4ASZA

Crystal structure of apo trkb kinase domain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
299
structure length
289
Chain Sequence
GAMDTFVQHIKRHNIVLKRELGEFGKVFLAECYNLCKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BDNF/NT-3 GROWTH FACTORS RECEPTOR
publication title The Crystal Structures of Trka and Trkb Suggest Key Regions for Achieving Selective Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 289
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aszA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aszA01
4ZSGA 5F4NA 2GCDA 2J50A 2R3LA 5DIAA 3U87A 3WZJA 2WAJA 4FG8A 4BDJA 3OEFX 4UEUA 1V0PA 2X6DA 2XRWA 3IECA 3OF0A 2B1PA 4FUYA 5TT7A 3HA8A 4RC2A 5LQFA 3TACA 1PY5A 2UZEA 2YM6A 2JKOA 4X2NA 5ICPA 4D4RA 3SQQA 1YHSA 1GJOA 3FYKX 3FV8A 1Q5KA 3ORIA 4O0TA 2GNFA 5HBJA 2OW3A 4FODA 3GU4A 2BVAA 2XVDA 1APME 4K11A 3ZDIA 4HCTA 4F99A 1J1BA 2B7AA 2J7TA 3KRRA 4J52A 3PYYA 3TV7A 5HO7A 5ETCA 4U80A 4Y83A 1CDKA 3BQCA 2QNJA 4U97A 5CEMA 5BQ0A 2XJ1A 2XRUA 3R7UA 4E6AA 4YZNA 4EK8A 2CJMA 2Y8OA 1XQZA 4BZDA 4DG2E 4EHZA 4QMLA 1YOLA 4RWKA 5CT0A 4FZ6A 5LCKA 4D2WA 3HZTA 4P90A 5IUIA 3RGFA 3S00A 3A7GA 5HORA 3EN5A 4EBWA 4NSTA 1RDQE 5M55A 3FZRA 4DEAA 1L3RE 4MF0A 4QQTA 1ZOGA 3POZA 3QTIA 3E88A 3KF4A 3NSZA 3NUXA 4MTAA 4M84A 5C01A 4D2PA 3S0OA 4C4HA 3MIYA 4P5QA 3RM6A 4LGDA 5FUTA 5CENA 4L3PA 2PMLX 1LPUA 4UV0A 3G6HA 3SXSA 4QTBA 4Z7GA 4USEA 5E8VA 3MVHA 1F3MC 4JX3A 4F9CA 4GK2A 2PMNX 3ROYA 2WTCA 4A9RA 1JKLA 4W4YA 2VO6A 3I79A 4NM0A 3RHKA 4AFEA 5E9EA 5J1WA 2XCKA 3EQHA 4MF1A 4XP0A 3QTWA 2YJSA 3HV6A 4FSRA 3Q5IA 4KBKA 4BC6A 4AZFA 3TZMA 5CU3A 5IA5A 2YCFA 3FKOA 3RAKA 2HENA 5FGKA 3ZYAA 5AUVA 2BIYA 3QQJA 1VZOA 4Y72A 4EUTA 5GHVA 5EI6A 1UVRA 5KMKA 3DBQA 1NVQA 1Q8WA 3FZSA 5FDXA 3AT2A 5AA9A 3KRXA 1GZKA 1OL1A 4FV0A 4XLIA 2WMVA 5HNIX 1JNKA 5EH0A 1YXTA 3R83A 4C3FA 2OBJA 5AP4A 1Z9XA 4EQUA 3SG9A 3VUGA 4BBEA 3COKA 1OZ1A 1JOWB 3RAIA 2B4SB 2VWWA 2XP2A 3BYUA 3DB8A 3QC9A 2LGCA 4GFGA 2GSFA 4EH9A 1J7UA 2C3JA 1MP8A 2W1GA 4ZTHA 2OJIA 2YISA 2C6TA 5L6PA 3DY7A 5KO1A 4EH2A 3E8DA 1OMWA 4EC8A 1XHAA 5EHYA 4HJOA 3EB0A 4N6YA 2WTIA 2XIZA 3H9OA 5TOZA 3VBXA 4C59A 4AF3A 3C1XA 1UV5A 3P86A 4IB0A 4V0GB 4FTTA 1YDSE 3LLTA 5AP2A 1TQPA 3QD0A 4XEYA 3OTVA 2XS0A 2YABA 4FTOA 2ERKA 3TTIA 3NRMA 2Q0BA 2R7BA 4OBQA 4WIHA 1H07A 2WTJA 4O86A 4CMUA 2ITYA 5BMMA 3O51A 5CLPA 4CQEA 2QURA 3LFCA 1DAWA 3T3UA 4HVGA 1W8CA 2EVAA 3UZPA 3UOHA 3PG3A 5CASA 2J9MA 5HE3A 4AP7A 1HCLA 1U54A 2EB3A 4U43A 3MPAA 4GVAA 5IKWA 3L9PA 2WU6A 2ZV9A 3MH0A 1PRYA 4ORKA 5AR7A 4QQ5A 3DK3A 1UNGA 1YDTE 2HOGA 4P4CA 2Q0NA 3QTRA 5FTOA 1J7LA 2XKFA 4RFYA 5JH6A 3O71A 3OHTA 2C69A 4GU9A 2IZUA 4CZUA 4F08A 2OG8A 3GVUA 4NL0A 5C26A 4LRMA 5CS6A 2VWYA 5IZFA 4DH7A 4O22A 3GENA 2X7GA 4YZMA 3MVMA 3NR9A 4HPTE 3V5QA 3IW8A 2XEZA 3PJCA 2PTKA 3MI9A 4BI0A 3SLSA 4Q2AA 3QAME 4W4WA 5M07A 4JJRA 3NMUF 3ENMA 4WKQA 1Z57A 1BLXA 2PVJA 2YCRA 3CY3A 3HMIA 3QRTA 3NS9A 4Y46A 5CSHA 4U6RA 2YITA 3I6WA 4ASZA 5BVFA 4FBXA 1PXKA 4CCBA 2ERZE 4D28A 5HX6A 5L8LA 4ACDA 4BL1A 1OBDA 3DPKA 5E8UA 3WF9A 2JGZA 4GIHA 5H9BA 2UZLA 5DA3A 4AGUA 4RLLA 4ZSAA 4NM5A 3QQLA 3VJNA 3DQWA 3PVUA 4KA3A 4QP3A 3FZOA 4R5SA 4K18A 4CZYB 1P4OA 2WTDA 1PXOA 2EB2A 3QTQA 1O6LA 2JDOA 1O6KA 2BRGA 3PSBA 4DAWA 4F9BA 5LWNA 3R9RA 5LMBA 5CNOA 4AOIA 5HESA 5IF1A 2W9ZB 2YIQA 3KXGA 3MSSA 5AR8A 2W4KA 2XKEA 4FKRA 4H39A 3I5NA 2XIKA 4OTFA 3V8WA 4D9TA 5JSMA 4UN0C 3FMKA 2B52A 2NNWB 5HLWA 5IQEA 2YZLA 4ANQA 2PYWA 4PDYA 4MYGA 4V0GA 1DAYA 3QZFA 4YBKA 1GIJA 5I9XA 3QLFA 4FMQA 5K4JA 3WILA 1Q62A 1ZMWA 4FNXA 4G16A 3Q96A 3ZSGA 4CKIA 3JXWA 3G6GA 3FMDA 3UDBA 3PXFA 2ETMA 2A0CX 3FLSA 5HLNA 4IJPA 1IAJA 2EU9A 3MH2A 3BLRA 2BRHA 2VWVA 3QLGA 5C27A 3VS3A 4IB3A 3ZEPA 4BBMA 3E3BX 2W5HA 2VTOA 5IDNA 3HV7A 4I3ZA 2XMYA 2PPQA 3CGOA 4GYGA 5IMEA 1IAHA 5CU6A 3TZ8A 1ZOEA 4G5JA 3EN7A 3FMHA 3PUPA 1K2PA 3RNYA 4BTJA 3MB7A 2CLQA 2ZV8A 2GNGA 4DGNA 3PZEA 1M17A 4LL5A 2UZUE 3DBFA 4QYYA 5DFPA 5F95A 2C6DA 2C0IA 3BGQA 1PKGA 4NTTA 1JBPE 4OTQA 4GH2A 3BKBA 3PXZA 3PVGA 4YJUA 2VTHA 2VWZA 4JIKA 4DF3A 3E63A 4AN9A 4FEUA 3G5DA 4IWDA 3DTCA 3V6RA 3WI6A 2BFYA 3E87A 4PNIA 3NW5A 3ZLYA 1OECA 5HBHA 5L4QA 1ND4A 3RVGA 3JS2A 3DOGA 3COIA 3ZSIA 1KE9A 1WBWA 4ZTSA 3GXLA 3NUUA 3GQLA 3QFVA 4JBQA 4QPSA 3TJCA 4E3CA 3AC4A 4RVKA 2Z7SA 4ZY6A 2XA4A 4ANBA 5HZNA 2I40A 3IGOA 3JUHA 4UMRA 3LIJA 4XOYA 1ZLTA 2R3JA 3FI2A 3EQRA 3G51A 3OWLA 4RGJA 5CI6A 5FBOA 4WD5A 4RFMA 5CTPA 5HG5A 5HKMA 3DXPA 4G3FA 2GHLA 4E6QA 5JFVA 4CLJA 3FEGA 3CQUA 3R7EA 4RT7A 1ERKA 3L8PA 3GFWA 4AW1A 5KHXA 4BY9E 4IB1A 4BKYA 5TE0A 2QOQA 2QOKA 4A9YA 4QP6A 3MN3A 2W4OA 5HHWA 4W8EA 4M66A 2G2IA 3EQBA 2BZKB 3D5VA 2BRBA 5L8JA 3FPQA 4FTAA 4ALVA 5KCVA 3N4TA 5H3QA 3IW6A 4EK5A 2WB8A 2V7OA 3AC1A 3AMBA 2FB8A 4FEQA 4LV8A 3C4WA 4CYJA 3VW8A 5L8KA 3EL8A 5IQFA 2J5EA 3BPRA 5TF9A 2YERA 3SW7A 4AT5A 1QPJA 3PIXA 3Q4CA 3P0MA 4J7BA 4GRBA 4PMSA 3ATSA 3M2WA 2WEIA 2C6MA 4WT6A 1JKKA 4ANNA 4YHJA 3IO7A 3K3JA 3UC3A 4AGWA 5IH6A 1OI9A 4K8AA 5A4EA 4YJTA 5E8WA 4J95A 4RC4A 3D15A 3PFQA 4HZRA 5L2WA 3A7FA 3KCKA 3PP0A 5E8XA 5L6OA 3FY0A 4ZLZA 4FGRA 2XF0A 3IGGA 2E9VA 3M1SA 4RZWA 1ZYLA 3NNXA 4XV2A 3VF8A 3C0HA 1WVXA 2BROA 3TNWA 2W1EA 3TNQB 3LQ3A 5D1JA 3QZGA 1OL2A 2UW0A 4HOKA 5CVFA 5DWRA 4ZLOA 3PA4A 2RFDA 4NUSA 4E20A 4NZWB 1UU7A 3MY5A 4IH8A 3TUDA 1NY3A 5F9EA 4O7TA 4BI2A 2XIXA 3F2AA 1R78A 3QYZA 2R0UA 3LJ0A 3PPJA 2UVYA 1H28A 3UIMA 4PDOA 4C37A 4PMMA 5EM8A 4HYUA 2WPAA 4J8NA 1P2AA 4O6EA 4D2RA 4WBOA 2PVLA 4BWXA 1ATPE 4DE4A 3MIAA 4ZJIA 2OJFE 2WMTA 5EYDA 3ENHA 3KXMA 4LGGA 3UVRA 5KMMA 5LXMA 2R3IA 3VUTA 5K4IA 4IXPA 4MXOA 4YU2A 3R63A 3HMMA 5IG1A 4IM3A 3UP2A 3CXWA 5IA2A 1YXSA 2E2BA 3E3PA 4S34A 1KOAA 4DITA 2W1DA 3OCGA 5LVOA 4UMUA 4IM2A 4B6LA 3R22A 4YJOA 3C5UA 4CFNA 1CMKE 3ZUTA 2W06A 4TXCA 4B8LA 3BE2A 3BZ3A 1YXXA 2ZMCA 2WOUA 4UBAA 1XJDA 4EUUA 3AOXA 3BV3A 5M4CA 3UPZA 3FAAA 3ZO3A 1KV1A 1SM2A 2RL5A 3KRWA 3OTUA 4IX4A 2F49A 3DKCA 1S9IA 2IVUA 4FKUA 4GCJA 2O63A 4L42A 4MBJA 1FVTA 3ODYX 3AG9A 4TL0A 5AV1A 4DA5A 4JG7A 4IANA 5AX3A 4RWLA 1OKVA 3TDVA 3MB6A 4JIAA 4EZ5A 2RFNA 4MX9A 4WBBB 5JGBA 2XUUA 3R7IA 4A06A 1R3CA 2C3KA 3W33A 4DINA 3P78A 5AP1A 4EL9A 1UKIA 3WYXA 4DH8A 5D7VA 5EOBA 4BTKA 4D55A 3UYTA 4CTCA 4QMPA 4CD0A 4F0IA 4O82A 5IQDA 2G9XA 4EHGA 2IW9A 3WE8A 4O0VA 4XUFA 5J9ZA 2X2LA 5FTQA 3V5PA 3VIDA 3DXNA 5A14A 1M7QA 2BILB 3DS6A 2QO7A 4QP2A 4I92A 3UOKA 4FEXA 4BDIA 3F61A 1JLUE 2JFLA 4MNEA 5ANGA 2PSQA 4QMTA 4ZAUA 2ETKA 1P5EA 3I5ZA 4R77A 1WVWA 3G9NA 4N70A 5HCXA 5ITAA 4HVSA 1ZZ2A 2WQEA 5JFXA 4HYHA 4UYAA 2ZOQA 4NM3A 3P1AA 4W9XA 4CQGA 4M0ZA 4FNWA 5JRSA 2PVYA 3GQIA 3ZCLA 5CZHA 4KIPA 4FIFA 4KSQA 3MTFA 2UZTA 2R3RA 1XWSA 4YPSA 3R30A 3NCGA 4RWJA 3R8MA 5B2LA 4GKHA 4IC7A 4W4VA 3R9OA 4FK6A 3EOCA 4YSJA 5GZAA 4C4GA 4GK4A 4O27B 2R3MA 2AC3A 5AM7A 4K77A 3W2PA 3ORKA 4EI4A 2F7XE 3FZTA 3QF9A 4CLIA 3FZPA 4OT6A 5AIRA 3EN6A 3DZOA 4L6QA 2PZYA 5EYMA 3OWPA 2OZAB 4FYNA 4QYGA 4RVMA 5L3AA 3IQ7A 4PTGA 2CKOA 3QWJA 4I4EA 3QTUA 3RTPA 4FV7A 2IPXA 5EM7A 3R8VA 4IVCA 1W7HA 3W18A 2SRCA 4KSPA 2W5BA 3TIZA 1UU9A 2QOHA 4AG8A 4BDKA 1PMVA 3DLSA 4PPCA 2X8DA 3OFMA 4G34A 2VO0A 4J96A 3K3IA 3T8OA 3R9HA 3ULZA 5I3OA 2GMXA 3TTJA 4QRCA 2CGVA 4IX3A 3LQ8A 1OITA 3PTGA 4RX9A 4EOQA 2RF9A 4F1TA 2HELA 4FKSA 3I7CA 4BFMA 4WNKA 1CTPE 1B6CB 1Q8ZA 4RIWA 4U3YA 3CQEA 4RIYB 4O0UA 2WTWA 4GUEA 2R64A 1OPKA 3ORTA 4FKPA 3NGAA 4FTRA 5E8YA 4XG2A 4FV6A 5CAOA 4F1OA 3MFTA 4YC3A 2VN9A 3ID6C 1YI6A 4ZLYA 4CKRA 2XYUA 2C68A 2XK4A 4DTBA 3OMVA 4U0IA 4EK4A 3O7LD 3NCZA 4QMXA 2A4LA 3HEGA 4GVJA 4H3PA 4WHZA 3U6HA 4Q9SA 3BBTB 3VF9A 4BI1A 4ZTRA 2C6OA 2CSNA 4Q5EA 3VVHA 4CFFA 2FUMA 2H34A 1F0QA 3KU2A 4O7WA 4K1BA 2AYPA 2XNNA 3OXTA 3QUPA 1ZRZA 4YLLA 4LOPA 3KC3A 3CD8A 3R21A 3LM0A 3FQSA 3KXZA 2VWUA 4AE6A 5ANEA 3UYSA 2V0DA 5HIDA 4C36A 2VTQA 3E62A 3K2LA 4H3QA 5KZIA 2PZPA 2JAMA 1PXLA 2IJMA 2VWXA 4AN3A 4MXYA 4Q5HA 3UC4A 5D12A 3UO4A 4EH4A 4PRJA 4IC8A 2J0IA 3DKFA 4X3FB 3BRBA 2YHVA 4XOZA 3OZ6A 5EDQA 3C50A 2OH4A 2GNIA 3ITZA 2HY81 4Z3VA 3GCUA 2OFUA 3OWJA 3PJ8A 3PY1A 2HYYA 3OCSA 4PL3A 3DGKA 2BFXA 3DZQA 4FC0A 4JT3A 4ZTLA 3VQHA 3WIGA 2Y7JA 3SOCA 2WFYA 4FT9A 4FA2A 3G9LX 2B55A 4JL9A 3U4WA 1KUTA 3IW7A 4L01A 2YDJA 3MGYA 1OB3A 3B2TA 1JSUA 2B9JA 1Q99A 4RLKA 1ZYCA 1K9AA 2XM8A 3MVJA 3L8SA 3ZO1A 4E93A 2VV9A 4NCTC 5DT0A 3DKOA 4E6CA 2Y6OA 4CKJA 4I6HA 5IQCA 2PE2A 4KAOA 3NIZA 3KVWA 4FT3A 2GNHA 3P5KA 5D11A 5CANA 2CCHA 5ETIA 4IAFA 4F9WA 4ITIA 4U45A 3D5WA 3C7QA 4Y5QA 3IKAA 3D5XA 2GDOA 2ZM4A 4QMNA 2X2KA 3NUAA 4U44A 3PIZA 4KWPA 4QQCA 5HE0A 2G2FA 3TV4A 3E93A 4JDKA 1MQ4A 3H0ZA 4BGGA 4AGDA 1B38A 5EHOA 2ZB1A 5JK3A 4QMWA 4JDHA 1YOMA 1AGWA 5KHWA 4RIYA 2UVXA 4L7FA 3ZMMA 2VTIA 3DBEA 1HOWA 2FSMX 3NUPA 3E7OA 5EW9A 5B2MA 1W82A 2PE0A 4NFNA 4N0SA 5AV4A 2YZAA 4QMQA 4FKTA 3OBGA 5LWMA 5CEKA 2VTRA 4O84A 3T3VA 3JVRA 4R6VA 2I0YA 3L9LA 3IDCA 1Q41A 3RK9A 5AADA 4YSMA 4IX6A 3UO5A 3E8EA 3LJ2A 3FXZA 4HGLA 2UW8A 3ERKA 1JSTA 3GU7A 3C13A 3POOA 3GCPA 5CF4A 2WEVA 3PE1A 3D2KA 3SX9A 3FPMA 1TVOA 2C0OA 2OI4X 4UWYA 3TKIA 4A07A 5CQWA 4O0WA 3ZM9A 3K5UA 4JR3A 2W1CA 3H9FA 5FD2A 3KULA 4D1ZA 4C2VA 4QMVA 3BU6A 4D0WA 1BUHA 3MTLA 2GNJA 4ALWA 1XKKA 3IW4A 4I5CA 1REJA 3C0IA 3GB2A 4C3RA 4ACCA 4X3FA 2OK1A 4MCVA 3TM0A 4ZTMA 1Q61A 4M8TA 3L9NA 2HXQA 3MV5A 2EXCX 2ITNA 4OT5A 3UVPA 5LOHA 2Z8CA 4MD8E 4UZDA 4Y8DA 4U3ZA 4OLIA 4BDCA 1FQ1B 4XH6A 3EQPA 4FZFB 3W8QA 2QQ7A 2R9SA 3FMLA 3ODZX 4DEDA 3OWKA 4HYSA 3KK8A 4RX7A 2QO9A 2C1BA 3KMUA 4FIGA 3UODA 4FVQA 1PMEA 4G3DA 4NKAA 3E8CA 5AUUA 4QTEA 5BUEA 1ZWSA 3LKMA 4WA9A 5AIKA 2PZRA 5ETFA 5ANOA 4BWKA 5FXQA 2JIVA 4GEOA 3PE2A 2QD9A 3HMOA 3R6XA 4EC9A 3RWQA 4FEWA 3R1QA 1YHVA 4QPAA 3CTQA 4S33A 4KIKA 5E8ZA 3DA6A 2YCSA 1KE7A 2YEXA 1LR4A 2WMSA 3CGFA 3KK9A 2PVMA 4YHTA 4KUJA 4F70A 3G2FA 2F7EE 2BHHA 4IACA 2VGOA 2QLUA 5HCYA 4CFXA 4W8DA 4E5WA 3ROCA 2E9NA 3S4QA 4R7HA 2HWOA 2EXEA 3LHJA 4Y85A 4YZCA 5HG7A 3DLZA 2BAQA 3WIKA 1FGKA 4I41A 2QLQA 4UYNA 4HYIA 3HV3A 3PRIA 4CEGA 5CF8A 4E4NA 4WG4A 3RPRA 3VJOA 2J5FA 4GYIA 2CCIA 5LARA 4P5ZA 3WF8A 3HUBA 1M7NA 3EFLA 2VO7A 4BDDA 3UIUA 2BTSA 2FVDA 2OF4A 3KREA 3I4BA 1H1SA 4FSQA 2QR8A 2V7AA 2W17A 5HVYA 1ZYSA 4FV5A 4MKCA 3HDMA 2CMWA 2OXXA 3BU5A 3MPTA 4M15A 5E90A 4PDPA 5AMNA 3LM5A 4PQNA 2C5OA 1J91A 1IR3A 4XG3A 3ZLXA 2GQSA 4WUAA 4ANOA 2XBAA 4LM5A 3U51A 3P7BA 2OJJA 4APPA 5DLSA 5IQAA 1PMNA 2JEDA 3FL4A 1GIIA 1SVHA 3IDBA 1H24A 3QKLA 4LMNA 4YJVA 3FMMA 4YHFA 3I1AA 4FTQA 2IVTA 3AXWA 2ITPA 5AAGA 3PPKA 5IA0A 1T45A 4BDFA 4X0MA 2JDVA 2RFEA 2RG5A 3V8SA 4NIFB 4XJ0A 4AACA 3HVCA 4AT3A 1FPUA 2JITA 3ZBFA 4ANLA 5HD4A 3P4KA 4FSUA 4NYEA 3O8PA 1OIYA 3GCVA 3OUKA 2G15A 3A2CA 1WVYA 5AP5A 3OW3A 3QRJA 2XJ0A 4IZ5A 3FI8A 5LVMA 5IH5A 3QRIA 4BCQA 1A48A 3PJ2A 5DRBA 3QD3A 3BBWA 3TN8A 4YC8A 3UIXA 3E92A 4G31A 4D2TA 2UW7A 5CXZA 2QCSA 2O2UA 4ZEGA 5K9IA 3BHTA 3GC9A 3H30A 4U7ZA 3ZDUA 4D9UA 4QP8A 5HTIA 1H1QA 5IA1A 3SA0A 3IOPA 1WBPA 4EQCA 5DEWA 4FKVA 4KS8A 4D0XA 4D5KA 2C6KA 5JN2A 2WGJA 2B54A 4DBXA 3BX5A 3FLNC 1YW2A 3DBDA 3F2NA 3VS6A 4ZSEA 5A54A 4RZVA 3FDNA 1IRKA 5CALA 2OZOA 3WZEA 1OM1A 4C3PA 3ZO4A 4KIOA 4JBVA 3ET7A 4GV1A 4UZHA 4I20A 1W0XC 2HW6A 4GT3A 2XZSA 4GSBA 1M2QA 5F94A 3QBNA 3VAPA 5FDPA 4PMTA 3O8TA 1JKSA 1YXVA 2VTPA 3DK7A 1MUOA 1Q3WA 4JDIA 5IEXA 5AR3A 3HRCA 3I0OA 4AZVA 4BGHA 3MWUA 2JDSA 3OW4A 3QRKA 5JZJA 2X8EA 3H3CA 4I94A 4NW6A 5CAUA 3LFDA 1RE8A 1IEPA 4LUEA 4BCKA 4BCIA 1M2PA 5DR2A 4F7NA 3AD6A 2XIYA 4YJSA 3H0YA 2ONLA 2P2IA 3CQWA 3D7TB 3QXOA 3DCVA 3C4FA 4JX7A 4O2ZA 4EJNA 2UZVA 3GOPA 2PVHA 3BI6A 3CPBA 3ORNA 4I22A 1LP4A 4QPMA 4FV1A 3QXPA 3K5VA 3EL7A 4IVDA 3PLAE 3FLYA 3VS4A 2RKUA 2ITXA 5AUZA 3Q6WA 2PVNA 3F69A 4FICA 4ZXTA 5AV2A 4TNDA 5I3RA 5M4UA 4CRSA 1OGUA 4E4XA 3LMGA 4YR8A 3F88A 3HP2A 4B7TA 1H00A 4QNAA 3MBLA 4QMSA 2QOOA 4YC6A 5AJQA 4KIQA 3HL7A 5FRIA 5A4LA 2YAKA 2KTYA 2QOCA 2BTRA 2J51A 4L67A 4PL4A 5AP6A 4AW5A 4TYIA 3MYGA 4ZZOA 1OUYA 4YJRA 5DEYA 3U8WA 4JDJA 2BRMA 3QYWA 5IQGA 3FKLA 4TPTA 5ANIA 4IAZA 5HVKA 1TQIA 1K3AA 3G90X 4NM7A 4MBLA 4EJ7A 3ZOSA 3HV5A 3LPBA 4YPDA 2C3IB 4AN2A 3GC8A 1VR2A 2P2HA 3F66A 4WSQA 1PXNA 5HU9A 1R1WA 3LLAA 3A4OX 1ZMUA 2XNEA 4IBMA 2Y4PA 3II5A 1STCE 3UBDA 2VZ6A 4IHPA 4K33A 4RJ7A 3VHKA 2PL0A 2YFXA 3TG1A 4KRDA 2IG7A 2GPHA 1JWHA 3W8LA 5BYYA 4C62A 4BRXA 3HMPA 5K0XA 5T6KA 4H05A 1BMKA 5LMKC 2W96B 3PSCA 2Z2WA 3O8UA 5FLFA 4JAJA 5DOSA 1H1WA 4A4XA 3QA8A 4GS6A 4USFA 4BHNA 3F6XA 3AC8A 3WARA 4CV8A 2HW7A 3L9MA 4H1MA 4XBRA 5A6OA 2UW3A 3MH3A 1AD5A 3S2PA 3TWJA 2VTLA 4I5HA 2E9PA 4YJPA 4RG0A 4BN1A 1U46A 4IQ6A 3UE4A 4ANMA 4AW2A 4FTKA 3P7AA 2UZWE 1SVEA 5D10A 2UVZA 1Q24A 1JKTA 5J7BA 1HCKA 2AUHA 2R3FA 2W1ZA 5TO8A 3GU5A 3F7WA 4ASDA 1REKA 5CT7A 3MESA 4TWNA 1SZMA 4L44A 4O38A 3WZUA 3TCPA 4DEHA 5IMXA 5HNGA 4PP7A 1YRPA 2XK3A 1FINA 2XCHA 4AXAA 3D7TA 5BMSA 3UNKA 4EHVA 4AAAA 3G0FA 3GT8A 3I6UA 2X4FA 1ZYDA 2BAJA 1XBCA 3TNHA 1W84A 4M14A 3W2RA 4RWIA 4ERKA 2WMBA 5BVEA 3EYGA 4RIOA 4BKZA 3ZSHA 4H1JA 4GFOA 2UW6A 4U81A 5AAFA 1OKZA 5EYKA 4DGOA 1BI7A 2Y6MA 4BZNA 4QTCA 1PXPA 3JR1A 3C0GA 3GC0A 4EYJA 4LQMA 3CSVA 1MRVA 4BCFA 4O7ZA 1KV2A 4JXFA 4TTHB 4DFLA 1XH5A 4IW0A 2X8IA 1ZZLA 4FT7A 5KMLA 2WIHA 3U54A 3G0EA 4IJ9A 3T9IA 4FSWA 3ZEWA 2W7XA 4G6LA 2F2CB 4Z9LA 3V6SA 2CNUA 5AM6A 3W2SA 4EHEA 2VTAA 2ZJWA 3QZHA 4JBPA 2WOTA 3ALNA 3BU3A 4XS2A 3EN9A 3OG7A 2ITOA 5E92A 4CT2A 2CGWA 3LFAA 1IA8A 2UZDA 5KZ0A 4PWNA 4FKOA 1PF8A 2GFSA 3U6JA 3JY9A 4IEBA 3F9NA 2XH5A 2G2HA 3AC5A 2BUJA 5HTBA 3F5PA 4IVBA 5EKNA 4ZY4A 2KULA 5CVGA 4FV3A 5J79A 4ACGA 2XKCA 3Q52A 2QOLA 3QD4A 3QX2A 5E91A 2ESMA 4U9AA 3PZHA 1W83A 2J2IB 4X2GA 5KMIA 4BR3A 4FSMA 3UOLA 4FIIA 3ZXZA 4C02A 3SVVA 4TKSA 4BKJA 2VNWA 4PNKA 3VUHA 4QMYA 3EQIA 4M3QA 3RKBA 4PMPA 4E4LA 3C4EA 4MWHA 2JBPA 4QTDA 2ETRA 4O6LA 5GJFA 5CEQA 5M09A 5M08A 3NW7A 3FXWA 3UQFA 2X0GA 4DLJA 5CSWA 3A4PA 2W0JA 3IK3A 4WRSA 4PP9A 4HGSA 3LCKA 2R2PA 4GJ3A 3S1HA 4J98A 3UZTA 4DFBA 3GOKA 2YIXA 3RINA 3SDJA 1NA7A 2CKQA 4IZAA 3QHWA 4PL5A 4QTAA 2RSVA 4FX3A 1UNLA 3LFNA 4GT5A 4U8ZA 5L2QA 5KX8A 5J9YA 4FR4A 3M11A 2PMIA 3VRZA 2XK8A 3FY2A 5DI1A 2BZIB 4AQCA 4E26A 2UZNA 1VJYA 3THBA 4FSNA 3ORLA 4XG8A 4S30A 3FMEA 4FKWA 4EH3A 1ZOHA 5E7RA 2XJ2A 2QC6A 5J5SA 3TDWA 1I44A 4O91A 4E5BA 4ALUA 4C0TA 2JDTA 3P08A 3KL8A 3ZFMA 3D5UA 1H27A 3WF7A 3WZDA 1XH4A 4CMTA 3COHA 4L43A 4BDGA 4CCUA 3VBYA 3QHRA 4G2FA 5BYLA 3F5XA 1Z5MA 3UTOA 3W16A 2F9GA 5HI2A 4QYFA 2J0LA 1PXMA 2OH0E 4TWPA 2PZIA 4NEUA 5IA4A 4V04A 2CDZA 2ZAZA 3KXNA 1RW8A 2QG7A 3PSDA 4WOVA 4YTHA 4YTCA 1Y91A 4TW9A 1G3NA 2HCKA 4X2KA 5IDPA 4FKLA 3ZM4A 2R7IA 4AOJA 2OF2A 5E1SA 4YURA 2FYSA 4FKGA 2GQRA 3BEGA 3QTZA 1UNHA 3VUMA 4TNBA 3BEAA 1XH8A 2UV2A 3CC6A 3QKMA 4C57A 2QKRA 4BICA 4RC3A 3TIYA 4EZ7A 4G1WA 4E4MA 4EOJA 3C4ZA 3TNIA 3SRVB 3SW4A 3GNIB 4O0SA 4ZJJA 5DVRA 5M51A 2Y4IC 3DJ5A 3RPYA 4DGMA 3CR0A 3U6IA 2E9UA 3LOKA 3TEIA 5I5ZA 3KFAA 5DG5A 1URCA 1RJBA 3FHRA 3CD3A 4ZMEA 2REIA 3VWAA 4IZ7A 2FSLX 2I1MA 4MAOA 3A62A 3E64A 1XBAA 2NP8A 3UZRA 3CBLA 4OUCA 2F2UA 3TZ9A 3BQRA 5KMJA 1XR1A 2PY3A 3H10A 4DC2A 4TRLA 5I9YA 3VUKA 4PUZA 2VGPA 4J97A 4PTCA 5LCJA 3NDMA 5AFVA 2F57A 3B2WA 2WMWA 2CKPA 3FXXA 3KY2A 5AEPA 2JC6A 1OIUA 3L8VA 3C51A 4HNFA 3LCTA 2ZB0A 4BHZA 4MQ1A 5DHJA 4BCHA 2J6MA 3WF5A 3KA0A 3IPHA 3EFJA 4MHAA 1WZYA 3HLLA 5FP5A 2BMCA 4E73A 1WBSA 2VTTA 1Y8YA 4ZOGA 4I6QA 2C6IA 2PZ5A 4FF8A 4A7CA 1MRUA 1GNGA 2UZOA 4ZP5A 2CHLA 4DYMA 1ZAOA 5HX8A 5C8KA 3RPOA 3RWPA 3VBWA 5I0BA 5H8BA 3VNTA 1NT2A 5A4TA 3ZUUA 2C4GA 2BDJA 4FZDB 3LCOA 3FHIA 4JQEA 5J87A 3HGKA 5C8MA 3MFRA 3COMA 2XNGA 2GS6A 1H08A 4TYHB 2W5AA 3FI3A 3PP1A 2R3GA 3BIZA 1OVEA 4NTSA 3L8XA 3PIYA 4LOQA 2QU5A 3C5IA 4TZRA 3F3ZA 4F6WA 3L1SA 4K6ZA 3NAXA 4JR7A 2B53A 5F20A 3WZKA 4ITJA 2R3QA 5M4FA 4RJ3A 3OCBA 4HPUE 3R7OA 3UG2A 4O1OA 2NRYA 4FTMA 1Q8TA 5BNJA 3VO3A 3DJ7A 3FL5A 4QMUA 4W9WA 3RBWA 4LMUA 5IUGA 3JVSA 4UY9A 3RALA 3AGLA 3O96A 3KF7A 4FNZA 1ZARA 5H2UA 5FG8A 2YM7A 4JVGA 3CKWA 2OKRA 2WQMA 1XBBA 1GOLA 2B9FA 3EQGA 4HCUA 3BHUA 4XG4A 2ZVAA 2LAVA 4GK3A 5C4KA 4IDVA 4MEDA 3UMWA 4C4EA 5EQPA 3BYSA 4ZZNA 4F9YA 3SAYA 2ZDTA 4C58A 1KE8A 3E7VA 3LXLA 4R8QA 5JMSA 3UQCA 3NNWA 2J0KA 3HNGA 4A9UA 4C4IA 3NAYA 2QOIA 4G3EA 4M69B 4AU8A 4V01A 5J9LA 2W9FB 4EOLA 5JGDA 4XG6A 3OD6X 5EM6A 2XK9A 4DHFA 5I4NA 2J0JA 4CZTA 3VW6A 2X7OA 3P7CA 3FBVA 4EKKA 5AR2A 4K0YA 4RIXB 4R7IA 4ZMFA 3DFAA 3M42A 3EZVA 3Q2MA 5DPVA 4BCGA 3R01A 2X9EA 3QUEA 5CF6A 4FZAB 2JLDA 1G8SA 4TY1A 4ZTNA 4ZIMA 4DBNA 4F09A 1LUFA 4XRJA 1YOJA 3BWJA 4JRVA 3R8LA 1H0WA 4U5JA 3A8XA 3NWWA 2ITZA 4ACHA 1U4DA 4WUNA 4QMMA 5GNKA 4O0RA 3OXZA 5CEPA 3FKNA 4EK6A 4OAVB 1QCFA 2QONA 1JSVA 2OJGA 2VD5A 2R3NA 5CWZA 3ORXA 1PJKA 3NYVA 4DH3A 3LMHA 4E8AA 4IWPA 5EKOA 5CAQA 3R0TA 5IEVA 4FTCA 5EI2A 1YKRA 3MH1A 3AD5A 4M97A 5DBXA 5ANJA 2GNLA 4O83A 5FQDC 1UU3A 4LFIA 4BGQA 2C6EA 4IVAA 4ZS4A 2P0CA 1H0VA 4UX9A 5FXSA 5CEOA 5JEBA 2C5VA 3ANQA 3PY3A 1R0PA 4RX8A 3WBLA 4O0XA 4D1XA 3ANRA 5ACBC 3VS2A 2PMOX 3FLZA 3Q2JA 4BF2A 4XCUA 3BE9A 4S32A 5J95A 4RJ6A 4HW7A 2XEYA 3GUBA 3GC7A 4BCNA 1VYWA 3R7YA 3ZFXA 4ZJVA 2XKDA 4L46A 5EOLA 2X6EA 2V55A 4C38A 3Q9WA 1OL6A 4DTAA 4YGAA 3CJFA 2OZAA 2A27A 3EYHA 3QQUA 2X7FA 4AOTA 2YAAA 5BUJA 2VU3A 5CEIA 5DN3A 1OKWA 3DKGA 4UWCA 4X6RA 1YWRA 2HY0A 1H26A 3IW5A 4G17A 5DYJA 1V1KA 3QQKA 4ONAA 5FBNC 1S9JA 3EZRA 2DWBA 4F6UA 2UW4A 3H9RA 2XK7A 2WKMA 2XB7A 1WBOA 2C0TA 3UGCA 5HO8A 3R9NA 4BIBA 2CGUA 1M52A 2YWVA 2VWIA 3NUYA 4QP1A 4UXQA 4JRNA 3OT3A 4DEIA 4DH5A 5I9WA 2QR7A 1PW2A 5KKRC 2IZTA 2VX3A 4DT8A 3W55A 4OTRA 1ZY5A 2ACXA 2GU8A 3O23A 3ULIA 4GKIA 3DU8A 1OBGA 2VTNA 4L3LA 2B9IA 4N4SA 4ACMA 4E1ZA 3UG1A 4W4XA 5IUHA 3F3WA 4D4YA 5G1XA 3QZIA 2OGVA 5DMZA 2C30A 3NUSA 1KOBA 1WCCA 2ITTA 4M69A 4QYHA 4FE2A 3DK6A 5ETAA 3UIBA 4GJ2A 2FH9A 2PVFA 4FOBA 3R1YA 4J99A 2BRNA 4MXAA 4XLVA 4AGCA 3Q60A 2YCQA 3LCSA 3NLBA 4APCA 5CZIA 5EM5A 3R8UA 1YWVA 3DV3A 4KBCA 3UQGA 4KINA 4AUAA 5B2KA 4JS8A 1H4LA 3Q9YA 5EQEA 4ERWA 3SC1A 4IWQA 3QU0A 3CTHA 3W1FA 5K0KA 4HNIA 5EG3A 5E4HA 3EMGA 4JOAA 1QPEA 4X3JA 4AWIA 3HRBA 2JIIA 4RRVA 3EQFA 4U41A 4FSTA 2HZNA 2P33A 4LRKA 2JD5A 4YTIA 2IWIA 1FGIA 3U9NA 2WQBA 3TV6A 1YQJA 3MPMA 4QD6A 3OS3A 3REPA 3NNUA 3C4CA 4XG7A 3CJGA 2H6DA 2PHKA 2P4IA 2X1NA 5KNJA 4FV9A 5FEQA 3GCSA 4F9AA 2YN8A 3BYVA 2BALA 2A1AB 3NW6A 1U5RA 3QCQA 3F3TA 4MXCA 3NVMB 1YHWA 1URWA 3ZS5A 2XNPA 3BLQA 4B8MA 4BYJA 4CGAA 2C3LA 3HAMA 3BYMA 5EYCA 3DXQA 5D41A 1J1CA 2XNMA 4AX8A 4FEVA 3A99A 5C4LA 4FV4A 4UB7A 4IIRA 1YDRE 1FVVA 2GFCA 4A9SA 5HEZA 2FO0A 5C1QB 3N4UA 2W1HA 4G5PA 2G1TA 4BTFA 4F63A 1FVRA 4DGGA 2P3GX 3EKNA 3KGAA 3R02A 4OAUC 2OIDA 5TKDA 4O21A 3SKCA 1L8TA 1X8BA 2HWPA 2FSTX 3BWFA 4DG0E 2VAGA 2W1FA 4B9DA 3VUIA 2DQ7X 4PF4A 5BVKA 5A6NA 4IADA 3BELA 4L3JA 3ZRKA 4AZEA 3MVLA 2XNBA 2YIYA 3I0QA 4L00A 3ZUVA 4DCAA 2OU7A 2ITVA 4UMQA 4C2WA 4DT9A 3EKKA 4F64A 2YLEA 1UKHA 3NVKI 5LVLA 2R4BA 3ZHPC 4KS7A 2HZ4A 5KBRA 1J7IA 5FEEA 3RK5A 4P7EA 3U9CA 4CRLA 3LMIA 4RMZA 4HVDA 2YDIA 4DLIA 2CN8A 3EHAA 3TJDA 4BCMA 1JAMA 2VTSA 5E8SA 1M14A 4X7QA 2YM4A 3EFKA 4G3CA 3G33A 5L2TA 1U5QA 3ALOA 1ZYJA 3EFWA 4BVUA 4R7BA 4L52A 3RCDA 2PVKA 3ORZA 3QTXA 3R8PA 3FC2A 1OUKA 4B99A 4E6DA 2YACA 3TKUA 1QL6A 4FTLA 4DEEA 3BHHA 4I6FA 3IONA 3C4XA 2HZIA 2WXVA 4UXLA 5IPJA 2WTKC 2JBOA 4G6OA 4G6NA 5EW8A 3F3VA 3OP5A 2QHMA 2ZYBA 4FOCA 4NW5A 1WBVA 4RFZA 3VRYA 3JPVA 2R3KA 3HDNA 2YDKA 3FSKA 1SMHA 4OTDA 4F0GA 5D9HA 5HD7A 2YIWA 4M13A 4M7IA 1PXJA 1U54B 3F82A 4OW8A 4RJ4A 5JQ8A 3SGCA 1Q8UA 3NNVA 4BB4A 2XK6A 3GU6A 2DUVA 3KN6A 4OBOA 3RZBA 4CSVA 1O9UA 4X21A 3DNDA 4IMYA 3MDYA 4CTBA 5A4QA 5CI7A 4OR5A 4A9TA 3LE6A 2Y9QA 2OLCA 4IB5A 4F0FA 2FA2A 3VUDA 3AT3A 5AP3A 4FT0A 4NCTA 4CT1A 3U4UA 4J1RA 1A06A 3RPSA 2BR1A 5A4CA 2ZM3A 4XP2A 3SXFA 1DI9A 3R1NA 4OTPA 4I0RA 4TWCA 4TT7A 5DH3A 5IA3A 1GY3A 4PTEA 3BHVA 2PULA 5BVDA 1TQMA 1DS5A 4YTFA 3PLSA 4U42A 4IFCA 4EQMA 1Q97A 1BYGA 4EWHA 2YJRA 4YJNA 4QOXA 2HZ0A 2BAKA 3RM7A 1IASA 1F5QA 3V5WA 3D7ZA 3Q04A 4GIIA 4CNHA 4EYMA 5T68A 4EH8A 4FT5A 1WMKA 3WE4A 4LV5A 3PXYA 3VS7A 2JIUA 4G9CA 2C5YA 3PWYA 4R5YA 5I9UA 5EDRA 3VC4A 4JAIA 4OTGA 3QALE 1GIHA 2QKWB 5H8EA 5AX9A 1WFCA 5CY3A 4PV0A 1G5SA 3KMMA 3SD0A 4RA5A 4KD1A 4ZSJA 4ARKA 4KABA 4DH1A 4F65A 2O0UA 3A7JA 4IWOA 4NKSA 5J8IA 2W1IA 4AZSA 1OPLA 4XV9A 1BI8A 4O7LA 4OTWA 4IX5A 3FLWA 2PK9A 1GAGA 2BZJA 2H96A 4AA4A 2CNQA 3VBVA 3RAWA 3ZBXA 4M0YA 4MBIA 3GI3A 5L6WL 4AW0A 4EOKA 2WTKB 1NVRA 4QMOA 3CKXA 4I5PA 3RPVA 3ZRLA 3RJCA 4JQ8A 5CSXA 5HQ0A 2IVVA 1MRYA 1O6YA 3JY0A 4MD7E 4BWPA 4IAAA 1WBNA 2OO8X 4YO4A 3CPCA 1KWPA 3ZLWA 3QRUA 2X2MA 4RQKA 1BL7A 3BLHA 3GEQA 3F5UA 1E1XA 3NZ0A 4HCVA 4USDA 2OSCA 2NO3A 3LVPA 2YIRA 3PXRA 4YBJA 3V5LA 4CXAA 2YA9A 1JPAA 4QP9A 4RPVA 5CYIA 4FK3A 5AUTA 4HGEA 1ZMVA 1B39A 1CKIA 1LEWA 3DJ6A 4BIDA 3KKVA 2NRUA 5DE2A 5LJJA 4YNOA 2OJ9A 2Z02A 3F7ZA 3JYAA 3OROA 5GIPE 3ZTXA 5IQBA 3F5GA 4H36A 3RNIA 3LXPA 4NIFA 1I09A 4F7JA 4CFWA 4BDHA 4O7RA 2QU6A 3OC1A 4QO9A 3FLQA 4C34A 3OBJA 3P23A 4MWIA 5GZ8A 4FIJA 4FTJA 4J53A 5B0XA 3SOAA 2O65A 3PVBA 4X2JA 5LVPA 4ENYA 4NU1A 4ZS0A 3ZFYA 3PWDA 4RVLA 3ZONA 5GIOE 4AE9A 3H4JA 4O0YA 2V5QA 2GS7A 3HRFA 4AS0A 2UUEA 3FWQA 3OY3A 4IAYA 4AZWA 3DNEA 3IS5A 5C03A 4RA4A 3EWHA 3VULA 3FZ1A 4WG3A 3ZXTA 5J7HA 4QT1A 4I6BA 3GP0A 3Q5ZA 3IOKA 5G6VA 4EH6A 3HV4A 5AUXA 1WBTA 1PKDA 1WAKA 3MFSA 3W10A 4M68A 4EH7A 1XH7A 5GJDA 2OFVA 1OL7A 3DB6A 1KSWA 5JKGA 2XYNA 4L53A 4YP8A 3RAHA 3QTSA 2OIBA 3KRJA 1LEZA 4TYJA 2R3HA 3V04A 4LL0A 4R3CA 3R2YA 2GTNA 3RCJA 3TZ7A 4TWOA 3FMJA 3FSFA 4I4FA 5LMAA 4QMZA 2WQOA 5K3YA 4BTMA 2WELA 5HBEA 3LJ1A 4HZSA 3CY2A 5DR6A 4AT4A 3V5TA 3OOMA 3FJQE 3OT8A 5IQHA 3D9VA 3HMNA 2QODA 3D14A 4YMJA 3Q53A 5EFQA 3RI1A 1GZNA 2WTVA 3W32A 2RG6A 3S95A 2PUNA 3D0EA 2Z7LA 3UPXA 4EOPA 2VWBA 2YM8A 3CLYA 1E9HA 5CU4A 2X9FA 4U79A 5AWMA 5C9CA 4LYNA 4L7SA 3BV2A 4N6ZA 4BDEA 3QCXA 2WMUA 3QWKA 4O7VA 3LAUA 3R71A 4O96A 4ASXA 4AA5A 3HUCA 4FV8A 1DI8A 2GS2A 3OOGA 3WF6A 3R2BA 4L8MA 4CV9A 2F7ZE 2PUUA 2IZRA 2QOBA 4N57A 4EK3A 3R73A 4FKIA 2IO6A 2IVSA 2Z60A 3KB7A 3QQFA 1PXIA 4I5MA 5BVWA 1OPJA 4EOIA 4MXXA 4G3GA 2OXDA 2FSOX 1PYXA 1H01A 4J71A 3WOWA 3KVXA 5M57A 4NK9A 4JLCA 4RX5A 5HIBA 5IU2A 2C47A 4JNWA 1J3HA 2ITUA 3RP9A 1M2RA 4LOOA 4OTIA 5HLPA 4OBPA 1OIQA 4QNYA 3D83A 3UVQA 4RBLA 4IM0A 3FE3A 4DFNA 1IA9A 2YWPA 2WU7A 4KNBA 5AR5A 4EOMA 1KE6A 1AQ1A 4O81A 3O17A 4D5HA 4EEVA 4CFUA 5CXHA 2PUPA 1JVPP 3MY1A 4EBVA 4KKEA 3GBZA 3FI4A 3QGWA 4IE9A 4PY1A 1Q4LA 4XNEA 3QL8A 3GFEA 2ZDUA 3VS1A 5B7VA 3MJ1A 4ZZMA 3QA0A 5LVNA 2Y0AA 3AD4A 3CEKA 3O7LB 4K2RA 3GGFA 4RSSA 3VBTA 4EONA 4O7YA 5CAVA 3EIDA 3NYXA 4FZ7A 3KXHA 4KKHA 1FMOE 1Q3DA 4HGTA 4NFMA 3FYJX 3R28A 4IDTA 2OXYA 5AP0A 3ZZEA 4ID7A 4WNPA 4L45A 2X4ZA 4IZYA 3D4QA 2BKZA 3SXRA 5HU3A 3P79A 1UWJA 4A4LA 4C7TA 3ETAA 4DGLC 3TUCA 4YLJA 2ZMDA 1OL5A 1U59A 3P9JA 4FNYA 4UWBA 4XBUA 5DRDA 4EORA 5JFSA 3UOJA 4DFZE 1NXKA 5EDPA 3BGPA 3BCEA 3VBQA 1PHKA 2XM9A 2Z7QA 2JFMA 5HIEA 4WNOA 5BVOA 1NW1A 3QD2B 4CFMA 4D2SA 3UO6A 4PDSA 1VEBA 4H3BA 4FKQA 3PY0A 4R78A 4KBAA 2VRXA 3CCNA 5CU0A 4WSYA 3O50A 1BX6A 2VO3A 1MQBA 4LRJA 2W05A 2WO6A 4R1YA 3PDTA 3LZBA 4GFMA 5GZ9A 3HA6A 3PJ1A 2JKQA 3QKKA 4I1ZA 2VX0A 4MNEB 4NH1A 3UNZA 4DN5A 2VUWA 4YJQA 4EKLA 3FUPA 4E5AX 3U55A 4IAIA 3ACKA 4QP4A 5CQUA 2C6LA 5L2IA 2XNOA 2GQGA 2A19B 3T9TA 2NPQA 4PX6A 2OIQA 3QQGA 4Y5HA 2J4ZA 3MJ2A 2CLXA 4AA0A 5HTCA 2V62A 3PA5A 2H9VA 3LW0A 4B0GA 4DFUA 4R3RA 2YM5A 3AGMA 1EH4A 1UU8A 3QGYA 4GMYA 2IW8A 3KMWA 2PUIA 3R00A 3DTWA 4MNFA 3FC1X 3NIEA 4MD9E 4FGBA 4YNEA 5KMOA 2WMRA 3NEWA 5BVNA 2O3PA 3MS9A 1G8AA 4C4FA 3D94A 5HE2A 1RQQA 2CN5A 3EN4A 1XH6A 2ZV7A 4ENXA 3W2CA 4BCPA 2B0QA 5AUYA 2A2AA 4BCJA 1FMKA 5T3QA 4Z7HA 3O2MA 1E1VA 3QUDA 2ITQA 5LMKA 4XRLA 1JQHA 1UA2A 2I6LA 4GL9A 1UWHA 4C33A 4YUQA 1TKIA 4XG9A 2YM3A 5HICA 3OCTA 5JQ5A 5KBQA 3UP7A 5M56A 2QO2A 3PVWA 1BL6A 2QOFA 5A3XA 3Q3BA 4FV2A 3OXIA 4ZTQA 3R7GA 3FQHA 5J1VA 4CFVA 3V5JA 5DT4A 5K5XA 4S2ZA 2WMQA 3W2QA 3QCSA 5BPYA 2HXLA 4K9YA 4EH5A 4RIWB 1P14A 4QQJA 3I60A 4FTIA 4BDBA 3PG1A 4ITHA 2C5NA 3AMAA 1QPCA 5C8NA 1P4FA 3Q6UA 4TYEA 5I9ZA 3UNJA 5JZNA 5IEYA 3HYHA 3MY0A 3R1SA 1CSNA 2I0VA 5CX9A 2QI8A 3DT1A 2BHEA 5A46A 5BUIA 4X2FA 3LXNA 3AMYA 1Y8GA 4ZSLA 2WQNA 4FUXA 3Q9XA 1W98A 3QX4A 4JG6A 4QP7A 5CNNA 3MFUA 3S3IA 4UMTA 3ZLSA 1SNXA 3N51A 2DYLA 3VS0A 3Q32A 5FTGA 3PA3A 4UMPA 4JG8A 4ANSA 2UW5A 1H1PA 3HAVA 2XIRA 2O8YA 2WIPA 2BDWA 4RQVA 4C61A 1V0BA 3DAKA 4D58A 4YZ9A 2WMAA 5I9VA 4IFGA 3LFFA 3VQUA 2W99B 5CVHA 3MA3A 4D2VA 5M44A 3LFSA 3AC3A 5CAPA 3TT0A 3B8RA 1SVGA 4FTNA 4O7NA 1XO2B 4GT4A 2JDRA 5HOAA 3KCFA 4UALA 4OTHA 3RK7A 3DAEA 3QC4A 2CKEA 4AZTA 4HVIA 5AA8A 3ZO2A 4FVPA 4FG7A 3GCQA 4GG7A 4J8MA 3I7BA 3LXKA 2H8HA 4L68A 2C5XA 3R04A 5CF5A 2DS1A 1H8FA 3Q4ZA 2ZV2A 5F1ZA 1FBNA 4TN6A 2VTMA 3ELJA 1BKXA 4X3FC 4Q9ZA 4BIEA 2UW9A 4XV3A 2R5TA 2Y4IB 4FL1A 1DM2A 4I93A 4RJ5A 5TR6A 3EH9A 3HECA 4KKGA 4F1MA 1OIRA 4Z55A 2BZHB 4O2PA 3UJGA 5HG9A 1QMZA 4D4SA 4GW8A 3EQCA 1CKPA 3NX8A 2BIKB 2PVRA 1SNUA 3ATTA 5FM3A 3BGZA 4JQ7A 5EHLA 4C8BA 4R1VA 2CNVA 5GINE 3QCYA 5HGIA 3SRVA 4FL3A 3RMFA 1QPDA 3A60A 4DCEA 2BPMA 4OGRA 4X6QC 2QG5A 4R3PA 4II5A 4NWMA 4PPBA 2EXMA 4DTKA 4EZ3A 4FSYA 3QQHA 5EI8A 4RVTA 3V8TA 2RFSA 3PRFA 4BBFA 3DDPA 3LFBA 3K54A 3W2OA 4CYIA 2V22A 4PPAA 5E8TA 2E9OA 4F7LA 4S31A 4IAKA 1V0OA 1Y6BA 3MW1A 2Q83A 5DR9A 2R3OA 5M4IA 2IW6A 4O7SA 5FP6A 4TYGA 5FM2A 3C9WA 3CS9A 3Q4TA 3AT4A 1VYZA 4FIHA 4CVAA 3TUBA 4I0TA 5AUWA 5KE0A 4ZY5A 2C1AA 4XMOA 2O5KA 4D4VA 1ZXEA 5BX0A 4O1PA 4CMOA 3CIKA 3KQ7A 3OEZA 3ZU7A 4XHKB 3MA6A 3DAJA 5HE1A 2IZSA 3E8NA 3KEXA 1H1RA 4RJ8A 3R9DA 3TL8A 2W4JA 4FKJA 1CM8A 4FL2A 5IQIA 3NYOA 2XBJA 4WRGA 3R8ZA 1YXUA 3WYYA 3ZRMA 3ACJA 4JBOA 4NJDA 5CSVA 4DEBA 2GHGA 2WNTA 4KB8A 5EK7A 1PMUA 4FI1A 3F2RA 4Y73A 4MVFA 4P2KA 3V01A 1FOTA 2HIWA 3KULB 4I24A 5FWKK 5H8GA 1Y57A 4I21A 2JKMA 5DNRA 4MXZA 4EWQA 3IDPA 3SV0A 3A7HA 3TI1A 4TYHA 4G9RA 4DFXE 2JAVA 2WD1A 3B8QA 3LQ5A 2R3PA 4GUBA 4GU6A 1Y6AA 4NJ3A 5EQYA 3UMXA 3LFQA 4ASEA 4C4JA 2CPKE 1YVJA 5IISA 2PWLA 1Q8YA 4FG9A 4CG9A 5JT2A 2EUFB 3EQDA 4XP3A 2BDFA 2J0MB 3ORMA 2PE1A 3KN5A 2J90A 1GZ8A 1SYKA 2RGPA 3VS5A 4A4OA 3FQEA 4LGHA 4QYEA 2F4JA 4JI9A 4XX9A 1GZOA 4V05A 3N9XA 4FIEA 3BYOA 3OUNB 3V51A 2I7QA 5JGAA 3PJ3A 5L2SA 2I0HA 3PXQA 3GU8A 3DBCA 4BDAA 1CKJA 3LFEA 4C35A 4F7SA 2ZM1A 5KUPA 2GHMA 1XH9A 4DFYA 2IN6A 5AAEA 4DEGA 2WMXA 5HNBA 4B4LA 4L9IA 3SG8A 4KIKB 2OWBA 3A7IA 2JKKA 4AFJA 2I0EA 5E1EA 4XYFA 1YI3A 5ANDA 2QHNA 2R0IA 2X39A 3R7VA 3CTJA 1NVSA 2UZBA 4M67A 4MK0A 5FXRA 2O64A 3ZZWA 5J5TA 4RIXA 3OVVA 3NUNA 3CE3A 5HG8A 5GJGA 1ZY4A 3TXOA 4EOSA 3HX4A 2P55A 5AV0A 4CG8A 5M06A 2WHBA 2GTMA 3O0GA 5BYZA 1PYEA 5AP7A 3AC2A 3PXKA 4WG5A 5ACKA 5K5NA 2ITWA 4I23A 5HO6A 3VHEA 3PPZA 3TKHA 2BKKA 3V3VA 4LI5A 4FSZA 4MQ2A 2VX1A 3N4VA 4WNMA 2PU8A 5HCZA 3EJ1A 2CGXA 3AQVA 4BZOA 1KE5A 3HKOA 4YLKA 3RHXA 3BHYA 2VTJA 2RIOA 2WZJA 4KRCA 2X81A 4M12A 5EW3A 3DQXA 5ANKA 3A8WA 4WO5A 1R39A 2Z7RA 5AR4A 3VN9A 1R0EA 1YWNA 3ZC5A 2FGIA 4YZDA 4YZBA 4DG3E 4HVHA 1OKYA 4FTUA 4FVRA 4EOOA 5JRQA 4H58A 5KMNA 3KRLA 3Q4UA 3I81A 1A9UA 3LCDA 4I0SA 5D7AA 5HVJA 1IG1A 2ONLC 4ZK5A 3SHEA 3A61A 3E5AA 4FYOA 1T46A 3RZFA 1H25A 2VNYA 3ZC6A 4XV1A 4BYIA 4F4PA 2HK5A 4MH7A 4YO6A 4BCOA 5CSPA 3OY1A 3DFCB 3IG7A 3FMNA 4LG4A 1YI4A 5FEDA 5KKRB 4LUDA 3CP9A 3KXXA 4F6SA 3G15A 4Y95A 2OICA 3Q9ZA 2EWAA 3D2IA 4D1SA 4Z16A 2B9HA 3DDQA 3NYNA 4GG5A 5JFWA 2YLFA 2HAKA 5IH4A 5A9UA 2G01A 3HP5A 4NT4A 3TNPC 3ZH8A 3F3UA 2AC5A 2QVSE 3NPCA 5AV3A 5CU2A 5DT3A 4E7WA 3ORPA 5DGZA 5M53A 2BCJA 4U40A
chains in the Genus database with same CATH superfamily
4ZSGA 5F4NA 2GCDA 2J50A 2R3LA 5DIAA 3U87A 4JMQA 3WZJA 2WAJA 4FG8A 4BDJA 3OEFX 4UEUA 1V0PA 2X6DA 2XRWA 3IECA 3OF0A 2B1PA 4FUYA 5TT7A 3HA8A 4RC2A 5LQFA 3TACA 1PY5A 2UZEA 2YM6A 2JKOA 4X2NA 5ICPA 4D4RA 3SQQA 1YHSA 1GJOA 3FYKX 3FV8A 1Q5KA 3ORIA 4O0TA 2GNFA 5HBJA 2OW3A 4FODA 4DDIA 3GU4A 2BVAA 2XVDA 1APME 4K11A 3ZDIA 4HCTA 4F99A 1J1BA 2B7AA 2J7TA 3KRRA 4J52A 3PYYA 3TV7A 5HO7A 5ETCA 4U80A 2IEWA 4Y83A 1CDKA 3BQCA 2QNJA 4U97A 5CEMA 5BQ0A 2XJ1A 2XRUA 3R7UA 4E6AA 4YZNA 4EK8A 2CJMA 2Y8OA 1XQZA 4BZDA 4DG2E 4EHZA 4QMLA 1YOLA 4RWKA 5CT0A 4FZ6A 5LCKA 4D2WA 3HZTA 4P90A 5IUIA 3RGFA 3S00A 3A7GA 5HORA 3EN5A 4EBWA 4NSTA 1RDQE 5M55A 3FZRA 4DEAA 1L3RE 4MF0A 4QQTA 1ZOGA 3POZA 3QTIA 3E88A 3KF4A 3NSZA 3NUXA 4MTAA 4M84A 5C01A 4D2PA 3S0OA 4C4HA 3MIYA 4P5QA 3RM6A 4LGDA 5FUTA 5CENA 4L3PA 2PMLX 1LPUA 4UV0A 3G6HA 3SXSA 4QTBA 4Z7GA 4USEA 5E8VA 3MVHA 1F3MC 4JX3A 4F9CA 4GK2A 2PMNX 3ROYA 2WTCA 4A9RA 1JKLA 4W4YA 2VO6A 3I79A 4NM0A 3RHKA 4AFEA 5E9EA 5J1WA 2XCKA 3EQHA 4MF1A 4XP0A 3QTWA 2YJSA 3HV6A 4FSRA 3Q5IA 4KBKA 4AXCA 4BC6A 4AZFA 3TZMA 5CU3A 5IA5A 2YCFA 3FKOA 3RAKA 2HENA 5FGKA 3ZYAA 5AUVA 2BIYA 3QQJA 1VZOA 4Y72A 4EUTA 5GHVA 5EI6A 1UVRA 5KMKA 3DBQA 1NVQA 1Q8WA 3FZSA 5FDXA 3AT2A 5AA9A 3KRXA 1GZKA 1OL1A 4FV0A 4XLIA 2WMVA 5HNIX 1JNKA 5EH0A 1YXTA 3R83A 4C3FA 2OBJA 5AP4A 1Z9XA 4EQUA 3SG9A 3VUGA 4BBEA 3COKA 1OZ1A 1JOWB 3RAIA 2B4SB 2VWWA 2XP2A 3BYUA 3DB8A 3QC9A 2LGCA 4GFGA 2GSFA 4EH9A 1J7UA 2C3JA 1MP8A 2W1GA 4ZTHA 2OJIA 2YISA 2C6TA 5L6PA 3DY7A 5KO1A 4EH2A 3E8DA 1OMWA 4EC8A 1XHAA 5EHYA 4HJOA 3EB0A 4N6YA 2WTIA 2XIZA 3H9OA 5TOZA 3VBXA 4C59A 4AF3A 3C1XA 1UV5A 3P86A 4IB0A 4V0GB 4FTTA 1YDSE 3LLTA 5AP2A 1TQPA 3QD0A 4XEYA 3OTVA 2XS0A 2YABA 4FTOA 2ERKA 3TTIA 3NRMA 2Q0BA 2R7BA 4OBQA 4WIHA 1H07A 2WTJA 4O86A 4CMUA 2ITYA 5BMMA 3O51A 5CLPA 4CQEA 2QURA 3LFCA 1DAWA 3T3UA 4HVGA 1W8CA 2EVAA 3UZPA 3UOHA 3PG3A 5CASA 2J9MA 5HE3A 4AP7A 1HCLA 1U54A 2EB3A 4U43A 3MPAA 4GVAA 5IKWA 3L9PA 2WU6A 2ZV9A 3MH0A 1PRYA 4ORKA 5AR7A 4QQ5A 3DK3A 1UNGA 1YDTE 2HOGA 4P4CA 2Q0NA 3QTRA 5FTOA 1J7LA 2XKFA 4RFYA 5JH6A 3O71A 3OHTA 2C69A 4GU9A 2IZUA 4CZUA 4F08A 2OG8A 3GVUA 4NL0A 5C26A 4LRMA 5CS6A 2VWYA 5IZFA 4DH7A 4O22A 3GENA 2X7GA 4YZMA 3MVMA 3NR9A 4HPTE 3V5QA 3IW8A 2XEZA 3PJCA 2PTKA 3MI9A 4BI0A 3SLSA 4Q2AA 3QAME 4W4WA 5M07A 4JJRA 3NMUF 3ENMA 4WKQA 1Z57A 1BLXA 2PVJA 2YCRA 3CY3A 3HMIA 3QRTA 3NS9A 4Y46A 5CSHA 4U6RA 2YITA 3I6WA 4ASZA 5BVFA 4FBXA 1PXKA 4CCBA 2ERZE 4D28A 5HX6A 5L8LA 4ACDA 4BL1A 1OBDA 3DPKA 5E8UA 3WF9A 2JGZA 4GIHA 5H9BA 2UZLA 5DA3A 4AGUA 4RLLA 4ZSAA 4NM5A 3QQLA 3VJNA 3DQWA 3PVUA 4KA3A 4QP3A 3FZOA 4R5SA 4K18A 4CZYB 1P4OA 2WTDA 1PXOA 2EB2A 3QTQA 1O6LA 2JDOA 1O6KA 2BRGA 3PSBA 4DAWA 4F9BA 5LWNA 3R9RA 5LMBA 5CNOA 4AOIA 5HESA 5IF1A 2W9ZB 2YIQA 3KXGA 3MSSA 5AR8A 4QDVA 2W4KA 2XKEA 4FKRA 4H39A 3I5NA 2XIKA 4OTFA 3V8WA 4D9TA 5JSMA 4UN0C 3FMKA 2B52A 2NNWB 5HLWA 5IQEA 2YZLA 4AXEA 4ANQA 2PYWA 4PDYA 4MYGA 4V0GA 1DAYA 3QZFA 4YBKA 1GIJA 5I9XA 3QLFA 4FMQA 5K4JA 3WILA 1Q62A 1ZMWA 4FNXA 4G16A 3Q96A 3ZSGA 4CKIA 3JXWA 3G6GA 3FMDA 3UDBA 3PXFA 2ETMA 2A0CX 3FLSA 5HLNA 4IJPA 1IAJA 2EU9A 3MH2A 2IF8A 2BRHA 2VWVA 3BLRA 3QLGA 5C27A 3VS3A 4IB3A 3ZEPA 4BBMA 3E3BX 2W5HA 2VTOA 5IDNA 3HV7A 2AQXA 4MUQA 4I3ZA 2XMYA 2PPQA 3CGOA 4GYGA 5IMEA 1IAHA 5CU6A 3TZ8A 1ZOEA 4G5JA 3EN7A 3FMHA 3PUPA 1K2PA 3RNYA 4BTJA 3MB7A 2CLQA 2ZV8A 2GNGA 4DGNA 3PZEA 1M17A 4LL5A 2UZUE 3DBFA 4QYYA 5DFPA 5F95A 2C6DA 2C0IA 3BGQA 1PKGA 4NTTA 1JBPE 4OTQA 4GH2A 3BKBA 3PXZA 3PVGA 4YJUA 2VTHA 2VWZA 4JIKA 4DF3A 3E63A 4AN9A 4FEUA 3G5DA 4IWDA 3DTCA 3V6RA 3WI6A 2BFYA 3E87A 3UDZA 4PNIA 3NW5A 3ZLYA 1OECA 5HBHA 5L4QA 1ND4A 3RVGA 3JS2A 3DOGA 3COIA 3ZSIA 1KE9A 1WBWA 4ZTSA 3GXLA 3NUUA 3GQLA 3QFVA 4JBQA 4QPSA 3TJCA 4E3CA 3AC4A 4RVKA 2Z7SA 4ZY6A 2XA4A 4ANBA 5HZNA 2I40A 3IGOA 3JUHA 4UMRA 3LIJA 4XOYA 1ZLTA 2R3JA 3FI2A 3EQRA 3G51A 3OWLA 4RGJA 5CI6A 5FBOA 4WD5A 4RFMA 5CTPA 5HG5A 5HKMA 3DXPA 4G3FA 2GHLA 4E6QA 5JFVA 4CLJA 3FEGA 3CQUA 3R7EA 4RT7A 1ERKA 3L8PA 3GFWA 4AW1A 5KHXA 4BY9E 4IB1A 4BKYA 5TE0A 2QOQA 2QOKA 4A9YA 4QP6A 3MN3A 2W4OA 5HHWA 4W8EA 4M66A 2G2IA 3EQBA 2BZKB 3D5VA 2BRBA 5L8JA 3FPQA 4FTAA 4ALVA 5KCVA 3N4TA 5H3QA 3IW6A 4EK5A 2WB8A 2V7OA 3AC1A 3AMBA 2FB8A 4FEQA 4LV8A 1G8JA 3C4WA 4CYJA 3VW8A 5L8KA 3EL8A 5IQFA 2J5EA 3BPRA 5TF9A 2YERA 3SW7A 4AT5A 1QPJA 3PIXA 3Q4CA 3P0MA 4J7BA 4GRBA 4PMSA 3AKKA 3ATSA 3M2WA 2WEIA 2C6MA 4WT6A 1JKKA 4ANNA 4YHJA 3IO7A 3K3JA 3UC3A 4AGWA 5IH6A 1OI9A 4K8AA 5A4EA 4YJTA 5E8WA 4J95A 4RC4A 3D15A 3PFQA 4HZRA 5L2WA 3A7FA 3KCKA 3PP0A 5E8XA 5L6OA 3FY0A 4ZLZA 4FGRA 2XF0A 3IGGA 2E9VA 3M1SA 4RZWA 1ZYLA 3NNXA 4XV2A 3VF8A 3C0HA 1WVXA 2BROA 3TNWA 2W1EA 3TNQB 3LQ3A 5D1JA 3QZGA 1OL2A 2UW0A 4HOKA 5CVFA 5DWRA 4ZLOA 3PA4A 2RFDA 4NUSA 4E20A 4NZWB 1UU7A 3MY5A 4IH8A 3TUDA 1NY3A 5F9EA 4O7TA 4BI2A 2XIXA 3F2AA 1R78A 3QYZA 2R0UA 3LJ0A 3PPJA 2UVYA 1H28A 3UIMA 4PDOA 4C37A 4PMMA 5EM8A 4HYUA 2WPAA 4J8NA 1P2AA 4O6EA 4D2RA 4WBOA 2PVLA 4BWXA 1ATPE 4DE4A 3MIAA 4ZJIA 2OJFE 2WMTA 5EYDA 3ENHA 3KXMA 4LGGA 3UVRA 5KMMA 5LXMA 2R3IA 3VUTA 5K4IA 4IXPA 4MXOA 4YU2A 3R63A 3HMMA 5IG1A 4IM3A 3UP2A 3CXWA 5IA2A 1YXSA 2E2BA 3E3PA 4S34A 1KOAA 4DITA 2W1DA 3OCGA 5LVOA 4UMUA 4IM2A 4B6LA 3R22A 4YJOA 3C5UA 4CFNA 1CMKE 3ZUTA 2W06A 4TXCA 4B8LA 3BE2A 3BZ3A 1YXXA 2ZMCA 2WOUA 4UBAA 1XJDA 4EUUA 3AOXA 3BV3A 5M4CA 3UPZA 3FAAA 3ZO3A 1KV1A 1SM2A 2RL5A 3KRWA 3OTUA 4IX4A 2F49A 3DKCA 1S9IA 2IVUA 4FKUA 4GCJA 2O63A 4L42A 4MBJA 1FVTA 3ODYX 3AG9A 4TL0A 5AV1A 4DA5A 4JG7A 4IANA 5AX3A 4RWLA 1OKVA 3TDVA 3MB6A 4JIAA 4EZ5A 2RFNA 4MX9A 4WBBB 5JGBA 2XUUA 3R7IA 4A06A 1R3CA 2C3KA 3W33A 4DINA 3P78A 5AP1A 4EL9A 1UKIA 3WYXA 4DH8A 5D7VA 5EOBA 4BTKA 1TFFA 4D55A 3UYTA 4CTCA 4QMPA 4CD0A 4F0IA 3BL9A 4O82A 5IQDA 2G9XA 4EHGA 2IW9A 3WE8A 4O0VA 4XUFA 5J9ZA 2X2LA 5FTQA 3V5PA 3VIDA 3DXNA 5A14A 3TMOA 1M7QA 2BILB 3DS6A 2QO7A 4QP2A 4I92A 3UOKA 4FEXA 4BDIA 3F61A 1JLUE 2JFLA 4MNEA 5ANGA 2PSQA 4QMTA 4ZAUA 2ETKA 1P5EA 3I5ZA 4R77A 1WVWA 3G9NA 4N70A 5HCXA 5ITAA 4HVSA 1ZZ2A 2WQEA 5JFXA 4HYHA 4UYAA 2ZOQA 4NM3A 3P1AA 4W9XA 4CQGA 4M0ZA 4FNWA 5JRSA 2PVYA 3GQIA 3ZCLA 5CZHA 4KIPA 4FIFA 4KSQA 3MTFA 2UZTA 2R3RA 1XWSA 4YPSA 3R30A 3NCGA 4RWJA 4O4BB 3R8MA 5B2LA 2XAMA 4GKHA 4IC7A 4W4VA 3R9OA 4FK6A 3EOCA 4YSJA 5GZAA 4C4GA 4GK4A 4O27B 2R3MA 2AC3A 5AM7A 4K77A 3W2PA 3ORKA 4EI4A 2F7XE 3FZTA 3QF9A 4CLIA 3FZPA 4OT6A 5AIRA 3EN6A 3DZOA 4L6QA 2PZYA 5EYMA 3OWPA 2OZAB 4FYNA 4QYGA 4RVMA 5L3AA 3IQ7A 4PTGA 2CKOA 3QWJA 4I4EA 3QTUA 3RTPA 4FV7A 2IPXA 5EM7A 3R8VA 4IVCA 1W7HA 3W18A 2SRCA 4KSPA 2W5BA 3TIZA 1UU9A 2QOHA 4AG8A 4BDKA 1PMVA 3DLSA 4PPCA 2X8DA 3OFMA 4G34A 2VO0A 4J96A 3K3IA 3T8OA 3R9HA 3ULZA 5I3OA 2GMXA 3TTJA 4QRCA 2CGVA 4IX3A 3LQ8A 1OITA 3PTGA 4RX9A 4EOQA 2RF9A 4F1TA 2HELA 4FKSA 3I7CA 4BFMA 4WNKA 1CTPE 1B6CB 1Q8ZA 4RIWA 4U3YA 3CQEA 4RIYB 4O0UA 2WTWA 4GUEA 2R64A 1OPKA 3ORTA 4FKPA 3NGAA 4FTRA 5E8YA 4XG2A 4FV6A 5CAOA 4F1OA 3MFTA 4YC3A 2VN9A 3ID6C 1YI6A 4ZLYA 4CKRA 2XYUA 2C68A 2XK4A 4DTBA 3OMVA 4U0IA 4EK4A 3O7LD 3NCZA 4QMXA 2A4LA 3HEGA 4GVJA 4H3PA 4WHZA 3U6HA 4Q9SA 3BBTB 3VF9A 4BI1A 4ZTRA 2C6OA 2CSNA 4Q5EA 3VVHA 4CFFA 2FUMA 2H34A 1F0QA 3KU2A 4O7WA 4K1BA 2AYPA 2XNNA 3OXTA 3QUPA 1ZRZA 4YLLA 4LOPA 3KC3A 3CD8A 3R21A 3LM0A 3FQSA 3KXZA 2VWUA 4AE6A 5ANEA 3UYSA 2V0DA 5HIDA 4C36A 2VTQA 3E62A 3K2LA 4H3QA 5KZIA 2PZPA 2JAMA 1PXLA 2IJMA 2VWXA 4AN3A 4MXYA 4Q5HA 3UC4A 5D12A 3UO4A 4EH4A 4PRJA 4IC8A 2J0IA 3DKFA 4X3FB 3BRBA 2YHVA 4XOZA 3OZ6A 5EDQA 3C50A 2OH4A 2GNIA 3ITZA 2HY81 4Z3VA 3GCUA 2OFUA 3OWJA 3PJ8A 3PY1A 2HYYA 3OCSA 4PL3A 3DGKA 2BFXA 3DZQA 4FC0A 4JT3A 4ZTLA 3VQHA 3WIGA 2Y7JA 3SOCA 2WFYA 4FT9A 4FA2A 3G9LX 2B55A 4JL9A 3U4WA 1KUTA 3IW7A 4L01A 2YDJA 3MGYA 1OB3A 3B2TA 1JSUA 2B9JA 1Q99A 4RLKA 1ZYCA 1K9AA 2XM8A 3MVJA 3L8SA 3ZO1A 4E93A 2VV9A 4NCTC 5DT0A 3DKOA 4E6CA 2Y6OA 4CKJA 4I6HA 5IQCA 2PE2A 4KAOA 3NIZA 3KVWA 4FT3A 2GNHA 3P5KA 5D11A 5CANA 2CCHA 5ETIA 4IAFA 4F9WA 4ITIA 4U45A 3D5WA 3C7QA 4Y5QA 3W0OA 3IKAA 3D5XA 2GDOA 2ZM4A 4QDEA 4QMNA 2X2KA 3NUAA 4U44A 3PIZA 4KWPA 4QQCA 5HE0A 2G2FA 3TV4A 3E93A 4JDKA 1MQ4A 3H0ZA 4BGGA 4AGDA 1B38A 5EHOA 2ZB1A 5JK3A 4QMWA 4JDHA 1YOMA 1AGWA 5KHWA 4RIYA 2UVXA 4L7FA 3ZMMA 2VTIA 3DBEA 1HOWA 2FSMX 3NUPA 3E7OA 5EW9A 5B2MA 1W82A 2AEGA 2PE0A 4NFNA 4N0SA 5AV4A 2YZAA 4QMQA 4FKTA 3OBGA 5LWMA 5CEKA 2VTRA 4O84A 3T3VA 3JVRA 4R6VA 2I0YA 3L9LA 3IDCA 1Q41A 3RK9A 5AADA 4YSMA 4IX6A 3UO5A 3E8EA 3LJ2A 3FXZA 4HGLA 2UW8A 3ERKA 1JSTA 3GU7A 3C13A 3POOA 3GCPA 5CF4A 2WEVA 3PE1A 3D2KA 3SX9A 3FPMA 1TVOA 2C0OA 2OI4X 4UWYA 3TKIA 4A07A 5CQWA 4O0WA 3ZM9A 3K5UA 4JR3A 4DHIB 2W1CA 3H9FA 5FD2A 3KULA 4D1ZA 4C2VA 4QMVA 3BU6A 4D0WA 1BUHA 3MTLA 2GNJA 4ALWA 1XKKA 3IW4A 4I5CA 1REJA 3C0IA 3GB2A 4C3RA 4ACCA 2XAOA 4X3FA 2OK1A 4MCVA 3TM0A 4ZTMA 1Q61A 4M8TA 3L9NA 2HXQA 3MV5A 2EXCX 2ITNA 4OT5A 3UVPA 5LOHA 2Z8CA 4MD8E 4UZDA 4Y8DA 4U3ZA 4OLIA 4BDCA 1FQ1B 4XH6A 3EQPA 4FZFB 3W8QA 2QQ7A 2R9SA 3FMLA 3ODZX 4DEDA 3OWKA 4HYSA 3KK8A 4RX7A 2QO9A 2C1BA 3KMUA 4FIGA 3UODA 4FVQA 1PMEA 4G3DA 4NKAA 3E8CA 5AUUA 4QTEA 5BUEA 1ZWSA 3LKMA 4WA9A 1VLRA 5AIKA 2PZRA 5ETFA 5ANOA 4BWKA 5FXQA 2JIVA 4GEOA 3PE2A 2QD9A 3HMOA 3R6XA 4EC9A 3RWQA 4FEWA 3R1QA 1YHVA 4QPAA 3CTQA 4S33A 4KIKA 5E8ZA 3DA6A 2YCSA 1KE7A 2YEXA 1LR4A 2WMSA 3CGFA 3KK9A 2PVMA 4YHTA 4KUJA 4F70A 3G2FA 2F7EE 2BHHA 4IACA 2VGOA 2QLUA 5HCYA 4CFXA 4W8DA 4E5WA 3ROCA 2E9NA 3S4QA 4R7HA 2HWOA 2EXEA 3LHJA 4Y85A 4YZCA 5HG7A 3DLZA 2BAQA 3WIKA 1FGKA 4I41A 2QLQA 4UYNA 4HYIA 3HV3A 3PRIA 4CEGA 5CF8A 4E4NA 4WG4A 3PFYA 3RPRA 3VJOA 2J5FA 4GYIA 2CCIA 5LARA 3ML1A 4P5ZA 3WF8A 3HUBA 1M7NA 3EFLA 4BJJB 2VO7A 4BDDA 3UIUA 2BTSA 2FVDA 2OF4A 3KREA 3I4BA 1H1SA 4FSQA 2QR8A 2V7AA 2W17A 5HVYA 1ZYSA 4FV5A 4MKCA 3HDMA 2CMWA 2OXXA 3BU5A 3MPTA 4M15A 5E90A 4PDPA 5AMNA 3LM5A 4PQNA 2C5OA 1J91A 1IR3A 4XG3A 3ZLXA 2GQSA 4WUAA 4ANOA 2XBAA 4LM5A 3U51A 3P7BA 2OJJA 4APPA 5DLSA 5IQAA 1PMNA 2JEDA 3FL4A 1GIIA 1SVHA 3IDBA 1H24A 3QKLA 4LMNA 4YJVA 3FMMA 4YHFA 3I1AA 4FTQA 2IVTA 3AXWA 2ITPA 5AAGA 3PPKA 5IA0A 1T45A 4BDFA 4X0MA 2JDVA 2RFEA 2RG5A 3V8SA 4NIFB 4XJ0A 4AACA 3HVCA 4AT3A 1FPUA 2JITA 3ZBFA 4ANLA 5HD4A 3P4KA 4FSUA 4NYEA 3O8PA 1OIYA 3GCVA 3OUKA 2G15A 3A2CA 1WVYA 5AP5A 3OW3A 3QRJA 2XJ0A 4IZ5A 3FI8A 5LVMA 5IH5A 3QRIA 4BCQA 1A48A 3PJ2A 5DRBA 3QD3A 3BBWA 3TN8A 4YC8A 3UIXA 3E92A 4I6LA 4G31A 4D2TA 2UW7A 5CXZA 2QCSA 2O2UA 4ZEGA 5K9IA 3BHTA 3GC9A 3H30A 4U7ZA 3ZDUA 4D9UA 4QP8A 5HTIA 1H1QA 5IA1A 3SA0A 3IOPA 1WBPA 3NFFB 4EQCA 5DEWA 4FKVA 4KS8A 4D0XA 4D5KA 2C6KA 5JN2A 2WGJA 2B54A 4DBXA 3BX5A 3FLNC 1YW2A 3DBDA 3F2NA 3VS6A 4ZSEA 5A54A 3W0NA 4RZVA 3FDNA 1IRKA 5CALA 2OZOA 3WZEA 1OM1A 4C3PA 3ZO4A 4KIOA 4JBVA 3ET7A 4GV1A 4UZHA 4I20A 1W0XC 2HW6A 4GT3A 2XZSA 4GSBA 1M2QA 5F94A 3QBNA 3VAPA 5FDPA 4PMTA 3O8TA 1JKSA 1YXVA 2VTPA 3DK7A 1MUOA 1Q3WA 4JDIA 5IEXA 5AR3A 3HRCA 3I0OA 4AZVA 3O5AA 4BGHA 3MWUA 2JDSA 3OW4A 3QRKA 5JZJA 2X8EA 3H3CA 4I94A 4NW6A 5CAUA 3LFDA 1RE8A 1IEPA 4LUEA 4BCKA 4BCIA 1M2PA 5DR2A 4F7NA 3AD6A 2XIYA 4YJSA 3H0YA 2ONLA 2P2IA 4AAYA 3CQWA 3D7TB 3QXOA 3DCVA 3C4FA 4JX7A 4O2ZA 4EJNA 2UZVA 3GOPA 2PVHA 3BI6A 3CPBA 3ORNA 4FRFA 4I22A 1LP4A 4QPMA 4FV1A 3QXPA 3K5VA 3EL7A 4IVDA 3PLAE 3FLYA 3VS4A 2RKUA 2ITXA 5AUZA 3Q6WA 2PVNA 3F69A 4FICA 4ZXTA 5AV2A 4TNDA 5I3RA 5M4UA 4CRSA 1OGUA 4E4XA 3LMGA 4YR8A 3F88A 3HP2A 4B7TA 1H00A 4QNAA 3MBLA 4QMSA 2QOOA 4YC6A 5AJQA 4KIQA 3HL7A 5FRIA 5A4LA 2YAKA 2KTYA 2QOCA 2BTRA 2J51A 4L67A 4PL4A 5AP6A 4AW5A 4TYIA 1XMMA 3MYGA 4ZZOA 1OUYA 4YJRA 5DEYA 3U8WA 4JDJA 2BRMA 3QYWA 5IQGA 3FKLA 4TPTA 5ANIA 4IAZA 5HVKA 1TQIA 1K3AA 3G90X 4NM7A 4MBLA 4EJ7A 3ZOSA 3HV5A 3LPBA 4YPDA 2C3IB 4AN2A 3GC8A 1VR2A 2P2HA 3F66A 4WSQA 1PXNA 5HU9A 1R1WA 3LLAA 3A4OX 1ZMUA 2XNEA 4IBMA 2Y4PA 3II5A 1STCE 3UBDA 2VZ6A 4IHPA 4K33A 4RJ7A 3VHKA 2PL0A 2YFXA 3TG1A 4KRDA 2IG7A 2GPHA 1JWHA 3W8LA 5BYYA 4C62A 4BRXA 3HMPA 5K0XA 5T6KA 4H05A 1BMKA 5LMKC 2W96B 3PSCA 2Z2WA 3O8UA 5FLFA 4JAJA 5DOSA 1H1WA 4A4XA 3QA8A 4GS6A 4USFA 4BHNA 1ST0A 3F6XA 3AC8A 3WARA 4CV8A 2HW7A 3L9MA 4H1MA 4XBRA 5A6OA 2UW3A 3MH3A 1AD5A 3S2PA 3TWJA 2VTLA 4I5HA 2E9PA 4YJPA 4RG0A 4BN1A 1U46A 4IQ6A 3UE4A 4ANMA 4AW2A 4FTKA 3P7AA 2UZWE 1SVEA 5D10A 2UVZA 1Q24A 1JKTA 5J7BA 1HCKA 2AUHA 2R3FA 2W1ZA 5TO8A 3GU5A 3F7WA 4ASDA 1REKA 5CT7A 3MESA 4TWNA 1SZMA 4L44A 4O38A 3WZUA 3TCPA 4DEHA 5IMXA 5HNGA 4PP7A 3PUFC 1YRPA 2XK3A 1FINA 2XCHA 4AXAA 3D7TA 5BMSA 3UNKA 4EHVA 4AAAA 3G0FA 3GT8A 3I6UA 2X4FA 1ZYDA 2BAJA 1XBCA 3TNHA 1W84A 4M14A 3W2RA 4RWIA 4ERKA 2WMBA 5BVEA 3EYGA 4RIOA 4BKZA 3ZSHA 4H1JA 4GFOA 2UW6A 4U81A 5AAFA 1OKZA 5EYKA 4DGOA 1BI7A 2Y6MA 4BZNA 4QTCA 1PXPA 3JR1A 3C0GA 3GC0A 4EYJA 4LQMA 3CSVA 1MRVA 4BCFA 4O7ZA 1KV2A 4JXFA 4TTHB 4DFLA 1XH5A 4IW0A 2X8IA 1ZZLA 4FT7A 5KMLA 2WIHA 3U54A 3G0EA 4IJ9A 3T9IA 4FSWA 3ZEWA 2W7XA 4G6LA 2F2CB 4Z9LA 3V6SA 2CNUA 5AM6A 3W2SA 4EHEA 2VTAA 2ZJWA 3QZHA 4JBPA 2WOTA 3ALNA 3BU3A 4XS2A 3EN9A 3OG7A 2ITOA 5E92A 4CT2A 1OGYA 2CGWA 3LFAA 1IA8A 2UZDA 5KZ0A 4PWNA 4FKOA 1PF8A 2GFSA 3U6JA 3JY9A 4IEBA 3F9NA 2XH5A 2G2HA 3AC5A 2BUJA 5HTBA 3F5PA 4IVBA 5EKNA 4ZY4A 2KULA 5CVGA 4FV3A 5J79A 4ACGA 2XKCA 3Q52A 2QOLA 3QD4A 3QX2A 5E91A 2ESMA 4U9AA 3PZHA 1W83A 2J2IB 4X2GA 5KMIA 4BR3A 4FSMA 3UOLA 4FIIA 3ZXZA 4C02A 3SVVA 4FJVA 4TKSA 4BKJA 2VNWA 4PNKA 3VUHA 4QMYA 3EQIA 4M3QA 3RKBA 4PMPA 4E4LA 3C4EA 4MWHA 2JBPA 4QTDA 2ETRA 4O6LA 5GJFA 5CEQA 5M09A 5M08A 3NW7A 3FXWA 3UQFA 2X0GA 4DLJA 5CSWA 3A4PA 2W0JA 3IK3A 4O4DA 4WRSA 4PP9A 4HGSA 3LCKA 2R2PA 4GJ3A 3S1HA 4J98A 3UZTA 4DFBA 3GOKA 4LDTA 2YIXA 3RINA 3SDJA 1NA7A 2CKQA 4IZAA 3QHWA 4PL5A 4QTAA 2RSVA 4FX3A 1UNLA 3LFNA 4GT5A 4U8ZA 5L2QA 5KX8A 5J9YA 4FR4A 3M11A 2PMIA 3VRZA 2XK8A 3FY2A 5DI1A 2BZIB 4AQCA 4E26A 2UZNA 1VJYA 3THBA 4FSNA 3ORLA 4XG8A 4S30A 3FMEA 4FKWA 4EH3A 1ZOHA 5E7RA 2XJ2A 2QC6A 5J5SA 3TDWA 1I44A 4O91A 4E5BA 4ALUA 4C0TA 2JDTA 3P08A 3KL8A 3ZFMA 3D5UA 1H27A 3WF7A 3WZDA 1XH4A