4ASZA

Crystal structure of apo trkb kinase domain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
299
structure length
289
Chain Sequence
GAMDTFVQHIKRHNIVLKRELGEFGKVFLAECYNLCKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Trka and Trkb Suggest Key Regions for Achieving Selective Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords BDNF/NT-3 GROWTH FACTORS RECEPTOR
total genus 95
structure length 289
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aszA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aszA01
2W4OA 1YWVA 4FTOA 4IX6A 4X2KA 4F7JA 1Q8YA 5CX9A 4UB7A 4G17A 4FSWA 4G5JA 3KU2A 2HIWA 2YIYA 3C1XA 4FG9A 4A7CA 4RWLA 4WA9A 4B0GA 3ANQA 3VHEA 2CGWA 4C4GA 5JEBA 4EHZA 2XM9A 4HVGA 3I6UA 2Y4IB 3TNHA 1PF8A 3DY7A 4KIPA 5HEZA 1DS5A 5D7VA 5K0XA 3NYNA 4DTAA 2C47A 1XKKA 1WBWA 3MH1A 5D1JA 3BU6A 3CP9A 2GFSA 5KX8A 1IASA 3LJ1A 3CS9A 4RVMA 3DXNA 4MD8E 4C02A 2C5YA 5D41A 4KKHA 3RWQA 2F2UA 1IA8A 5FDPA 3OWLA 5IF1A 2XYUA 4EYJA 1XHAA 3G2FA 4ZJIA 5ETFA 4MK0A 3POOA 2HZNA 3SRVB 4GUBA 4JT3A 5JMSA 4O83A 5CS6A 4E3CA 4FTQA 2VAGA 4GRBA 3IGOA 3ATSA 1P14A 3PSBA 4P7EA 5JQ5A 4CTCA 2HY81 2R3FA 3OROA 1UKIA 2IZUA 4CMTA 2ITQA 3CEKA 3NYXA 4O21A 1ZMWA 3F5XA 2QG7A 5GHVA 3HEGA 2BAJA 3H9FA 1MP8A 2PMNX 4MAOA 3D5VA 2X8IA 5D7AA 4GVAA 2YABA 1O6YA 4U7ZA 3UIXA 3OZ6A 3VUMA 5AEPA 5AAEA 3HMOA 3QD0A 3ETAA 3M2WA 4Y73A 5DWRA 5IU2A 3HZTA 3HA8A 4PNKA 1PXPA 5EM7A 2VX3A 3VJNA 1CKPA 4NWMA 2G15A 3TNWA 4C62A 4E7WA 4FKJA 5CSVA 4BIDA 4ASDA 3RMFA 3RZFA 3RK9A 3ZYAA 4DHFA 3RM7A 4AW2A 4JDKA 4I3ZA 4YSMA 5CT0A 4MYGA 1JKSA 5BMMA 4RQVA 3COKA 2Z7RA 4HGLA 3QCSA 4NW5A 5DBXA 2PK9A 2XH5A 4QPSA 3QCQA 4XRLA 2NNWB 1H1SA 1DM2A 5CEPA 3EQPA 1V0BA 3R8MA 5GNKA 3JY9A 2Q83A 4UN0C 5CVGA 4USFA 4PF4A 1NY3A 2X1NA 4UV0A 2BHHA 3CR0A 2OBJA 2YLFA 1SYKA 2QU5A 5HLPA 1QPCA 3NUUA 1Z5MA 2EUFB 4I6FA 1OPLA 2BPMA 2HZ0A 4R7BA 4FV2A 4LYNA 4FG8A 2H6DA 2ZMDA 1Y91A 2BRNA 2O63A 2VD5A 2ZMCA 3W2CA 4YTIA 1W8CA 4BY9E 2ETMA 4RX8A 3SXSA 3UIBA 4I6QA 2J0IA 5CNNA 5F9EA 3QF9A 4K2RA 3BEGA 3AG9A 4FTRA 4E1ZA 2X7FA 3BWFA 5ANJA 3ERKA 4RT7A 4TZRA 4X3FC 3NEWA 3OF0A 5E8WA 3UJGA 4C33A 3TIYA 5IZFA 4O2ZA 3DTCA 2E2BA 4L45A 4N6YA 2BIKB 3DQWA 2B9FA 4OTRA 1ERKA 4IVCA 2XNPA 3RBWA 3ZLYA 5IEXA 2RG5A 4ANOA 4DH7A 4U40A 3Q4CA 1JSUA 5AUUA 1NT2A 3EHAA 5AR3A 3ZEWA 4EK3A 4CV9A 4IWPA 4M7IA 4GK4A 3FLSA 2UVYA 3JVRA 5I0BA 4G5PA 3R7OA 1W82A 4LOQA 5A46A 3F3TA 3G51A 2W17A 5A6NA 1UVRA 1TKIA 3DT1A 2G2FA 2BFYA 4C8BA 5BVWA 4JLCA 4F99A 4TYIA 3TKHA 4EJNA 3KXZA 4EZ5A 4ZLZA 3D4QA 4ZY6A 4LRJA 4MWHA 4NM0A 2ZDUA 1A06A 4G3FA 3FBVA 3VS6A 4C2WA 3LKMA 4FNYA 2YCRA 4MKCA 3B2WA 4MHAA 4NFMA 1BL7A 4O0VA 5M08A 1YI4A 2Y4PA 2OSCA 1QPEA 3ZZWA 2OH4A 2CPKE 4DCAA 4ZY5A 1AQ1A 2JLDA 3MPMA 4AZSA 3FAAA 3POZA 4OTPA 5AR4A 3TUBA 3WF5A 2CN5A 1XH9A 1UU8A 4GT4A 2I0EA 4HVDA 4E26A 5DT3A 4D2PA 1SNUA 3GXLA 2XB7A 3PP0A 5I5ZA 5E9EA 5T6KA 2C3IB 3MVLA 2XNGA 2OG8A 4RX5A 3PFQA 4CTBA 5HVJA 3T8OA 3CY2A 5CVFA 5KKRC 5JRSA 3JXWA 3Q9ZA 3F69A 5IA1A 3IKAA 3O23A 3GUBA 5K0KA 2EU9A 4LGDA 2XJ1A 5H8GA 4IH8A 4FODA 2QOBA 3SRVA 4AFEA 4CFXA 2B52A 2JFLA 4EEVA 1ZY4A 2WMAA 4H3QA 4YU2A 5HTIA 3MH0A 4JIKA 5M55A 2F7EE 3KRJA 1XR1A 4EOQA 3HL7A 4D2VA 2OGVA 4M0ZA 5A54A 3TWJA 3G6GA 5M51A 4OTDA 5JFWA 4I6BA 2UV2A 3QHRA 4QMMA 2YIXA 3ZSHA 4ANQA 4GW8A 3MFTA 2VO3A 2YM4A 5D11A 4AOJA 2ZM3A 4AXAA 4FMQA 1Y8YA 3DZOA 4DTBA 3PXYA 4EL9A 4ZJJA 4CLIA 4D5HA 2PVNA 4BI0A 1H4LA 2G1TA 3DGKA 4F9CA 1OVEA 5BUIA 2HXLA 4M69B 5AM7A 5LJJA 3PJ2A 2GMXA 5CSHA 5A4LA 4A06A 5KBQA 4NUSA 5FQDC 2YWVA 5HU9A 3IOPA 2WMTA 3OMVA 5FP6A 2GQGA 3TNPC 2YCFA 3VUGA 4DEEA 4HW7A 4E4LA 4FSQA 5CZHA 3O7LB 4EHVA 2WQEA 3IG7A 5CF4A 2ONLA 4X6RA 1O6KA 4E20A 5AP6A 3OS3A 3NMUF 4DLJA 3CQEA 4HNFA 4IADA 4GU6A 4GFGA 3KF4A 4QYHA 4YO6A 3B2TA 2F9GA 3HRFA 4I6HA 3V3VA 5HCZA 4Z16A 4D0WA 4FKTA 4EH4A 2YZAA 1W83A 2VN9A 3DB8A 3S95A 2XEZA 3H30A 4E5AX 3SHEA 3UNZA 4F08A 3PLAE 4BCOA 3P7AA 1G5SA 3ZFMA 5FXQA 4NCTC 4QMWA 4NZWB 5T68A 2Q0NA 3R8ZA 3IECA 4DGGA 4UWBA 4V0GB 4V04A 3SD0A 5LWMA 1YKRA 3ROCA 2GQSA 2W1CA 3THBA 4J7BA 4Q2AA 3E8CA 4OR5A 2OIBA 4EBWA 1R3CA 3BX5A 3JS2A 3WZKA 5BVFA 4A9RA 4ENYA 2PE2A 1W0XC 1YHVA 3KF7A 2YISA 4O0TA 5GZ8A 4U3ZA 4D4SA 3VF8A 4F70A 3KVWA 3ZUTA 4W4WA 2Y6OA 3R28A 3LMHA 2ITOA 3CLYA 3GC0A 3MVJA 3ZONA 3FLWA 4GL9A 3T9IA 4C3RA 2R3LA 4M13A 4NJDA 4JXFA 4ZTHA 4YTFA 5J9YA 2IW8A 2WO6A 3U55A 4JJRA 3BHTA 3DKGA 2B9HA 2R3HA 3CTHA 4HPUE 4BC6A 4I4EA 1XH7A 2WTKB 3BYMA 3R7VA 3R9NA 4ZLYA 4ZSLA 5AP4A 5HU3A 4O81A 3D2KA 3I0QA 3L8SA 5C9CA 1ZARA 3C0HA 3DBCA 2XKDA 4FEQA 4G9RA 3TM0A 3VS1A 3PJCA 2RG6A 3FWQA 4FKVA 4FK3A 3Q9XA 3QTUA 1H08A 4PY1A 4RIXA 5HLWA 4L53A 3LXNA 3HV6A 5DRDA 5M4UA 2C68A 4LQMA 3R9RA 4Y83A 3DK7A 4I92A 4KBAA 4PNIA 3Q9WA 4FVQA 4EOLA 4ANLA 4FZDB 3CPBA 3F9NA 5FEEA 4C35A 5CQUA 5IA5A 2X2MA 5I9VA 4N4SA 4K11A 3EFKA 2BDFA 3A99A 5DIAA 3QQKA 1QPDA 3K2LA 3P08A 3UQCA 3KMWA 4YZCA 1TQPA 1QMZA 3TV4A 4C61A 4BYIA 4RIWA 4X2FA 4QTAA 5I9UA 4BGQA 1XBAA 4N6ZA 2RIOA 3D0EA 4QD6A 1E1VA 2DYLA 3EQBA 3QRJA 4OTGA 3ZH8A 2PUPA 3TN8A 3JR1A 3FHRA 1A9UA 4UXQA 1DAYA 4XEYA 3BV2A 3U51A 4CKIA 4C59A 5B2LA 4G6NA 2QO9A 5IDNA 2C0TA 3WZEA 4JQEA 3MN3A 5IPJA 3MPTA 2J90A 1PHKA 3I4BA 2X0GA 5AAGA 3VBWA 1URCA 2VWXA 4NCTA 4P5QA 4ZY4A 1JSTA 2OH0E 3R1NA 4G9CA 4L8MA 2Z7LA 3OHTA 4IXPA 2XVDA 1H8FA 3A2CA 3HVCA 3NW6A 4L52A 4RJ7A 5AV2A 5CEIA 2C69A 4IFCA 2C3KA 4FKOA 4CLJA 4JQ7A 4Y8DA 5BYZA 1PRYA 4IAAA 3HP2A 4QP7A 5IQCA 2GTNA 5IQBA 3W8LA 1G8AA 1OMWA 2VTOA 2G9XA 4IB0A 4X21A 4DG0E 1JBPE 3BYUA 4G3CA 2CJMA 4D58A 2QVSE 5L8LA 4XOZA 2JKOA 2UZBA 4F0IA 1PYXA 3PXKA 3QC9A 4RVLA 3MIYA 4WD5A 3DBQA 4Z9LA 1OL2A 1TVOA 2W4KA 3MV5A 4FYNA 4DFUA 1V0OA 2OF2A 3UIUA 2NO3A 2UZOA 4DF3A 3GVUA 3LM5A 3MJ2A 3PYYA 4OUCA 4RJ4A 4TXCA 5EW8A 2BRGA 5L6OA 3P78A 5CY3A 2W1HA 2H34A 1WMKA 3LXLA 5L4QA 3QQLA 4CZTA 4CZYB 2QKRA 3UVQA 4ONAA 5IA3A 4MEDA 3IW4A 2C4GA 4FT9A 4DFYA 5K5XA 4AA0A 3MH3A 5C8KA 4XV1A 4AGWA 4P4CA 3GQIA 4GJ2A 4IM0A 4RWJA 3TUDA 3UPXA 4NJ3A 2OFUA 4Q9SA 3VS3A 3FV8A 4YMJA 5M06A 4FTJA 1Q8TA 4P2KA 3ZZEA 4WIHA 3FL4A 4BIBA 4BDIA 3HKOA 3NWWA 3DTWA 3EYGA 3KC3A 4ZMEA 4QYYA 2WEVA 4QO9A 3NCGA 3BIZA 3FC1X 4M66A 1H1PA 3GP0A 4GJ3A 3G9NA 4Q5EA 3PXQA 4KINA 3CBLA 3EWHA 4ANNA 3GCUA 3DXQA 1O9UA 3MW1A 4GIIA 5E8VA 3F2RA 2HYYA 4NM5A 4CEGA 4BRXA 3V8TA 2PE0A 1Q3DA 4LUEA 3VQHA 5AM6A 3IDBA 2ITUA 5E1SA 2PWLA 4ALUA 2C5OA 2YEXA 2E9VA 1U5RA 1M17A 4LMNA 4DTKA 4F9BA 1SZMA 2OJJA 1LP4A 3FZOA 4FKRA 4M84A 5EM5A 3ZLWA 4A9SA 4BDEA 3O51A 2F2CB 4APPA 4C0TA 3C0GA 5IA0A 3C4ZA 3HUBA 5LVOA 3K5UA 4AT3A 4PMSA 4JR7A 4AZEA 5DE2A 4B8MA 3EQDA 4BWPA 2FGIA 3C0IA 2HWPA 4YR8A 2PZIA 2XMYA 3LQ5A 2UZNA 3ZEPA 2LGCA 5G6VA 5I9ZA 3LQ8A 1ZXEA 3E5AA 4LRKA 3IS5A 2UUEA 2W5BA 1JOWB 2VTMA 4WUAA 4YC3A 1H27A 3AD4A 3D7ZA 4UMQA 1OL5A 2PY3A 1FGIA 3CPCA 4ARKA 3PJ8A 3AC1A 4RPVA 1GZ8A 4PUZA 5HG8A 3PY1A 5IA2A 3BU3A 5E8UA 3DNEA 3TUCA 3NIEA 1U46A 3R2YA 2YM8A 4AOTA 5E4HA 2R0IA 1LEZA 1ZOEA 3E7VA 3L9MA 3ORMA 3PZHA 4XLVA 5IUIA 4MNFA 4JNWA 3VS5A 1GJOA 1UV5A 2X39A 3QA0A 4J95A 4FTNA 4KD1A 4PWNA 4IC8A 5ITAA 5CEOA 2H96A 3MPAA 3QRKA 2GNIA 4QQ5A 4BBMA 4O7WA 4DGOA 3UPZA 2ZJWA 2Y7JA 2XYNA 3ACKA 3OY1A 4IVDA 2OKRA 4PP7A 4DEDA 1PY5A 3ZLSA 5FM3A 4XP0A 3MYGA 4YZNA 2BDWA 5AV4A 5GIOE 4HNIA 4MH7A 4ZSJA 4Z7HA 1WAKA 4XG4A 3DK3A 3QGWA 2W9ZB 5ETIA 2P3GX 4ZAUA 2ZV8A 1KE7A 2FO0A 4QQCA 3D5UA 3SLSA 4LGHA 4E6AA 4I21A 4ZSGA 4HVIA 3QC4A 5KHWA 3SW4A 1XBBA 3UP7A 1NVQA 3QALE 4DH8A 3EB0A 3ORZA 5T3QA 4BCJA 1PXOA 3O17A 3W16A 5A14A 1U5QA 5CF8A 3NX8A 4UEUA 3GU6A 4FGBA 3VS4A 1GNGA 4O7TA 2I6LA 3PTGA 3HP5A 4YJRA 3L9NA 4X2NA 3LOKA 3QD3A 4IWOA 2RFEA 4X3FA 3RALA 4FV3A 4CCUA 4MF0A 4J97A 4Y95A 1FVVA 3R8LA 3O8UA 2WELA 2O5KA 1HOWA 3VW8A 4E6QA 2JITA 5KHXA 2XJ0A 4JR3A 4AE6A 4BDJA 5EQYA 3I5ZA 5G1XA 4OTFA 3PRIA 5HD7A 3F7WA 3CY3A 5CYIA 5AUVA 4A9UA 4IB3A 3LHJA 4L7FA 1I09A 3EJ1A 2IVVA 1RW8A 3NDMA 1Q3WA 3TNIA 3C13A 4K6ZA 3UVRA 5IEYA 5TT7A 5I3RA 3QKLA 1E9HA 2A4LA 3COMA 5KO1A 3SX9A 3UZPA 1YI6A 2GQRA 3LCKA 3ZMMA 3QTRA 1ZYLA 4AG8A 4JOAA 4RZVA 4KBKA 2B55A 5F1ZA 4H3BA 3HA6A 1UNHA 3WILA 4QP8A 4IAKA 3C5UA 2ZV2A 2J51A 4QRCA 3UG1A 1DI8A 1KOAA 5AR2A 4EK8A 4TYEA 1SVEA 3Q32A 4O7YA 3PLSA 4K9YA 5CF6A 3QXPA 3G33A 1OM1A 4QMOA 1U4DA 4FUXA 3BRBA 3VRZA 2WD1A 3C51A 3NW5A 5DRBA 4ENXA 3GOKA 5HBHA 5TOZA 4AGUA 4DEAA 4DG3E 1YXXA 4EUUA 1YOJA 4QQTA 4GSBA 5E1EA 4FKUA 3OT3A 4RFMA 3Q60A 1L3RE 1H28A 2PE1A 3RHXA 3F66A 4IZ7A 4RJ3A 3S3IA 1OB3A 2AC3A 3BV3A 1CMKE 4GMYA 4K77A 5CENA 2ZOQA 5BMSA 1WBSA 3QLFA 3BE2A 4AF3A 2XBAA 2B1PA 4AA5A 4G16A 3VBTA 1LEWA 2GNFA 3LVPA 3RAKA 3WF8A 3D7TA 3DAKA 3QCXA 3V04A 3F2NA 5AP7A 3CTJA 3QRTA 3KFAA 4C57A 4AOIA 5L2TA 5K4IA 4U42A 4XV9A 2BROA 3VWAA 2PZPA 2BKKA 4WSYA 5FM2A 3LQ3A 1OECA 3IW7A 3OCSA 4KSQA 5AP5A 4E6CA 3WF7A 4YJTA 4MBLA 4IZ5A 4MXCA 2HENA 4K18A 5EDQA 5C03A 3HMPA 3KA0A 2WOUA 3VS7A 5HO6A 4F64A 1MRUA 3VJOA 1UKHA 1REKA 3W2SA 4AN9A 4EUTA 4GIHA 1BI8A 2ZM1A 4FEUA 5FD2A 2NRYA 3G9LX 4YZ9A 4RIYB 2O8YA 4EH8A 3QFVA 1YW2A 5CAQA 2CNUA 5K9IA 2QR7A 1ATPE 1OZ1A 1YWNA 2WOTA 3EKNA 3RAHA 1LPUA 3TZ8A 3TZMA 2P33A 2VX0A 3R1SA 4C7TA 5FG8A 4X2GA 3TTIA 2PVRA 1IAJA 4DFBA 4PDYA 3DPKA 4O0WA 3ACJA 3KMMA 3KXNA 5M4IA 4PV0A 2KTYA 3S0OA 1XQZA 4KS7A 3SAYA 4LG4A 5JQ8A 5FWKK 5CQWA 5A6OA 4F09A 3KXGA 2XNEA 3F5UA 3Q04A 5DEWA 2R9SA 2WMQA 3RHKA 4GVJA 3FJQE 4FTTA 5LOHA 2QI8A 3QZIA 1Y6BA 3FLNC 4NSTA 1PKGA 4R3CA 5L2QA 4O7SA 2YM6A 3Q5ZA 2AUHA 3S4QA 5KMKA 3FZTA 5EOBA 4NL0A 1HCLA 3GU7A 4O91A 4ZEGA 3W18A 2YHVA 2Z60A 5TE0A 3II5A 4UMTA 5ANOA 3WIKA 1FBNA 5IH6A 4HVHA 3I79A 4U6RA 3V5WA 4JX7A 4O0RA 2H8HA 3ORPA 4MD7E 3U4UA 3EFWA 3COIA 4RA5A 1TQIA 2VTRA 3PDTA 3DOGA 3KCKA 3OW4A 4PMTA 4BHNA 2XK4A 3NW7A 4D2SA 2VWVA 3E3BX 3R7IA 4D2WA 2JIIA 4TKSA 3E63A 4FTIA 1XH8A 2QG5A 4L01A 2IZRA 4FNWA 3ENHA 1FMKA 3I81A 4BDCA 3BYSA 3SVVA 3F2AA 5EYDA 5FTOA 3W2PA 3O8PA 4IWQA 3ZC5A 2VNYA 3A7FA 3WZUA 3PIYA 2VNWA 2YJSA 5DR9A 1XJDA 1H01A 2QKWB 1UU9A 2J5EA 3H3CA 4TPTA 5KE0A 3ID6C 2CN8A 4HYUA 3VUTA 4EHEA 4XV3A 4FI1A 2JDVA 2PULA 3DJ7A 5A4CA 1PMEA 5AX3A 3MA6A 3GT8A 4D9TA 5KMOA 5EHYA 3H9OA 4C4EA 3DB6A 5DMZA 4V01A 3EIDA 3FI3A 5DI1A 2BUJA 3UO6A 2IVTA 2P2IA 1JNKA 4MX9A 4ZTQA 2W1ZA 3VW6A 1BUHA 2FVDA 2W06A 3CIKA 1WBPA 1OKYA 4TYHA 2OJ9A 1PXMA 5C4LA 1M2PA 3K3IA 5KUPA 3WE8A 5IUHA 3Q52A 4YHTA 4AUAA 4EOPA 3AT4A 5DT0A 3KQ7A 3UNKA 3V6SA 1GAGA 4WHZA 3FQEA 5DT4A 2QHMA 5FXSA 4ZTNA 5BVDA 4IACA 2BZIB 4GV1A 4FICA 1OIQA 1YXSA 5HNBA 2GPHA 2EXEA 2IN6A 2GS6A 4NM7A 5IKWA 1F0QA 2XJ2A 4MCVA 4PDPA 4QMXA 2GS7A 5EHOA 3LFSA 5H9BA 5L3AA 3MTLA 5IQEA 4CYIA 3G0EA 2BTSA 1ZY5A 3MBLA 4G1WA 5AIKA 4IZAA 4Y85A 2V7OA 3NAXA 3TNQB 4ASZA 3WF6A 3R04A 2QOQA 4KIKA 3G6HA 2X4ZA 5JT2A 3ELJA 1Q97A 2CCIA 1OKWA 3DS6A 4AGCA 4YUQA 4WO5A 3OEZA 4JI9A 4E8AA 4XG2A 2PMLX 1XH4A 4PPCA 4CG9A 1STCE 4A4LA 2PYWA 3KY2A 2JDSA 2R3KA 3OWPA 4ASEA 5FXRA 4FTCA 1P2AA 1Q8UA 4AN2A 4O0YA 5ACBC 5HZNA 3AMYA 4XNEA 3UQGA 4Z7GA 1UU3A 2X8EA 1BL6A 3DCVA 1YDSE 2X9FA 5LXMA 2WMXA 4IDTA 4QP1A 4J53A 5HESA 1UA2A 3E8NA 4RFZA 3DFCB 4BCNA 4QTEA 4JBQA 1H0VA 2FSTX 3RKBA 2XRUA 4AZWA 5LCJA 2WTJA 3LFBA 3HMNA 1EH4A 1XH5A 2WMSA 1OBGA 4S31A 1BLXA 2JAVA 5EI8A 2X6DA 4O7RA 3RK5A 4JBVA 4YC6A 3W33A 3CJFA 2GHLA 1ZMUA 4BR3A 4YJVA 4BI1A 4XH6A 3RCJA 1T46A 4QNYA 4IB1A 3Q5IA 4ITIA 2E9OA 3LPBA 4E93A 4V0GA 4PPBA 1W98A 3FXZA 1OL6A 4ID7A 5IQIA 2VO0A 3GCVA 4CYJA 4DH5A 4GKIA 4CT1A 4W4XA 4D28A 5LVMA 1ZZLA 2O64A 3NIZA 2WIPA 2R7IA 4HGEA 4GK3A 4A9YA 2UW5A 4GU9A 4FA2A 3SQQA 2YIWA 4FKQA 4CV8A 4EYMA 3HAMA 3OUNB 2PZ5A 4AZFA 5F4NA 2VTIA 4AT4A 4CFVA 4FV4A 1OPJA 1MQ4A 3N9XA 1FGKA 3CSVA 4X3JA 2IVUA 2C6KA 2BRMA 4KKGA 3JYAA 2XIRA 3R30A 4FT3A 1R0EA 4RX9A 3ORNA 3QZFA 3NCZA 2FUMA 5I9YA 4PP9A 4TY1A 4RWKA 4OTQA 4JG6A 3ULIA 2VGPA 3FI4A 4CNHA 4YURA 3R00A 2JKMA 3IGGA 1J7LA 2GS2A 2HZIA 4R8QA 4UYAA 3ZHPC 2EVAA 5E8ZA 5KCVA 5JSMA 4W8EA 4BYJA 2R3NA 1KV2A 4F1OA 4IANA 1KOBA 2I1MA 1KE9A 4I5CA 4UZHA 4FV0A 5DEYA 4BN1A 3LMIA 2QHNA 2AYPA 3Q3BA 3WE4A 3ZOSA 1CSNA 5LQFA 3AGMA 4RVTA 5I4NA 5CAUA 4UWYA 5HORA 5DR2A 3G0FA 4AA4A 2REIA 4ZP5A 5EI6A 1OI9A 5LVPA 5DVRA 2CNQA 2C6TA 4DLIA 1FMOE 4IAFA 2CKEA 2PMIA 4RJ8A 3KRRA 3FMDA 4TWOA 4EOJA 2JIUA 3IOKA 4Y72A 1VJYA 2WU6A 3BKBA 2RF9A 3Q6WA 3OFMA 3GFEA 1Z9XA 4AX8A 3ORLA 4FIHA 4ACGA 5BPYA 2C1AA 2GNHA 2OI4X 3WARA 4CQEA 3VAPA 3P86A 2VUWA 3V01A 3VUDA 5CEKA 4MQ1A 4H39A 4WKQA 3RWPA 5FTQA 4TWCA 3R7UA 4RX7A 4L3PA 4UZDA 4ZMFA 3VBQA 3BPRA 2ITPA 2Z7SA 4R5SA 1ZRZA 2X9EA 4H58A 1J1CA 4JAJA 3MI9A 3PP1A 2PZYA 4I1ZA 4YLLA 3AGLA 3KN5A 4JX3A 3TT0A 3IW6A 5JGBA 5CXZA 2O0UA 4IZYA 4PL4A 4WT6A 2W5HA 2XUUA 3RPYA 1MRVA 3QAME 5C4KA 3A7IA 2YDKA 5E8YA 1WVWA 4EOOA 4MNEA 4NEUA 4ZS0A 3VBVA 4FTKA 2B4SB 4KIQA 4YC8A 4D1ZA 4FUYA 5LWNA 1YI3A 3R21A 3VUKA 2P55A 5C26A 4FSMA 4F1TA 5JKGA 3UDBA 2WIHA 3E64A 2ERZE 4FF8A 4DBXA 4GKHA 1RQQA 4G3GA 3N4TA 2YFXA 3PVWA 3UO5A 1WVXA 3FY0A 3VULA 4B6LA 4RWIA 3TTJA 3RPRA 3OBJA 5EW3A 5L8JA 4UX9A 5J9LA 4D1SA 4K33A 4CRSA 4IWDA 2YCSA 4L9IA 5CZIA 3BGPA 3FC2A 3IPHA 3SV0A 5CSXA 3LCOA 5L8KA 5CF5A 4M68A 5C1QB 2EXMA 2C0OA 1P4FA 2YDJA 4ITHA 4BGGA 4XCUA 4UMUA 3KGAA 1SM2A 4D5KA 4O2PA 5HIDA 4IVBA 4GH2A 4HCUA 3FLZA 1KE8A 4OBPA 3KRLA 4BCHA 1Q4LA 2CKPA 5HE3A 3IQ7A 3FE3A 3L8PA 4UMRA 4RC3A 5FUTA 4D9UA 1BX6A 2FA2A 3NS9A 3QQUA 2IVSA 4DITA 3VC4A 5HQ0A 5IA4A 2QC6A 3MY0A 2PVKA 3LLTA 3EH9A 3HX4A 5CEQA 4JAIA 1OKZA 4LMUA 2J0JA 3U6HA 3W8QA 3AC5A 2UW0A 1V1KA 2JBOA 2QR8A 3GNIB 5ANGA 5E90A 3OBGA 1Q8ZA 2XZSA 3F7ZA 4NKAA 4FKSA 3OTVA 4DE4A 2C3LA 3IK3A 4C3PA 3C7QA 3DDPA 2ZB1A 5BYLA 2VWWA 2BFXA 1MRYA 5IEVA 1LR4A 5EQEA 4YJNA 3FHIA 3RINA 2XEYA 3V5PA 4BCQA 4XMOA 4L44A 4A9TA 2OU7A 1XH6A 4KIKB 4XP2A 1H00A 3C4EA 3S00A 3ZS5A 2ITNA 1OL7A 2ZYBA 4DC2A 5D9HA 2HW7A 4PTCA 4O86A 3NNXA 2PUIA 3UOJA 5FLFA 2PSQA 4OLIA 4AT5A 2QOFA 4J1RA 1OGUA 4K8AA 3HDNA 3WYYA 3C4FA 3TDWA 2H9VA 1GZNA 2WMVA 5HIEA 4L43A 3ORIA 5LMAA 4YJQA 3H9RA 4R78A 2FH9A 5HLNA 1YOMA 4EH5A 5HTCA 5AA9A 2AC5A 4M15A 3A4OX 4EZ7A 5EM6A 4G6LA 4AW0A 3MESA 1W84A 3DJ5A 3P4KA 1R39A 2ONLC 4FTMA 2IZSA 5AUXA 4BTKA 2C1BA 2G01A 4LL5A 2GNJA 4OT5A 4KNBA 2R3GA 2XK9A 2CLXA 3CXWA 4WRGA 4F6WA 3HECA 2WZJA 3R83A 3TJDA 2WKMA 3LFDA 4GFMA 5E8TA 1ND4A 3PA3A 4BKZA 4F9WA 5ANEA 2XNMA 4L68A 3E8DA 3COHA 4LOPA 4EONA 4M69A 4YO4A 3V51A 5FP5A 5CSPA 4AZTA 5AP0A 5CANA 2YLEA 4AW5A 3NUYA 3AQVA 4L67A 3WYXA 2V7AA 4RC4A 1F3MC 3OP5A 2UW7A 3EN9A 3E8EA 4NM3A 3PJ1A 3C9WA 3LIJA 4FZ6A 4I24A 4JVGA 5M57A 5DYJA 4DINA 4O1PA 3UIMA 3QWKA 1JKKA 2WAJA 5FGKA 3C5IA 4EK5A 4R1YA 1E1XA 2DUVA 4QNAA 2FB8A 2HZ4A 4U41A 3U6JA 2QOIA 2HAKA 3NYVA 3RK7A 1UWJA 3GC7A 3ZO2A 3RGFA 2I0YA 3EMGA 3PRFA 1IG1A 3FMNA 2Z2WA 3PJ3A 4M14A 4U8ZA 4BIEA 4YP8A 4EKLA 4ERWA 5L2WA 3UOKA 3CE3A 4HGTA 5K4JA 4S2ZA 3BLQA 1WFCA 4O38A 2J7TA 4XG3A 4PTEA 3T3UA 4PDOA 5BVEA 4FTLA 5BVNA 2W1IA 4CSVA 5J5SA 4BZOA 4IVAA 2G2HA 3E88A 3QTWA 5E8SA 2VTQA 5AUTA 5EK7A 4JBPA 5I9XA 1L8TA 5FBNC 2BILB 4WNKA 3UZRA 3BHHA 2UZTA 4NIFA 4LFIA 1LUFA 4TN6A 2WXVA 4LM5A 2WHBA 3OG7A 4DGMA 1ZMVA 3L8VA 4BHZA 3OC1A 4PMPA 2X4FA 1QL6A 3KN6A 4FL2A 3ORTA 2PVFA 2Z7QA 2B0QA 1KUTA 4DEGA 1VYWA 4BGHA 4KSPA 1YHWA 4QMUA 4KB8A 5CVHA 1P5EA 3QZHA 2F7ZE 2OJIA 2X7GA 3CQWA 4AN3A 4JBOA 3VUIA 4CXAA 5E91A 4ZTMA 3NUAA 1PXJA 4R3PA 4DAWA 3WOWA 4I23A 2Z8CA 5IQFA 2J6MA 1IEPA 3FXWA 4FK6A 3AC3A 3RM6A 5I3OA 5CU4A 4B7TA 3R8UA 2C5XA 1J1BA 1HCKA 4DT8A 2GCDA 3O7LD 5IG1A 2QOCA 1OUKA 5KMLA 4QPMA 3C4XA 3EQIA 4APCA 3QRIA 1YDTE 2G2IA 3MVMA 4R1VA 3ZUUA 4E5WA 5IUGA 4FVPA 2QOKA 1K2PA 5TO8A 5HVKA 4NT4A 1OIRA 4FR4A 4A4OA 4DGNA 2ITVA 3VO3A 2JDOA 1ZYCA 5JK3A 2I7QA 3E62A 2B54A 2XCHA 1S9JA 5KMJA 2QOHA 4FVRA 1PXNA 4O7ZA 2Y6MA 2OJFE 4TRLA 5CASA 4AFJA 1F5QA 3P23A 4QP2A 1OKVA 2VTHA 4OTWA 2WMBA 1YDRE 4EJ7A 3W2RA 4DH1A 5HBJA 4IAZA 3ZRKA 2WQMA 4L46A 3Q6UA 4LOOA 3FQSA 4TWNA 3AT2A 2C6IA 5AMNA 3ZLXA 4WNMA 3K5VA 3OCBA 1I44A 5ANIA 4ACDA 2XKEA 4U0IA 5GIPE 4HPTE 5ANDA 2HY0A 2RFNA 4FZFB 5TKDA 2OICA 4QMYA 2BDJA 3MB7A 5EDRA 1QCFA 5IH5A 5HE2A 5H8EA 5AP3A 1PXIA 4EH3A 5AR7A 2XS0A 4UYNA 5I9WA 3E92A 1FVTA 3GC8A 2V62A 2IO6A 2PVLA 2J50A 3BBWA 4FV5A 4WBOA 3QQFA 4FV8A 4YZBA 3OTUA 3EKKA 5HICA 4FV9A 3RPVA 3FMMA 5E92A 2XK3A 1T45A 2J4ZA 4QYFA 3PXFA 5H8BA 4FIFA 4MWIA 3CQUA 3SKCA 4EH6A 2A27A 3QQJA 4J52A 3RTPA 4XP3A 1JAMA 2OF4A 3EQGA 3GCQA 4TNDA 5HCXA 3ULZA 3D94A 2O2UA 4U43A 2BAQA 4KIOA 4MBJA 3VUHA 4MVFA 2FYSA 1SMHA 4CCBA 4D55A 2XBJA 4IJ9A 4RA4A 3ZFYA 4HYSA 1GIHA 4EC9A 3U4WA 4KRDA 1JKTA 1MQBA 3H0ZA 4RZWA 2ESMA 3R6XA 5FEQA 3EN5A 2WFYA 5CEMA 3PUPA 5KNJA 4JQ8A 3TL8A 1JLUE 4AAAA 5BUJA 2P2HA 3TCPA 3KK8A 2UZEA 4CGAA 4FX3A 4BCKA 3K54A 3NLBA 3MY1A 4KA3A 4MXXA 5AAFA 4IX3A 1APME 3CKXA 1URWA 4XUFA 2WTCA 3EFLA 4QTDA 4U80A 3BE9A 2W05A 3TIZA 3UVPA 3BI6A 3RAWA 4EQMA 3R1YA 4ANMA 4CFFA 2CDZA 3D5XA 5EKNA 1M7NA 3KEXA 1WBVA 4R7IA 4ZIMA 3ZC6A 4EOIA 4KBCA 4F9YA 1YXTA 3KB7A 3CTQA 4GG5A 3OWJA 3FPMA 1PMNA 4GYIA 4QMTA 2R64A 3KXHA 2E9UA 5LMKA 1VYZA 3CKWA 3HV5A 5AV3A 4B99A 4O0SA 2UW4A 3GU5A 3R7EA 4N57A 5IQDA 4N0SA 3LJ2A 2VRXA 4XOYA 1VR2A 3FUPA 3V8SA 3EZRA 2O65A 2X7OA 2VWIA 2I0HA 3MJ1A 4GUEA 4PTGA 3TACA 4KS8A 4RVKA 4LGGA 2WMRA 3OW3A 3UNJA 3VHKA 3ZBFA 3RZBA 4RRVA 3GB2A 1OIYA 1Y8GA 1YXVA 2R3QA 1FQ1B 3DJ6A 3A7HA 2UW3A 4XLIA 5JZNA 2YM5A 3KMUA 2W99B 2C3JA 5CTPA 5DFPA 2PVHA 2UVZA 3LFEA 2JIVA 2QU6A 3MIAA 2PVYA 2J0LA 4I94A 4X0MA 5ACKA 2XKFA 5L6WL 2CSNA 2WEIA 4YJOA 4ZTLA 5HE1A 5EDPA 5HE0A 1CTPE 4WG5A 1PKDA 4X7QA 2A1AB 2VX1A 2UZVA 3QYZA 1VZOA 5B2KA 4DCEA 2BIYA 4F6SA 3IDPA 4X2JA 4FKPA 4XHKB 5J5TA 4AQCA 2R4BA 2KULA 3LFCA 4FYOA 4QTCA 3OVVA 5EH0A 2WQOA 4S33A 1KV1A 4LUDA 5DR6A 3PG1A 5DHJA 4TWPA 3QRUA 4S30A 2R7BA 4FZ7A 4E4NA 4EOSA 4FSNA 4U44A 2RGPA 3NRMA 4CKRA 3ZRMA 5AIRA 3U9CA 1OL1A 1U59A 4V05A 1CM8A 2Q0BA 4OTIA 1FVRA 2BZHB 3FKLA 3W32A 3ZXTA 3EN7A 5H3QA 4BDGA 4CRLA 3D83A 4FTUA 1DI9A 4IMYA 4ANBA 4IHPA 4R6VA 4RC2A 5ANKA 3F3UA 4Q5HA 2F4JA 4LL0A 2CNVA 3QU0A 2EB3A 2JKKA 3C50A 2YM7A 4EBVA 3O96A 1ZZ2A 3EQCA 2BHEA 4IX5A 4TNBA 4XBUA 5IDPA 5IISA 3Q2JA 4ORKA 3TG1A 2ZV7A 2QODA 2WMWA 2QOOA 3H4JA 2ETKA 2UZUE 3PIXA 4MTAA 2VWYA 3G5DA 3P79A 5AWMA 3P7BA 3GBZA 3EFJA 5FRIA 2HELA 4M67A 3F61A 2JD5A 2JBPA 4BCGA 3DLSA 3I7BA 3BLHA 5CALA 2BKZA 3RVGA 2IPXA 4O0XA 2XIKA 2VTNA 3ENMA 4J8MA 4N70A 4C34A 4WNPA 5L2IA 4FSRA 3BCEA 1GZKA 4B8LA 1YHSA 3E93A 2GFCA 3EL8A 4UXLA 2X6EA 3LFNA 1ZWSA 2R2PA 4JDHA 4TT7A 3E87A 3PXZA 4BVUA 5HI2A 4GT3A 3Q96A 3F3WA 2O3PA 2IW6A 2NRUA 3HMMA 4JRVA 3L1SA 3R0TA 3QX4A 2HOGA 3QWJA 4ZK5A 3W55A 4EC8A 4RIXB 5DNRA 4BCFA 3GC9A 3C4CA 3PSDA 1G8SA 3HUCA 2WQBA 2WTIA 4S34A 4CFNA 4FSYA 4RMZA 2GHMA 4JDJA 5J79A 3BQCA 3DXPA 3PG3A 1UNLA 3EN4A 2X81A 3OOGA 5J95A 5LARA 4FEWA 4OBOA 4D4YA 4IIRA 5B7VA 5HD4A 2YA9A 2WTDA 3MFUA 4BWXA 2JDTA 3BEAA 3PVGA 2J2IB 4HYHA 4C36A 3GEQA 5A9UA 3PPZA 4O82A 2EB2A 4QTBA 2QONA 3BELA 3H10A 2PUNA 1UU7A 2SRCA 3GU8A 3QCYA 3HV4A 3UYTA 2R3RA 2BAKA 2OZOA 4Z3VA 2YIRA 3D2IA 4BCPA 2C5VA 4U45A 4QP4A 1Q41A 2CCHA 3C4WA 4O1OA 2WQNA 3DU8A 3A8XA 1YQJA 2QO7A 3L8XA 3V6RA 3LM0A 3ZO4A 3GQLA 4QYGA 2CLQA 3DK6A 4F0FA 4U3YA 4FT5A 2QLUA 1NW1A 4G6OA 1JWHA 4C4IA 3DQXA 3ZSGA 3MDYA 2LAVA 3DKOA 1AD5A 5BX0A 1J7UA 2XK8A 4B4LA 2WTVA 4FSTA 2PVMA 1DAWA 5HO7A 5GINE 1W7HA 1IRKA 2OZAA 4NU1A 1M14A 3KKVA 1R1WA 1JQHA 2VTAA 4EQCA 5HX6A 3LZBA 3UP2A 4C4HA 3OCGA 3QQHA 4MF1A 5A3XA 4AZVA 5EI2A 3EN6A 3ODYX 4W4YA 2C6LA 1B38A 1FOTA 2YCQA 2JFMA 3PA4A 4J98A 3F5GA 3A62A 3LJ0A 3QTIA 4L3LA 4O6EA 4U5JA 3RI1A 3ZUVA 4ZZOA 2A19B 4YTHA 1Q62A 3D7TB 3R63A 4HGSA 2X8DA 5GJDA 2W1FA 3EQFA 2IZTA 3ZBXA 1IA9A 5A4TA 3W2QA 5HKMA 4OT6A 4X3FB 3ZDUA 5CAOA 4JDIA 2R0UA 5LMBA 3DFAA 4KUJA 3CGOA 2I0VA 2X2LA 3AC8A 2I40A 3HRBA 4I22A 4CFUA 4ZLOA 4H1MA 3SW7A 2YDIA 4IFGA 1P4OA 4J8NA 1KE5A 5EYKA 3BZ3A 3MVHA 3FI8A 3F88A 2QD9A 3FMKA 3I0OA 4RQKA 4G3DA 4ZXTA 3FKOA 1PXLA 3Q4ZA 4FNXA 2W96B 4I5PA 4AW1A 3JUHA 5DPVA 4RLLA 4BKJA 4BTMA 4E4XA 3PPJA 3UOHA 3PA5A 4AE9A 4FIIA 5GZ9A 4MXYA 3UQFA 2IG7A 2WNTA 4IEBA 4O96A 1OUYA 5AP2A 5EKOA 3KXMA 3CGFA 3DZQA 3PWYA 1GZOA 3FZRA 5CT7A 5BNJA 2DWBA 2BRBA 3R01A 4U81A 4E73A 4CVAA 4GK2A 4RFYA 1QPJA 5EOLA 5AR8A 4M12A 4USEA 2VV9A 5K3YA 1RJBA 5F94A 2JEDA 3UOLA 4FV7A 3D9VA 5M07A 4G2FA 4GEOA 4YZDA 3PXRA 2R3PA 4WG3A 4QP6A 3PY3A 4EOKA 5DOSA 4L7SA 1J7IA 3A7JA 2CHLA 2E9PA 3I60A 1OPKA 3GI3A 2Y8OA 3QBNA 3WBLA 4BDKA 4DH3A 5B2MA 3OCTA 3OXZA 4ZJVA 3ZM9A 4JL9A 3SDJA 4OBQA 3ET7A 4E6DA 4IE9A 2W9FB 3PY0A 3R71A 4OGRA 4FSUA 4ZTSA 3SG8A 1AGWA 4C3FA 3IW8A 2CKQA 3AT3A 3R7GA 4ITJA 4JS8A 4ZS4A 2ITWA 5AFVA 3QD2B 3M11A 1MUOA 3FDNA 5IQGA 1CKIA 1M52A 3FXXA 2V55A 5HHWA 4PX6A 3Q9YA 4MXOA 1XBCA 4OAVB 4JG7A 4MQ2A 3O8TA 3LFAA 4RBLA 1KWPA 4FKLA 1PXKA 5D10A 4KKEA 4CMOA 4U97A 4PMMA 1ZYJA 2GNLA 4WBBB 4CFWA 3NVKI 3KULB 3WI6A 1NVRA 3KK9A 4QP3A 4HZSA 2XKCA 4UMPA 2F57A 4I5MA 5KZIA 3OUKA 4NIFB 3R9DA 1ZLTA 2UVXA 3TKIA 4AS0A 5DN3A 2J5FA 5HIBA 2XNNA 4LRMA 4PL5A 2XRWA 1H0WA 3NAYA 2OIQA 3R9OA 5M09A 2VWUA 1OIUA 5HX8A 5M4CA 4NYEA 2BCJA 2F49A 2CGXA 4PRJA 4UALA 4E5BA 1J3HA 4GCJA 4HZRA 1Q8WA 4MXAA 1WZYA 4EH7A 3FEGA 5AUYA 3SG9A 4JIAA 2ZVAA 3QKMA 2P4IA 4HCVA 3U54A 3QKKA 2ZM4A 4G34A 5EG3A 3U9NA 5JH6A 3R22A 3CCNA 3WF9A 4F4PA 1NA7A 3JPVA 4Q9ZA 5J1VA 5A4EA 3QYWA 2RKUA 2YWPA 2ITXA 4QMZA 1REJA 4XS2A 5C01A 4HJOA 3KULA 1SVHA 2BRHA 4WOVA 3NNWA 5CU6A 5EM8A 2CGUA 2IW9A 1WBTA 4GS6A 3SOCA 3VRYA 4ACCA 4JG8A 3AMBA 3FZPA 3RJCA 4DA5A 3FYJX 2VTSA 4I20A 4XRJA 3HGKA 4FKWA 3TZ7A 4OAUC 2BZJA 2CGVA 2HWOA 3FLQA 4PPAA 1U54A 3R9HA 1CKJA 2C6MA 2YAAA 3UE4A 3PIZA 4G3EA 2VGOA 4L42A 3QTXA 3AOXA 4FE2A 4HYIA 1CDKA 3MGYA 1Q24A 2W0JA 4J96A 3ROYA 4R77A 2B9IA 2GDOA 2IWIA 3LCTA 2RL5A 3FLYA 2QCSA 3SXFA 4YPSA 5BQ0A 2YACA 3R2BA 3I1AA 3R7YA 4ALWA 4DFLA 4P90A 4EH2A 5GZAA 4GT5A 2OLCA 3TXOA 4EWHA 3QQGA 4NH1A 1H1QA 4CQGA 1JPAA 1Y57A 2PZRA 4D0XA 2C6EA 3EYHA 4UY9A 5FEDA 2GNGA 3TV7A 2W1GA 4I41A 3R02A 3SA0A 4D4RA 3P0MA 4H3PA 4UWCA 5HCYA 3P1AA 4U9AA 3RNIA 3KCFA 2ERKA 3UMXA 3A7GA 3LMGA 4CMUA 4XBRA 4EOMA 1XWSA 4M8TA 2ZB0A 3MA3A 4YNOA 3F82A 4EK4A 4EK6A 3B8QA 4EQUA 5KKRB 2IJMA 4IC7A 5CI6A 5CXHA 5J7HA 3E3PA 4HOKA 3HV7A 3UG2A 4XG7A 4D4VA 5BUEA 5KMMA 3TZ9A 5DLSA 4FG7A 4BTFA 5KZ0A 5TF9A 2JDRA 4XJ0A 5DH3A 4BCIA 4ANSA 4QMSA 4WUNA 2W4JA 1PMVA 3F3ZA 4IDVA 3A61A 3IO7A 2B9JA 4TYJA 2OJGA 1ZYSA 4IM3A 2Y9QA 4HVSA 4EKKA 3F6XA 3LE6A 3HDMA 2ZV9A 4CKJA 1KE6A 4FTAA 1H25A 2YERA 5J8IA 2VO7A 5J7BA 4CZUA 3U8WA 3TEIA 4ZSAA 4BWKA 2Y4IC 1GIJA 3TDVA 2UW6A 5EW9A 4DN5A 4F9AA 2R5TA 5KMNA 3KL8A 3NUSA 4L3JA 4YZMA 4M3QA 2RFDA 5B0XA 5JFSA 3O71A 2XIXA 3DLZA 4RIYA 3S1HA 2RFSA 3KRXA 5M56A 2YIQA 5BYYA 2HW6A 3CJGA 3EQRA 1NVSA 5AR5A 4TW9A 4M0YA 2QURA 3BQRA 3VQUA 5IMXA 4OTHA 3UBDA 3LXKA 5IMEA 5KBRA 5JGAA 5JFVA 5CWZA 5C8NA 3ORKA 3N4VA 3W2OA 3QHWA 2OXDA 3VBYA 2B53A 5CI7A 2NPQA 3NNUA 3Q53A 3P9JA 3QUDA 4IBMA 4M97A 4F63A 3MB6A 5CNOA 5CAVA 2XK6A 3QTSA 4W4VA 2PPQA 3M42A 4TYHB 3R8PA 3T9TA 3QUPA 1Q99A 3NPCA 3K3JA 2FSMX 3HAVA 5IQHA 2W1DA 3ZRLA 1Z57A 4ZZNA 3OD6X 1TQMA 1S9IA 3L9PA 3FY2A 3MSSA 4L00A 1H1RA 2PHKA 1ZOGA 4MBIA 5JN2A 3FZ1A 2BR1A 3DBEA 2YAKA 5DG5A 3RNYA 2JC6A 3OXTA 4FEVA 5LCKA 2PMOX 2WU7A 3FMJA 1B6CB 4ALVA 2DS1A 4ZZMA 3WZJA 4LV8A 4RGJA 4DBNA 1J91A 2QQ7A 4H05A 4RSSA 1SNXA 3V5JA 2C6DA 1UWHA 2RSVA 4I0TA 3P5KA 4B9DA 2C30A 3Q4UA 2OFVA 4G31A 2XK7A 2WMUA 2BVAA 5AP1A 1WCCA 3B8RA 2PL0A 4D1XA 3FZSA 1GY3A 4AU8A 5AUWA 4BBEA 4BBFA 2BTRA 2OK1A 4QP9A 4O7LA 3A8WA 4RJ5A 4F7SA 3V5TA 2BZKB 4ACHA 5AADA 5HG9A 1O6LA 5C27A 5E7RA 5AV1A 5BVKA 4BDDA 4O7NA 3OY3A 1XO2B 3V5QA 4EORA 3FMLA 2XNBA 4YPDA 3RCDA 2VTLA 2OIDA 2UW8A 3ITZA 1PJKA 2VWZA 2W5AA 3I7CA 4K1BA 4FKGA 3JVSA 3BGQA 3GGFA 2VTPA 4EZ3A 3U87A 2BMCA 3LCDA 4BDFA 2OXXA 4D2RA 2QOLA 3QUEA 4O84A 4EHGA 2V0DA 1RDQE 1GOLA 4FEXA 4NW6A 3QGYA 4TL0A 3AXWA 5HG7A 5AUZA 2XM8A 4F6UA 5CLPA 2EXCX 4K0YA 5ETCA 5AV0A 2QNJA 3EOCA 3TJCA 3QXOA 2UZDA 3PE1A 2XIYA 4XYFA 1YVJA 1IAHA 3KRWA 3M1SA 4F65A 3ATTA 4YSJA 1BKXA 3VS0A 1B39A 3DDQA 3MFSA 3UGCA 4A4XA 3PPKA 3WZDA 3ODZX 4FC0A 2ITZA 5HTBA 5M4FA 3VNTA 5CSWA 5J9ZA 1KSWA 2YN8A 4TYGA 3HNGA 5HBEA 3WIGA 4YJPA 2C6OA 4L6QA 3FL5A 4J99A 4W9WA 4XG8A 3W10A 3IONA 3PZEA 4FV1A 5FTGA 3DKFA 2XCKA 4U79A 4O22A 1PYEA 4C4JA 4IJPA 5L2SA 3G15A 2J0MB 4I0RA 3UTOA 4X6QC 4BB4A 3R8VA 4RLKA 4YLJA 4DT9A 4BICA 2VWBA 4Z55A 4USDA 4II5A 3O2MA 2VTJA 1BYGA 1R78A 3NYOA 2YITA 4PL3A 5IH4A 1K3AA 1YRPA 4F7NA 1ZAOA 1H26A 2HCKA 2PUUA 3KREA 3UO4A 3SC1A 4YBKA 4IB5A 4ZTRA 3BLRA 3RP9A 3PE2A 2QO2A 4I0SA 4WRSA 4CD0A 1H1WA 1JVPP 2ITTA 3A60A 3GOPA 2OXYA 4BZDA 4DEBA 2PU8A 2OW3A 3AC2A 2YJRA 3ALNA 5D12A 3RAIA 3VS2A 4FT7A 3EL7A 3AMAA 4YHJA 5CU2A 1X8BA 1RE8A 2A0CX 4OW8A 3RPSA 3QX2A 3FPQA 3H0YA 4GG7A 3NUPA 3R1QA 3ZO1A 3NUNA 5JGDA 4BF2A 4ZOGA 2VO6A 1BI7A 2JAMA 4RIWB 2UW9A 4QT1A 4UBAA 1V0PA 4Y5QA 4YJUA 4Y46A 4C37A 3SXRA 4MXZA 4ACMA 3P7CA 4C38A 1G3NA 1SVGA 2DQ7X 3LW0A 3OWKA 5EYMA 3ALOA 5CU0A 3R73A 4YBJA 1OITA 4KRCA 2VZ6A 2EWAA 5LMKC 4RG0A 1UNGA 1PW2A 4YJSA 4YHFA 4GFOA 4FSZA 3DAEA 4GYGA 4WNOA 5HNIX 2J9MA 3I5NA 3PWDA 3ZM4A 1NXKA 2WGJA 5CAPA 3G90X 3REPA 2ZAZA 4IQ6A 2VTTA 5HVYA 1ZYDA 2QLQA 3E7OA 1IR3A 3LCSA 3VVHA 3ZFXA 3MWUA 1FINA 4YTCA 5M53A 4QMPA 4J71A 3AC4A 3BYVA 4ASXA 2ITYA 3N51A 4C58A 1JKLA 2WTKC 4QMVA 4IX4A 4WSQA 5F95A 2FSOX 4H1JA 5KMIA 2GSFA 3MH2A 5HO8A 2YM3A 3OEFX 3F5PA 1VEBA 4E4MA 2XA4A 4I5HA 4R7HA 3KXXA 4QMLA 2C0IA 4CT2A 3HYHA 4A07A 4FL3A 4CFMA 3JY0A 1ZOHA 3QLGA 4IM2A 4XV2A 1FPUA 5AX9A 4EH9A 3DAJA 2PTKA 3IDCA 4FL1A 2Y0AA 4YGAA 3UYSA 3V5LA 3V8WA 3SOAA 3DNDA 1Y6AA 3MY5A 4C2VA 3RPOA 3W1FA 3CD8A 1YXUA 4D2TA 3UZTA 4FT0A 2HK5A 1YOLA 3FQHA 4QPAA 5H2UA 2BALA 4BZNA 5GJGA 1K9AA 1WBNA 4BCMA 2CKOA 2E9NA 3DBFA 4FIEA 4F7LA 4HCTA 3FMHA 3MFRA 3LFFA 3MS9A 2R3OA 4I93A 4QYEA 3ZU7A 3F3VA 4F0GA 4JRNA 1M2RA 4FIGA 2UZLA 3ZO3A 2ACXA 3NNVA 3VIDA 5M44A 2GU8A 4NTTA 4TTHB 4BI2A 4IW0A 4BTJA 4EWQA 4QMNA 2R3JA 2GHGA 2P0CA 3TKUA 4RIOA 4XG9A 1A48A 1M2QA 3LLAA 3ZSIA 3N4UA 3BYOA 1GIIA 2XNOA 3GFWA 4FIJA 3UC4A 4BL1A 4W8DA 3QL8A 5EHLA 4FGRA 5CU3A 2B7AA 4AWIA 4FOBA 4FV6A 2V5QA 3QA8A 2W7XA 3HLLA 4BDAA 1WVYA 4O27B 4ERKA 4O7VA 3PSCA 3HRCA 3DKCA 2XP2A 5FDXA 2A2AA 3D5WA 5LVLA 3BBTB 3CC6A 4DYMA 5EQPA 2F7XE 4FOCA 4R3RA 1BMKA 2GTMA 5LVNA 5HGIA 4AGDA 3OOMA 5ICPA 3Q2MA 1PMUA 3FSFA 1H07A 2JKQA 2PVJA 4W9XA 5F20A 4BFMA 3UMWA 5HG5A 4EI4A 1Q61A 2OWBA 3MTFA 4PQNA 3CD3A 5E8XA 2HXQA 2R3IA 3D14A 5EFQA 3FSKA 3TI1A 5HOAA 3VN9A 3GU4A 3QZGA 4IAYA 3UC3A 2WB8A 3Q4TA 4O0UA 2NP8A 2XF0A 3AD6A 3GCPA 3NVMB 3BGZA 5AA8A 3OXIA 3DBDA 1YWRA 1WBOA 2FSLX 3ANRA 4QQJA 3QTZA 3UODA 4DFNA 4DEIA 3GENA 4CG8A 3QD4A 4NTSA 3EZVA 5IQAA 3BHYA 3FI2A 3BHVA 3NZ0A 5AJQA 4NK9A 4F1MA 4MD9E 5GJFA 4IAIA 4BKYA 5TR6A 4YNEA 5ETAA 5C8MA 2ETRA 4P5ZA 3KVXA 2W1EA 3HV3A 5JFXA 3ZXZA 3LFQA 4LI5A 3PVBA 4FZAB 3BWJA 3PVUA 4KAOA 2WPAA 3NUXA 3TV6A 4Y5HA 5FBOA 3DV3A 3ORXA 3NGAA 4NFNA 3ZCLA 4DGLC 4RJ6A 4BDBA 3SGCA 3T3VA 3I6WA 4ZSEA 3AD5A 3VBXA 1H24A 5J87A 1M7QA 3U6IA 3OT8A 5HNGA 3HMIA 4FNZA 4QMQA 5EYCA 4DFZE 2JGZA 5J1WA 4PDSA 4C4FA 3IW5A 3FKNA 1U54B 4H36A 5A4QA 2OO8X 5L6PA 2Z02A 3LXPA 4XG6A 4DEHA 1R0PA 5BVOA 2CMWA 2V22A 3BU5A 4MNEB 2J0KA 4O6LA 2ZDTA 5DA3A 3A4PA 2WTWA 2VU3A 1JSVA 4I4FA 4DG2E 3NSZA 3L9LA 3O0GA 3LAUA 3O50A 4R5YA 1OBDA 2OZAB 3DA6A 2UZWE 2R3MA 3FMEA 3GCSA 4WG4A 5K5NA 4AACA 4QOXA 4KWPA 4AP7A 4BDHA 5JRQA 3FYKX 4YLKA 5JZJA 1Q5KA 3BHUA 5DGZA 3ZTXA 2XIZA 3D15A 4LV5A 3S2PA 3NR9A 3ZDIA 2X2KA 4FBXA 2C5NA 4S32A 2YZLA 4XX9A 4NKSA 4DFXE 4FKIA 4KABA 3QTQA 3VF9A 3EQHA
chains in the Genus database with same CATH superfamily
2W4OA 1YWVA 4FTOA 4IX6A 4X2KA 4F7JA 1Q8YA 5CX9A 4UB7A 4G17A 4FSWA 4G5JA 3KU2A 2HIWA 2YIYA 3C1XA 4FG9A 4A7CA 4RWLA 4WA9A 4B0GA 3ANQA 3VHEA 2CGWA 4C4GA 5JEBA 4EHZA 2XM9A 4HVGA 3I6UA 2Y4IB 3TNHA 1PF8A 3DY7A 4KIPA 5HEZA 1DS5A 5D7VA 5K0XA 3NYNA 4DTAA 2C47A 1XKKA 1WBWA 3MH1A 5D1JA 3BU6A 3CP9A 2GFSA 5KX8A 1IASA 3LJ1A 3CS9A 4RVMA 3DXNA 4MD8E 4C02A 2C5YA 3TMOA 5D41A 4KKHA 3RWQA 2F2UA 1IA8A 5FDPA 3OWLA 5IF1A 2XYUA 4EYJA 1XHAA 3G2FA 4ZJIA 5ETFA 4MK0A 3POOA 2HZNA 3SRVB 4GUBA 2IEWA 4JT3A 5JMSA 4O83A 5CS6A 4E3CA 4FTQA 2VAGA 4GRBA 3IGOA 3ATSA 1P14A 3PSBA 4P7EA 5JQ5A 4CTCA 2HY81 2R3FA 3OROA 1UKIA 2IZUA 4CMTA 2ITQA 3CEKA 3NYXA 4O21A 1ZMWA 3F5XA 2QG7A 5GHVA 3HEGA 2BAJA 3H9FA 1MP8A 2PMNX 4MAOA 3D5VA 2X8IA 5D7AA 4GVAA 2YABA 1O6YA 4U7ZA 3UIXA 3OZ6A 3VUMA 5AEPA 5AAEA 3HMOA 3QD0A 3ETAA 3M2WA 4Y73A 5DWRA 5IU2A 3HZTA 3HA8A 4PNKA 1PXPA 5EM7A 2VX3A 3VJNA 1CKPA 4NWMA 2G15A 3TNWA 4C62A 4E7WA 4FKJA 5CSVA 4BIDA 4ASDA 3RMFA 3RZFA 3RK9A 3ZYAA 4DHFA 3RM7A 4AW2A 4JDKA 4I3ZA 4YSMA 5CT0A 4MYGA 1JKSA 5BMMA 4RQVA 3COKA 2Z7RA 4HGLA 3QCSA 4NW5A 5DBXA 2PK9A 2XH5A 4QPSA 3QCQA 4XRLA 2NNWB 1H1SA 1DM2A 5CEPA 3EQPA 1V0BA 3R8MA 5GNKA 3JY9A 2Q83A 4UN0C 5CVGA 4USFA 4PF4A 1NY3A 2X1NA 4UV0A 2BHHA 3CR0A 2OBJA 2YLFA 4FJVA 1SYKA 2QU5A 5HLPA 1QPCA 3NUUA 1Z5MA 2EUFB 4I6FA 1OPLA 2BPMA 2HZ0A 4R7BA 4FV2A 4LYNA 4FG8A 2H6DA 2ZMDA 1Y91A 2BRNA 2O63A 2VD5A 2ZMCA 3W2CA 4YTIA 1W8CA 4BY9E 2ETMA 4RX8A 3SXSA 3UIBA 4I6QA 2J0IA 5CNNA 5F9EA 3QF9A 4K2RA 3BEGA 3AG9A 4FTRA 4E1ZA 2X7FA 3BWFA 5ANJA 3ERKA 4RT7A 4TZRA 4X3FC 3NEWA 3OF0A 5E8WA 3UJGA 4C33A 3TIYA 5IZFA 4O2ZA 3DTCA 2E2BA 4L45A 3NFFB 4N6YA 2BIKB 3DQWA 2B9FA 4OTRA 1ERKA 4IVCA 2XNPA 3RBWA 3ZLYA 5IEXA 2RG5A 4ANOA 4DH7A 4U40A 3Q4CA 1JSUA 5AUUA 1NT2A 4I6LA 3EHAA 5AR3A 3ZEWA 4EK3A 4CV9A 4IWPA 4M7IA 4GK4A 3FLSA 2UVYA 3JVRA 5I0BA 4G5PA 3R7OA 1W82A 4LOQA 5A46A 3F3TA 3G51A 2W17A 5A6NA 1UVRA 1TKIA 3DT1A 2G2FA 3BL9A 2BFYA 4C8BA 5BVWA 4JLCA 4F99A 4TYIA 3TKHA 4EJNA 3KXZA 4EZ5A 4ZLZA 3D4QA 4ZY6A 4LRJA 4MWHA 4NM0A 2ZDUA 1A06A 4G3FA 3FBVA 3VS6A 4C2WA 3LKMA 4FNYA 2YCRA 4MKCA 3B2WA 4MHAA 4NFMA 1BL7A 4O0VA 5M08A 1YI4A 2Y4PA 2OSCA 1QPEA 3ZZWA 2OH4A 2CPKE 4DCAA 4ZY5A 1AQ1A 2JLDA 3MPMA 4AZSA 3FAAA 3POZA 4OTPA 1OGYA 5AR4A 3TUBA 3WF5A 2CN5A 1XH9A 1UU8A 4GT4A 2I0EA 4HVDA 4E26A 5DT3A 4D2PA 1SNUA 3GXLA 2XB7A 3PP0A 5I5ZA 5E9EA 5T6KA 2C3IB 3MVLA 2XNGA 2OG8A 4RX5A 3PFQA 4CTBA 5HVJA 3T8OA 3CY2A 5CVFA 5KKRC 5JRSA 3JXWA 3Q9ZA 3F69A 5IA1A 3IKAA 3O23A 3GUBA 5K0KA 2EU9A 4LGDA 2XJ1A 5H8GA 4IH8A 4FODA 2QOBA 3SRVA 4AFEA 4CFXA 2B52A 2JFLA 4EEVA 1ZY4A 2WMAA 4H3QA 4YU2A 5HTIA 3MH0A 4JIKA 5M55A 2F7EE 3KRJA 1XR1A 4EOQA 3HL7A 4D2VA 2OGVA 4M0ZA 5A54A 3TWJA 3G6GA 5M51A 4OTDA 5JFWA 4I6BA 2UV2A 3QHRA 4QMMA 2YIXA 3ZSHA 4ANQA 4GW8A 3MFTA 2VO3A 2YM4A 5D11A 4AOJA 2ZM3A 4AXAA 4FMQA 1Y8YA 3DZOA 4DTBA 3PXYA 4EL9A 4ZJJA 4CLIA 4D5HA 2PVNA 4BI0A 1H4LA 2G1TA 3DGKA 4F9CA 1OVEA 5BUIA 2HXLA 4M69B 5AM7A 5LJJA 3PJ2A 2GMXA 5CSHA 5A4LA 4A06A 5KBQA 4NUSA 5FQDC 2YWVA 5HU9A 3IOPA 2WMTA 3OMVA 5FP6A 2GQGA 3TNPC 2YCFA 3VUGA 4DEEA 4HW7A 4E4LA 4FSQA 5CZHA 3O7LB 4EHVA 2WQEA 3IG7A 5CF4A 2ONLA 4X6RA 1O6KA 4E20A 5AP6A 3OS3A 3NMUF 4DLJA 3CQEA 4HNFA 4IADA 4GU6A 4GFGA 3KF4A 4QYHA 4YO6A 3B2TA 2F9GA 3HRFA 4I6HA 3V3VA 5HCZA 4Z16A 4D0WA 4FKTA 4EH4A 2YZAA 1W83A 2VN9A 3DB8A 3S95A 2XEZA 3H30A 4E5AX 3SHEA 3UNZA 4F08A 3PLAE 4BCOA 3P7AA 1G5SA 3ZFMA 5FXQA 4NCTC 4QMWA 4NZWB 5T68A 2Q0NA 3R8ZA 3IECA 4DGGA 4MUQA 4UWBA 4V0GB 4V04A 3SD0A 5LWMA 1YKRA 3ROCA 2GQSA 2W1CA 3THBA 4J7BA 4Q2AA 3E8CA 4OR5A 2OIBA 4EBWA 1R3CA 3BX5A 3JS2A 3WZKA 5BVFA 2XANA 4A9RA 4ENYA 2PE2A 1W0XC 1YHVA 3KF7A 2YISA 4O0TA 5GZ8A 4U3ZA 4D4SA 3VF8A 4F70A 3KVWA 3ZUTA 4W4WA 2Y6OA 3R28A 3LMHA 2ITOA 3CLYA 3GC0A 3MVJA 3ZONA 3FLWA 4GL9A 3T9IA 4C3RA 2R3LA 4M13A 4NJDA 4JXFA 4ZTHA 4YTFA 5J9YA 2IW8A 2WO6A 3U55A 4JJRA 3BHTA 3DKGA 2B9HA 2R3HA 3CTHA 4HPUE 4BC6A 4I4EA 1XH7A 2WTKB 3BYMA 3R7VA 3R9NA 4ZLYA 4ZSLA 5AP4A 5HU3A 4O81A 3D2KA 3I0QA 3L8SA 5C9CA 1ZARA 3C0HA 3DBCA 2XKDA 4FEQA 4G9RA 3TM0A 3VS1A 3PJCA 2RG6A 3FWQA 4FKVA 4FK3A 3Q9XA 3QTUA 1H08A 4PY1A 4RIXA 5HLWA 4L53A 3LXNA 3HV6A 5DRDA 5M4UA 2C68A 4LQMA 3R9RA 2AQXA 4Y83A 3DK7A 4I92A 4KBAA 4PNIA 3Q9WA 4FVQA 4EOLA 4ANLA 4FZDB 3CPBA 3F9NA 5FEEA 4C35A 5CQUA 5IA5A 2X2MA 5I9VA 4N4SA 4K11A 3EFKA 2BDFA 3A99A 5DIAA 3QQKA 1QPDA 3K2LA 3P08A 3UQCA 3KMWA 4YZCA 1TQPA 1QMZA 3TV4A 4C61A 4BYIA 4RIWA 4X2FA 4QTAA 5I9UA 4BGQA 1XBAA 4N6ZA 2RIOA 3D0EA 4QD6A 1E1VA 2DYLA 3EQBA 3QRJA 4OTGA 3ZH8A 2PUPA 3TN8A 3JR1A 3FHRA 1A9UA 4UXQA 1DAYA 4XEYA 3BV2A 3U51A 4CKIA 4C59A 5B2LA 4G6NA 2QO9A 3TYKA 5IDNA 2C0TA 3WZEA 4JQEA 3MN3A 5IPJA 3MPTA 2J90A 1PHKA 3I4BA 2X0GA 5AAGA 3VBWA 1URCA 2VWXA 4NCTA 4P5QA 4ZY4A 5BV3A 1JSTA 2OH0E 3R1NA 4G9CA 4L8MA 2AEGA 2Z7LA 3OHTA 4IXPA 2XVDA 1H8FA 3A2CA 3HVCA 3NW6A 4L52A 4RJ7A 5AV2A 5CEIA 4DDIA 2C69A 4IFCA 2C3KA 4FKOA 4CLJA 4JQ7A 4Y8DA 5BYZA 1PRYA 4IAAA 3HP2A 4QP7A 5IQCA 2GTNA 5IQBA 3W8LA 1G8AA 1OMWA 2VTOA 2G9XA 4IB0A 4X21A 4DG0E 1JBPE 3BYUA 4G3CA 2CJMA 4D58A 2QVSE 5L8LA 4XOZA 2JKOA 2UZBA 4F0IA 1PYXA 3PXKA 3QC9A 4RVLA 3MIYA 4WD5A 3DBQA 4Z9LA 1OL2A 1TVOA 2W4KA 3MV5A 4FYNA 4DFUA 1V0OA 2OF2A 3UIUA 2NO3A 2UZOA 4DF3A 3GVUA 3LM5A 3MJ2A 3PYYA 4OUCA 4RJ4A 4TXCA 5EW8A 3UDZA 2BRGA 5L6OA 3P78A 5CY3A 2W1HA 2H34A 1WMKA 3LXLA 5L4QA 3QQLA 4CZTA 4CZYB 2QKRA 3UVQA 4ONAA 5IA3A 4MEDA 3IW4A 2C4GA 4FT9A 4DFYA 5K5XA 4AA0A 3MH3A 5C8KA 4XV1A 4AGWA 4P4CA 3GQIA 4GJ2A 4IM0A 4RWJA 3TUDA 3UPXA 4NJ3A 2OFUA 4Q9SA 3VS3A 3FV8A 4YMJA 5M06A 4FTJA 1Q8TA 4P2KA 3ZZEA 4WIHA 3FL4A 4BIBA 4BDIA 3HKOA 3NWWA 3DTWA 3EYGA 3KC3A 4ZMEA 4QYYA 2WEVA 4QO9A 3NCGA 3BIZA 3FC1X 4M66A 1H1PA 3GP0A 4GJ3A 3G9NA 4Q5EA 3PXQA 4KINA 3CBLA 3EWHA 4ANNA 3GCUA 3DXQA 1O9UA 3MW1A 4GIIA 5E8VA 3F2RA 2HYYA 4NM5A 4CEGA 4BRXA 3V8TA 2PE0A 1Q3DA 4LUEA 3VQHA 5AM6A 3IDBA 2ITUA 5E1SA 2PWLA 4ALUA 2C5OA 2YEXA 2E9VA 1U5RA 1M17A 4LMNA 4DTKA 4F9BA 1SZMA 2OJJA 1LP4A 3FZOA 4FKRA 4M84A 5EM5A 3ZLWA 4A9SA 4BDEA 3O51A 2F2CB 4APPA 4C0TA 3C0GA 5IA0A 3C4ZA 3HUBA 5LVOA 3K5UA 4AT3A 4PMSA 4JR7A 4AZEA 5DE2A 4B8MA 3EQDA 4BWPA 2FGIA 3C0IA 2HWPA 4YR8A 2PZIA 2XMYA 3LQ5A 2UZNA 3ZEPA 2LGCA 5G6VA 5I9ZA 3LQ8A 1ZXEA 3E5AA 4LRKA 3IS5A 2UUEA 2W5BA 1JOWB 2VTMA 4WUAA 4YC3A 2X0QA 1H27A 3AD4A 3D7ZA 4UMQA 1OL5A 2PY3A 1FGIA 3CPCA 4ARKA 3PJ8A 3AC1A 4RPVA 1GZ8A 4PUZA 5HG8A 3AKJA 3PY1A 5IA2A 3BU3A 5E8UA 3DNEA 3TUCA 3NIEA 1U46A 3R2YA 2YM8A 4AOTA 5E4HA 2R0IA 1LEZA 1ZOEA 3E7VA 3L9MA 3ORMA 3PZHA 4XLVA 5IUIA 4MNFA 4JNWA 3VS5A 1GJOA 1UV5A 2X39A 3QA0A 4J95A 4FTNA 4KD1A 4PWNA 4IC8A 5ITAA 5CEOA 2H96A 3MPAA 3QRKA 2GNIA 4QQ5A 4BBMA 4O7WA 4DGOA 3UPZA 2ZJWA 2Y7JA 2XYNA 3ACKA 3OY1A 4IVDA 2OKRA 4PP7A 4DEDA 1PY5A 3ZLSA 5FM3A 4XP0A 3MYGA 4YZNA 2BDWA 5AV4A 5GIOE 4HNIA 4MH7A 3W0PA 4ZSJA 4Z7HA 1WAKA 4XG4A 3DK3A 3QGWA 2W9ZB 5ETIA 2P3GX 4ZAUA 2ZV8A 1KE7A 2FO0A 4QQCA 3D5UA 3SLSA 4LGHA 4E6AA 4I21A 4ZSGA 4HVIA 3QC4A 5KHWA 3SW4A 1XBBA 3UP7A 1NVQA 3QALE 4DH8A 3EB0A 3ORZA 5T3QA 4BCJA 1PXOA 3O17A 3W16A 5A14A 1U5QA 5CF8A 3NX8A 4UEUA 3GU6A 4FGBA 3VS4A 1GNGA 4O7TA 2I6LA 3PTGA 3HP5A 4YJRA 3L9NA 4X2NA 3ML1A 3LOKA 3QD3A 4IWOA 2RFEA 4X3FA 3RALA 4FV3A 4CCUA 4MF0A 4J97A 4Y95A 1FVVA 3R8LA 3O8UA 2WELA 2O5KA 1HOWA 3VW8A 4E6QA 2JITA 5KHXA 2XJ0A 4JR3A 4AE6A 4BDJA 5EQYA 3I5ZA 5G1XA 4OTFA 3PRIA 5HD7A 3F7WA 3CY3A 5CYIA 2X0OA 5AUVA 4A9UA 4IB3A 3LHJA 4L7FA 1I09A 3EJ1A 2IVVA 1RW8A 3NDMA 1Q3WA 3TNIA 3C13A 4K6ZA 3UVRA 5IEYA 5TT7A 5I3RA 3QKLA 1E9HA 2A4LA 3COMA 5KO1A 3SX9A 3UZPA 1YI6A 2GQRA 3LCKA 3ZMMA 3QTRA 1ZYLA 4AG8A 4JOAA 4RZVA 4KBKA 2B55A 5F1ZA 4H3BA 3HA6A 1UNHA 3WILA 4QP8A 4IAKA 4O4EA 3C5UA 2ZV2A 2J51A 4QRCA 3UG1A 3W0RA 1DI8A 1KOAA 5AR2A 4EK8A 4TYEA 1SVEA 3Q32A 4O7YA 3PLSA 4K9YA 5CF6A 3QXPA 3G33A 1OM1A 4QMOA 1U4DA 4FUXA 3BRBA 3VRZA 3UDSA 2WD1A 3C51A 3NW5A 5DRBA 4ENXA 3GOKA 5HBHA 5TOZA 4AGUA 4DEAA 4DG3E 1YXXA 4EUUA 1YOJA 4QQTA 4GSBA 5E1EA 4FKUA 3OT3A 4RFMA 3Q60A 1L3RE 1H28A 2PE1A 3RHXA 3F66A 4IZ7A 4RJ3A 3S3IA 1OB3A 2AC3A 3BV3A 1CMKE 4GMYA 4K77A 5CENA 2ZOQA 5BMSA 1WBSA 3QLFA 3BE2A 4AF3A 2XBAA 2B1PA 4AA5A 4G16A 3VBTA 1LEWA 2GNFA 3LVPA 3RAKA 3WF8A 3D7TA 3DAKA 3QCXA 3V04A 3F2NA 5AP7A 3CTJA 3QRTA 3KFAA 4C57A 4AOIA 5L2TA 5K4IA 4U42A 4XV9A 2BROA 3VWAA 2PZPA 2BKKA 4WSYA 5FM2A 3LQ3A 1OECA 3IW7A 3OCSA 4KSQA 5AP5A 4E6CA 3WF7A 4YJTA 4MBLA 4IZ5A 4MXCA 2HENA 4K18A 5EDQA 5C03A 3HMPA 3KA0A 2WOUA 3VS7A 5HO6A 4F64A 1MRUA 3W0NA 3VJOA 1UKHA 1REKA 3W2SA 4AN9A 4EUTA 4GIHA 1BI8A 2ZM1A 4FEUA 5FD2A 2NRYA 3G9LX 4YZ9A 4RIYB 2O8YA 4EH8A 3QFVA 1YW2A 5CAQA 2CNUA 5K9IA 2QR7A 1ATPE 1OZ1A 1YWNA 2WOTA 3EKNA 3RAHA 1LPUA 3TZ8A 3TZMA 2P33A 2VX0A 3R1SA 4C7TA 5FG8A 4X2GA 3TTIA 2PVRA 1IAJA 4DFBA 4PDYA 3DPKA 4O0WA 3ACJA 3KMMA 3KXNA 5M4IA 3NFGB 4PV0A 2KTYA 3S0OA 1XQZA 4KS7A 3SAYA 4LG4A 5JQ8A 5FWKK 5CQWA 5A6OA 4F09A 3KXGA 2XNEA 3F5UA 3Q04A 5DEWA 2R9SA 2WMQA 3RHKA 4GVJA 3FJQE 4FTTA 5LOHA 2QI8A 3QZIA 1Y6BA 3FLNC 4NSTA 1PKGA 4R3CA 5L2QA 4O7SA 2YM6A 3Q5ZA 2AUHA 3S4QA 5KMKA 3FZTA 5EOBA 4NL0A 1HCLA 3GU7A 4O91A 4ZEGA 3W18A 2YHVA 2Z60A 5TE0A 3II5A 4UMTA 5ANOA 3WIKA 1FBNA 5IH6A 4HVHA 3I79A 4U6RA 3V5WA 4JX7A 4O0RA 2H8HA 3ORPA 4MD7E 3U4UA 3EFWA 3COIA 4RA5A 1TQIA 2VTRA 3PDTA 3DOGA 3KCKA 3OW4A 4PMTA 4BHNA 2XK4A 3NW7A 4D2SA 2VWVA 3E3BX 3R7IA 4D2WA 2JIIA 4TKSA 3E63A 4FTIA 1XH8A 2QG5A 4L01A 2IZRA 4FNWA 3ENHA 1FMKA 3I81A 4BDCA 3BYSA 3SVVA 3F2AA 5EYDA 5FTOA 3W2PA 3O8PA 4IWQA 3ZC5A 2VNYA 3A7FA 3WZUA 3PIYA 2VNWA 2YJSA 5DR9A 1XJDA 1H01A 2QKWB 1UU9A 2J5EA 3H3CA 4TPTA 5KE0A 3ID6C 2CN8A 4HYUA 3VUTA 4EHEA 4XV3A 4FI1A 2JDVA 2PULA 4O4DA 3DJ7A 5A4CA 1PMEA 5AX3A 3MA6A 1TZDA 3GT8A 4D9TA 5KMOA 5EHYA 3H9OA 4C4EA 3DB6A 5DMZA 4V01A 3EIDA 3FI3A 5DI1A 2BUJA 3UO6A 2IVTA 2P2IA 1JNKA 4MX9A 4ZTQA 2W1ZA 3VW6A 1BUHA 2FVDA 2W06A 3CIKA 1WBPA 1OKYA 4TYHA 2OJ9A 1PXMA 5C4LA 1M2PA 3K3IA 5KUPA 3WE8A 5IUHA 3Q52A 4YHTA 4AUAA 4EOPA 3AT4A 5DT0A 3KQ7A 3UNKA 3V6SA 1GAGA 4WHZA 3FQEA 5DT4A 2QHMA 5FXSA 4ZTNA 5BVDA 4IACA 2BZIB 4GV1A 4FICA 1OIQA 1YXSA 5HNBA 2GPHA 2EXEA 2IN6A 2GS6A 4NM7A 5IKWA 1F0QA 2XJ2A 4MCVA 4PDPA 4QMXA 2GS7A 5EHOA 3LFSA 5H9BA 5L3AA 3MTLA 5IQEA 4CYIA 3G0EA 2BTSA 1ZY5A 3MBLA 4G1WA 5AIKA 4IZAA 4Y85A 2V7OA 3NAXA 3TNQB 4ASZA 3WF6A 3R04A 2QOQA 4KIKA 3G6HA 2X4ZA 5JT2A 3ELJA 1Q97A 2CCIA 1OKWA 3DS6A 4AGCA 4YUQA 4DHJA 4WO5A 3OEZA 4JI9A 4E8AA 4XG2A 2PMLX 1XH4A 4PPCA 4CG9A 1STCE 4A4LA 2PYWA 3KY2A 2JDSA 2R3KA 3OWPA 4ASEA 5FXRA 4FTCA 1P2AA 1Q8UA 4AN2A 4O0YA 5ACBC 5HZNA 3AMYA 4XNEA 3UQGA 4Z7GA 1UU3A 2X8EA 1BL6A 3DCVA 1YDSE 2X9FA 5LXMA 2WMXA 4IDTA 4QP1A 4J53A 5HESA 1UA2A 3E8NA 4RFZA 3DFCB 4BCNA 4QTEA 4JBQA 4AQKA 1H0VA 2FSTX 3RKBA 2XRUA 4AZWA 5LCJA 2WTJA 3LFBA 3HMNA 1EH4A 1XH5A 2WMSA 1OBGA 4S31A 1BLXA 2JAVA 5EI8A 2X6DA 4O7RA 3RK5A 4JBVA 4YC6A 3W33A 3CJFA 2GHLA 1ZMUA 4BR3A 4YJVA 4BI1A 4XH6A 3RCJA 1T46A 4QNYA 4IB1A 3Q5IA 4ITIA 2E9OA 3LPBA 4E93A 1G8JA 4V0GA 4PPBA 1W98A 3FXZA 1OL6A 4ID7A 5IQIA 2VO0A 3GCVA 4CYJA 4DH5A 4GKIA 4CT1A 4W4XA 4D28A 5LVMA 1ZZLA 2O64A 3NIZA 2WIPA 2R7IA 4HGEA 4GK3A 4A9YA 2UW5A 4GU9A 4FA2A 3SQQA 2YIWA 4FKQA 4CV8A 4EYMA 2NYAA 3HAMA 3OUNB 2PZ5A 4AZFA 5F4NA 2VTIA 4AT4A 4CFVA 4FV4A 1OPJA 1MQ4A 3N9XA 1FGKA 3CSVA 4X3JA 2IVUA 2C6KA 2BRMA 4KKGA 3JYAA 2XIRA 3R30A 4FT3A 1R0EA 4RX9A 3ORNA 3QZFA 1XMMA 3NCZA 2FUMA 5I9YA 4PP9A 4TY1A 4RWKA 4OTQA 4JG6A 3ULIA 2VGPA 3FI4A 4CNHA 4YURA 3R00A 2JKMA 3IGGA 1J7LA 2GS2A 2HZIA 4R8QA 4UYAA 3ZHPC 2EVAA 5E8ZA 5KCVA 5JSMA 4W8EA 4BYJA 2R3NA 1KV2A 4F1OA 4IANA 1KOBA 2I1MA 1KE9A 4I5CA 4UZHA 4FV0A 5DEYA 4BN1A 3LMIA 2QHNA 2AYPA 3Q3BA 3WE4A 3ZOSA 1CSNA 5LQFA 4LV7A 3AGMA 4RVTA 5I4NA 5CAUA 4UWYA 5HORA 5DR2A 3G0FA 4AA4A 2REIA 4ZP5A 5EI6A 1OI9A 5LVPA 5DVRA 2CNQA 2C6TA 4DLIA 1FMOE 4IAFA 2CKEA 2PMIA 4RJ8A 3KRRA 3FMDA 4TWOA 4EOJA 2JIUA 3IOKA 4Y72A 1VJYA 2WU6A 3BKBA 2RF9A 3Q6WA 3OFMA 3GFEA 1Z9XA 4AX8A 3ORLA 4FIHA 4ACGA 5BPYA 2C1AA 2GNHA 2OI4X 3WARA 4CQEA 3VAPA 3P86A 2VUWA 3V01A 3VUDA 5CEKA 4MQ1A 4H39A 4WKQA 3RWPA 5FTQA 4TWCA 3R7UA 4RX7A 4L3PA 4UZDA 4ZMFA 3VBQA 3BPRA 2ITPA 2Z7SA 4R5SA 1ZRZA 2X9EA 4H58A 1J1CA 4JAJA 3MI9A 3PP1A 2PZYA 4I1ZA 4YLLA 3AGLA 3KN5A 4JX3A 3TT0A 3IW6A 5JGBA 5CXZA 2O0UA 4IZYA 4PL4A 4WT6A 2W5HA 2XUUA 3RPYA 1MRVA 3QAME 5C4KA 3A7IA 2YDKA 5E8YA 1WVWA 4EOOA 4MNEA 4NEUA 4ZS0A 3VBVA 4FTKA 2B4SB 4KIQA 4YC8A 4D1ZA 4FUYA 5LWNA 1YI3A 3R21A 3VUKA 2P55A 5C26A 4FSMA 4F1TA 5JKGA 3UDBA 2WIHA 3E64A 2ERZE 4FF8A 4DBXA 4GKHA 1RQQA 4G3GA 3N4TA 2YFXA 3PVWA 3UO5A 1WVXA 3FY0A 3VULA 4B6LA 4RWIA 3TTJA 3RPRA 3OBJA 5EW3A 5L8JA 4UX9A 5J9LA 4D1SA 4K33A 4CRSA 4IWDA 2YCSA 4L9IA 5CZIA 3BGPA 3FC2A 3IPHA 3SV0A 5CSXA 3LCOA 5L8KA 3P5JC 5CF5A 4M68A 5C1QB 2EXMA 2C0OA 1P4FA 2YDJA 4ITHA 4BGGA 4XCUA 4UMUA 3KGAA 1SM2A 4D5KA 4O2PA 5HIDA 4IVBA 4GH2A 4HCUA 3FLZA 1KE8A 4OBPA 3KRLA 4BCHA 1Q4LA 2CKPA 5HE3A 3IQ7A 3FE3A 3L8PA 4UMRA 4RC3A 5FUTA 4D9UA 1BX6A 2FA2A 3PFYA 3NS9A 3QQUA 2IVSA 4DITA 3VC4A 5HQ0A 5IA4A 2QC6A 3MY0A 2PVKA 3LLTA 3EH9A 3HX4A 5CEQA 4JAIA 1OKZA 4LMUA 2J0JA 3U6HA 1VLRA 3W8QA 3AC5A 2UW0A 1V1KA 2JBOA 2QR8A 3GNIB 5ANGA 5E90A 3OBGA 1Q8ZA 2XZSA 3F7ZA 4NKAA 4FKSA 3OTVA 4DE4A 2C3LA 3IK3A 4C3PA 3C7QA 3DDPA 2ZB1A 5BYLA 2VWWA 2BFXA 1MRYA 5IEVA 1LR4A 5EQEA 4YJNA 3FHIA 3RINA 2XEYA 3V5PA 4BCQA 4XMOA 4L44A 4O4BB 4A9TA 2OU7A 1XH6A 4KIKB 4XP2A 1H00A 3C4EA 3S00A 3ZS5A 2ITNA 1OL7A 2ZYBA 4DC2A 5D9HA 2HW7A 4PTCA 4O86A 3NNXA 2PUIA 3UOJA 5FLFA 2PSQA 4OLIA 4AT5A 2QOFA 4J1RA 1OGUA 4K8AA 3HDNA 3WYYA 3C4FA 3TDWA 2H9VA 1GZNA 2WMVA 5HIEA 4L43A 3ORIA 5LMAA 4YJQA 3H9RA 4R78A 2FH9A 5HLNA 1YOMA 4EH5A 5HTCA 5AA9A 2AC5A 4M15A 3A4OX 4EZ7A 5EM6A 4G6LA 4AW0A 3MESA 1W84A 3DJ5A 3P4KA 1R39A 2ONLC 4FTMA 2IZSA 5AUXA 4BTKA 2C1BA 2G01A 4LL5A 2GNJA 4OT5A 4KNBA 2R3GA 2XK9A 2CLXA 3CXWA 4WRGA 4F6WA 3HECA 2WZJA 3R83A 3TJDA 2WKMA 3LFDA 4GFMA 5E8TA 1ND4A 3PA3A 4BKZA 4F9WA 5ANEA 2XNMA 4L68A 3E8DA 3COHA 4LOPA 4EONA 4M69A 4YO4A 3V51A