4ASZA

Crystal structure of apo trkb kinase domain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
299
structure length
289
Chain Sequence
b'GAMDTFVQHIKRHNIVLKRELGEFGKVFLAECYNLCKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BDNF/NT-3 GROWTH FACTORS RECEPTOR
publication title The Crystal Structures of Trka and Trkb Suggest Key Regions for Achieving Selective Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 289
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aszA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aszA01
1TQPA 5LQFA 3V8SA 5JGAA 3CSVA 5DYJA 3BELA 3BYSA 4MD9E 1FINA 1BKXA 4D9TA 2BIKB 5FP5A 3DBDA 3ORPA 1A06A 2J0IA 4Y85A 2IN6A 3KCFA 3QRTA 1LEWA 1OMWA 4FVRA 2FGIA 3ATSA 5HICA 4UMPA 4IXPA 1P5EA 2RGPA 4J99A 2XNPA 5CF5A 4B8LA 2XNEA 4UZHA 1QL6A 4V0GA 4FX3A 3AGLA 4XMOA 4MCVA 5C26A 3HA6A 2PTKA 5DR6A 3D2IA 4J96A 2BRGA 5IEYA 2VTRA 5KMMA 4BIEA 5AP3A 5CNNA 5HG5A 1TVOA 2OSCA 4QPMA 2IJMA 5HKMA 3O23A 4TN6A 3D83A 4TWCA 4BTKA 1UNHA 4Y8DA 2ZOQA 4BGQA 4ASEA 5F95A 5H9BA 1WBVA 4YC3A 5EK7A 4QP9A 4D1ZA 4HGLA 3H3CA 4D5HA 3E8EA 4O7ZA 4UXLA 1ZOGA 4N4SA 3CLYA 2DWBA 4X3FC 4FIFA 4IB1A 1YXVA 4CV8A 2PVJA 4YTFA 5LWMA 3OWJA 5T68A 3DV3A 3QTSA 1ZZLA 4KRDA 5HORA 1YWNA 2ZDTA 1T46A 5I3OA 2WTWA 2ZJWA 3SLSA 3W2PA 2GMXA 2X6DA 3EZVA 4U9AA 1RDQE 3W55A 4FT9A 4DE4A 1FMOE 2C6IA 3DB6A 4PRJA 4R3RA 3HUCA 4X2JA 4YHTA 3ATTA 1EH4A 5B2KA 3F69A 2UZTA 2V0DA 5C03A 2YHVA 3NYOA 2UZOA 3LCKA 2Q83A 3NW7A 3AD6A 4AZVA 1YXUA 2OU7A 5EM5A 1YWRA 2X2LA 3FZTA 5EW3A 2QHMA 1G5SA 3GFWA 4CLIA 3TTIA 4MXOA 3PE2A 2UZUE 1XBBA 4ZP5A 2PVRA 2HIWA 3NAYA 3P79A 4UV0A 3A4OX 4ASXA 1J91A 4AXAA 5HNGA 1OL6A 3UYSA 5JH6A 2R3LA 2W4KA 3OUKA 4C0TA 5DT0A 3PY0A 4RSSA 4C61A 1BX6A 5E8VA 2Z7SA 1MP8A 2HWOA 4NUSA 4FTOA 3DBCA 5FUTA 4FT5A 4BTJA 5A14A 4ZTSA 4YLLA 3KU2A 5HESA 3BU3A 4DG0E 4O7NA 4YTHA 5CENA 3HECA 3QGYA 4XV9A 3HMIA 3QZIA 4AAAA 3MV5A 5EW8A 2WMUA 2BZIB 3BWFA 3ZXZA 4NSTA 3MFUA 4RPVA 3T3VA 2ERZE 3KK9A 5A6NA 3IGGA 5B7VA 5K9IA 1G8AA 3QTZA 2R64A 1H24A 1Q4LA 2JEDA 4K77A 4PL3A 2C6MA 3SRVB 3QTXA 4M7IA 2WOUA 3LFAA 4DH3A 4YR8A 3K3JA 2XYNA 5KO1A 2XIRA 4BCOA 1YDTE 3F61A 2GQSA 3LXKA 5A46A 4YHFA 3EN5A 4YHJA 4BGGA 4RZVA 4XUFA 3FMEA 4JDJA 4N70A 3A7GA 3PVGA 3QD0A 4O0YA 3WBLA 1LEZA 2XUUA 4A9TA 3AXWA 4IC7A 3RPRA 1ZY5A 3C4ZA 4NTTA 3ID6C 4J1RA 2OJ9A 4BDIA 5C8NA 5AR8A 5M09A 2YM5A 3ALNA 3WIKA 4CRLA 4QQJA 3NCZA 5IEVA 4NM7A 4X7QA 2XMYA 4BKYA 1JNKA 4OT6A 5CF8A 2YEXA 4UZDA 2XIKA 1KE5A 5LOHA 2DYLA 3NYNA 3U51A 3C7QA 3TUCA 3E8NA 2QO9A 1HCKA 5L4QA 2XNMA 2CKEA 4EZ5A 3LFQA 3R9OA 3PZHA 4BIBA 5GHVA 3QWKA 2O8YA 3UBDA 2VWZA 5J7HA 3P4KA 4G34A 3KC3A 3LHJA 4RJ4A 4ACGA 5KMIA 4FZ7A 5L3AA 2WIPA 4RLLA 3H4JA 5KMJA 2CN8A 4C57A 2WD1A 4L68A 4BDEA 5AADA 4H1MA 4IAAA 3OXIA 4CGAA 2W5AA 4AT3A 4FT3A 1VYWA 4CEGA 3KRJA 4RVKA 4FSWA 3HP5A 4DEGA 2NPQA 2WZJA 3CY3A 4YJSA 1QPDA 3UO6A 4FUYA 2ITXA 3HV4A 3MSSA 4IIRA 4EYMA 3OUNB 5HU9A 4U0IA 5IEXA 2ZDUA 4IAKA 2PVMA 4XCUA 5IA5A 4OW8A 4F9YA 1ZYSA 5ANKA 3FI2A 5EYMA 1WVWA 1UA2A 4PTGA 4UY9A 1UNLA 3KMMA 4UYAA 3EZRA 5FLFA 3PIYA 4PDSA 5JZJA 4FKPA 2B53A 2YDKA 3PSDA 3B2TA 3W32A 2EU9A 3RVGA 3DBFA 4EQCA 3SOAA 5EG3A 4R1VA 3KCKA 4QTBA 5HBJA 5E4HA 1KSWA 2OGVA 5C4LA 3MA3A 3TJCA 2UZNA 1OBDA 3OOMA 2XM9A 3IK3A 3R2BA 4QPAA 3E92A 4L9IA 3G5DA 3I6WA 3NMUF 4ENXA 3TN8A 3EFKA 4QMYA 1WFCA 2YIWA 2YLEA 1F0QA 3COHA 3KRRA 5EHLA 2DS1A 5IUIA 2CN5A 3TZ7A 4O7YA 4MTAA 3DOGA 1BMKA 4JBPA 4F7SA 3DY7A 5DGZA 5CVGA 4A9YA 4UYNA 2F2UA 4XP2A 1R0EA 2PYWA 4GJ2A 4IVBA 4FL1A 4EH6A 4LYNA 3MI9A 4AOTA 4J97A 3DS6A 3DBEA 3BHUA 4S31A 4UALA 4BCQA 1L3RE 3Q6WA 4RJ7A 3QX2A 4O0VA 4EJ7A 4EOOA 2ITWA 4IB3A 4IDVA 5CAOA 5L2WA 2PZRA 3CC6A 5J9ZA 2R0UA 1JKLA 2GS2A 1RW8A 2XEZA 3R1NA 4AN9A 3GT8A 2YFXA 4RWJA 5BMSA 2VO6A 4MX9A 4I21A 4PTEA 3D14A 3KULA 4UB7A 4DH1A 1M7NA 2WTIA 2XH5A 4X3FA 3HAMA 4EWQA 4JT3A 5CI6A 4MK0A 3LCTA 2R7BA 3FE3A 3F5UA 3MH2A 2GNFA 1PXKA 3O7LD 3Q52A 4YJUA 3W8QA 1VJYA 2CSNA 2BR1A 2QKWB 3EWHA 2BTSA 4FKUA 2QU6A 2R9SA 2YERA 4OTFA 4KKGA 4P4CA 4ZTRA 3VVHA 4E20A 5EKOA 3AC4A 3FXWA 4U41A 3SW7A 3TUDA 4G9RA 3GCVA 1V0OA 2WQOA 2XK9A 3Q53A 3VBXA 4C8BA 5IQHA 1F3MC 1YXTA 3CEKA 4ERKA 1J7UA 4I5MA 2X8DA 4KBAA 3JVRA 4O1OA 3UO4A 1ZY4A 5DR9A 3Q9YA 1ZAOA 4L53A 5D41A 3MVLA 3HMPA 2PE2A 3ORMA 4TXCA 4G5PA 3KF7A 5KMLA 4M84A 4KIQA 4FTAA 1PYEA 4FI1A 3MY5A 1Y6BA 3N51A 4ZTHA 4BI1A 4O81A 4TYHA 3W10A 3WE4A 3RHKA 3C5UA 2Z02A 4LOPA 3OEFX 3SG9A 3CGFA 5CANA 4DBNA 5HBHA 2O64A 4FNYA 3SW4A 1Q24A 2ITUA 3ORLA 1Q99A 2QOKA 3K5VA 1FOTA 3R1QA 3KFAA 4XNEA 4EBVA 2WMBA 5J79A 4RIXB 2ETRA 2BDFA 3AD4A 3R8ZA 2P2HA 4MEDA 4M13A 4JNWA 5E92A 4ZJJA 3UOJA 4BWKA 5FEQA 3TIZA 4M15A 2Y4PA 3QLFA 3EMGA 3BV2A 3LE6A 3IW5A 2HZNA 4F1TA 2NRUA 4AG8A 4KBKA 4CT1A 3ORIA 1H1RA 2F7ZE 3E8CA 5DT4A 3Q04A 5CEQA 2ZM3A 4O2PA 4TT7A 3TKUA 4FBXA 4MF1A 3RZFA 3UGCA 3UZPA 2CGXA 3G33A 2WTJA 4QNYA 4UWYA 1Z5MA 3FZ1A 4QYHA 4H3QA 5AM7A 4GK4A 2X8IA 5KUPA 3MTLA 3ZRMA 3QXOA 3ZYAA 5FP6A 1OIYA 1MQBA 3NUNA 2G1TA 4YURA 3RI1A 3PRFA 4JDKA 3PJ2A 2UVYA 4U5JA 2CHLA 3ZM4A 2UZVA 1IA9A 3ELJA 1HOWA 3NYVA 1W83A 1ZYDA 2QOFA 4IVAA 2ZB1A 4DN5A 2BIYA 2YM6A 3ZM9A 2UW0A 3F2AA 4YJVA 1CSNA 1REJA 2X9EA 1ZYCA 3OS3A 3QFVA 2XKFA 4FTTA 4O6LA 3GC0A 4OTRA 5IQEA 3CS9A 1APME 1JKTA 2J90A 3QAME 3OWLA 1S9IA 2QONA 3UOKA 4ZSGA 4D2WA 4F9BA 2YISA 2BDJA 3KL8A 3SDJA 4RC4A 3R7IA 4F09A 3R02A 2X7OA 4OR5A 4CD0A 3LKMA 4F6WA 3NUXA 1GZNA 4IM0A 4IC8A 2X81A 3CKXA 4FODA 3NR9A 3MPAA 3I81A 4QTCA 1E9HA 4NT4A 1PMNA 5CT7A 4F1MA 5HNIX 1H1WA 4ID7A 4DGNA 3EQGA 3PPKA 4YLKA 4LRJA 3EQIA 3TKHA 4DFZE 3CE3A 3ZO3A 3QGWA 4R7BA 3BU6A 2BZJA 4OLIA 4BTMA 5HTCA 4FG9A 2V7AA 4EL9A 3V04A 5AA8A 5HG7A 1OGUA 3QRJA 4DYMA 3RHXA 4GCJA 4RX7A 3BZ3A 5CSHA 1YHSA 1XH9A 3EL7A 1H26A 4KIPA 4GVJA 1M52A 5IQAA 2JIVA 4WG5A 4FKTA 3OFMA 3C0IA 4XOYA 3D4QA 5C4KA 4APCA 4GG7A 3ET7A 2VTLA 2WOTA 5CQUA 4CTBA 3GU7A 2WMXA 1OVEA 4FTIA 4RIWA 4UMRA 5CEOA 1JBPE 1FVTA 4PDOA 4X21A 5BNJA 5JSMA 4D4SA 2CKOA 1Q3DA 1W82A 1PXJA 2E9NA 4AOIA 4F9AA 3ZC6A 4E5AX 4Q5HA 3G90X 4TZRA 2C5OA 4CLJA 4GYIA 3QD2B 2C6EA 2C4GA 1WVYA 2C3KA 2EWAA 3DB8A 3HYHA 3DXPA 5FGKA 1PW2A 2GFSA 3W2RA 5M57A 4FOBA 3PXZA 4ZTQA 4I5PA 2R3MA 5CZHA 5AP2A 4KIKA 4A4LA 4BCFA 5TO8A 4NL0A 4FGBA 3W1FA 4P5QA 4CMUA 5HVKA 2YJSA 3ZDUA 3KXNA 3RZBA 1Q8UA 4DLIA 3FPMA 4AN3A 4N57A 2YCQA 4CRSA 1KV2A 3MVHA 3HGKA 4YO4A 3BE9A 1CTPE 5E8WA 5ACBC 5DWRA 3QRKA 2C6LA 4AA5A 2X2KA 4NKAA 3D94A 4AP7A 4QMQA 4D58A 3VAPA 3OWKA 3PA5A 4C2WA 3MBLA 4QO9A 5JKGA 5J1VA 2PUIA 4K8AA 4R3PA 2IW9A 4ZLZA 4JDHA 4HGEA 3QHRA 1YOJA 4YNEA 4LUDA 1W84A 2OFUA 3E5AA 3GEQA 3RALA 3SVVA 5HEZA 3PXRA 4YO6A 1IR3A 2I40A 3F7WA 5ETFA 4BKZA 2X2MA 3NCGA 2G9XA 3TZ8A 3R7UA 1J7IA 1OL1A 1TKIA 4Z55A 3KA0A 5M53A 1Q97A 5LMKC 2F9GA 2VTMA 3NRMA 4XG3A 3PVUA 5ITAA 1PMVA 2OH4A 3DLSA 4DEDA 5J5SA 2VGPA 1T45A 2VTNA 1J1CA 3DCVA 3EL8A 2WB8A 4H3PA 4E6QA 4I1ZA 5CASA 2FYSA 3SKCA 3A4PA 4ZMFA 3WOWA 4FSRA 4C3RA 1H1QA 5AUVA 1PMUA 5BMMA 3JY9A 4AA4A 4FTMA 4EH7A 4AZTA 1NA7A 3LFFA 1RE8A 4EOQA 5JK3A 4RMZA 2IW8A 3BX5A 4TYGA 4E6DA 2OXYA 3SC1A 3ZLYA 3WARA 5IMXA 3LCOA 4I0TA 2C6OA 3GI3A 3FQEA 4O38A 3UIMA 4RJ5A 2UW8A 1U54A 3CY2A 5ACKA 2GFCA 4XH6A 4E7WA 3O8UA 5LVLA 3Q32A 3OBGA 4NIFA 2W4OA 4RC2A 2J6MA 3QRUA 2QOCA 4NTSA 3LCSA 3M2WA 4H36A 4O0RA 4F0FA 3AG9A 2H9VA 4GK3A 3R0TA 3ZBFA 4BBMA 3P78A 3NDMA 4PMTA 4ZAUA 4BR3A 3OG7A 3MPMA 5EI2A 4DGMA 3EHAA 4EYJA 1UWHA 4LRMA 1YI6A 4NM3A 2YA9A 3BBWA 3VQHA 4FG8A 2QOBA 2XF0A 2XJ2A 3NX8A 4KS7A 5DRDA 1OUKA 2RFNA 3K5UA 5FBNC 4BHZA 4EONA 5KKRB 5E9EA 5JZNA 4RVLA 3C4EA 4E1ZA 4DFBA 3H0YA 4GUBA 2WNTA 3H9OA 5AJQA 4G3GA 4N6ZA 4GV1A 3ZSGA 3V3VA 4E73A 1WMKA 3AC5A 4JBQA 3W2SA 3RAKA 3TNQB 4IDTA 3RM7A 5K4JA 4IJPA 2FH9A 3THBA 2A4LA 4BYJA 3HUBA 5JRSA 4F63A 2WXVA 4YJNA 4E4XA 4AOJA 3ZSIA 2OO8X 5L6WL 1IAJA 2JKQA 1URCA 2PZIA 4O7SA 1QPEA 3I5ZA 2XS0A 3VS5A 3BI6A 1BLXA 3FMMA 4I6QA 4BCPA 1JVPP 5AAFA 1Q41A 3CD8A 4MXXA 2C3LA 1W98A 1LR4A 3EN9A 3DGKA 4KSPA 5HIBA 5KE0A 4E3CA 2XZSA 2EXMA 2F49A 4PMMA 3CQWA 4DEAA 2QOOA 1YI4A 3HKOA 3UVQA 2Y8OA 4GU6A 2BFYA 3FZPA 5I5ZA 5DVRA 2GS7A 1U59A 5FXSA 2WTVA 3R7OA 2XB7A 3WF6A 1K9AA 3LMIA 3GOKA 3RCDA 2FUMA 2WEIA 5A4LA 3QWJA 4G6OA 4XLVA 4IHPA 5AV2A 4R8QA 3ZTXA 1R78A 2I0HA 4EWHA 3UP7A 3FMJA 2W5HA 3DDPA 3R8VA 2GTMA 2C5VA 4NZWB 5DG5A 3DFAA 5AP4A 2VWXA 4DG2E 2C47A 3VJOA 1CMKE 4DAWA 2DQ7X 5CVFA 4FKVA 4FEUA 4A07A 2JDTA 2B9HA 4O7WA 4QP4A 3VBVA 4EZ7A 3FWQA 4JX7A 3TDVA 5IQDA 3L8VA 5DOSA 4FV1A 2YCRA 3PIZA 4TW9A 2GTNA 4PNIA 3E8DA 3EFWA 3F5GA 4ITJA 5DFPA 1XR1A 1PXIA 4MXYA 5LMAA 4JAIA 5AMNA 4CSVA 1W7HA 4PP9A 2X6EA 2ZMDA 2A19B 2NO3A 5CALA 5JN2A 2X4FA 2VTAA 5JGDA 5C8MA 2PVHA 3V6SA 1V0PA 1MRUA 3CD3A 3TZ9A 4QMZA 3OHTA 4EK5A 4NFNA 3LLTA 3V6RA 4D4VA 1QCFA 3G9NA 5IU2A 2F2CB 3OC1A 3HP2A 4D1XA 5CSXA 3QQGA 4DGLC 4D5KA 3DXQA 4TY1A 3TL8A 5ANJA 3ZRLA 1K3AA 2VU3A 3I4BA 2J7TA 3LOKA 4RJ6A 3I0QA 4X0MA 2XIZA 1I09A 5FG8A 3FLQA 2ITQA 3QKKA 2J0MB 3G0EA 4O0WA 4OAUC 4E93A 4OBPA 4RFZA 4WG4A 4LQMA 4YC8A 4U3YA 4G1WA 4RIOA 4DEHA 5L8JA 4ANBA 3N4TA 3EN6A 5KBQA 2OIDA 3UG2A 2GNGA 2W7XA 4OGRA 1WBTA 2V7OA 2UW9A 2PVLA 5KMKA 2OH0E 3MTFA 4EH2A 2IZTA 4EQMA 4DC2A 5IUHA 4UN0C 5BX0A 4ITIA 3SD0A 1YXXA 3U9NA 4W9XA 1U4DA 3LPBA 1YW2A 3QBNA 4TYJA 3UOHA 5CEPA 4AW0A 5LMKA 3FSFA 5DT3A 3VBTA 3ZBXA 2JDVA 5L6OA 1PHKA 4LG4A 3FLWA 5CEKA 4EKKA 5BVNA 4OTPA 1PXPA 2X7FA 3VN9A 3DK7A 5CXHA 5IH4A 4HZRA 4JXFA 3K2LA 3DKOA 3BLQA 1H8FA 3QCQA 4B7TA 4F7JA 4FMQA 1QPCA 5FD2A 4CCUA 3QLGA 3SQQA 4IWPA 2V62A 3A60A 5CTPA 2HAKA 3S0OA 4X3FB 2XNNA 3ENHA 3HVCA 3MJ2A 3AMAA 3IONA 1DS5A 5D7VA 4G16A 4YBJA 4FGRA 1OBGA 1OITA 4ZS0A 4RFMA 3ACKA 4BF2A 5L8LA 5AP6A 5ETCA 3BGZA 5AV0A 4CT2A 5FM2A 5IH6A 2BRBA 2YWPA 4BICA 2GQRA 3BLRA 4R78A 4XV1A 1B38A 2R3IA 3OCBA 4A06A 5CF6A 2BDWA 3QQJA 4XG8A 1S9JA 3PWYA 4D4RA 3Q6UA 4IB5A 3U6JA 4QTDA 2HY0A 2YITA 5KMOA 4ZXTA 4QP7A 1OB3A 2PVKA 5CYIA 4B0GA 3DNEA 3COIA 5JRQA 4I0RA 2EB3A 4F70A 4D2SA 3KXZA 2H96A 3JS2A 2F57A 4EKLA 5HO8A 3PG3A 1A48A 5I9XA 1SVEA 4EK3A 1Y8GA 3TV7A 4MQ2A 1H0VA 4JQ7A 5HGIA 2GHMA 3VF9A 4AACA 4DINA 2HWPA 5FXQA 2O65A 2H6DA 3PG1A 4ALVA 5F1ZA 2X4ZA 2ITVA 4WSYA 5CX9A 2Y4IB 3LFEA 4X6QC 1XKKA 3MA6A 5CU6A 3ZRKA 2XEYA 4GFMA 4O0SA 3L9PA 2ZB0A 4FV2A 4XG9A 4ZJIA 1KV1A 3EQRA 4RIYA 3F2RA 4IWOA 3PYYA 3HRFA 2VGOA 3NUSA 2OJFE 4GSBA 2XK3A 3C4WA 4P90A 4FG7A 1TQIA 3MN3A 4W8EA 4WSQA 2PUPA 3RM6A 4ZMEA 2BAJA 3QA8A 1KUTA 2X0GA 4ZZMA 2I0YA 1I44A 4C34A 3FYKX 4LGHA 2E9OA 5CY3A 4OBQA 2ONLC 5L6PA 5JFWA 4FIHA 3MFRA 4L7SA 3U87A 5BUEA 3KN6A 3KMUA 3QX4A 1OL7A 4I3ZA 2ZM1A 4AS0A 3ZU7A 4CZTA 1E1XA 4F4PA 1JPAA 3PPZA 4HOKA 4V04A 4MXCA 2XCKA 2I6LA 4B9DA 5J9LA 3F5XA 4K11A 3EOCA 5M08A 4GKIA 3DTWA 4HZSA 2NRYA 3R8MA 4XLIA 4WA9A 4EC8A 3C50A 4DLJA 3R22A 1OPJA 2VO7A 5D1JA 3UYTA 4DGOA 3KB7A 2OXXA 2VO0A 4MVFA 2VNYA 2OKRA 3NYXA 5EM6A 2JDOA 4BWPA 4LL0A 5J9YA 3D0EA 2O63A 2XIYA 3UE4A 3CPCA 3UQFA 5I9UA 4O7LA 3HA8A 2ITTA 4GRBA 4A9RA 5BVEA 4XG2A 1YOLA 2H34A 3RWPA 3DFCB 4JR7A 5DHJA 4MWHA 3RTPA 4MXAA 4M67A 2RG6A 3QCSA 4S2ZA 5J95A 4AF3A 4Z7HA 4L3JA 3VUKA 2B1PA 3Q4ZA 1XH5A 2YLFA 5HG8A 4D0WA 5IDPA 5KNJA 2WQMA 3C51A 4W4WA 2RG5A 3E64A 2WMTA 4FT7A 3CTQA 2B4SB 3DQXA 3LAUA 4USDA 2Y6MA 4WRSA 5CAPA 3T3UA 1IRKA 3IDCA 2B0QA 3GNIB 4MF0A 2WGJA 4Z16A 3FY0A 4ZTMA 4CFWA 3L8SA 3R1SA 5AIRA 5HLWA 1MUOA 2WMAA 2XRWA 3DJ6A 3DKCA 4MNFA 5DNRA 4YJTA 4MXZA 4RX8A 5FTQA 5H2UA 5CU0A 4M66A 5JFVA 4G3EA 5H8BA 4CFVA 3MGYA 4IVDA 5E8UA 4GT3A 3WF7A 3CIKA 4O0XA 2YAAA 4PV0A 2QVSE 3VC4A 3IG7A 3KXHA 3QYWA 1RJBA 2W1ZA 3GU4A 3NWWA 3V01A 2Q0BA 2QCSA 3Q9ZA 4RC3A 1PXMA 4KIOA 4R5YA 4D2PA 4XP3A 1ZYLA 4WHZA 4QP6A 1Q3WA 3LFNA 4IQ6A 3E88A 2ZMCA 4LV5A 4M69B 2PK9A 2P3GX 3KF4A 5J7BA 2QKRA 4BDBA 3QTUA 4S30A 1OPLA 3ZUUA 3AC8A 4QNAA 1ZLTA 3RAWA 3VS7A 5AP1A 4EOIA 5BVOA 3MFSA 1DI8A 3H9FA 4TYIA 4YBKA 4YLJA 2R0IA 3F6XA 3TCPA 2AC3A 2XNGA 1XWSA 3IDPA 3OVVA 5EOLA 2CGVA 4JR3A 2YZLA 3HRBA 5GZ8A 4AE6A 5IH5A 1XBCA 3UJGA 3QXPA 3VS3A 2AYPA 3ZO1A 2HYYA 5ANEA 2XKEA 3R9NA 2W0JA 4IAYA 3C0GA 4WBBB 3ALOA 3TKIA 4FKOA 3BPRA 3VS1A 3VUHA 2QR8A 3GFEA 3I1AA 3BYMA 5D9HA 4FKWA 4L46A 3ZO4A 3C0HA 3FL4A 5HD4A 4F6SA 3GVUA 4WO5A 4O84A 4QP3A 2QC6A 4C4GA 3NW5A 3QC4A 3C4XA 3AOXA 3F82A 5KMNA 2VX0A 3EKKA 3LFCA 3AGMA 4JIKA 4FTJA 3MDYA 1KE9A 4EZ3A 4J8MA 3TNPC 3T9IA 3AC1A 5HIEA 3IS5A 1PXLA 2PULA 2JKMA 3NNWA 5HE1A 3C4FA 2BHHA 2YCFA 4ONAA 4XEYA 5JMSA 3P9JA 3KGAA 3OXZA 5AUUA 5KCVA 4JOAA 3ROCA 3TDWA 3OZ6A 3NW6A 5AR7A 3VULA 4I4EA 3EKNA 3MFTA 3NIZA 3RP9A 4BCJA 4G17A 4QMNA 3JPVA 1M2PA 4U79A 5B0XA 3QTRA 4C36A 3Q5IA 2BFXA 2F7EE 4IE9A 4IX4A 3R01A 3ZHPC 3VS2A 4C4JA 2BMCA 2PU8A 3R04A 4CQEA 4ZS4A 2WEVA 4OUCA 2VTJA 4ZSLA 4DFUA 4U45A 4I24A 3KN5A 2IZSA 4XV2A 4Y46A 4BIDA 3KRLA 3AMYA 4FEQA 3QA0A 4IAIA 3LXLA 2W1FA 3FLZA 5K4IA 2OXDA 4IM3A 3G9LX 4KABA 4ANQA 1IAHA 4TNBA 3QL8A 1NY3A 2ONLA 4G3DA 3QCXA 1KOBA 4G2FA 4FKSA 4BDHA 5IA3A 3QQKA 5HTBA 2IVUA 4AX8A 1KE6A 4EEVA 3M1SA 4CG8A 3OD6X 3F9NA 2J4ZA 1NVRA 4RWKA 5AP0A 3DXNA 5AUZA 3O96A 4KAOA 5BQ0A 3RK9A 2KTYA 3R00A 2P0CA 4M97A 3LQ8A 4IADA 1M14A 3OT3A 5H3QA 3G6HA 3QUEA 4ZEGA 2A1AB 3DJ7A 4Y73A 3EQBA 3P1AA 1KE8A 3OTVA 5M55A 5K5XA 4MBLA 4W9WA 3VW6A 3ZCLA 4NK9A 2WELA 3DK6A 3FMKA 3F5PA 4FYNA 4II5A 3QUPA 3R2YA 4WNMA 4E8AA 3FQSA 3W2OA 2R3KA 4WUAA 4U8ZA 4ERWA 4I4FA 4BDCA 4FYOA 4UEUA 4R77A 2BRMA 2W96B 2YJRA 5DE2A 5TR6A 4FR4A 4AW2A 5EYDA 5HTIA 3SA0A 4FZ6A 4F0IA 4O1PA 2GDOA 3E93A 2VUWA 3MVMA 4GKHA 4OAVB 4JJRA 2XKCA 4QMMA 3D15A 1ZZ2A 5IG1A 3WZEA 3LJ2A 5HCYA 3ZONA 4EOPA 3O0GA 4EHEA 5IA1A 1J7LA 5LMBA 3VUDA 3WZDA 2B54A 1UU8A 5CT0A 2EXCX 3RPSA 4V01A 3NNXA 4ZZNA 5GJGA 2R7IA 2EB2A 2BAQA 1FMKA 2B55A 2WQNA 4S32A 4CZYB 4C35A 3ZUVA 4ASZA 2VTSA 3UNJA 1XH6A 2FB8A 2G2HA 2BZHB 3D9VA 4QTAA 4CVAA 3E3PA 4KBCA 3OEZA 4JIAA 3R8LA 2BRNA 1ZWSA 3AC2A 5CEIA 5GZAA 5JGBA 4ACDA 3AMBA 4WUNA 3NZ0A 2Z7QA 3ZFXA 3PY1A 3HLLA 2PVFA 4YUQA 2ZAZA 3Q9WA 1V1KA 3VBQA 4RX5A 2GNJA 1OKWA 3BGQA 2XNBA 3WZUA 2G2IA 3I6UA 5A54A 1XO2B 3U6HA 3LIJA 4FV9A 1YXSA 2VWVA 3I79A 3LCDA 3BYOA 3GUBA 3FLNC 3LZBA 5EHYA 2PMLX 4HCTA 3U4UA 4BCGA 4EK8A 1UKHA 2OFVA 3R7YA 1WCCA 3A7JA 1XH7A 3KK8A 5HVYA 5HD7A 3VRZA 2R3HA 3SRVA 4FKQA 4J53A 4BCIA 5BYYA 3KXGA 1YDSE 3KVWA 4U44A 2EUFB 4MNEA 4JRVA 2IZRA 2XJ0A 3A62A 4EOLA 4FK6A 4Z7GA 5BUIA 3O2MA 2HZ4A 2W1GA 4OTDA 5EW9A 4EHGA 5J8IA 5CU3A 3RINA 5C1QB 1IEPA 4HNIA 3B8RA 3POZA 3QQLA 3V5WA 1CKPA 1H07A 2LAVA 3VUGA 4RWIA 1PMEA 3UIBA 3VS0A 4ZY4A 1PKGA 4BN1A 4UXQA 4J8NA 4KNBA 3FEGA 3R6XA 4K2RA 2QD9A 5AR2A 4FNWA 3R7VA 3GCUA 3JXWA 2GNLA 2QHNA 3DZQA 4LFIA 3UODA 2J51A 3V5PA 3FI4A 3PJ1A 4CMTA 3EN7A 2RKUA 4DFLA 5CZIA 2CKPA 3FMLA 3C1XA 5CAQA 4L6QA 4ZSJA 4BKJA 3ZDIA 5AAEA 2EXEA 4C4IA 3GP0A 4C59A 2W1CA 2CGUA 4FK3A 2VN9A 3G6GA 1YRPA 1PXNA 2PWLA 3OWPA 3TG1A 4C38A 4FTQA 2NNWB 3R9RA 5GIOE 4QP8A 4YJRA 2VTHA 4YTIA 4AZFA 2YIXA 4ZK5A 1V0BA 2GNHA 3OBJA 5IISA 4U81A 1GY3A 3ERKA 4CTCA 5E8TA 4FNZA 1XH4A 1XJDA 4QMLA 4X2NA 5D10A 4BCMA 3C4CA 1U5RA 2E9UA 2QI8A 3BHYA 3QQUA 1UU7A 2OBJA 5EI6A 4IB0A 2BUJA 4BI2A 2GCDA 5JQ8A 2C69A 4ZTNA 4ENYA 2C0OA 4JAJA 3CR0A 3JYAA 5CAUA 3N4UA 1FGKA 3FJQE 3GU6A 4KS8A 4PL5A 3AT2A 1HCLA 3VW8A 3VWAA 3ZO2A 4QMXA 4NM0A 3DAJA 4EJNA 4USFA 3JR1A 3BHTA 4I20A 2X1NA 3O50A 1O6LA 2J2IB 4I23A 4CNHA 1SZMA 2WMSA 3HV5A 2FSMX 5ETIA 2PVNA 4DG3E 2YN8A 4BZNA 3KRWA 4V0GB 3PXYA 2KULA 4F65A 4GT5A 4RT7A 5T6KA 2HZIA 3GCSA 5HCZA 4GFGA 5HO6A 1P4FA 3AQVA 5D12A 3GQLA 4JQ8A 2EVAA 1NW1A 5DPVA 3NLBA 2G01A 3QTIA 5M4FA 2E9VA 2UZBA 4MKCA 4FKJA 3BU5A 4AFEA 1L8TA 4Y72A 4BVUA 2R3PA 4D2RA 4AW1A 2PMIA 2WIHA 4FSTA 2YCSA 4FTCA 5FM3A 2XCHA 4KWPA 4HYSA 2FSOX 4WT6A 3BV3A 3ZH8A 5GINE 3MY1A 5E1SA 5LCJA 4OTWA 2HW7A 4Y83A 2ZV7A 4PX6A 4FL3A 1FGIA 2C5YA 2YACA 3QZFA 2YM7A 4CFUA 5ICPA 4RVMA 2YM8A 2VWYA 2WMRA 4ACHA 1VZOA 4R7IA 4MBJA 5LVNA 3VF8A 1H01A 5HLPA 2QLQA 2QG7A 1J1BA 4ZSAA 3EQDA 3OF0A 2ITYA 3I60A 3PA4A 4RA5A 5C01A 4D2TA 2W9ZB 1H1PA 2OF2A 3PY3A 4X3JA 3QF9A 5CF4A 3DDQA 2FSTX 1UU3A 4RIYB 3TXOA 2CPKE 2C3IB 3E63A 3RNIA 4P7EA 1Z9XA 5T3QA 4ITHA 5EDRA 5FEEA 4A7CA 1YKRA 1ZRZA 4RBLA 5ANGA 4KB8A 3O8PA 3U55A 5BYLA 4CXAA 5A6OA 5AP7A 4MD7E 2W99B 4G9CA 4NCTC 4K33A 2O3PA 2UW3A 3UPZA 4MQ1A 1JWHA 2RSVA 4QMTA 3VHEA 3MIYA 3ZXTA 3IECA 4UMUA 4AGUA 3CJGA 4IWQA 4FZFB 2PL0A 4CKIA 4HGSA 2RF9A 3PUPA 3TNWA 4FV0A 2Q0NA 4KINA 5TOZA 3F3WA 5CU4A 5F94A 4FEWA 5M44A 2W1EA 2ZV9A 5C9CA 1TQMA 1YHWA 5HVJA 3OT8A 3G2FA 3CBLA 4ANSA 3TI1A 4ANOA 4GIHA 4ZLYA 3MIAA 3QUDA 1GAGA 3UTOA 5E8XA 4FKGA 5I4NA 3NNVA 3ODZX 3EFLA 1RQQA 4YSJA 3UQCA 2X9FA 1Z57A 4F0GA 3VBYA 1BL6A 4MBIA 3V5QA 5L2QA 4A9SA 2OLCA 3HAVA 4BDAA 3UZRA 3HL7A 4ZY5A 3LXNA 5F4NA 5HNBA 2PUNA 4S33A 5DEYA 5LXMA 2BKKA 3E62A 4AZEA 1KOAA 3C5IA 2C1AA 3L8PA 3ACJA 5AWMA 2AUHA 3RPOA 2XK6A 3ORNA 5CQWA 1MQ4A 4YPSA 1JOWB 5DA3A 4RIXA 4CFMA 4F64A 3Q96A 3U9CA 2WTDA 4IZYA 4K9YA 3OW4A 1FPUA 3FC2A 4R5SA 4DH8A 1AGWA 4QQCA 2OF4A 1Q8WA 5DLSA 5L8KA 3R30A 4M3QA 3QC9A 3W16A 3QKLA 4ZOGA 5IF1A 4XV3A 4PMPA 4FTNA 2XNOA 1Y8YA 3MW1A 4CZUA 2W1HA 3K3IA 4U80A 3TIYA 4DTAA 1WBNA 3M42A 2OZAA 4EK6A 2I0EA 3V5TA 2YAKA 3DT1A 2BILB 2J50A 2BVAA 4ZY6A 2VTIA 2LGCA 2XYUA 3BWJA 3L9NA 3NVKI 1OKVA 4Y5QA 3BGPA 3R9DA 4D2VA 5BYZA 1NT2A 3FUPA 2IZUA 2JD5A 1JKKA 3HMMA 1LP4A 4KKHA 4H1JA 3ETAA 3JUHA 5E90A 3MY0A 5EFQA 4TPTA 4YJPA 3SV0A 4O27B 2WPAA 4LMUA 4HYHA 4QMOA 3ORTA 1ZOEA 3COKA 3LFDA 3SG8A 4FL2A 2BAKA 3RKBA 4ASDA 3RPYA 2UZWE 2IW6A 1YDRE 3GXLA 3AT4A 3R7GA 1ZYJA 3O17A 2IVVA 2ERKA 2WTKB 5H8GA 3IOKA 5AX3A 4ZZOA 5M51A 4GH2A 3T8OA 5LVMA 3TUBA 1KE7A 3PE1A 4HPUE 4KSQA 5KHXA 4I0SA 3EH9A 3IW7A 3I7CA 4XG6A 2F7XE 2R3FA 4HYIA 1URWA 4KRCA 4LOOA 4HGTA 2PZYA 3QTWA 2JDRA 3P5KA 1DAYA 2QODA 5EQPA 5IQFA 3ZS5A 4GIIA 2JBOA 4QMPA 2HZ0A 5AA9A 3EN4A 4IX5A 5GJDA 3LLAA 4I41A 3Q4CA 4M14A 4I92A 4J71A 4N6YA 1R39A 2VWIA 1BYGA 3CTHA 2QOHA 4BDDA 4CQGA 4D55A 3O7LB 3QKMA 4IW0A 4U40A 4JS8A 4IFGA 4FC0A 3HV7A 3H30A 2ITNA 4O2ZA 3PDTA 4FKRA 3S3IA 2FVDA 1M7QA 2PVYA 3IO7A 4WBOA 2C6DA 4O22A 4CG9A 4IAZA 2YDJA 2JFLA 4FIGA 5EKNA 4FKLA 5K3YA 5DN3A 4BZOA 4IJ9A 4N0SA 4BRXA 3ANQA 3GB2A 3PSBA 4FOCA 1WAKA 4L3PA 1NVSA 2P4IA 3OXTA 4KKEA 1Q61A 2DUVA 3D5WA 5BVDA 2UW7A 4X2GA 3G51A 5GJFA 4PF4A 4APPA 3ORKA 4W8DA 3FAAA 1H4LA 1PXOA 3H10A 3MJ1A 5HCXA 2BTRA 3CKWA 3M11A 4EC9A 5AR4A 1YQJA 3GGFA 5EQEA 3RNYA 5EDQA 2VV9A 1SNXA 3F7ZA 4BCNA 3E87A 5IQGA 5AV3A 3KULB 2OG8A 3A7FA 2Z8CA 2IO6A 3OCSA 1CKJA 3ORZA 4CYJA 4BWXA 4W4VA 3B2WA 4XX9A 5IQCA 2ZVAA 4LM5A 4KD1A 3F3TA 3A61A 1MRYA 4AUAA 3V8TA 3BQCA 2OI4X 3UMWA 3NIEA 4K6ZA 2ZV8A 4C4HA 3SGCA 3ZZWA 2GNIA 2HELA 4RG0A 3U54A 4MHAA 3NPCA 5HE0A 1JSVA 1OI9A 4YJQA 3WILA 4FSYA 4GU9A 2HCKA 2CNVA 1CKIA 2A0CX 3L1SA 3EQHA 3QU0A 3LMGA 5D7AA 1OM1A 4E5BA 1P2AA 4EBWA 2B9IA 4NCTA 5BUJA 5GIPE 1JAMA 3LFBA 2F4JA 4BYIA 4U3ZA 5AIKA 5M4UA 5HBEA 4FSMA 2P2IA 2XKDA 3DU8A 5I9YA 3Q2JA 1Q8TA 2CJMA 4TYHB 4F9WA 4UWCA 1IASA 5EH0A 3CCNA 2XK4A 4DEIA 5L2SA 3HMNA 2HW6A 3PZEA 4TKSA 5I3RA 4LL5A 4DH7A 1PF8A 4JBOA 3ZSHA 3FYJX 4BB4A 2IVTA 4QP2A 4FKIA 4O86A 4FSUA 2PMOX 1ZARA 1FQ1B 1GIHA 4EH5A 5F20A 1GJOA 5CI7A 4G3CA 5CNOA 5HG9A 1OIQA 3QQHA 1REKA 2XRUA 1UKIA 4RVTA 3F66A 1SNUA 3PP0A 1GOLA 2Y0AA 1OUYA 4ANLA 4QQ5A 4O21A 4ACMA 4D0XA 3U8WA 3RBWA 3COMA 3K54A 3KRXA 3ZLWA 3GBZA 3BE2A 1M2QA 2JGZA 3DK3A 4OTIA 2FSLX 5C8KA 3MESA 1SVHA 4OTQA 2HOGA 3DTCA 4U43A 3D7TA 3PRIA 2WQEA 4PTCA 4V05A 4MAOA 4E5WA 4I5CA 4YP8A 5IKWA 2QO2A 4BDKA 5TT7A 4GFOA 4NU1A 3NSZA 4FT0A 4CYIA 3S95A 5FEDA 4JI9A 3LXPA 3KXXA 5TKDA 3SAYA 1YOMA 3WF8A 3A7IA 3F3VA 3V51A 1JSTA 4TWPA 3FMDA 4FIEA 3VUMA 4CMOA 4XRJA 4TL0A 1Y91A 2BALA 3EQCA 1H28A 2VTPA 2QG5A 4JRNA 5G6VA 4PDYA 3MYGA 3GC7A 4XP0A 4GUEA 3TEIA 4XG4A 3WIGA 5AFVA 2R4BA 3VO3A 1J3HA 4PPBA 5K5NA 1O6KA 3NEWA 3DJ5A 4HVGA 3P86A 4IH8A 1BI8A 2JDSA 1IG1A 3Q2MA 3RGFA 3SHEA 4C7TA 3FI8A 5AR3A 4LRKA 2JIUA 4DEEA 4U7ZA 4Q2AA 4NKSA 3TV6A 2C6KA 2Y6OA 4I94A 1H1SA 5C27A 3E7OA 3VS6A 3BBTB 3OOGA 1VEBA 2XM8A 4CV9A 3PVBA 5IQIA 3T9TA 5E91A 3ZMMA 4DFXE 5HX8A 2XBAA 2Y4IC 5M4IA 4WNPA 4NW5A 5IA0A 2Z7RA 4OTGA 4AT5A 2NP8A 4GW8A 3OCTA 4IM2A 4Q9ZA 3EQFA 5DMZA 2C1BA 2QO7A 2CLQA 2Z2WA 4EUTA 1H08A 4K18A 4TTHB 4X6RA 3HDMA 3UIUA 1JQHA 4E6AA 1DI9A 1SYKA 5HZNA 1G3NA 2QLUA 3Q5ZA 5H8EA 4QQTA 2CDZA 2VWUA 4MNEB 4J98A 4FV6A 5BVWA 3FI3A 3R63A 4YNOA 4UX9A 3I0OA 1SM2A 3ORXA 1OKYA 2G2FA 2OIBA 3EYHA 1OL5A 3QHWA 4NFMA 4RWLA 3EIDA 3Q60A 5HOAA 2JLDA 2WMWA 4XBUA 4YGAA 3QCYA 4W4XA 4UMTA 3P08A 3TZMA 3W18A 3WE8A 2J5EA 4GJ3A 2ESMA 3MB7A 1KWPA 4EORA 4F1OA 2B9FA 3S1HA 1K2PA 3ZZEA 1AD5A 3IKAA 2YM4A 4Y95A 3FKOA 4HVSA 4TRLA 3W8LA 2QU5A 4QMSA 2JKOA 3FZOA 4FUXA 4O7TA 1LPUA 5I9VA 4G6LA 3IPHA 4RIWB 3SXRA 4GG5A 4J7BA 4NW6A 4R1YA 4TWNA 4DHFA 4UMQA 2P55A 4PQNA 2JC6A 2X7GA 3BHVA 3FMHA 4OT5A 3W2QA 5IQBA 4I6BA 3V5JA 3ROYA 3ZLSA 2Z60A 2UZEA 4PMSA 2HXLA 3RK7A 5CSVA 3FBVA 2E9PA 4RA4A 2PY3A 4QP1A 5AUWA 4A4XA 2AC5A 3KVXA 4A4OA 2WKMA 2BRHA 3EFJA 3IW4A 4QD6A 3FZSA 1IA8A 2VWWA 2JBPA 4KIKB 5CSWA 3UC4A 4C33A 3UZTA 4GL9A 2P33A 4U42A 4DITA 4I5HA 1H27A 4PL4A 3VUIA 2R3GA 2YIRA 3GENA 4YZCA 5EI8A 3FL5A 3S4QA 4XBRA 2GSFA 2HK5A 2I0VA 3VQUA 5HE3A 4AQCA 5CVHA 3Q9XA 3ZC5A 1ZMWA 4JG8A 2RFEA 1JSUA 1R1WA 2JAMA 4YZBA 4C37A 3LM0A 3S2PA 3TV4A 5CEMA 1OL2A 4NWMA 5ANOA 1Y6AA 2C68A 3P7CA 3BQRA 2REIA 2R3RA 4LV8A 3AD5A 4M0ZA 4Q9SA 3CTJA 3DZOA 3Q4UA 4AGCA 5A4QA 3PJ8A 4D28A 5HQ0A 1WBOA 4HJOA 2WAJA 4JX3A 4WIHA 3ZEWA 4FTKA 5IZFA 2CNUA 4DTBA 3G0FA 5CU2A 5FDXA 2J9MA 3BIZA 4BDFA 5FRIA 4Q5EA 5DIAA 5E8YA 4L01A 1GNGA 4EK4A 2HY81 2PUUA 3PA3A 4BFMA 2B9JA 2ITPA 4FSNA 1CDKA 5HI2A 4YZMA 4L44A 1Q8ZA 1PYXA 3PXFA 2W05A 5JFXA 3UO5A 2JIIA 3RJCA 3PLSA 3UQGA 3IOPA 3G15A 4AGWA 2VNWA 3QD3A 3N9XA 4XS2A 3TNHA 2C5XA 3UG1A 3BKBA 4D1SA 3WF9A 4L43A 2CNQA 3TACA 3KQ7A 3REPA 5K0KA 4HPTE 3QZGA 2O2UA 3SXFA 5G1XA 3VRYA 3I7BA 1DAWA 1NXKA 3KXMA 3MPTA 3R8UA 5AP5A 3H0ZA 3F88A 1U54B 5E8SA 4QTEA 2RFSA 3IW8A 4IMYA 4BTFA 2O0UA 4NIFB 1GIJA 4FTUA 4BC6A 1U46A 3VNTA 3CJFA 2C3JA 4YJOA 2QOIA 2QNJA 1QMZA 1B6CB 1W8CA 4U6RA 2GS6A 4FE2A 1M2RA 3L8XA 5AX9A 3RWQA 2OIQA 4ZJVA 2VRXA 4U97A 3UNZA 1ND4A 1R3CA 4NJDA 2QOLA 2SRCA 3PP1A 4IBMA 3WZJA 3PLAE 3SXSA 2UVZA 4PY1A 5M07A 3II5A 1XHAA 4IX3A 4RJ3A 3DA6A 4O96A 3ENMA 3V8WA 3OY3A 2ETKA 2QR7A 4J52A 4HCVA 3F3ZA 4FVPA 4I6HA 4QOXA 4TNDA 2RL5A 4WNOA 3R8PA 4ALWA 5ANDA 4BI0A 3DQWA 2J0JA 4I93A 2WU6A 2HXQA 3NUUA 4YMJA 3U4WA 2CLXA 4O83A 5JQ5A 2RFDA 5E1EA 1ZXEA 4BGHA 4FZAB 5HIDA 4JVGA 5TF9A 3P23A 1U5QA 2PE1A 3EJ1A 3E3BX 3HNGA 2A27A 4BDJA 2W4JA 5AM6A 4AWIA 3GCPA 2YDIA 3BEGA 4TYEA 4CFXA 4I6FA 4WNKA 5HHWA 4O7RA 2PMNX 1BUHA 3HEGA 4PNKA 1VR2A 3FQHA 3ITZA 3FHRA 2R3JA 3NGAA 4A9UA 2W17A 4FEXA 3CQEA 3HDNA 1Q5KA 4RRVA 4D4YA 3VJNA 3NUYA 1PY5A 3SOCA 2O5KA 3FZRA 3QZHA 2BROA 4DA5A 4EOKA 4LGGA 4PPCA 3JVSA 5DRBA 5FQDC 2UZLA 1WBSA 2XVDA 4CFNA 2BZKB 4H05A 4M68A 4AU8A 4RLKA 5M4CA 3KY2A 4B8MA 3HMOA 5J5TA 5D11A 3PXKA 4FNXA 3DBQA 3CXWA 3BYUA 2JAVA 2OZAB 4TWOA 4EH8A 3DPKA 3BEAA 3GOPA 4NH1A 2E2BA 4XHKB 3RAIA 5DR2A 3RAHA 4BCHA 4YTCA 2BCJA 3LW0A 4EOJA 2W9FB 4GT4A 2GU8A 4B6LA 5TE0A 5BVFA 5IDNA 3LQ3A 4C4FA 3DKFA 2OJJA 5FTOA 1BI7A 3OY1A 4FA2A 3LMHA 4F99A 3HZTA 4FF8A 5JEBA 4PWNA 2H8HA 4MH7A 3O8TA 3E7VA 3LVPA 4UBAA 5E7RA 2A2AA 3RCJA 4PDPA 1YWVA 5EDPA 4C4EA 4HVHA 4RZWA 2PPQA 3FLYA 3JY0A 2R3QA 2XK8A 1WBPA 2FA2A 2YWVA 4OBOA 3TJDA 2WFYA 5E8ZA 2W5BA 5ANIA 4ALUA 4EH4A 2C0TA 2G15A 3EQPA 3FC1X 3R71A 4EOSA 5IPJA 1OKZA 4GVAA 4QYGA 3W33A 2HENA 2QQ7A 2BKZA 3ULIA 1JKSA 5CSPA 5HO7A 4FIIA 2C5NA 4C62A 3VIDA 3MVJA 3R73A 2I1MA 2OZOA 3D5VA 5J87A 3UVPA 5JFSA 4YPDA 2X39A 4YSMA 4NYEA 1ZMUA 2QURA 3H9RA 5GNKA 4DF3A 2UVXA 4F7NA 5HU3A 3CPBA 3QYZA 2CCHA 5HLNA 4K0YA 4ANMA 4ARKA 4AZSA 1WBWA 4IEBA 2Y7JA 3A99A 3FLSA 3HV6A 2IVSA 4XRLA 3LJ1A 1ZOHA 3FDNA 5I9WA 3BLHA 3WI6A 4O6EA 2PZ5A 2ITOA 3ZFYA 2ZV2A 4Z9LA 1Y57A 4IVCA 5CWZA 3R83A 4F9CA 4FEVA 2WHBA 2IPXA 1B39A 3GC9A 3O51A 2YIQA 1ERKA 3B8QA 3TWJA 3O71A 3MS9A 3A8XA 1WVXA 2VTTA 1YHVA 4DGGA 5IA2A 4X2KA 5K0XA 1G8SA 3L9LA 3IDBA 3DKGA 2FO0A 3MB6A 5LWNA 1O9UA 5BVKA 2VWBA 1Q62A 3FKLA 3POOA 5FDPA 2OK1A 3U6IA 5A4TA 3GU8A 4RX9A 2JKKA 2UW6A 2WQBA 3PVWA 4C58A 2V22A 5I9ZA 2ACXA 3KKVA 1BL7A 3VBWA 4EHZA 2W1DA 5AUTA 5HX6A 5KBRA 2J5FA 3C13A 4AT4A 3AC3A 4XOZA 4H3BA 2OWBA 1QPJA 1E1VA 3CQUA 4ACCA 3DLZA 4CKJA 4LI5A 4DCEA 3OW3A 3PFQA 1UWJA 2UW4A 4M69A 4HVIA 4QPSA 3PJ3A 4L67A 4ZSEA 3NAXA 3LQ5A 5L2TA 2VD5A 1OECA 2WMQA 4RQKA 5EYKA 3A2CA 1FBNA 3AT3A 1LUFA 4FSQA 3D2KA 4DEBA 2VTOA 4FZDB 4EOMA 5KZ0A 1YI3A 4AE9A 4BY9E 4AZWA 5M06A 4C02A 5ETAA 3VUTA 4G5JA 4HNFA 4JG7A 4R6VA 4PP7A 4B99A 2R3NA 3IQ7A 2CCIA 5FBOA 2CMWA 3F3UA 5IA4A 2IWIA 2ZM4A 4FV4A 3KEXA 1DM2A 5LCKA 5DBXA 3RK5A 4DH5A 5IUGA 2WU7A 3FKNA 5B2MA 1A9UA 2PZPA 2YABA 3P7AA 2UUEA 2XK7A 5JT2A 3UDBA 4FV8A 1H25A 2WTCA 2YIYA 2YM3A 2XBJA 4G31A 4MYGA 3SX9A 4AFJA 4EH3A 4H39A 5EM8A 5LVPA 4FV3A 5L2IA 4FV7A 4QRCA 4S34A 5I0BA 2V55A 3D7ZA 4DFNA 2XP2A 5BPYA 4QMUA 3BRBA 3PIXA 1H0WA 3WZKA 5CAVA 2WO6A 3GQIA 4E4LA 4HVDA 2ETMA 4BBFA 5KHWA 3KMWA 2XA4A 4XYFA 5AUYA 4HW7A 4E4MA 4EI4A 4JLCA 2OICA 4WG3A 4XJ0A 4FIJA 4GMYA 3PSCA 4EUUA 4C2VA 5LJJA 4IANA 2CKQA 4L00A 3GC8A 2R3OA 4YC6A 3PXQA 3CP9A 1FVVA 4L8MA 3D7TB 4O7VA 1MRVA 3A8WA 4KA3A 2GHLA 1UNGA 4ZTLA 4GK2A 2I7QA 1X8BA 1YVJA 3C9WA 2BPMA 4R3CA 5J1WA 4BDGA 2W06A 5A4EA 3ANRA 3ODYX 3N4VA 3NUAA 3R7EA 5IMEA 1OIRA 3R21A 3A7HA 1WZYA 1SVGA 2IG7A 4FVQA 4DT8A 1NVQA 3WYXA 3FY2A 3QRIA 4P2KA 3OP5A 4QT1A 4HCUA 2B52A 2VTQA 2JFMA 3DAKA 4HYUA 1PKDA 3TNIA 3TM0A 4IZ5A 4L3LA 4LGDA 4NEUA 3KREA 4EQUA 2ZYBA 5EOBA 2XJ1A 2UV2A 2YZAA 4EH9A 2VO3A 4WOVA 4ZIMA 4WKQA 5DH3A 3UOLA 1FVRA 3ZUTA 4O0TA 2PHKA 3UPXA 2J0LA 3MH3A 3IGOA 4FV5A 3IW6A 1O6YA 2WMVA 3MH1A 4Z3VA 2V5QA 3VHKA 4BBEA 4EHVA 5AAGA 4JL9A 3BHHA 1UVRA 2PSQA 5FTGA 4F08A 1GIIA 2VX3A 3GCQA 4O91A 3WF5A 4WRGA 3HV3A 3DNDA 3UVRA 1ATPE 4P5ZA 3VS4A 2PE0A 1P4OA 2VX1A 5CXZA 3I5NA 4Y5HA 3FXZA 1ZMVA 1M17A 2Y9QA 4GEOA 5FXRA 3P0MA 4IX6A 4M12A 4C3PA 4MD8E 3W2CA 4IACA 4CCBA 3EB0A 5M56A 3UNKA 5AUXA 4C3FA 5FWKK 2OJIA 2R5TA 3HRCA 4K1BA 4YZDA 3ZEPA 4LOQA 4AW5A 5B2LA 4DTKA 2J0KA 4M0YA 4WD5A 3RMFA 3UP2A 4DCAA 5KKRC 2VAGA 3UMXA 3D5XA 4YU2A 4QMVA 4G6NA 2W1IA 4D9UA 2GHGA 1OPKA 2C0IA 2VZ6A 5LVOA 1PRYA 3QD4A 4W4YA 5A9UA 4G3FA 3R28A 5GZ9A 5AV1A 1OIUA 4IAFA 4BHNA 1XH8A 4IWDA 3CGOA 4MWIA 4OTHA 4BZDA 5HE2A 3OMVA 4E6CA 4AN2A 3LJ0A 3QALE 3TTJA 1XBAA 4BL1A 4QYFA 4YZNA 3HX4A 2UW5A 3ZFMA 4F7LA 4PPAA 4KUJA 3Q4TA 5F9EA 4DT9A 3FSKA 3PJCA 3Q3BA 4FSZA 4IZ7A 1SMHA 1R0PA 5DEWA 1VYZA 4I22A 3FXXA 2Z7LA 2X8EA 4L45A 3FMNA 3OCGA 4YZ9A 2C6TA 2GPHA 3PWDA 4PUZA 4QYEA 4F6UA 4DBXA 3L9MA 4JDIA 4FICA 5A4CA 3QQFA 4IZAA 4JBVA 5CS6A 5LARA 5EQYA 4FTLA 4E4NA 4RGJA 5AR5A 4NM5A 3BYVA 1H00A 3FPQA 1P14A 3EYGA 4DFYA 5KX8A 4USEA 4B4LA 1W0XC 2ITZA 3WYYA 3PTGA 4JQEA 1UU9A 4QMWA 1F5QA 4IFCA 2XIXA 3DAEA 3LM5A 4AA0A 3QTQA 5EYCA 4L7FA 5CLPA 4ANNA 1Q8YA 3OTUA 1GZOA 2OJGA 4R7HA 3F2NA 1PJKA 2JITA 3TT0A 3FHIA 2R2PA 4AGDA 2B7AA 3V5LA 3NUPA 5EM7A 3GU5A 1STCE 1GZKA 4X2FA 1AQ1A 1JLUE 1GZ8A 3R1YA 4XG7A 3ZLXA 4ORKA 3BCEA 5DI1A 1CM8A 4LMNA 2C30A 3PPJA 3LFSA 2UZDA 4RJ8A 2QOQA 3MWUA 5EHOA 4QYYA 3ZOSA 3MH0A 4RFYA 1OZ1A 4UWBA 2WTKC 5A3XA 4BCKA 2GQGA 2RIOA 4H58A 5AV4A 2OW3A 3UC3A 4J95A 4M8TA 3D5UA 5AEPA 4CKRA 3RPVA 5KZIA 3OROA 2CGWA 2BHEA 3R9HA 4E26A 3NS9A 4ZLOA 4GS6A 4FTRA 4L52A 4NJ3A 4CFFA 4RQVA 3NVMB 3NNUA 4LUEA 3ULZA 1XQZA 3P7BA 4O0UA 3UIXA 3S00A 4GYGA 4L42A 3FV8A 1UV5A 4O82A 4JG6A
chains in the Genus database with same CATH superfamily
1TQPA 5LQFA 3V8SA 5JGAA 3CSVA 5DYJA 3BELA 3BYSA 4MD9E 1FINA 1BKXA 4D9TA 2BIKB 5FP5A 3DBDA 3ORPA 1A06A 2J0IA 4Y85A 2IN6A 3KCFA 3QRTA 1LEWA 1OMWA 4FVRA 2FGIA 3ATSA 5HICA 4UMPA 4IXPA 1P5EA 2RGPA 4J99A 2XNPA 5CF5A 4B8LA 2XNEA 4UZHA 1QL6A 4V0GA 4FX3A 3AGLA 4XMOA 4MCVA 5C26A 3HA6A 2PTKA 5DR6A 3D2IA 4J96A 2BRGA 5IEYA 2VTRA 5KMMA 4BIEA 5AP3A 5CNNA 5HG5A 1TVOA 2OSCA 4QPMA 2IJMA 5HKMA 3O23A 4TN6A 3D83A 4TWCA 4BTKA 1UNHA 4Y8DA 2ZOQA 4BGQA 4ASEA 5F95A 5H9BA 1WBVA 4YC3A 5EK7A 4QP9A 4D1ZA 4HGLA 3H3CA 4D5HA 3E8EA 4O7ZA 4UXLA 1ZOGA 4N4SA 3CLYA 2DWBA 4X3FC 4FIFA 4IB1A 1YXVA 4CV8A 2PVJA 4YTFA 5LWMA 3OWJA 5T68A 3DV3A 3QTSA 1ZZLA 4KRDA 5HORA 3UDTA 1YWNA 2ZDTA 1T46A 5I3OA 2WTWA 2ZJWA 3SLSA 3W2PA 2GMXA 2X6DA 3EZVA 4U9AA 1RDQE 3W55A 4FJVA 4FT9A 4DE4A 1FMOE 2C6IA 3DB6A 4PRJA 4R3RA 3HUCA 4X2JA 4YHTA 3ATTA 1EH4A 5B2KA 3F69A 2UZTA 2V0DA 5C03A 2YHVA 3NYOA 2UZOA 3LCKA 2Q83A 3NW7A 3AD6A 4AZVA 1YXUA 2OU7A 5EM5A 1YWRA 2X0OA 2X2LA 3FZTA 5EW3A 2QHMA 1G5SA 3GFWA 4CLIA 3TTIA 4MXOA 3PE2A 2UZUE 1XBBA 4ZP5A 2PVRA 2HIWA 3NAYA 3P79A 4UV0A 3A4OX 4ASXA 1J91A 4AXAA 4QEBA 5HNGA 1OL6A 3UYSA 5JH6A 2R3LA 2W4KA 3OUKA 4C0TA 5DT0A 3PY0A 4RSSA 4C61A 1BX6A 5E8VA 2Z7SA 1MP8A 2HWOA 4NUSA 4FTOA 3DBCA 5FUTA 4FT5A 4BTJA 5A14A 4ZTSA 4YLLA 3KU2A 5HESA 3BU3A 4DG0E 4O7NA 4YTHA 5CENA 3HECA 3QGYA 4XV9A 3HMIA 3QZIA 4AAAA 3MV5A 5EW8A 3NFFB 2WMUA 2BZIB 3BWFA 3ZXZA 4NSTA 3MFUA 4RPVA 3T3VA 2ERZE 3KK9A 5A6NA 3IGGA 5B7VA 3O5AA 5K9IA 1G8AA 3QTZA 2R64A 1H24A 1Q4LA 2JEDA 4K77A 4PL3A 2C6MA 3SRVB 3QTXA 4M7IA 2WOUA 3LFAA 4DH3A 4YR8A 3AKKA 3K3JA 2XYNA 5KO1A 2XIRA 4BCOA 1YDTE 3F61A 2GQSA 3LXKA 5A46A 4YHFA 3EN5A 4YHJA 4BGGA 4RZVA 4XUFA 3FMEA 4JDJA 4N70A 3A7GA 3PVGA 3QD0A 4O0YA 3WBLA 1LEZA 2XUUA 4A9TA 3AXWA 4IC7A 3RPRA 1ZY5A 3C4ZA 4NTTA 3ID6C 4J1RA 2OJ9A 4BDIA 5C8NA 5AR8A 5M09A 2YM5A 3ALNA 3WIKA 4CRLA 2IEWA 4QQJA 3NCZA 5IEVA 4NM7A 4X7QA 2XMYA 4BKYA 1JNKA 4OT6A 5CF8A 2YEXA 4UZDA 2XIKA 1KE5A 5LOHA 2DYLA 3NYNA 3U51A 3C7QA 3TUCA 3E8NA 2QO9A 1HCKA 5L4QA 2XNMA 2CKEA 4EZ5A 3LFQA 3R9OA 3PZHA 4BIBA 5GHVA 3QWKA 2O8YA 3UBDA 2VWZA 5J7HA 3P4KA 4G34A 3KC3A 3LHJA 4RJ4A 4ACGA 5KMIA 4FZ7A 5L3AA 2WIPA 4RLLA 3H4JA 5KMJA 2CN8A 4BJJB 4C57A 2WD1A 4L68A 4BDEA 5AADA 4H1MA 4IAAA 3OXIA 4O4FA 4CGAA 2W5AA 4AT3A 4FT3A 1VYWA 4CEGA 3KRJA 4RVKA 4FSWA 3HP5A 4DEGA 2NPQA 2WZJA 3CY3A 4YJSA 1QPDA 3UO6A 4FUYA 2ITXA 3HV4A 3MSSA 4IIRA 4EYMA 3OUNB 5HU9A 4U0IA 5IEXA 2ZDUA 4IAKA 2PVMA 4XCUA 5IA5A 4OW8A 4F9YA 1ZYSA 5ANKA 3FI2A 5EYMA 1WVWA 1UA2A 4PTGA 4UY9A 1UNLA 3KMMA 4UYAA 3EZRA 5FLFA 3PIYA 4PDSA 5JZJA 4FKPA 2B53A 2YDKA 3PSDA 2AEGA 3W0NA 3B2TA 3W32A 2EU9A 3RVGA 3DBFA 4EQCA 3SOAA 5EG3A 4R1VA 3KCKA 4QTBA 5HBJA 5E4HA 1KSWA 2OGVA 5C4LA 3MA3A 3TJCA 2UZNA 1OBDA 3OOMA 2XM9A 3IK3A 3R2BA 4QPAA 2AQXA 3E92A 4L9IA 3G5DA 3I6WA 3NMUF 4ENXA 3TN8A 3EFKA 4QMYA 1WFCA 2YIWA 2YLEA 1F0QA 3COHA 3KRRA 5EHLA 2DS1A 5IUIA 2CN5A 3TZ7A 4O7YA 4MTAA 3DOGA 1BMKA 4JBPA 4F7SA 3DY7A 5DGZA 5CVGA 4A9YA 4UYNA 2F2UA 4XP2A 1R0EA 2PYWA 4GJ2A 4IVBA 4FL1A 4EH6A 4LYNA 3MI9A 4AOTA 4J97A 3DS6A 3DBEA 3BHUA 4S31A 4UALA 4BCQA 1L3RE 3Q6WA 4AXDA 4RJ7A 3QX2A 4O0VA 4EJ7A 4EOOA 2ITWA 4IB3A 4IDVA 5CAOA 5L2WA 2PZRA 3CC6A 5J9ZA 2R0UA 1JKLA 2GS2A 1RW8A 2XEZA 3R1NA 4AN9A 3GT8A 2YFXA 4RWJA 5BMSA 2VO6A 4MX9A 4I21A 4PTEA 3D14A 3KULA 4UB7A 4DH1A 1M7NA 2WTIA 2XH5A 4X3FA 3HAMA 4EWQA 4JT3A 5CI6A 4MK0A 3LCTA 2R7BA 3FE3A 3F5UA 3MH2A 2GNFA 1PXKA 3O7LD 3Q52A 4YJUA 3W8QA 1G8KA 1VJYA 2CSNA 2BR1A 2QKWB 3EWHA 2BTSA 4FKUA 2QU6A 2R9SA 2YERA 4OTFA 4KKGA 4P4CA 4ZTRA 3VVHA 4E20A 5EKOA 3AC4A 3FXWA 4U41A 3SW7A 3TUDA 4G9RA 3GCVA 1V0OA 2WQOA 2XK9A 3Q53A 3VBXA 4C8BA 5IQHA 1F3MC 1YXTA 3CEKA 4ERKA 1J7UA 4I5MA 2X8DA 4KBAA 3JVRA 4O1OA 3UO4A 1ZY4A 5DR9A 4AXFA 3Q9YA 1ZAOA 4L53A 5D41A 3MVLA 3HMPA 2PE2A 3ORMA 4TXCA 4G5PA 3KF7A 5KMLA 4M84A 4KIQA 4FTAA 1PYEA 4FI1A 3MY5A 1Y6BA 3N51A 4ZTHA 4BI1A 4O81A 4TYHA 3W10A 3WE4A 3RHKA 3C5UA 2Z02A 1W2DA 3OEFX 4LOPA 3SG9A 3CGFA 5CANA 4DBNA 5HBHA 2O64A 4FNYA 3SW4A 1Q24A 2ITUA 3ORLA 1Q99A 2QOKA 3K5VA 1FOTA 3R1QA 3KFAA 4XNEA 4EBVA 2WMBA 5J79A 4RIXB 2ETRA 3AD4A 2BDFA 3R8ZA 2P2HA 4MEDA 4M13A 4JNWA 5E92A 4ZJJA 3UOJA 4BWKA 5FEQA 3TIZA 4M15A 2Y4PA 3QLFA 3EMGA 3BV2A 3LE6A 3IW5A 2HZNA 4F1TA 2NRUA 4AG8A 4KBKA 4CT1A 3ORIA 1H1RA 2F7ZE 3E8CA 5DT4A 3Q04A 5CEQA 2ZM3A 4O2PA 4TT7A 3TKUA 4FBXA 4MF1A 3RZFA 3UGCA 3UZPA 2CGXA 3G33A 2WTJA 4QNYA 4UWYA 1Z5MA 3FZ1A 4QYHA 4H3QA 5AM7A 4GK4A 2X8IA 5KUPA 3MTLA 3ZRMA 3QXOA 3ZYAA 1W2CA 1OIYA 1MQBA 3NUNA 5FP6A 2G1TA 4YURA 3RI1A 3PRFA 4JDKA 3PJ2A 2UVYA 4U5JA 2CHLA 3ZM4A 2UZVA 1IA9A 3ELJA 1HOWA 3NYVA 1W83A 1ZYDA 2QOFA 4IVAA 2ZB1A 4DN5A 2BIYA 2YM6A 4O4BB 3ZM9A 2UW0A 3F2AA 4YJVA 1CSNA 1REJA 2X9EA 1ZYCA 3OS3A 3QFVA 2XKFA 4FTTA 4O6LA 3GC0A 4OTRA 5IQEA 3CS9A 1APME 1JKTA 2J90A 3QAME 3OWLA 1S9IA 2QONA 3UOKA 4ZSGA 4D2WA 4F9BA 2YISA 2BDJA 3KL8A 3SDJA 4RC4A 3R7IA 4F09A 3R02A 2X7OA 4OR5A 4CD0A 3LKMA 4F6WA 3NUXA 1GZNA 4IM0A 4IC8A 2X81A 3CKXA 4FODA 3W0RA 3NR9A 3MPAA 3I81A 4QTCA 1E9HA 4NT4A 1PMNA 5CT7A 4F1MA 4QDVA 5HNIX 1H1WA 4ID7A 4DGNA 4QDEA 3EQGA 3PPKA 4YLKA 4LRJA 3EQIA 3TKHA 4DFZE 3CE3A 3ZO3A 3QGWA 4R7BA 3BU6A 2BZJA 4OLIA 4BTMA 5HTCA 4FG9A 3ML1A 2V7AA 4EL9A 3V04A 5AA8A 5HG7A 1OGUA 3QRJA 4DYMA 3RHXA 4GCJA 4RX7A 3BZ3A 5CSHA 1YHSA 1XH9A 5BV3A 3EL7A 1H26A 4KIPA 4GVJA 1M52A 5IQAA 2JIVA 4WG5A 4FKTA 3OFMA 3C0IA 4XOYA 3D4QA 5C4KA 4APCA 4GG7A 3ET7A 2VTLA 2WOTA 5CQUA 4CTBA 3GU7A 2WMXA 1OVEA 4FTIA 4RIWA 4UMRA 5CEOA 1JBPE 1FVTA 4PDOA 4X21A 5BNJA 5JSMA 4D4SA 2CKOA 1Q3DA 1W82A 1PXJA 2E9NA 4AOIA 4F9AA 3ZC6A 4E5AX 4Q5HA 3G90X 4TZRA 2C5OA 4CLJA 4GYIA 3QD2B 2C6EA 2C4GA 1WVYA 2C3KA 2EWAA 3DB8A 3HYHA 3DXPA 5FGKA 1PW2A 2GFSA 3W2RA 5M57A 4FOBA 3PXZA 4ZTQA 4I5PA 2R3MA 5CZHA 5AP2A 4KIKA 4A4LA 4BCFA 5TO8A 4NL0A 4FGBA 3W1FA 4P5QA 4CMUA 5HVKA 2YJSA 3ZDUA 3KXNA 3RZBA 1Q8UA 4DLIA 3FPMA 4AN3A 4N57A 2YCQA 4CRSA 1KV2A 3MVHA 3HGKA 4YO4A 3BE9A 1CTPE 5E8WA 5ACBC 5DWRA 3QRKA 2C6LA 4AA5A 2X2KA 4NKAA 3D94A 4AP7A 4QMQA 4D58A 3VAPA 3OWKA 3PA5A 4C2WA 2XARA 3MBLA 4QO9A 5JKGA 5J1VA 2PUIA 4K8AA 4R3PA 2IW9A 4ZLZA 4JDHA 4HGEA 3QHRA 1YOJA 4YNEA 4LUDA 1W84A 2OFUA 3E5AA 3GEQA 3RALA 3SVVA 5HEZA 3PXRA 4YO6A 1IR3A 2I40A 3F7WA 5ETFA 4BKZA 2X2MA 3NCGA 2G9XA 3TZ8A 3R7UA 1J7IA 1OL1A 1TKIA 4Z55A 3KA0A 5M53A 1Q97A 5LMKC 2F9GA 2VTMA 3NRMA 3W0SA 4XG3A 3PVUA 5ITAA 1PMVA 2OH4A 3DLSA 4DEDA 5J5SA 2VGPA 1T45A 2VTNA 1J1CA 3DCVA 3EL8A 2WB8A 4H3PA 4E6QA 4I1ZA 5CASA 2FYSA 3SKCA 3A4PA 3KIOC 3WOWA 4ZMFA 4FSRA 4C3RA 1H1QA 5AUVA 1PMUA 5BMMA 3JY9A 4AA4A 4FTMA 4EH7A 4AZTA 1NA7A 3LFFA 1RE8A 4EOQA 5JK3A 4RMZA 2IW8A 3BX5A 4TYGA 4E6DA 2OXYA 3SC1A 3ZLYA 3WARA 5IMXA 3LCOA 4I0TA 2C6OA 3GI3A 3FQEA 4O38A 3UIMA 4RJ5A 2UW8A 1U54A 3CY2A 5ACKA 2GFCA 4XH6A 4E7WA 3O8UA 5LVLA 3Q32A 3OBGA 4NIFA 2W4OA 4RC2A 2J6MA 3QRUA 2QOCA 4NTSA 3LCSA 3M2WA 4H36A 4O0RA 4F0FA 3AG9A 2H9VA 4GK3A 3R0TA 3ZBFA 3W0QA 4BBMA 3P78A 3NDMA 4PMTA 4ZAUA 4BR3A 3OG7A 3MPMA 5EI2A 4DGMA 3EHAA 4EYJA 1UWHA 4LRMA 1YI6A 4NM3A 2YA9A 3BBWA 3VQHA 4FG8A 4DDIA 2QOBA 2XF0A 2XJ2A 3NX8A 4KS7A 5DRDA 1OUKA 2RFNA 3K5UA 5FBNC 4BHZA 4EONA 5KKRB 5E9EA 5JZNA 4RVLA 3C4EA 4E1ZA 4DFBA 3H0YA 4GUBA 2WNTA 3H9OA 5AJQA 4G3GA 4N6ZA 4GV1A 3ZSGA 3V3VA 4E73A 1WMKA 3AC5A 4JBQA 3W2SA 3RAKA 3TNQB 4IDTA 3RM7A 5K4JA 4IJPA 2FH9A 3THBA 2A4LA 4BYJA 3HUBA 5JRSA 4F63A 2WXVA 4YJNA 4E4XA 4AOJA 3ZSIA 2OO8X 5L6WL 1IAJA 2JKQA 1URCA 2PZIA 4O7SA 1QPEA 3I5ZA 2XS0A 3VS5A 3BI6A 1BLXA 3FMMA 4I6QA 4BCPA 1JVPP 5AAFA 1Q41A 3CD8A 4MXXA 2C3LA 1W98A 1LR4A 3EN9A 3DGKA 4KSPA 5HIBA 5KE0A 4E3CA 2XZSA 2EXMA 2F49A 4PMMA 3CQWA 4DEAA 2QOOA 1YI4A 3HKOA 3UVQA 2Y8OA 4GU6A 2BFYA 3FZPA 5I5ZA 5DVRA 2GS7A 1U59A 5FXSA 2WTVA 3R7OA 2XB7A 3WF6A 1K9AA 3LMIA 3GOKA 3RCDA 2FUMA 2WEIA 5A4LA 3QWJA 4G6OA 4XLVA 4IHPA 5AV2A 4R8QA 3ZTXA 1R78A 2I0HA 4EWHA 3UP7A 3FMJA 2W5HA 3DDPA 3R8VA 2GTMA 4JMQA 2C5VA 4NZWB 5DG5A 3DFAA 5AP4A 2VWXA 4DG2E 2C47A 3VJOA 1CMKE 4DAWA 2DQ7X 5CVFA 4FKVA 4FEUA 4A07A 2JDTA 2B9HA 4O7WA 4QP4A 3VBVA 4EZ7A 3FWQA 4JX7A 4FRFA 3TDVA 5IQDA 3L8VA 5DOSA 4FV1A 2YCRA 3PIZA 4TW9A 2GTNA 4PNIA 3E8DA 3EFWA 3F5GA 4ITJA 5DFPA 1XR1A 1PXIA 4MXYA 5LMAA 4JAIA 5AMNA 4CSVA 1W7HA 4PP9A 2X6EA 2ZMDA 2A19B 2NO3A 5CALA 5JN2A 2X4FA 2VTAA 5JGDA 5C8MA 2PVHA 3V6SA 1V0PA 1MRUA 3CD3A 3TZ9A 4QMZA 3OHTA 4EK5A 4NFNA 3LLTA 3V6RA 4D4VA 1QCFA 3G9NA 5IU2A 2F2CB 3OC1A 3HP2A 4D1XA 5CSXA 3QQGA 4DGLC 4D5KA 3DXQA 4TY1A 3TL8A 5ANJA 3ZRLA 1K3AA 2VU3A 3I4BA 2J7TA 3LOKA 4RJ6A 3I0QA 4X0MA 2XIZA 1I09A 5FG8A 3FLQA 2ITQA 3QKKA 2J0MB 3G0EA 4O0WA 4OAUC 4E93A 4OBPA 4RFZA 4WG4A 4LQMA 4YC8A 4U3YA 4G1WA 4RIOA 1TFFA 4DEHA 5L8JA 4ANBA 3N4TA 3EN6A 5KBQA 2OIDA 3UG2A 2GNGA 2W7XA 4OGRA 1WBTA 2V7OA 3W0OA 2UW9A 2PVLA 5KMKA 2OH0E 3MTFA 4EH2A 2IZTA 4EQMA 4DC2A 5IUHA 4UN0C 5BX0A 3PUFC 4ITIA 3SD0A 1YXXA 3U9NA 4W9XA 1U4DA 3LPBA 1YW2A 3QBNA 4TYJA 3UOHA 5CEPA 2XANA 4AW0A 5LMKA 2A98A 3FSFA 5DT3A 3VBTA 3ZBXA 2JDVA 5L6OA 1PHKA 4LG4A 3FLWA 5CEKA 4EKKA 1G8JA 5BVNA 4OTPA 1PXPA 2X7FA 3VN9A 3DK7A 5CXHA 5IH4A 4HZRA 4JXFA 3K2LA 3DKOA 3BLQA 1H8FA 3QCQA 4B7TA 4F7JA 4FMQA 1QPCA 5FD2A 4CCUA 3QLGA 3SQQA 4IWPA 2V62A 3A60A 5CTPA 2HAKA 3S0OA 4X3FB 2XNNA 3ENHA 3HVCA 3MJ2A 3AMAA 1ST4A 3IONA 1DS5A 5D7VA 4G16A 4YBJA 4FGRA 1OBGA 1OITA 4ZS0A 4RFMA 3ACKA 4BF2A 5L8LA 5AP6A 5ETCA 3AKLA 3BGZA 5AV0A 4CT2A 5FM2A 5IH6A 2BRBA 2YWPA 4BICA 2GQRA 3BLRA 4R78A 4XV1A 1B38A 2R3IA 3OCBA 4A06A 5CF6A 1XMMA 2BDWA 3QQJA 4XG8A 1S9JA 3PWYA 4D4RA 3Q6UA 4IB5A 3U6JA 4QTDA 2HY0A 2YITA 5KMOA 4ZXTA 4DDGA 4QP7A 1OB3A 2PVKA 5CYIA 4B0GA 3DNEA 3COIA 5JRQA 4I0RA 2EB3A 4F70A 4D2SA 3KXZA 2H96A 3JS2A 2F57A 4EKLA 5HO8A 3PG3A 1A48A 5I9XA 1SVEA 4EK3A 1Y8GA 3TV7A 4MQ2A 1H0VA 4JQ7A 5HGIA 2GHMA 3VF9A 4AACA 4DINA 2HWPA 5FXQA 2O65A 2H6DA 3PG1A 4ALVA 5F1ZA 2X4ZA 2ITVA 4WSYA 5CX9A 2Y4IB 3LFEA 4X6QC 1XKKA 3MA6A 5CU6A 3ZRKA 2XEYA 4GFMA 4O0SA 3L9PA 2ZB0A 4FV2A 4XG9A 4ZJIA 1KV1A 3EQRA 4RIYA 3F2RA 4IWOA 3PYYA 3HRFA 2VGOA 3NUSA 2OJFE 4GSBA 2XK3A 3C4WA 4P90A 4FG7A 1TQIA 3MN3A 4W8EA 4WSQA 2PUPA 3RM6A 4ZMEA 2BAJA 3QA8A 1KUTA 2X0GA 4ZZMA 2I0YA 1I44A 4C34A 3FYKX 4LGHA 2E9OA 4O4DA 5CY3A 4OBQA 2ONLC 5L6PA 5JFWA 4FIHA 3MFRA 4L7SA 3U87A 5BUEA 4LDTA 3KN6A 3KMUA 3QX4A 1OL7A 4I3ZA 2ZM1A 4AS0A 3ZU7A 4CZTA 1E1XA 4F4PA 1JPAA 3PPZA 4HOKA 4V04A 4MXCA 2XCKA 2I6LA 4B9DA 5J9LA 3F5XA 4K11A 3EOCA 5M08A 4GKIA 3DTWA 4HZSA 2NRYA 3R8MA 4XLIA 4WA9A 4EC8A 3C50A 4DLJA 3R22A 1OPJA 2VO7A 5D1JA 3UYTA 4DGOA 3KB7A 2OXXA 2VO0A 4MVFA 2VNYA 2OKRA 3NYXA 5EM6A 2JDOA 4BWPA 4LL0A 5J9YA 3D0EA 2O63A 2XIYA 3UE4A 3CPCA 3UQFA 5I9UA 4O7LA 3HA8A 2ITTA 4GRBA 4A9RA 5BVEA 4XG2A 1YOLA 2H34A 3RWPA 3DFCB 4JR7A 5DHJA 4MWHA 3RTPA 4MXAA 4M67A 2RG6A 3QCSA 4S2ZA 5J95A 4AF3A 4Z7HA 4L3JA 3VUKA 2B1PA 3Q4ZA 1XH5A 2YLFA 5HG8A 4D0WA 5IDPA 5KNJA 2WQMA 3C51A 4W4WA 2RG5A 3E64A 2WMTA 4FT7A 3CTQA 2B4SB 3DQXA 3LAUA 4USDA 2Y6MA 4WRSA 5CAPA 3T3UA 1IRKA 3IDCA 2B0QA 3GNIB 4MF0A 2WGJA 4Z16A 3FY0A 4ZTMA 4CFWA 3L8SA 3R1SA 5AIRA 5HLWA 1MUOA 2WMAA 2XRWA 3DJ6A 3DKCA 4MNFA 5DNRA 4YJTA 4MXZA 4RX8A 5FTQA 5H2UA 5CU0A 4M66A 5JFVA 4G3EA 5H8BA 4CFVA 3MGYA 4IVDA 5E8UA 4GT3A 3WF7A 3CIKA 4O0XA 2YAAA 4PV0A 2QVSE 3VC4A 3IG7A 3KXHA 3QYWA 1RJBA 2W1ZA 3GU4A 3NWWA 3V01A 2Q0BA 2QCSA 3Q9ZA 4RC3A 1PXMA 4KIOA 4R5YA 4D2PA 4XP3A 1ZYLA 4WHZA 4QP6A 1Q3WA 3LFNA 4IQ6A 1TZDA 3E88A 2ZMCA 4LV5A 4M69B 2PK9A 2P3GX 3KF4A 5J7BA 2QKRA 4BDBA 3QTUA 4S30A 1OPLA 3ZUUA 3AC8A 4QNAA 1ZLTA 3RAWA 3VS7A 5AP1A 4EOIA 5BVOA 3MFSA 1DI8A 3H9FA 4TYIA 4YBKA 4YLJA 2R0IA 3F6XA 3TCPA 2AC3A 2XNGA 1XWSA 3IDPA 3OVVA 5EOLA 1ST0A 2CGVA 4JR3A 2YZLA 3HRBA 5GZ8A 4AE6A 5IH5A 1XBCA 3UJGA 3QXPA 3VS3A 2AYPA 3ZO1A 2HYYA 5ANEA 2XKEA 3R9NA 2W0JA 4IAYA 3C0GA 4WBBB 3ALOA 3TKIA 4FKOA 3BPRA 3VS1A 3VUHA 2QR8A 3GFEA 3I1AA 3BYMA 5D9HA 4FKWA 4L46A 3ZO4A 3C0HA 3FL4A 5HD4A 4F6SA 3NFGB 3GVUA 4WO5A 4O84A 4QP3A 2QC6A 4C4GA 3PFYA 3NW5A 3QC4A 3C4XA 3AOXA 3F82A 5KMNA 2VX0A 3EKKA 3LFCA 3AGMA 4JIKA 4FTJA 3MDYA 1KE9A 4EZ3A 4J8MA 3TNPC 3T9IA 3AC1A 5HIEA 3IS5A 1PXLA 2PULA 2JKMA 3NNWA 5HE1A 3C4FA 2BHHA 2YCFA 4ONAA 4XEYA 5JMSA 3P9JA 3KGAA 3OXZA 5AUUA 5KCVA 4JOAA 3ROCA 3TDWA 3OZ6A 3NW6A 5AR7A 3VULA 4I4EA 3EKNA 3MFTA 3NIZA 3RP9A 4BCJA 4G17A 4QMNA 3JPVA 1M2PA 4U79A 5B0XA 3QTRA 4C36A 3Q5IA 2BFXA 2F7EE 4IE9A 4IX4A 3R01A 3ZHPC 3VS2A 4C4JA 2BMCA 2PU8A 3R04A 4CQEA 4ZS4A 2WEVA 4OUCA 2VTJA 4ZSLA 4DFUA 4U45A 4I24A 3KN5A 2IZSA 4XV2A 4Y46A 4BIDA 3KRLA 3AMYA 4FEQA 3QA0A 4IAIA 3LXLA 2W1FA 3FLZA 5K4IA 2XAOA 2OXDA 4IM3A 3G9LX 4KABA 4ANQA 1IAHA 4TNBA 3QL8A 1NY3A 2ONLA 4G3DA 3QCXA 1KOBA 4G2FA 4FKSA 4BDHA 5IA3A 3QQKA 5HTBA 2IVUA 4AX8A 1KE6A 4EEVA 3M1SA 4CG8A 3P5JC 3OD6X 3F9NA 2J4ZA 1NVRA 4RWKA 5AP0A 3DXNA 5AUZA 3O96A 4KAOA 5BQ0A 3RK9A 2KTYA 3R00A 2P0CA 4M97A 3LQ8A 4IADA 1M14A 3OT3A 5H3QA 3G6HA 3QUEA 4ZEGA 2A1AB 3DJ7A 4Y73A 3EQBA 3P1AA 1KE8A 3OTVA 5M55A 5K5XA 4MBLA 4W9WA 3VW6A 3ZCLA 4NK9A 2WELA 3DK6A 3FMKA 3F5PA 4FYNA 4II5A 3QUPA 3R2YA 4WNMA 4E8AA 3FQSA 3W2OA 2R3KA 4WUAA 4U8ZA 4ERWA 4I4FA 4BDCA 4FYOA 4UEUA 4R77A 2BRMA 2W96B 2YJRA 5DE2A 5TR6A 4FR4A 4AW2A 5EYDA 5HTIA 3SA0A 4FZ6A 4F0IA 4O1PA 4AXCA 2GDOA 3UDZA 3E93A 2VUWA 3MVMA 4GKHA 4OAVB 4JJRA 2XKCA 4QMMA 3D15A 1ZZ2A 5IG1A 3WZEA 3LJ2A 5HCYA 3ZONA 4EOPA 3O0GA 4EHEA 5IA1A 1J7LA 5LMBA 3VUDA 3WZDA 2B54A 1UU8A 5CT0A 2EXCX 3RPSA 4V01A 3NNXA 4ZZNA 5GJGA 2R7IA 2EB2A 2BAQA 1FMKA 2B55A 2WQNA 4S32A 4CZYB 4C35A 3ZUVA 4ASZA 2VTSA 3UNJA 1XH6A 2FB8A 2G2HA 2BZHB 3D9VA 4QTAA 4CVAA 3E3PA 4KBCA 3OEZA 4JIAA 3R8LA 2BRNA 1ZWSA 3AC2A 5CEIA 5GZAA 5JGBA 4ACDA 3AMBA 4WUNA 3NZ0A 2Z7QA 3ZFXA 3PY1A 3HLLA 2PVFA 4YUQA 2ZAZA 3Q9WA 1V1KA 3VBQA 2NYAA 4RX5A 2GNJA 1OKWA 3BGQA 2XNBA 3WZUA 2G2IA 3I6UA 5A54A 1XO2B 3U6HA 3LIJA 4FV9A 1YXSA 2VWVA 3I79A 3LCDA 3BYOA 3GUBA 3FLNC 3LZBA 5EHYA 2PMLX 4HCTA 3U4UA 4BCGA 4EK8A 1UKHA 2OFVA 3R7YA 1WCCA 3A7JA 1XH7A 3KK8A 5HVYA 5HD7A 3VRZA 2R3HA 3SRVA 4FKQA 4J53A