3I4BA 4RA4A 2OO8X 5IF1A 2WELA 3DXNA 3OC1A 1U59A 4PP7A 4NZWB 2R3FA 3COHA 4QP7A 4G5JA 2ZDUA 3VS2A 1FVRA 4QTCA 1Q8YA 4QMUA 4XX9A 4Y5QA 3DAJA 4YZDA 4GK2A 4O0VA 3R7UA 3OG7A 4E73A 2CKQA 4OTFA 4R78A 3LZBA 5BUEA 2HZ4A 3UP7A 3DQXA 5A4LA 2ZAZA 3KRRA 4GIIA 1CTPE 4MX9A 4O81A 2QHMA 4G3EA 4C36A 1OKZA 1U5RA 5KMKA 4F0GA 2OFVA 4MD9E 4YSMA 5BYZA 4E5AX 4W4XA 4J99A 4QTBA 3QXOA 2IVUA 3R1QA 3ZU7A 4UYNA 4EORA 3UZTA 2H8HA 4DGNA 2OSCA 5HZNA 4I6QA 4X3FB 4ENYA 4IM0A 1Q4LA 3F6XA 2QC6A 3O23A 3UG1A 1ZMWA 3MY0A 4WO5A 3SXRA 5HLWA 1BX6A 1UKIA 4K9YA 3C4WA 3VBVA 2G15A 3ENHA 5G6VA 2R64A 4ANQA 4BL1A 1NXKA 3FXZA 4ZTQA 4FKPA 1W83A 4FTLA 3TNPC 1PXIA 4BFMA 4F7LA 3PIXA 5KBRA 1R0EA 1YXXA 2X9EA 3FXXA 3KQ7A 4B7TA 4MEDA 4Q2AA 5CAVA 4YZ9A 2YA9A 4AE6A 2WQMA 5LQFA 3OUNB 5AX3A 3V3VA 1H0VA 2WXVA 3B8RA 4C57A 3OWKA 1IA8A 1OECA 5E1EA 4USDA 2OJGA 3EQDA 2HCKA 3F3TA 4DFYA 3GI3A 4GKHA 3HMMA 3S4QA 4Z7GA 2AYPA 3AC2A 4RJ5A 4S2ZA 5C8KA 5K9IA 3PRFA 3DFAA 4LRJA 4R7BA 4JI9A 1E9HA 3CEKA 3KC3A 4LOQA 4NM7A 4WKQA 3QF9A 5A4QA 5CVHA 4QQTA 2DS1A 1XBCA 3NCZA 4C3PA 2YISA 2BCJA 3VNTA 2F57A 1ZYSA 3SOCA 3HX4A 4S34A 2QODA 1OBGA 3ZYAA 2XKEA 4QMOA 4XG9A 2YAAA 4CMUA 3ELJA 4FVPA 5KKRC 4QQJA 5I5ZA 5JFVA 4DTKA 2XP2A 3HMPA 4JDIA 4XP3A 2HY81 5LVOA 3NIZA 4V05A 5EDRA 3PY3A 1CSNA 3RHKA 3GEQA 5E92A 2GNGA 2PVHA 2XJ1A 5L2WA 4P90A 3DKFA 3LJ2A 3RPSA 4HVGA 2RGPA 4FVRA 4MHAA 4YJVA 3A62A 3KXHA 3PSDA 4FF8A 3W8QA 4S31A 4BBEA 4JBVA 5LWNA 3IW6A 5DYJA 2O5KA 4RIXA 4Z55A 1VZOA 2PMIA 2E9VA 3R0TA 4HNFA 5CSHA 5EYMA 5I9UA 4XMOA 3RJCA 4FT9A 4U3ZA 1BI8A 5BMMA 4BVUA 4DH1A 5EQEA 3EQPA 3HRFA 1ZZ2A 2IW8A 2W99B 5LVNA 3P7CA 4I24A 3MN3A 4XBRA 1XKKA 3FUPA 4OUCA 2WTKB 4MBLA 4UWBA 3R7GA 2VV9A 3BZ3A 4XCUA 3TACA 3ORKA 3W33A 4FR4A 4RJ3A 3GCPA 3MPMA 4FA2A 3HGKA 4CMOA 3D5VA 3CBLA 4IX3A 4CTCA 5AR8A 2JKKA 4L00A 4PUZA 3TIZA 4RFYA 4BICA 2HWPA 1E1XA 4RWKA 2OIQA 3ZDUA 4AUAA 2UW6A 2CNQA 2CSNA 2HAKA 1PXLA 1H01A 2PY3A 3OS3A 2F4JA 3GCVA 5HQ0A 4BZNA 5IQIA 2YDJA 3MY1A 4GRBA 4ZTRA 5A4TA 4AZWA 1OKVA 2OU7A 4L46A 5HE1A 3F7WA 4NEUA 5HLNA 4GG7A 2FVDA 3IW4A 2Z8CA 4YLJA 3QTSA 5FRIA 4DTBA 3JYAA 5CEMA 4RT7A 1JVPP 2I1MA 3G9LX 5AAFA 2CKOA 4AGUA 4JAJA 4B8LA 4EHZA 4XOYA 2ESMA 3HP5A 4O0RA 3O8PA 5K4IA 3CTHA 3ORLA 4U0IA 3QQGA 3VHKA 3BEGA 2BRHA 2JKMA 3BYSA 5HIEA 2C6MA 4U40A 5EW8A 4NWMA 2VU3A 2XKCA 4IB5A 3A7JA 3VUGA 3V01A 3SA0A 4PL4A 2W1HA 3LLAA 5AV1A 4X3FA 3K2LA 5J1WA 2YM5A 4M0YA 5GZ8A 5LXMA 5FM2A 3WF6A 4FEQA 4EJ7A 4MTAA 3UO4A 4G17A 4BGQA 2CMWA 4K77A 3SLSA 2XYUA 4C4HA 1MRVA 3RM7A 4KNBA 3MESA 1CKJA 4FSNA 4BTKA 3V5WA 4Y46A 3E3BX 1YXVA 2BRGA 4QTDA 1S9IA 3VIDA 5HLPA 5CAPA 4MXOA 3DB8A 4R3RA 3OWJA 1R3CA 2EXCX 3C4ZA 3H9FA 3E64A 3ZS5A 4HVDA 3VQUA 4RVLA 3LM5A 3CY2A 3OTUA 5A3XA 4FZAB 2WFYA 4QMTA 3TKUA 2WTJA 4R5SA 4O1PA 4LOPA 4HGLA 3EQFA 4EQMA 3JPVA 2UZOA 4CKRA 4O7RA 4RBLA 3O71A 2XBJA 4J8NA 4QTEA 4USEA 3ORXA 5F94A 5HTBA 2PZRA 4JDKA 3LXLA 1TVOA 4WRSA 3TV7A 3LVPA 2ETMA 5JSMA 4KSQA 3FMHA 4U45A 4UZDA 2QONA 5HNGA 4G9RA 4ALUA 4FT0A 3UQFA 5DE2A 5BMSA 4FZDB 5FBOA 2R3KA 1H1QA 4JVGA 3REPA 3ROCA 2ZMDA 4CVAA 3MIAA 4MXYA 3QGYA 4JT3A 4RSSA 5CY3A 3OY3A 4BTJA 3OVVA 5G1XA 2FSMX 4O7LA 2C4GA 5DEWA 3ZC5A 1ZWSA 3TDVA 2Q0BA 4G6NA 5GIPE 4O6EA 4ZJIA 3HRCA 2GS2A 3CS9A 3JUHA 4IWDA 5AV4A 1H4LA 4IZAA 4IAFA 4FTRA 4CYIA 2B9HA 5HX8A 3E62A 2QO9A 3M1SA 3MFSA 4TXCA 1OPLA 4QMNA 3S1HA 3KFAA 2PE1A 5I9WA 2PMNX 4AE9A 1CKIA 3MIYA 5M4FA 2R3MA 3OOGA 4FSZA 4OTIA 4BDKA 1H0WA 4RX7A 1VJYA 3MTFA 4XG2A 3TZ8A 3FMEA 4ARKA 4AW5A 5A4EA 2WKMA 4I0SA 4BIDA 3VRZA 4X3FC 3CD3A 4K11A 3Q4TA 1Q62A 4R7IA 3RINA 4BI2A 5A4CA 4FEVA 1UNLA 4DLIA 1OIQA 4DN5A 3SQQA 4PV0A 5H8EA 3WI6A 2YAKA 4B6LA 3R73A 4RRVA 3MH3A 2VTIA 4F99A 5CF8A 2H6DA 2VD5A 1U4DA 3FKLA 4RJ8A 5E8ZA 3SOAA 1PMEA 5AUXA 2WQEA 2WU6A 3PP0A 4HVHA 2B9FA 5BYYA 5B2LA 2GCDA 4RZWA 4RIWA 5JT2A 4PMSA 5KMLA 1REJA 1MP8A 1WBPA 3F61A 3QHWA 3I5ZA 4YBKA 3R8LA 4MWHA 3QC9A 5J5SA 1BYGA 4LV5A 3PXKA 4RZVA 4YGAA 5KE0A 5HO7A 4NW6A 3KGAA 2H96A 3A7GA 3W55A 4BCJA 1SMHA 2JIVA 4IVCA 3JR1A 2X6EA 4YR8A 4QQCA 1JSVA 4R1VA 4JRVA 2JDRA 4RVMA 2GFSA 4M97A 5CAOA 4J98A 4NCTA 1WBSA 4J95A 4TYGA 3OY1A 3KVWA 1Q41A 3FI3A 5CTPA 2ITWA 2X2MA 4EOSA 3WF5A 1FVVA 1PRYA 4EOOA 1IAJA 1H1SA 4CNHA 3Q4ZA 4QO9A 3QQUA 1ZOEA 3IK3A 4FTIA 4M0ZA 4PTCA 5ANEA 4EYJA 2PULA 2NNWB 2ZB0A 1E1VA 1WBWA 1WAKA 4MXZA 1IAHA 3N4VA 4PDOA 1Q8ZA 5CVFA 3NWWA 3QTQA 5IH6A 4YZCA 3EFKA 3QYZA 3SX9A 5IG1A 2XIRA 3R00A 5KMMA 4E3CA 4I94A 3ZEWA 3KRLA 4HPUE 3P0MA 5CSWA 3E7VA 4JR7A 4KAOA 3HLLA 4JNWA 3KRWA 4L42A 3BE9A 4M84A 4RX9A 4EH8A 3BWJA 5HG7A 5L2SA 3FLWA 2JC6A 1ZAOA 4MD7E 3LMGA 2UW4A 5AUUA 5DR2A 3UOHA 4FTTA 4GKIA 4IX4A 2IZUA 2UVYA 3OEZA 4RQKA 4FIIA 2E2BA 4ALWA 2J4ZA 3CY3A 4L8MA 4QOXA 3DDQA 5AR4A 4EOQA 4DEAA 4CD0A 3H10A 2Z60A 4QMYA 3GB2A 2GU8A 1PXKA 4MQ1A 3UPXA 4E4NA 2ONLC 3H9RA 3PE1A 3WYYA 3O51A 1KV1A 4G16A 4HZSA 5JGAA 2OZOA 1JKKA 3I6UA 4I20A 2WMSA 4FKRA 3UOLA 3TUCA 3NW5A 4IZYA 4G3CA 5D10A 4AW0A 3HV3A 3O0GA 1J7IA 3DV3A 1DI9A 3P78A 5HG9A 1Z9XA 1DAYA 3LLTA 3O7LD 4AN2A 3LCDA 3CLYA 3O17A 3ULIA 4GJ3A 1OGUA 2P2HA 3O8UA 4S32A 3ZO1A 4BHNA 4PPBA 4PMMA 1FBNA 4DITA 4ZSGA 1MRUA 4I5MA 3BU3A 3QUDA 4Y73A 5T68A 5CU4A 3ORIA 4O0YA 4BCGA 2YIQA 4I92A 4DH3A 3AGLA 4TZRA 5FTOA 4EJNA 3LCOA 3IKAA 4WOVA 2GMXA 4BI1A 3DGKA 3FZ1A 3G51A 3WIGA 2BIYA 1BLXA 3AT3A 4UBAA 4BN1A 4RLLA 4CQGA 4IJ9A 3EIDA 3LHJA 3DK3A 4O6LA 4FKWA 4AZSA 1KOBA 4ALVA 2R0UA 3UYSA 2FSOX 4IAAA 4IQ6A 5DR6A 4CV8A 5M56A 5HICA 4EH9A 3DKGA 2BAJA 3KF4A 1B39A 4O0XA 5F4NA 2J2IB 4I5HA 4FSWA 3EQGA 4Z16A 2G9XA 3ZSIA 2WU7A 1CDKA 2I6LA 2IJMA 3MB6A 2OJIA 1DM2A 3PSCA 1SNUA 5HCYA 2BDWA 3PZEA 3PXQA 4EK5A 4ZTLA 2UW0A 3MFUA 2OBJA 3TV6A 4YU2A 2J0IA 4ZS0A 3QD0A 4M15A 4ZIMA 4EK3A 3HA8A 4ZK5A 2ITQA 1FGKA 3CD8A 3F82A 3MJ2A 3QGWA 3GBZA 3GU4A 1SYKA 5J79A 2YN8A 3GC7A 4LV8A 4NKSA 5CENA 4C58A 2XS0A 4CRLA 3UOJA 4IH8A 4FTMA 2QURA 1RDQE 3ZCLA 1YDSE 2BR1A 2JEDA 3NW6A 5FP5A 2VTNA 3GXLA 3LFFA 4X2NA 4RFZA 1V0OA 1H8FA 4A9YA 4DGMA 2SRCA 1H07A 2Y4IB 4F08A 2I0EA 1ZY5A 1WVWA 1KE6A 2IW6A 2J0KA 4FEXA 3Q2JA 2WPAA 4AN3A 4DT9A 3RKBA 2B52A 1O9UA 2C5NA 2VTJA 3R9HA 4N70A 4I23A 4YC8A 4CCUA 2HW7A 3IG7A 4GT5A 2XKFA 3DKCA 4BYJA 4H36A 1YHVA 3I1AA 2QOLA 5C8NA 3Q3BA 3N4UA 3ODYX 3LFQA 2BIKB 3EYGA 3ZTXA 3RAWA 1ZY4A 3MBLA 5M44A 5CVGA 3CGOA 5HTIA 1PF8A 3ZHPC 5HCXA 4LG4A 3UQGA 1YI3A 2OXXA 3D7ZA 3F3VA 4IM2A 2XB7A 2XJ0A 3Q04A 5DEYA 4O0UA 4HJOA 5CNNA 4CG8A 2WIHA 1H28A 3RPOA 3SXFA 4R7HA 2R0IA 5HI2A 3RHXA 1CMKE 2A4LA 3RNIA 4FYOA 5E8WA 3QQFA 1LP4A 4X3JA 3Q6UA 2BHHA 4UMQA 3P7AA 4YUQA 3E3PA 2J0LA 4O2PA 4XV3A 4CT1A 3FZOA 3AMYA 4H1JA 4UEUA 4O7WA 5FTQA 1P2AA 3BGZA 5AM6A 3COKA 3WOWA 1B6CB 2WTDA 4FODA 2WMUA 3THBA 2VWBA 4E6AA 3QCYA 4TY1A 4U8ZA 1XWSA 4Z9LA 5AR2A 4D55A 3MVLA 3V51A 3DAEA 2P2IA 1YOMA 5JFSA 4BKZA 1ZYDA 3O8TA 4QP9A 4AWIA 4UXQA 4EOJA 2PMOX 1OL6A 3LQ8A 4NM0A 4TW9A 4IM3A 3UIMA 2IPXA 5KO1A 4D4SA 2WOTA 1W82A 4IC8A 4O0TA 4IW0A 5HIDA 4Q9ZA 4W4VA 3KVXA 3VAPA 3RM6A 2OGVA 4OAVB 5KBQA 2Z7RA 1T45A 3K5VA 2VAGA 4NTTA 2A2AA 1OL1A 4IAYA 4JL9A 3E92A 3BHHA 2B4SB 1Y8YA 3AQVA 3GU7A 2HZ0A 3BIZA 1JSTA 3WZUA 3V8SA 4Z7HA 3UTOA 4ZY5A 4E93A 4FZ6A 4DH7A 2OLCA 2BILB 4U6RA 3FZTA 5HD7A 4GFMA 3HMOA 4TPTA 2W1GA 4QT1A 4YLKA 3CE3A 4OT6A 5HU9A 3TUDA 3C0GA 2JBOA 2R3IA 4FOCA 2W4KA 4OBQA 3ERKA 3E7OA 4P5QA 5CSXA 3JVSA 5M08A 4KINA 1VEBA 1V0PA 3LW0A 5IEVA 4YNOA 1UU8A 4GU9A 4BBMA 2ZOQA 2GHMA 3POZA 2VTRA 2YHVA 4X2KA 3ZO3A 4NUSA 5IH4A 1S9JA 2X8DA 2R3PA 1CKPA 3ZXZA 4H3QA 2QOKA 3AC4A 3BHTA 4FEWA 4DFZE 3BE2A 4IZ5A 1J7LA 2C5XA 2J0JA 5HE3A 2E9OA 1HCLA 4CGAA 4KIKB 4O7SA 3EQHA 1JLUE 3FHRA 3N9XA 1W84A 2VWZA 5EHYA 4U44A 4IB0A 3TZMA 2RSVA 1OPKA 3C50A 4ITHA 2WTWA 1WBOA 2C6TA 3LFDA 3FXWA 1PMNA 3PIYA 3QWJA 3ZLSA 2ZM3A 1OKWA 4HGSA 2O64A 3P1AA 3S0OA 4YNEA 4YHFA 2BDJA 3H3CA 4ACGA 2GSFA 2O2UA 5CEKA 3IPHA 1K2PA 5CSVA 1ZXEA 5AP7A 5FQDC 2JD5A 5HESA 1M2QA 4Q5HA 1KE8A 4CYJA 4NW5A 3GUBA 1CM8A 3CQUA 4FL3A 4CFUA 5M57A 4ACMA 4R6VA 3CP9A 4MVFA 2YERA 5CU3A 4CLIA 2PZYA 3LXPA 3H0ZA 2YZLA 2PZ5A 3EB0A 5FXSA 3H9OA 2O3PA 2XK9A 3DT1A 2XA4A 4Y5HA 2X1NA 3MVMA 2WOUA 1P14A 4RVTA 3WZKA 3IDPA 5DN3A 2OH4A 2O0UA 3BRBA 3Q32A 1TQMA 2A27A 5AP1A 3A99A 2CJMA 3PA5A 2BTRA 4RLKA 4XS2A 5JGBA 4IVBA 1H25A 2CGWA 3RPYA 1LR4A 1U46A 4MWIA 3BI6A 3BLRA 4L67A 4M8TA 3BGQA 4K18A 2BUJA 3PWYA 4JX7A 4LL0A 1PXPA 5KZ0A 4E7WA 3R2YA 3COMA 3LJ0A 4NCTC 3A7IA 3SV0A 2PVLA 4FT7A 5H3QA 4AT3A 2DYLA 2ITPA 3BU6A 4EOMA 3SW7A 3QRJA 2Y7JA 2W0JA 5ANKA 1KSWA 4YC3A 4M68A 5ETAA 3F2NA 1Q61A 3R1SA 2I0HA 4ZTMA 4GEOA 2GS7A
chains in the Genus database with same CATH superfamily
4LMUA 4OT5A 2GDOA 2OKRA 4L9IA 2CHLA 3KU2A 1JSUA 2Y8OA 4F70A 1GZNA 2HWOA 5KMJA 4BDDA 3QQHA 2C6EA 3LCTA 4ZZNA 5HTCA 4H1MA 4FOBA 2PVKA 4XH6A 3R2BA 2IVVA 3A60A 3HNGA 3PVBA 3D9VA 1YDRE 2W9ZB 4HNIA 5ANDA 2NRYA 2GTMA 5K0XA 4FX3A 3R01A 3GOKA 5LCKA 4AFJA 4AXEA 2PVYA 3F5PA 2RFDA 4JG6A 5IQHA 3MSSA 2OZAA 1W2CA 4UYAA 4LRKA 3LJ1A 3UODA 2YDKA 5IEYA 2JFMA 4BR3A 2QOHA 4BYIA 2UUEA 1M52A 4ANLA 4DGGA 5DG5A 1XJDA 3D5WA 4AA4A 1Q99A 2O65A 3SW4A 2I0YA 1Z57A 2J9MA 4BCOA 2BMCA 4DEGA 4LUDA 4XJ0A 5DA3A 3CTQA 2IVSA 3FMKA 2PE2A 3IOPA 5DOSA 1YRPA 4QMQA 4DHZA 4TWNA 3D94A 5M06A 1H1PA 4RMZA 2UZVA 4YPDA 3L8SA 4M13A 3UYTA 5AX9A 3OROA 2V55A 3E88A 4JIKA 4G2FA 3TNIA 5AP3A 4BC6A 2UW9A 5BVDA 2ITUA 3QTUA 4D2TA 4CV9A 2I7QA 5HBEA 4NSTA 3GVUA 3I0OA 4O4BB 4JBOA 3Q52A 4U5JA 3WZEA 3TNHA 4BDAA 4O91A 3FMMA 4HCVA 4MF0A 4BDHA 3KB7A 2FGIA 3PVGA 4KS7A 3DBFA 3V04A 4A4XA 1WCCA 3PXFA 4C33A 5KX8A 3AT4A 2ZV9A 4KKGA 5DGZA 5IA3A 4JXFA 5HE0A 4F6SA 3G0EA 1WMKA 5J1VA 4RFMA 2R3GA 4TYEA 5HCZA 2UZTA 5F20A 1K9AA 5C8MA 3C5IA 1JKTA 2LAVA 4QMLA 4YJNA 4CKJA 3DDPA 1R78A 5CU6A 3FJQE 5C4LA 4FSRA 3NSZA 1FQ1B 4ZTSA 2C3IB 2YCQA 3OEFX 3KXNA 3BLQA 4E4LA 2AC5A 2X2KA 2YFXA 4DYMA 2CLQA 4FTUA 5C01A 4G3DA 5AA8A 3PZHA 4NM5A 2XK8A 4EK8A 5L6OA 3TZ7A 3ATSA 5CQWA 4BDFA 1ZOHA 1NVRA 1GNGA 3P23A 3V6RA 2PVNA 2I40A 2PSQA 4ITJA 4CFMA 3HECA 4MXCA 5K4JA 4L3LA 5D12A 1FGIA 3F3UA 3JS2A 2EU9A 3W0RA 5D1JA 3LXNA 3T3VA 4J96A 4Y85A 3IGGA 5H9BA 4BDJA 5M51A 1PXJA 4C4GA 4U41A 2CCIA 4MBJA 5B2KA 3VBTA 5IA2A 3JVRA 5EOLA 4YJTA 5BUJA 4QYYA 2Z7SA 4JOAA 4GUBA 4ZSLA 2XKDA 4YLLA 4BWXA 3PA3A 4TNBA 4UALA 5J87A 3VW6A 2CPKE 1SM2A 5CF5A 4G5PA 1ZMUA 3O2MA 2BHEA 3DS6A 4R5YA 1L8TA 3KEXA 3L9MA 5GHVA 1XO2B 4RIWB 5M4CA 4O83A 1A9UA 2BKZA 3O7LB 5JQ8A 1PXNA 4QYFA 3PJ8A 3IQ7A 3U8WA 2RG5A 1PXOA 3IECA 4JQ8A 5GIOE 4GMYA 5IQAA 3QTXA 3MH0A 4KA3A 2ZM4A 4M3QA 1PKGA 4YZNA 2IW9A 3NUXA 5AP0A 3G15A 3NVKI 1H1WA 5M07A 5AR7A 4FTQA 3ZZEA 1JAMA 2QLQA 2ETKA 4I0TA 4ZSEA 3A8WA 5CF6A 3R63A 4QMXA 5KNJA 1YWVA 1ZYCA 2GPHA 3RVGA 4LYNA 4IIRA 4FV2A 5FDPA 2JDOA 4RGJA 4MQ2A 4AP7A 2YIYA 5AWMA 5GJFA 2OIBA 2CKEA 5FEQA 3OD6X 5GJGA 3OMVA 3NUAA 3BLHA 4BWKA 4BB4A 4GU6A 4KRCA 5KHXA 3LFBA 3VUTA 2R7IA 5K0KA 2ITVA 3BHYA 2HELA 4E4MA 3NW7A 4FTJA 3CR0A 2QHNA 4YMJA 4FTAA 2WGJA 4LUEA 4OTHA 4AZFA 3DZQA 3SC1A 4QMZA 4TYIA 4WBBB 2ITTA 2BZIB 3FL4A 3KY2A 2XNOA 5LMKA 4PTEA 4EOPA 4AT5A 4E8AA 4RIXB 5AMNA 4QP6A 2W5HA 1YWRA 1RJBA 3AMBA 4NIFA 3KF7A 4FG9A 4USFA 5TOZA 4H05A 3TN8A 4LMNA 4E20A 4K2RA 3FBVA 1BL7A 3HAMA 3PYYA 3QTZA 4AQCA 4RIYA 2B9IA 4XBUA 4FBXA 3D2IA 4ANSA 5IMEA 2X39A 3C5UA 2BZHB 3O96A 2VWVA 3EZVA 4BZDA 3FE3A 3Q9YA 2W4OA 3LCSA 5CAQA 3WBLA 5AR3A 3UVQA 4F64A 4CXAA 2IEWA 2YDIA 2BDFA 4L44A 3UQCA 4ZSAA 1M14A 1Q97A 4NTSA 3HRBA 2WO6A 2G01A 1MRYA 2WMRA 5A14A 2EXEA 2ZVAA 2VO7A 3QFVA 4I5PA 3EJ1A 4K8AA 4PPCA 1YOLA 5J9ZA 3OCGA 3VS0A 4DLJA 3EN6A 5E1SA 2DQ7X 5TO8A 3OT3A 3NUYA 5D11A 1SVEA 4D0XA 3MS9A 5IPJA 4BIBA 2GS6A 4WBOA 2RF9A 3EOCA 3H0YA 3RMFA 4FK3A 2J50A 5AUVA 3VS3A 1KE9A 3R04A 2C69A 3AD6A 2UZBA 2YJRA 5FEDA 4F9AA 4E4XA 4F0IA 5CZHA 2F7EE 2R4BA 1IA9A 2YWVA 4O22A 3ZLWA 2VTTA 3UMWA 5ETFA 1JNKA 1ND4A 4EQUA 5KKRB 5EK7A 3V5PA 5KMOA 1W98A 2RFNA 2IVTA 4WD5A 3EN5A 5EG3A 1IASA 4O96A 3R9RA 3TNQB 4ZMEA 4MH7A 4OBOA 3KL8A 4GW8A 3VS5A 4BZOA 3NYNA 1O6KA 5HD4A 5M09A 2C6IA 5F1ZA 4JBPA 1Q5KA 3R8VA 4QDVA 1OI9A 2E9UA 2OXDA 3H30A 3NIEA 5TE0A 4E1ZA 4YTIA 2QOQA 3I6WA 4G1WA 4NIFB 3T9TA 4Y8DA 4O2ZA 3QZFA 3ZM4A 1JBPE 4PL5A 4FNWA 5EM6A 5GNKA 4CT2A 4IMYA 4GV1A 1XH9A 2ZDTA 2Y0AA 4GUEA 4U9AA 4QP8A 4EC9A 5BPYA 3ANQA 3NAXA 3ZEPA 3FMNA 4EH5A 1YW2A 3N4TA 3AOXA 4QMVA 4KIQA 4EH2A 1NVSA 5IQEA 4J71A 1KOAA 4IB1A 3G5DA 4RQVA 5EYDA 1EH4A 1B38A 3QQLA 5I3OA 2W4JA 3EN4A 4FSTA 3A8XA 3A7HA 4C2VA 4KBCA 4LRMA 4NKAA 3TT0A 3ZUVA 4AZVA 5EM5A 4D4VA 4U79A 5HG5A 3RWPA 2BZJA 4EBWA 4ZJVA 2OJFE 3AGMA 1XBAA 4V0GA 1BUHA 4ZP5A 2XAMA 4EOKA 3D5XA 2XEZA 3FQSA 4BKYA 2UZUE 5JN2A 3UPZA 4O0WA 3NAYA 3QXPA 2WTIA 4M12A 3BX5A 4B4LA 4E5WA 2XNMA 4L01A 4NU1A 4CTBA 2Q83A 5FUTA 2C6KA 5IQBA 3KK8A 4KD1A 4O0SA 3VS1A 2VN9A 4IXPA 2CLXA 4BTFA 3OW4A 3SG9A 1OM1A 2NPQA 3OHTA 3MPTA 1J91A 4KB8A 1UNHA 3NUPA 2WAJA 2WIPA 3WZJA 3NZ0A 3NYOA 4OR5A 4D2SA 2BKKA 4IFGA 2JKQA 3MYGA 2YCRA 4GSBA 3EQCA 4KBAA 2QOIA 1RQQA 4KIKA 1UU3A 1OZ1A 4IWPA 2JKOA 5TT7A 1U54A 4A9RA 2X0GA 3ZH8A 3JY9A 3NNVA 4O86A 2J7TA 3GT8A 4M7IA 3B2TA 4XLIA 2XVDA 3F5UA 4YBJA 2VUWA 4LI5A 5A54A 4YO6A 3PRIA 5K5XA 2OJ9A 1VR2A 3DU8A 2FUMA 3TJCA 1M2PA 4DGLC 2QNJA 2Y9QA 2WZJA 2XM8A 4PNIA 3UIUA 3RNYA 3R7OA 4I1ZA 4EQCA 5C26A 4D0WA 3PG1A 2NRUA 3HAVA 3Q5IA 3CJFA 3PPJA 2VWYA 3IDCA 3QL8A 2GQRA 1Q3WA 5AEPA 4XV1A 3RGFA 3FY2A 3SAYA 5CSPA 1GY3A 3W16A 4F1MA 3ORMA 4KUJA 1TZDA 4IZ7A 4I22A 3G33A 3R7IA 2OFUA 3WF9A 1U54B 3W2CA 3ZBFA 4BRXA 5JRSA 5JMSA 3SXSA 3HEGA 5K3YA 3S95A 3IO7A 4ACHA 3ID6C 2A1AB 2CNUA 3EMGA 3R71A 2BVAA 1QPCA 2HW6A 1JQHA 3FC1X 1H00A 2C1AA 2X4ZA 4TYHB 5IUGA 1H26A 3RZBA 3BYMA 4A4OA 3COIA 4YZBA 5E8VA 3NFGB 4C38A 4FGRA 4C4FA 5I9ZA 3TM0A 5KMIA 3KREA 2C0OA 2B54A 2FO0A 3A2CA 3CKXA 4YZMA 4XOZA 3R1YA 3OFMA 2VX0A 3ZLXA 2PZIA 2QU6A 3SHEA 4ERWA 5DRBA 1YQJA 3MA3A 3ZFXA 4DEEA 2YLFA 1I09A 3VBYA 3OXIA 3JY0A 3V8WA 2BRMA 2CN8A 5E91A 4TL0A 4F78A 4FL1A 4DG0E 1XBBA 4FZFB 3BCEA 3DK7A 3OUKA 2VRXA 4I21A 4U43A 4BTMA 5CS6A 4D4YA 3Q4CA 3FYKX 3EFJA 1OGYA 4P4CA 4UX9A 1VYZA 3PSBA 3M42A 3QTRA 4M67A 2C5OA 5C4KA 5KZIA 3TXOA 3ZRMA 3F2RA 1YXSA 3PA4A 5L6WL 3CKWA 4FG8A 4G6LA 3MH1A 5LMKC 3LKMA 3MFRA 3EKNA 2ZYBA 5EH0A 2O8YA 3OWPA 3MW1A 4V04A 5J95A 4B99A 1XH7A 4GJ2A 3GOPA 4BCNA 3NLBA 2ITZA 4XRLA 3BV3A 2IZTA 2WMBA 3DOGA 3FHIA 4ZY4A 4DHJA 3AD4A 4DCAA 4D1ZA 2GFCA 4FGBA 4MCVA 4AA0A 2RFEA 4GT4A 4Y72A 4DFUA 2AUHA 2VTMA 3BV2A 2QOOA 3VULA 1Q3DA 4A7CA 2NP8A 4S30A 3T3UA 4BGHA 3E8NA 4FKQA 3QC4A 5KMNA 4HGTA 4IDTA 4XHKB 5CI6A 2HOGA 4HCUA 3NUUA 1W0XC 1YXUA 2W17A 2XIYA 3LIJA 4QMPA 2AC3A 3KMWA 4E6CA 4F1TA 1T46A 3ORZA 4Y95A 1F3MC 4J53A 1BMKA 5HORA 3EQRA 3UP2A 2XM9A 4YTFA 2WQBA 4J7BA 3VJOA 3KXZA 1PW2A 4QP2A 5HOAA 3ZDIA 3EN9A 4W4WA 5TF9A 2C5VA 4FSYA 4OTWA 3WF8A 3P86A 4L7SA 2OXYA 5E8SA 3IDBA 4G6OA 2WMVA 3ITZA 2ITXA 3R8MA 3RPRA 2PUNA 3ORTA 3DTCA 4ERKA 4F1OA 3NRMA 4RA5A 4JBQA 4K33A 3SDJA 4CMTA 5EKOA 2Z7LA 4ZEGA 4DFXE 5CASA 5CYIA 4GYGA 2WQNA 4FV4A 2C0TA 4WHZA 4PDPA 1ZZLA 4WRGA 4QMSA 5DT4A 2YM4A 1GZ8A 4TYJA 3BPRA 4RIYB 2ZV2A 3HDNA 4AF3A 5I4NA 3NNXA 4EOIA 3MVJA 3C4FA 3CQEA 5AP2A 3VRYA 4PX6A 2OICA 5DR9A 5A6NA 2OIDA 2WMXA 5HX6A 3KMUA 4KKEA 4AS0A 2G2HA 5T6KA 3Q2MA 3DTWA 3A4PA 4G3GA 5E8UA 4D1SA 3LAUA 5IH5A 3FC2A 3CC6A 3E8DA 5ICPA 5IEXA 3M2WA 1F0QA 3EQBA 4F7NA 4L52A 5CANA 2UVZA 2Z2WA 2EB3A 1WBVA 3KRXA 4G9CA 4F6UA 4YC6A 4NL0A 5EM8A 2VO6A 3SRVB 3WILA 5AAEA 3KULA 4XG7A 4K0YA 3RP9A 4KRDA 4MK0A 3QZIA 4PNKA 4IAZA 4D28A 4MBIA 2X0QA 5DH3A 3K3IA 3QKKA 3DA6A 1XR1A 3G90X 3JXWA 2W9FB 3EN7A 4YJOA 1UWHA 4DEIA 3DB6A 4JR3A 5EKNA 5DVRA 2IG7A 2QKRA 4PWNA 3RWQA 5KUPA 3P5KA 3QUPA 3TMOA 4RC3A 5JFXA 2YCFA 3PY0A 4J97A 5GZ9A 2JAVA 3HDMA 4UV0A 3RAHA 4L3PA 3PP1A 4YURA 5L4QA 5D9HA 3UNKA 5FTGA 5L8LA 5BQ0A 4N57A 3UC4A 2BAQA 5ANGA 4PP9A 5A46A 2YITA 5DT0A 3PFQA 3S00A 4FKOA 4I6LA 5TKDA 4N6ZA 3W0PA 3G9NA 1Z5MA 2ACXA 3C1XA 5I9YA 4IADA 1DI8A 4DC2A 4JG7A 4I6FA 1XH8A 3NUNA 3ZLYA 3G2FA 4CCBA 3BWFA 2VNWA 5TR6A 5B2MA 4A9TA 3UBDA 5DFPA 4FTKA 3VUMA 4L3JA 2C3KA 5FGKA 2HXLA 4PRJA 1OPJA 3FQHA 2G2FA 1NA7A 4HYUA 4ZOGA 2GHLA 3KK9A 4XNEA 5EFQA 2UW5A 2PE0A 4O7YA 3ZUTA 5GINE 3UVPA 3F3ZA 3NGAA 3BQRA 4UMRA 1O6YA 4I3ZA 3DBQA 2WTKC 4EC8A 4C61A 4DDIA 3VS4A 2YM3A 3PXYA 2XANA 4LM5A 4YTCA 3HMNA 4UWYA 3V6SA 5BV3A 2J6MA 2ZJWA 4AGCA 3L8VA 3DBEA 3T9IA 3S3IA 3W8LA 4XV2A 4JLCA 5LVPA 3WZDA 3R6XA 2W05A 2JDTA 5LARA 3CPCA 4EL9A 2Y6MA 4HYHA 4BKJA 4R3CA 5FDXA 2GNIA 3PXRA 2JBPA 3T8OA 5FXRA 1G8JA 4WUNA 3ZXTA 2C6OA 4A4LA 5EQPA 4P2KA 3CSVA 3R21A 4X0MA 5LWMA 4DH5A 4LGHA 5C27A 4BCHA 2W96B 3AG9A 3FI4A 4TRLA 3W10A 4IWOA 4RPVA 4LGDA 1OITA 1JKSA 4H3BA 3UZRA 3W0OA 5DNRA 2GHGA 3FMDA 3QD2B 5HBHA 3TCPA 3A61A 5BX0A 3DJ5A 2YEXA 3NUSA 3UDTA 3QZHA 5CU2A 5L8JA 3ZZWA 1UA2A 2BAKA 3FZRA 3FLNC 3PG3A 1RW8A 3FLYA 3VBQA 4IANA 4AA5A 4EZ3A 2YM6A 4ZLZA 4YTHA 3QHRA 3EH9A 5IUIA 4TYHA 3VF8A 1G8SA 4YJUA 3VHEA 3CCNA 5KHWA 5FEEA 4M66A 3VJNA 2QG7A 4X6RA 2HXQA 2RKUA 3EFLA 4G3FA 1M2RA 2XEYA 2FSTX 5FBNC 3LFEA 1OIUA 2XK4A 1W2FA 2CGVA 5IU2A 3TKHA 3ML1A 3PFYA 5IQCA 2B53A 4M14A 5CXHA 3U54A 2UZWE 3PIZA 5DI1A 4YJPA 2PUUA 2P4IA 2Z02A 3DJ6A 3CTJA 2QG5A 3L9PA 2OW3A 3EWHA 3DY7A 5CWZA 2WQOA 3BYVA 2CN5A 2VNYA 4RIOA 4F65A 4ACCA 2VTOA 3L9NA 5I9XA 3P79A 5IA5A 2CDZA 3FMJA 4FV0A 3GU6A 4CFWA 3GU8A 3R7VA 2QKWB 2VWIA 4EK4A 3MB7A 1PYEA 5CZIA 3FSFA 4FI1A 2JAMA 5J9YA 5B7VA 1JKLA 3D7TB 3NEWA 5BVNA 2Y6OA 3AT2A 4DT8A 3R7EA 3D83A 2F7XE 2CNVA 2QOFA 3ZFMA 1OUKA 4DG2E 3PJ3A 4ZZOA 2GQGA 5I0BA 5HVYA 2Q0NA 1QPEA 3VBXA 3KN6A 4C3RA 1LUFA 3W1FA 3GC0A 4UY9A 5M4UA 1GZKA 4AU8A 2W1FA 3QAME 4I93A 2PU8A 1WVXA 3CQWA 3K3JA 4GVAA 4KWPA 5K5NA 1URCA 2F2CB 1MQBA 3EL8A 1KV2A 4UMPA 3KCKA 4WNOA 3Q96A 3E63A 4B0GA 5BUIA 4FT3A 2C6LA 4TT7A 4UMUA 4FJVA 5AFVA 3DBDA 1XQZA 2UW8A 4FIJA 4GK4A 2PVJA 1OL5A 4EONA 4BJJB 3RK5A 4FICA 4EKLA 5CEPA 3R22A 3UG2A 4GK3A 4OTQA 3V5TA 4DDGA 1IR3A 3I7CA 1H1RA 3LE6A 2QVSE 3F7ZA 3OBJA 5AR5A 3SKCA 4BCIA 4O82A 3MA6A 2XIZA 1ZMVA 1OMWA 3AC5A 3ANRA 4QPAA 3NR9A 3NNUA 3OT8A 5AV0A 1P4FA 1SVHA 4BBFA 4R3PA 3NDMA 3I79A 3VONA 2JITA 2R3OA 3RAKA 2C3LA 5AIRA 1WVYA 4L6QA 4BDIA 1PYXA 4XG8A 2QD9A 5HGIA 4ANMA 5JQ5A 3DKOA 4P5ZA 5BVOA 4H58A 5IZFA 2B7AA 3MI9A 2ETRA 3RBWA 4DINA 2BFYA 1JOWB 1G5SA 2J90A 3ACJA 3IW7A 3MVHA 4IVDA 5ANJA 3VUHA 1OIYA 3R02A 3KMMA 4KABA 3MPAA 4RC2A 5AADA 4CFXA 3TYKA 2VTSA 5E9EA 4FSQA 3F2AA 2VWWA 4BIEA 4BDBA 5EYKA 3B8QA 4TKSA 2W1EA 2ZM1A 4U7ZA 4JMQA 4TWPA 2YM8A 5D7AA 2GNLA 4FRFA 3U4WA 3PE2A 2QOBA 4JG8A 4E6QA 2C6DA 4XG3A 5HVKA 3LOKA 4ZTNA 3VF9A 3QRKA 5CF4A 4FYNA 4C34A 3DAKA 3K5UA 4EZ7A 5I9VA 4APCA 2WNTA 3PPKA 4LL5A 4CRSA 2P33A 3PUPA 3IW5A 3VUIA 2GQSA 3FL5A 1VYWA 1OVEA 3NYVA 3PVUA 2FSLX 2R5TA 4R8QA 5BYLA 5IDPA 4CKIA 1FMKA 2XNBA 5JFWA 2VX1A 2QQ7A 2C0IA 4WNPA 3GFWA 4DF3A 5EQYA 4MNEA 4XUFA 4I4FA 5AV2A 3CPBA 5FWKK 3F88A 4WSYA 4L45A 1WBTA 3TEIA 4BGGA 2W1CA 4QYGA 3WYXA 2RIOA 1LPUA 5HEZA 2PPQA 1GZOA 4EOLA 1SNXA 3D7TA 5L8KA 4ORKA 3U87A 4MXAA 1TQIA 4X2FA 1G3NA 2PL0A 4WG4A 2OZAB 2QO7A 3GQLA 2J0MB 3IGOA 3Q4UA 2PUPA 2ONLA 3K54A 2WB8A 3ZRLA 2X8IA 2VO0A 3QD4A 2X0OA 5LOHA 3U4UA 4ACDA 4LDTA 4XLVA 2WTCA 3P08A 4JIAA 3KRJA 5CT7A 4UB7A 5DBXA 3PWDA 5D41A 3QCSA 2YJSA 4BCKA 4IFCA 4EK6A 2PYWA 5AV3A 5DRDA 2ZB1A 1LEWA 3HKOA 4UZHA 1J7UA 3BYUA 4CFNA 5GJDA 1OBDA 3PLAE 5FXQA 2QI8A 3P4KA 5J8IA 3QU0A 2UV2A 3RK7A 5ANOA 4APPA 3GENA 2P3GX 5EHLA 5EDPA 4C3FA 3FAAA 1ZARA 4FKSA 2VWXA 3VC4A 3I60A 4RG0A 5LVMA 3QCQA 1M17A 2J5FA 4BWPA 3VBWA 4EYMA 3EL7A 1MUOA 3ENMA 3V5QA 1MQ4A 3Q5ZA 2RL5A 5EW9A 4L7FA 4TNDA 5LCJA 2XIKA 2IO6A 4IVAA 4MXXA 4YHJA 2ERKA 1UU7A 4KS8A 4FIFA 4GG5A 2XMYA 2HZIA 4W9XA 4AOJA 2V22A 5CU0A 1Y6BA 1V0BA 3DNEA 5C03A 4FV7A 2R2PA 5B0XA 3MWUA 3QBNA 4NFMA 4YJQA 2IN6A 5CT0A 3C51A 2F49A 3A4OX 2YWPA 2IF8A 3GC8A 4FKVA 4K6ZA 4WG5A 4Q5EA 4QQ5A 4AAAA 2C68A 2JLDA 1L3RE 4O1OA 4E26A 5ACBC 3OTVA 4EUTA 2P0CA 3TDWA 4DFNA 3ZMMA 4DEDA 4ZSJA 3BKBA 3E8CA 5J9LA 5BVWA 4DCEA 2VTAA 4AW2A 2GTNA 3C0IA 4GVJA 3SD0A 2JDVA 4FUXA 3BU5A 2BTSA 3R9DA 2ZMCA 3PVWA 2FH9A 3Q9XA 5AIKA 4G31A 2J51A 4FG7A 3UOKA 1W8CA 2EXMA 5L2QA 3HP2A 3TI1A 1XMLA 4AOIA 3BL7A 1P5EA 3ORNA 2XZSA 4ONAA 2RFSA 1PMVA 4PY1A 3ZRKA 4X2GA 3P9JA 4W4YA 3AKJA 5LVLA 4GL9A 3U6IA 4O7NA 3RPVA 2BALA 4CFVA 3QLFA 2HIWA 2R3HA 2ZV8A 3IONA 3R83A 2F7ZE 1SVGA 4D9TA 4PDYA 1SZMA 4BDGA 4WNMA 2A0CX 3S2PA 2FYSA 4QYHA 1KUTA 5HG8A 4ASEA 3HVCA 5CQUA 3F9NA 4ZTHA 3UJGA 4FIHA 5DHJA 1J1CA 5HIBA 3DLSA 1G8AA 1WBNA 3QUEA 5AJQA 3GCQA 3LQ5A 4WIHA 5E8XA 4O7ZA 5AP4A 5CI7A 2B0QA 4RJ7A 1GOLA 3QQJA 3UNJA 4BHZA 4PDSA 2WTVA 5EOBA 1UU9A 5CX9A 1H08A 3FEGA 4ANNA 3TIYA 1GIIA 3W2PA 1Y91A 3MGYA 3DLZA 1W7HA 3ETAA 1J3HA 1URWA 4OTDA 5CAUA 4MYGA 1ATPE 2PZPA 3NS9A 2R3LA 1HCKA 4UXLA 5CLPA 4BCMA 2XRWA 2HENA 4HCTA 5AP5A 5EM7A 3U9NA 4MNFA 4ZXTA 3FZPA 4OTRA 4C37A 4FV1A 3SGCA 4FUYA 2UZEA 1YWNA 3EQIA 3UDBA 2VTHA 1Q24A 3EYHA 3FV8A 3II5A 1UWJA 4FIEA 2JIUA 2VTPA 4C8BA 4RX5A 2OJJA 4NYEA 3W0NA 3QX2A 5JKGA 4UMTA 5IDNA 4C35A 4MKCA 2B9JA 4YJSA 3KULB 2PVFA 3MV5A 2JDSA 4I6BA 2YLEA 1WZYA 3BHVA 5C9CA 4EHGA 1AQ1A 4F6WA 3TWJA 3EZRA 3VQHA 3WE8A 3N51A 4BI0A 4N0SA 3QLGA 4A9UA 5C1QB 2B1PA 1O6LA 1PXMA 1UKHA 3NCGA 2EWAA 4V01A 3R8ZA 1QPDA 3BEAA 2Z7QA 3HMIA 5HNBA 3RTPA 5AA9A 3UDSA 4CLJA 4XRJA 1U5QA 4QPSA 3R9NA 1LEZA 3LXKA 3UMXA 4QRCA 3ALNA 4DA5A 1IG1A 4CG9A 2UVXA 2X4FA 2QCSA 2DWBA 4DFLA 2NYAA 3OXTA 1Q8WA 4IHPA 3W2QA 3F66A 1IRKA 3FZSA 3H4JA 5IQGA 3MFTA 3MTLA 3QKLA 3DXQA 4AZTA 2W7XA 2O63A 3TKIA 5JZNA 1FMOE 4O4FA 2NO3A 4EI4A 3AC1A 4FKLA 4U3YA 3FSKA 5LJJA 2PWLA 4JS8A 3GNIB 3HYHA 3UGCA 1AD5A 3QRTA 3RK9A 4F9WA 2PMLX 5IISA 4RJ6A 1FVTA 4IJPA 5M55A 2X6DA 2YZAA 3E5AA 4LGGA 1XH4A 2XK7A 3CXWA 5E8TA 4FTOA 3WIKA 2XF0A 3FYJX 5H2UA 4DHFA 4YJRA 3U51A 1STCE 3RCJA 5T3QA 2PVMA 3ATTA 4C4EA 2VGOA 3FDNA 5DLSA 4EKKA 2V62A 2OK1A 3OW3A 3ZONA 3F69A 4U80A 4ZY6A 4F63A 3U9CA 4C59A 4AXFA 3BQCA 4BY9E 1J1BA 3EKKA 5CALA 3G6HA 5E4HA 3QKMA 4GCJA 2CKPA 5E90A 3C4CA 1NW1A 3OOMA 2ERZE 4GIHA 4RWLA 2V5QA 3V5LA 4MF1A 3RZFA 4PMTA 5CEQA 4QP1A 2OG8A 4DG3E 4QMWA 1QCFA 1R39A 4RWIA 3C7QA 3C0HA 5ACKA 1V1KA 3V8TA 1TKIA 4RWJA 4PL3A 1OB3A 4QPMA 3TV4A 3KIOC 3CJGA 4QEBA 1H27A 4HZRA 1P4OA 4ZJJA 3VUDA 3LMIA 3IW8A 5HKMA 1BKXA 2ITYA 4IWQA 4J8MA 3RALA 2W06A 4F9BA 4OW8A 1M7QA 4GS6A 2LGCA 4I0RA 3DJ7A 5LMBA 3GCSA 4W8EA 4FL2A 4ZLOA 4U42A 2YACA 4FKJA 4S33A 3VS7A 4AGWA 3KXXA 4CZTA 4TWOA 3ZUUA 4NT4A 3LM0A 4TWCA 3FI2A 4A06A 2HY0A 4EH6A 3KCFA 3MY5A 4FKGA 2W5AA 3L1SA 1UV5A 1OKYA 4FTCA 3QA8A 2OWBA 2PHKA 4MNEB 1GAGA 3AMAA 4X2JA 3VS6A 3NFFB 2WMQA 4MUQA 3AC8A 4EH7A 4EUUA 3PJ2A 3Q9ZA 3QALE