4AT2A

The crystal structure of 3-ketosteroid-delta4-(5alpha)-dehydrogenase from rhodococcus jostii rha1 in complex with 4-androstene-3,17- dione
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
483
structure length
483
Chain Sequence
IRPRSATTVTEWDYEADVVVAGYGIAGVAASIEAARAGADVLVLERTSGWGGATALAGGFIYLGGGTPLQKACGFDDSPENMKTFMMAALGPGADEEKITDYCEGSVEHYNWLVDCGVPFKESFWGEPGWEPPFDDGLMYSGGENAAPFNEIAAPAPRGHVPQMDGKRTGEKGGGYMLMKPLVETAEKLGVRAEYDMRVQTLVTDDTGRVVGIVAKQYGKEVAVRARRGVVLATGSFAYNDKMIEAHAPRLIGRPGAAIEEHDGRSILMAQALGADLAHMDATEVAFVCDPQLIVRGILVNGRGQRYVPEDTYSGRIGQMTLFHQDNQAFLIIDEASYEEGAAATTATPFLRVQPKWAAETVEELESDMGLPAGALQSTVEVYNKHAAEGSDPLLHKKSEWVKPIGTPVAALDLRGFTLGFTLGGLRTTVNSEVLHVSGEPIPGLFAAGRCTSGVCAGGYASGTSLGDGSFYGRRAGISAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-KETOSTEROID-DELTA4-5ALPHA-DEHYDROGENASE
publication title Structure and Catalytic Mechanism of 3-Ketosteroid-{Delta}4-(5Alpha)-Dehydrogenase from Rhodococcus Jostii Rha1 Genome.
pubmed doi rcsb
source organism Rhodococcus jostii
molecule tags Oxidoreductase
total genus 163
structure length 483
sequence length 483
ec nomenclature ec 1.3.99.5: 3-oxo-5-alpha-steroid 4-dehydrogenase (acceptor).
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4at2A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4at2A02
3GMBA 1H82A 3KU9A 1FCDA 1H7XA 4NTDA 2WS3A 4GCMA 2GMJA 3E1TA 2QCUA 1K0IA 2XLSA 4NZHA 2YG3A 2RGOA 2XLPA 3CNDA 4NTCA 1IUXA 3K7TA 1YQ3A 2C64A 4H4PA 4CCRA 2WESA 4UDRA 3NG7X 3RP6A 3UOYA 1CC4A 2FJAA 1EBDA 4JNAA 1V59A 2B9YA 2XLTA 3GD4A 2VQBA 4H4WA 2BXRA 2XYOA 3DGHA 1Y56A 4TM3A 4YSHA 2A89A 3H8LA 3NRNA 5KOWA 1F8SA 4B66A 4C3XA 2ZBWA 1DJNA 2C7GA 4EIPA 1VRQB 4A6NA 2OA1A 3P9UA 5JCLA 3NK2X 2C76A 3UCLA 3UKQA 3FMWA 5J60A 3DMEA 1CBOA 1N4WA 1D4CA 1E39A 4JNQA 1QLBA 3NKSA 2C65A 3SQPA 3UKHA 1D4DA 3DH9A 3NYCA 4H7UA 1COYA 1NHSA 3CNSA 1H84A 1Q1WA 3DJGX 2JAEA 3HZLA 1K0JA 1E6EA 3AD7B 4I59A 2C73A 4OVIA 2GR0A 2BYBA 4OPLA 4XWZA 4H2RA 1DXLA 4OPDA 4BURA 1IUUA 3ATQA 4CNJA 2EQ8A 5M10A 1YQZA 4Y4LA 3UTEA 3QSMA 4K2XA 2XFQA 3DK8A 2NVKX 3NT6A 1ZP0A 1O5WA 3GMCA 2GAHB 3B6DA 1W4XA 1XHCA 1CJCA 4B63A 4EQWA 2WU2A 4EMWA 2FJDA 2GR3A 3CPHG 1JEHA 2BK4A 3ICSA 5KVIA 1S2YA 3VQRA 2YVGA 5HY5A 2ACZA 3UTHA 3P4SA 3V3NA 4USRA 1CL0A 5U25A 2QAEA 1GOSA 1S3EA 2OLNA 1YQ4A 5KOXA 1TYTA 3PVCA 1E1LA 1VQWA 1H6VA 4U8JA 2XCGA 2YAUA 4UDQA 3F8DA 1N4UA 4C77A 3LOVA 1NENA 2XVEA 3SFDA 3NN0X 2A8XA 4BJYA 4FDCB 3IF9A 3KA7A 3DJEA 4AOSA 1JRXA 1L9DA 2BXSA 4NTEA 2GVCA 4J33A 3F8RA 4B64A 2ZZ0A 3LZXA 5KWFA 3JSKA 2C3CA 1KNPA 4ADWA 5JCIA 4AT2A 2GRTA 4Z26A 4DGKA 3CNPA 2WDRA 3ICRA 2OAMA 2C72A 4U2LA 1PN0A 2B9XA 3SM8A 4H4YA 3K30A 1FECA 2R9ZA 1ZY8A 2RGHA 3B3RA 2BA9A 2BS2A 4JN9A 1Y56B 2F5ZA 2XFNA 3CGCA 1BWCA 3CGDA 1K4QA 3ADAB 3ABVA 1GRTA 1OJ9A 3V76A 3I6DA 4GUVA 1TDOA 4A6NB 3CGEA 3ZYXA 1N1PA 1NHQA 3URHA 4BV6A 2CVJA 3AE1A 2UZZA 2YM1A 5HYMA 2V60A 4K7ZA 3AD8B 4AP3A 2JB2A 4XWRA 2VOUA 1NHRA 2JKCA 3Q6JA 4USQA 3AWIA 4FK1A 3AE3A 1NDAA 3ALJA 4XXGA 5GRTA 4JY2A 2YQUA 3ALLA 2Q6UA 1ZMDA 3NYEA 1TYPA 3EPTA 3IHGA 1GPEA 1B37A 3AXBA 5EB4A 2WDQA 1QJDA 1IUVA 2LFCA 3QJ4A 2YLSA 1ONFA 4H4SA 1TRBA 1L0VA 4CRTA 2WOWA 1XDIA 3UTFA 2Q7VA 3QFAA 4YTNA 2BK5A 2XVJA 3ISHA 3BNUA 1YKJA 1NG4A 3ITJA 1AOGA 3BHKA 1PXAA 5CQFA 1PXCA 2IVDA 2VQ7A 1Z6LA 2WPEA 2QA2A 2NPXA 5KRQA 5U63A 3RNMA 1REOA 4A5LA 1GTHA 2JB1A 2Y6RA 3C4NA 4H2NA 3SFEA 4Z44A 1F6MA 2XFPA 3P1WA 4KX6A 2GF3A 2RABA 2EQ7A 2O9ZA 1GT8A 2V61A 4EMIA 4TM4A 1JNZA 3AYJA 2WP6A 3KVEA 3UOZA 4K5RA 4A7AA 3AE4A 5HXIA 4GDEA 1KSSA 2YLZA 2W0HA 4TM0A 3K7QX 2ARDA 4HB9A 1K0LA 4NEVA 1NEKA 2FBWA 4H4QA 4H2QA 5IQ1A 4JQ9A 3FBSA 4U8OA 1JOAA 1KF6A 4K8DA 2YWLA 5FS7A 5BULA 1SEZA 1ZMCA 1L9CA 3R9UA 2X8GA 1BZLA 1LV0A 2JK6A 2WP9A 4YTMA 1GRBA 5M0ZA 2V5ZA 2OLOA 2WPFA 1Y0PA 3OC4A 4H2PA 4C3YA 3GDNA 2CFYA 3RHAA 5C3JA 4H50A 2WETA 1PJ7A 4YWOA 3LADA 4X9NA 2WPCA 4UP3A 2WOIA 1PBFA 4YTPA 4X4JA 1FEBA 3DJDA 2AAQA 2YR5A 2WDVA 3EAOA 3UKPA 4E0VA 4PABA 4EM3A 2VVLG 4OPUA 1NAAA 4O5QA 3C96A 5KXJA 1N4VA 4I58A 4LA1A 4WCTA 1KFYA 1OJTA 4U8KA 1DOEA 3LB8A 4CY8A 3SGLA 4EQXA 5IPYA 1UKVG 1ZOYA 4H4UA 1MO9A 2EQ6A 1GEUA 3FIMB 2YG5A 1M64A 2YG7A 2YG4A 4J2WA 3KD9A 2WBAA 5ER0A 1BGNA 2XLRA 2XVIA 2XLUA 1GERA 2WQYA 2XVHA 4EIQA 1VDCA 5CKUA 4EQRA 2APGA 4Z43A 2YVFA 4U8NA 1S2QA 4P9SA 4U8PA 1E7PA 4IVOB 3GSIA 3UP4A 1KNRA 4A99A 1ELIA 4JDRA 5U1OA 1GRFA 2C75A 3UP5A 3NYFA 1E1MA 3CPIG 2R46A 2BACA 2B7SA 1LTXR 5GSNA 2V3BA 3CTYA 2FJBA 1GETA 1PJ5A 2WU5A 1ZOVA 2E4GA 4IA5A 3PO7A 4D03A 4H4ZA 1BGJA 1ZK7A 1B8SA 1LQUA 2H88A 1GREA 1GNDA 3VRAA 2I0ZA 2BC1A 5KVHA 5FS6A 4GRTA 2A87A 1H86A 4A65A 2XDOA 4FK1C 3CGBA 4YKGA 2ZZBA 4U8IA 2X50A 5IQ4A 2Q0LA 1H81A 3UKFA 3CNJA 3AE2A 4IA6A 2AQJA 2R4EA 4RG4A 4J36A 1PDHA 1PJ6A 3G5QA 3UKAA 1GRAA 2GR2A 2VRMA 3BI4A 1Q1RA 3L8KA 3UTGA 3F8PA 2YVJA 1B4VA 2TMDA 4PAAA 4J34A 4YSYA 3VRDB 3BNMA 4A9WA 3O0HA 3AYLA 2R0PA 4BJZA 3T37A 1IUSA 3AECA 3LXDA 4Z2RA 1FL2A 1CC6A 3WE0A 3FPZA 3FG2P 3REDA 2X99A 1PS9A 3NLCA 2ZZCA 1DJQA 4J56A 4OPIA 1LVLA 4BK1A 1GV4A 4GR1A 2YM2A 2CDUA 1NG3A 1BKWA 3AYIA 2J3NA 1D7LA 3BHFA 3KPFA 1E1NA 3P4RA 3S61A 5FS9A 1RYIA 3NK1X 3Q9TA 3AE6A 3VRBA 3PS9A 3IC9A 4YSZA 3EANA 4MJWA 4OCGA 1EL5A 1F8RA 5HHFA 1O95A 1LJ1A 2RGJA 3IWAA 4CCQA 4YKFA 2GB0A 4ZCCA 1D4EA 2OALA 3QVRA 2R0GA 1RP0A 4AOXA 2YLTA 4B69A 3NHOX 3M12A 3L1RA 1ZKQA 2YR6A 4M52A 2BK3A 5EB5A 4K5SA 1EL9A 4J57A 1FOHA 2FJEA 2PYXA 1BF3A 1TDKA 1IJHA 2C67A 1GALA 5BUKA 2JB3A 4U2SA 2IVEA 4BK2A 1JRZA 2BS3A 3AEGA 4OPCA 3UOVA 4HA6A 1PBBA 2CULA 3GWDA 1IUWA 3GYXA 4ECHA 4U2TA 1F8WA 1X31B 5LV9A 1PBEA 2E1MA 3DJJA 1OJAA 1S3BA 4TLXA 1VG9A 4ZCDA 2GEWA 1CJ2A 4Y4MA 4Z24A 3LZWA 1O94A 4B1BA 4H4XA 3C4AA 1ZDLA 3NNEA 5JCMA 3AEBA 1B5QA 1RSGA 2EQ9A 4Z25A 3UOXA 3IHMA 4IV9A 4Z2UA 4OPGA 1CC2A 2XFOA 3AEFA 4K22A 5EBKA 2GAGB 3GYJA 4U8MA 3M13A 4J31A 2VRLA 1H7WA 2VVLA 3DA1A 3QFBA 4KPRA 1ZX9A 4YXDA 1PHHA 3OZ2A 3AEAA 2Q0KA 2R0CA 2H89A 2X8CA 2XVFA 3NH3X 4BK3A 4Z2TA 5J7XA 2GMHA 3CPJG 3II4A 3UKKA 3UKLA 2WP5A 1VG0A 1JU2A 3ATRA 4AT0A 3I3LA 4EM4A 1CJ3A 2DKHA 4DSGA 3AD9B 1L9EA 2BCGG 2IIDA 3NGCX 2GV8A 3K7MX 3RP7A 2Z5XA 5JCKA 4B65A 1LPFA 4N9XA 1YY5A 2XFUA 3COXA 1OJCA 1TDNA 1CJ4A 3D1CA 4REKA 2YLRA 3H8IA 2PHHA 2HQMA 2X8HA 4JY3A 4CNKA 4D04A 1F3PA 3ALMA 2AR8A 1FEAA 4OPTA 1E1KA 4B67A 2WHDA 3QVPA 3S5WA 1M6IA 4LU6A 2TPRA 4YSXA 3NIXA 4CBQA 4B68A 4EQSA 5FMHA 2VZ2A 4A79A 4LIIA 4UDPA 1GRGA 2BCPA 3AB1A 4FX9A 1TDEA 2DKIA 4C74A 1OJDA 5EOWA 2GR1A 3AE8A 3AE5A 4RG3A 4U8LA 4ZN0A 5JCNA 1MOKA 1NHPA 1DOCA 1PXBA 4Y4NA 1IUTA 1EL7A 2R45A 2GQWA 2GH5A 3KLJA 1QO8A 1XANA 1PBCA 3KKJA 5TR3A 4DSHA 3H4KA 2V6OA 1D5TA 2BC0A 2B9WA 1CHUA 2V3AA 4APNA 1GXFA 1HYUA 3DGZA 1DOBA 4DNAA 2WEUA 1GRHA 5C2TA 3NN6X 3VR8A 3M0OA 1XPQA 1GSNA 3AEEA 3V3OA 4TLZA 3ICTA 2C70A 4AP1A 1CF3A 3GWFA 3NK0X 3NTDA 4EMJA 4C5OA 4RSLA 2YLXA 1Q9IA 2BABA 4GF7A 3QSSA 2E5VA 4GDPA 2B7RA 4H4VA 2YR4A 3RP8A 4WX1A 1PBDA 2WOVA 3DK9A 3AEDA 1KDGA 3CIRA 5BRTA 1P2EA 3P4PA 1NPXA 2R4JA 1GTEA 1JRYA 3EF6A 4ICYA 3DK4A 4H4TA 1EL8A 1GESA 3GYIA 1DNCA 3CN8A 2X3NA 3GDPA 1P2HA 2JBVA 2YG6A 2Z5YA 1KSUA 2VVMA 3G5RA 3GD3A 3LJPA 4IVMB 1LQTA 5L46A 5DBJA 4YT0A 4X9MA 3GRSA 3NTAA 3P4QA 3ZDNA 2C66A 1DODA 3D8XA 3AE9A 2Y6QA 3AE7A 1MXTA 3G5SA 3CNTA 4NEWA 3QSEA 3GRTA 5BVAA 2C3DA 3VR9A 1H83A 1JNRA 2QA1A 3BI5A 4CY6A 2BS4A 4O5UA 3BI2A 1TDFA 2B76A 1D7YA 2GQFA 2YLWA 4H4RA 4TM1A 5FS8A
chains in the Genus database with same CATH superfamily
3GMBA 1H82A 3KU9A 1FCDA 1H7XA 4NTDA 2WS3A 4GCMA 2GMJA 3E1TA 2QCUA 1K0IA 2XLSA 4NZHA 2YG3A 2RGOA 2XLPA 3CNDA 4NTCA 1IUXA 3CMMA 3K7TA 1YQ3A 2C64A 4H4PA 4CCRA 2WESA 4UDRA 3NG7X 3RP6A 3UOYA 1CC4A 2FJAA 1EBDA 4JNAA 1V59A 2B9YA 2XLTA 3GD4A 2VQBA 4H4WA 2BXRA 2XYOA 3DGHA 1Y56A 4TM3A 4YSHA 2A89A 3H8LA 3NRNA 5KOWA 1F8SA 4B66A 4C3XA 2ZBWA 1DJNA 2C7GA 3HYVA 4EIPA 1VRQB 4A6NA 2OA1A 3P9UA 5JCLA 3NK2X 2C76A 3UCLA 3UKQA 3FMWA 5J60A 3DMEA 1CBOA 1N4WA 1D4CA 1E39A 4JNQA 1QLBA 3NKSA 3T31A 2C65A 3SQPA 3UKHA 1D4DA 3DH9A 3NYCA 4H7UA 1COYA 1NHSA 3CNSA 1H84A 1Q1WA 3DJGX 2JAEA 3HZLA 1K0JA 1E6EA 3AD7B 4I59A 2C73A 4OVIA 2GR0A 2BYBA 4OPLA 4XWZA 4H2RA 1DXLA 4OPDA 4BURA 1IUUA 3ATQA 4CNJA 2EQ8A 5M10A 1YQZA 4Y4LA 3UTEA 3QSMA 4II3A 4K2XA 2XFQA 3DK8A 2NVKX 3NT6A 1ZP0A 1O5WA 3GMCA 2GAHB 3B6DA 1W4XA 1XHCA 1CJCA 4B63A 4EQWA 2WU2A 4EMWA 2FJDA 2GR3A 3CPHG 1JEHA 2BK4A 3ICSA 5KVIA 1S2YA 3VQRA 2YVGA 5HY5A 2ACZA 3UTHA 3P4SA 3V3NA 4USRA 1CL0A 5U25A 2QAEA 1GOSA 1S3EA 2OLNA 1YQ4A 5KOXA 1TYTA 3PVCA 1E1LA 1VQWA 1H6VA 4U8JA 2XCGA 2YAUA 4UDQA 3F8DA 1N4UA 4C77A 3LOVA 1NENA 2XVEA 3SFDA 3NN0X 2A8XA 4BJYA 4FDCB 4G6GA 3IF9A 3KA7A 3DJEA 4AOSA 1JRXA 1L9DA 2BXSA 4NTEA 2GVCA 4J33A 3F8RA 4B64A 2ZZ0A 3LZXA 5KWFA 3JSKA 2C3CA 1KNPA 4ADWA 5JCIA 4AT2A 2GRTA 4Z26A 4DGKA 3CNPA 2WDRA 3ICRA 2OAMA 2C72A 4U2LA 1PN0A 2B9XA 3SM8A 4H4YA 3K30A 1FECA 2R9ZA 1ZY8A 2RGHA 3B3RA 2BA9A 2BS2A 4JN9A 1Y56B 4G9KA 2F5ZA 2XFNA 3CGCA 1BWCA 3CGDA 1K4QA 3ADAB 3ABVA 1GRTA 1OJ9A 3V76A 3I6DA 4GUVA 1TDOA 4A6NB 3CGEA 3ZYXA 1N1PA 1NHQA 3URHA 4BV6A 2CVJA 3AE1A 2UZZA 2YM1A 5HYMA 2V60A 4K7ZA 3AD8B 4AP3A 2JB2A 4XWRA 2VOUA 1NHRA 2JKCA 3Q6JA 4USQA 3AWIA 4FK1A 3AE3A 1NDAA 3ALJA 4XXGA 5GRTA 4JY2A 2YQUA 3ALLA 2Q6UA 5KMPA 1ZMDA 3NYEA 1TYPA 3EPTA 3IHGA 1GPEA 1B37A 3AXBA 3T2YA 5EB4A 2WDQA 1QJDA 1IUVA 2LFCA 3QJ4A 3T0KA 2YLSA 1ONFA 4H4SA 1TRBA 1L0VA 4CRTA 2WOWA 1XDIA 3UTFA 2Q7VA 3QFAA 4YTNA 2BK5A 2XVJA 3ISHA 3BNUA 1YKJA 1NG4A 3ITJA 1AOGA 3BHKA 1PXAA 5CQFA 1PXCA 2IVDA 2VQ7A 4NWZA 1Z6LA 2WPEA 2QA2A 2NPXA 5KRQA 5U63A 3RNMA 1REOA 4A5LA 1GTHA 2JB1A 2Y6RA 3C4NA 4H2NA 3SFEA 4Z44A 1F6MA 2XFPA 3P1WA 4G74A 4KX6A 2GF3A 2RABA 2EQ7A 2O9ZA 1GT8A 2V61A 4EMIA 4TM4A 1JNZA 3AYJA 2WP6A 3KVEA 3UOZA 4K5RA 4A7AA 3AE4A 5HXIA 4GDEA 5KMSA 1KSSA 2YLZA 2W0HA 4TM0A 3K7QX 2ARDA 4HB9A 1K0LA 4NEVA 5KMRA 1NEKA 2FBWA 4H4QA 4H2QA 5IQ1A 4JQ9A 5KMQA 3FBSA 4U8OA 1JOAA 1KF6A 4K8DA 2YWLA 5FS7A 5BULA 1SEZA 1ZMCA 1L9CA 3R9UA 2X8GA 1BZLA 1LV0A 2JK6A 2WP9A 4YTMA 3SY4A 1GRBA 5M0ZA 2V5ZA 2OLOA 2WPFA 1Y0PA 3OC4A 4H2PA 4C3YA 3GDNA 2CFYA 3RHAA 5C3JA 4H50A 2WETA 1PJ7A 4YWOA 3LADA 4X9NA 2WPCA 4UP3A 2WOIA 1PBFA 4YTPA 4X4JA 1FEBA 3DJDA 2AAQA 2YR5A 2WDVA 3EAOA 3UKPA 4E0VA 4PABA 4GAPA 4EM3A 2VVLG 4OPUA 1NAAA 4O5QA 3C96A 5KXJA 1N4VA 4I58A 4LA1A 3KPKA 4WCTA 4GAVA 1KFYA 1OJTA 4U8KA 1DOEA 3LB8A 4CY8A 3SGLA 4EQXA 5IPYA 1UKVG 1ZOYA 4H4UA 1MO9A 2EQ6A 1GEUA 3FIMB 2YG5A 1M64A 2YG7A 2YG4A 4J2WA 3KD9A 2WBAA 5ER0A 1BGNA 2XLRA 3SZ0A 2XVIA 2XLUA 1GERA 2WQYA 2XVHA 4II2A 4EIQA 1VDCA 5CKUA 4EQRA 2APGA 4Z43A 2YVFA 4U8NA 1S2QA 4P9SA 4U8PA 1E7PA 4IVOB 3GSIA 3UP4A 1KNRA 4A99A 1ELIA 4JDRA 5U1OA 3SX6A 1GRFA 2C75A 3UP5A 3NYFA 1E1MA 3CPIG 2R46A 2BACA 2B7SA 1LTXR 5GSNA 2V3BA 3CTYA 2FJBA 1GETA 1PJ5A 2WU5A 1ZOVA 2E4GA 4IA5A 3PO7A 4D03A 4H4ZA 1BGJA 1ZK7A 1B8SA 1LQUA 2H88A 1GREA 1GNDA 3VRAA 2I0ZA 2BC1A 5KVHA 5FS6A 4GRTA 2A87A 1H86A 4A65A 2XDOA 4FK1C 3CGBA 4YKGA 2ZZBA 4U8IA 3SZFA 2X50A 5IQ4A 2Q0LA 1H81A 3UKFA 3CNJA 3AE2A 4IA6A 2AQJA 2R4EA 4RG4A 4J36A 1PDHA 1PJ6A 3G5QA 3UKAA 1GRAA 2BRYA 3HYXA 2GR2A 2VRMA 3BI4A 1Q1RA 3L8KA 3UTGA 3F8PA 2YVJA 1B4VA 2TMDA 4PAAA 4J34A 4YSYA 3VRDB 3BNMA 4A9WA 3O0HA 3AYLA 2R0PA 4BJZA 3T37A 1IUSA 3AECA 3LXDA 4Z2RA 1FL2A 1CC6A 3WE0A 3FPZA 3FG2P 3REDA 2X99A 1PS9A 3NLCA 2ZZCA 1DJQA 4J56A 4OPIA 1LVLA 4BK1A 1GV4A 4GR1A 2YM2A 2CDUA 1NG3A 1BKWA 3AYIA 2J3NA 1D7LA 3BHFA 3KPFA 1E1NA 3P4RA 3S61A 5FS9A 1RYIA 3NK1X 3Q9TA 3AE6A 3SXIA 3PS9A 3VRBA 3IC9A 4YSZA 3EANA 4MJWA 4OCGA 1EL5A 1F8RA 5HHFA 1O95A 1LJ1A 2RGJA 3IWAA 4CCQA 4YKFA 2GB0A 4ZCCA 5KNLA 1D4EA 2OALA 3QVRA 2R0GA 1RP0A 4AOXA 2YLTA 4B69A 3NHOX 3M12A 3L1RA 1ZKQA 2YR6A 4M52A 2BK3A 5EB5A 4K5SA 1EL9A 4J57A 1FOHA 2FJEA 2PYXA 1BF3A 1TDKA 1IJHA 2C67A 1GALA 5BUKA 2JB3A 4U2SA 2IVEA 4BK2A 1JRZA 2BS3A 3AEGA 4OPCA 3UOVA 3SZCA 4HA6A 1PBBA 2CULA 3GWDA 1IUWA 3GYXA 4ECHA 4U2TA 1F8WA 1X31B 5LV9A 1PBEA 2E1MA 3DJJA 1OJAA 1S3BA 4TLXA 1VG9A 4ZCDA 2GEWA 1CJ2A 4Y4MA 4Z24A 3LZWA 1O94A 4B1BA 4H4XA 3C4AA 1ZDLA 3NNEA 5JCMA 3AEBA 1B5QA 1RSGA 2EQ9A 4Z25A 3UOXA 3IHMA 4IV9A 4Z2UA 4OPGA 2C4CA 1CC2A 2XFOA 3AEFA 4K22A 5EBKA 2GAGB 3GYJA 4U8MA 3M13A 4J31A 2VRLA 1H7WA 2VVLA 3DA1A 3QFBA 4KPRA 1ZX9A 4YXDA 1PHHA 4G73A 3OZ2A 3AEAA 2Q0KA 2R0CA 2H89A 2X8CA 2XVFA 3NH3X 4BK3A 4Z2TA 5J7XA 2GMHA 3CPJG 3II4A 3UKKA 3UKLA 2WP5A 1VG0A 1JU2A 3ATRA 4AT0A 3I3LA 4EM4A 3T14A 1CJ3A 2DKHA 4DSGA 3AD9B 1L9EA 2BCGG 2IIDA 3SYIA 3NGCX 2GV8A 3K7MX 3RP7A 2Z5XA 5JCKA 4B65A 1LPFA 4N9XA 1YY5A 2XFUA 3COXA 1OJCA 1TDNA 1CJ4A 3D1CA 4REKA 2YLRA 3H8IA 2PHHA 2HQMA 2X8HA 4JY3A 4CNKA 4D04A 1F3PA 3ALMA 2AR8A 1FEAA 4OPTA 1E1KA 4B67A 2WHDA 3QVPA 3S5WA 1M6IA 4LU6A 2TPRA 4YSXA 3NIXA 4CBQA 4B68A 4EQSA 5FMHA 2VZ2A 4A79A 4LIIA 4UDPA 1GRGA 2BCPA 3AB1A 4FX9A 1TDEA 4NNJA 2DKIA 4C74A 1OJDA 5EOWA 2GR1A 2BRAA 3AE8A 3AE5A 4RG3A 4U8LA 4ZN0A 5JCNA 1MOKA 1NHPA 1DOCA 1PXBA 4Y4NA 1IUTA 1EL7A 2R45A 2GQWA 2GH5A 3KLJA 1QO8A 1XANA 1PBCA 3KKJA 5TR3A 4DSHA 3H4KA 2V6OA 1D5TA 2BC0A 2B9WA 1CHUA 2V3AA 4APNA 1GXFA 1HYUA 3DGZA 1DOBA 4DNAA 2WEUA 1GRHA 5C2TA 3T2KA 3NN6X 3VR8A 3M0OA 1XPQA 1GSNA 3AEEA 3V3OA 3HYWA 4TLZA 3ICTA 2C70A 4AP1A 1CF3A 3GWFA 3NK0X 3NTDA 3SZWA 4C5OA 4EMJA 4RSLA 2YLXA 1Q9IA 2BABA 4GF7A 3QSSA 2E5VA 4GDPA 2B7RA 4H4VA 2YR4A 4G6HA 3RP8A 4WX1A 1PBDA 2WOVA 3DK9A 3AEDA 1KDGA 3CIRA 5BRTA 1P2EA 3P4PA 1NPXA 2R4JA 1GTEA 1JRYA 3EF6A 4ICYA 3DK4A 4H4TA 1EL8A 1GESA 3GYIA 1DNCA 3CN8A 2X3NA 3GDPA 1P2HA 2JBVA 2YG6A 2Z5YA 1KSUA 2VVMA 3G5RA 3GD3A 3LJPA 4IVMB 1LQTA 5L46A 5DBJA 4YT0A 4X9MA 3GRSA 3NTAA 3P4QA 3ZDNA 2C66A 1DODA 3D8XA 3T2ZA 3AE9A 2Y6QA 3AE7A 1MXTA 3G5SA 3CNTA 4NEWA 3QSEA 3GRTA 5BVAA 2C3DA 3VR9A 1H83A 1JNRA 2QA1A 3BI5A 4CY6A 2BS4A 4O5UA 3BI2A 1TDFA 2B76A 1D7YA 2GQFA 2YLWA 4H4RA 4TM1A 5FS8A
chains in the Genus database with same CATH topology
3GMBA 1H82A 3KU9A 1FCDA 1H7XA 4NTDA 2WS3A 4GCMA 2GMJA 3E1TA 2QCUA 1K0IA 2XLSA 4NZHA 2YG3A 2RGOA 2XLPA 3CNDA 4NTCA 1IUXA 3CMMA 3K7TA 1YQ3A 2C64A 4H4PA 4CCRA 2WESA 4UDRA 3NG7X 3RP6A 3UOYA 1CC4A 2FJAA 1EBDA 4JNAA 1V59A 2B9YA 2XLTA 3GD4A 2VQBA 4H4WA 2BXRA 2XYOA 3DGHA 1Y56A 4TM3A 4YSHA 2A89A 3H8LA 3NRNA 5KOWA 1F8SA 4B66A 4C3XA 2ZBWA 1DJNA 2C7GA 3HYVA 4EIPA 1VRQB 4A6NA 2OA1A 3P9UA 5JCLA 3NK2X 2C76A 3UCLA 3UKQA 3FMWA 5J60A 3DMEA 1CBOA 1N4WA 1D4CA 1E39A 4JNQA 1QLBA 3NKSA 3T31A 2C65A 3SQPA 3UKHA 1D4DA 3DH9A 3NYCA 4H7UA 1COYA 1NHSA 3CNSA 1H84A 1Q1WA 3DJGX 2JAEA 3HZLA 1K0JA 1E6EA 3AD7B 4I59A 2C73A 4OVIA 2GR0A 2BYBA 4OPLA 4XWZA 4H2RA 1DXLA 4OPDA 4BURA 1IUUA 3ATQA 4CNJA 2EQ8A 5M10A 1YQZA 4Y4LA 3UTEA 3QSMA 4II3A 4K2XA 2XFQA 3DK8A 2NVKX 3NT6A 1ZP0A 1O5WA 3GMCA 2GAHB 3B6DA 1W4XA 1XHCA 1CJCA 4B63A 4EQWA 2WU2A 4EMWA 2FJDA 2GR3A 3CPHG 1JEHA 2BK4A 3ICSA 5KVIA 1S2YA 3VQRA 2YVGA 5HY5A 2ACZA 3UTHA 3P4SA 3V3NA 4USRA 1CL0A 5U25A 2QAEA 1GOSA 1S3EA 2OLNA 1YQ4A 5KOXA 1TYTA 3PVCA 1E1LA 1VQWA 1H6VA 4U8JA 2XCGA 2YAUA 4UDQA 3F8DA 1N4UA 4C77A 3LOVA 1NENA 2XVEA 3SFDA 3NN0X 2A8XA 4BJYA 4FDCB 4G6GA 3IF9A 3KA7A 3DJEA 4AOSA 1JRXA 1L9DA 2BXSA 4NTEA 2GVCA 4J33A 3F8RA 4B64A 2ZZ0A 3LZXA 5KWFA 3JSKA 2C3CA 1KNPA 4ADWA 5JCIA 4AT2A 2GRTA 4Z26A 4DGKA 3CNPA 2WDRA 3ICRA 2OAMA 2C72A 4U2LA 1PN0A 2B9XA 3SM8A 4H4YA 3K30A 1FECA 2R9ZA 1ZY8A 2RGHA 3B3RA 2BA9A 2BS2A 4JN9A 1Y56B 4G9KA 2F5ZA 2XFNA 3CGCA 1BWCA 3CGDA 1K4QA 3ADAB 3ABVA 1GRTA 1OJ9A 3V76A 3I6DA 4GUVA 1TDOA 4A6NB 3CGEA 3ZYXA 1N1PA 1NHQA 3URHA 4BV6A 2CVJA 3AE1A 2UZZA 2YM1A 5HYMA 2V60A 4K7ZA 3AD8B 4AP3A 2JB2A 4XWRA 2VOUA 1NHRA 2JKCA 3Q6JA 4USQA 3AWIA 4FK1A 3AE3A 1NDAA 3ALJA 4XXGA 5GRTA 4JY2A 2YQUA 3ALLA 2Q6UA 5KMPA 1ZMDA 3NYEA 1TYPA 3EPTA 3IHGA 1GPEA 1B37A 3AXBA 3T2YA 5EB4A 2WDQA 1QJDA 1IUVA 2LFCA 3QJ4A 3T0KA 2YLSA 1ONFA 4H4SA 1TRBA 1L0VA 4CRTA 2WOWA 1XDIA 3UTFA 2Q7VA 3QFAA 4YTNA 2BK5A 2XVJA 3ISHA 3BNUA 1YKJA 1NG4A 3ITJA 1AOGA 3BHKA 1PXAA 5CQFA 1PXCA 2IVDA 2VQ7A 4NWZA 1Z6LA 2WPEA 2QA2A 2NPXA 5KRQA 5U63A 3RNMA 1REOA 4A5LA 1GTHA 2JB1A 2Y6RA 3C4NA 4H2NA 3SFEA 4Z44A 1F6MA 2XFPA 3P1WA 4G74A 4KX6A 2GF3A 2RABA 2EQ7A 2O9ZA 1GT8A 2V61A 4EMIA 4TM4A 1JNZA 3AYJA 2WP6A 3KVEA 3UOZA 4K5RA 4A7AA 3AE4A 5HXIA 4GDEA 5KMSA 1KSSA 2YLZA 2W0HA 4TM0A 3K7QX 2ARDA 4HB9A 1K0LA 4NEVA 5KMRA 1NEKA 2FBWA 4H4QA 4H2QA 5IQ1A 4JQ9A 5KMQA 3FBSA 4U8OA 1JOAA 1KF6A 4K8DA 2YWLA 5FS7A 5BULA 1SEZA 1ZMCA 1L9CA 3R9UA 2X8GA 1BZLA 1LV0A 2JK6A 2WP9A 4YTMA 3SY4A 1GRBA 5M0ZA 2V5ZA 2OLOA 2WPFA 1Y0PA 3OC4A 4H2PA 4C3YA 3GDNA 2CFYA 3RHAA 5C3JA 4H50A 2WETA 1PJ7A 4YWOA 3LADA 4X9NA 2WPCA 4UP3A 2WOIA 1PBFA 4YTPA 4X4JA 1FEBA 3DJDA 2AAQA 2YR5A 2WDVA 3EAOA 3UKPA 4E0VA 4PABA 4GAPA 4EM3A 2VVLG 4OPUA 1NAAA 4O5QA 3C96A 5KXJA 1N4VA 4I58A 4LA1A 3KPKA 4WCTA 4GAVA 1KFYA 1OJTA 4U8KA 1DOEA 3LB8A 4CY8A 3SGLA 4EQXA 5IPYA 1UKVG 1ZOYA 4H4UA 1MO9A 2EQ6A 1GEUA 3FIMB 2YG5A 1M64A 2YG7A 2YG4A 4J2WA 3KD9A 2WBAA 5ER0A 1BGNA 2XLRA 3SZ0A 2XVIA 2XLUA 1GERA 2WQYA 2XVHA 4II2A 4EIQA 1VDCA 5CKUA 4EQRA 2APGA 4Z43A 2YVFA 4U8NA 1S2QA 4P9SA 4U8PA 1E7PA 4IVOB 3GSIA 3UP4A 1KNRA 4A99A 1ELIA 4JDRA 5U1OA 3SX6A 1GRFA 2C75A 3UP5A 3NYFA 1E1MA 3CPIG 2R46A 2BACA 2B7SA 1LTXR 5GSNA 2V3BA 3CTYA 2FJBA 1GETA 1PJ5A 2WU5A 1ZOVA 2E4GA 4IA5A 3PO7A 4D03A 4H4ZA 1BGJA 1ZK7A 1B8SA 1LQUA 2H88A 1GREA 1GNDA 3VRAA 2I0ZA 2BC1A 5KVHA 5FS6A 4GRTA 2A87A 1H86A 4A65A 2XDOA 4FK1C 3CGBA 4YKGA 2ZZBA 4U8IA 3SZFA 2X50A 5IQ4A 2Q0LA 1H81A 3UKFA 3CNJA 3AE2A 4IA6A 2AQJA 2R4EA 4RG4A 4J36A 1PDHA 1PJ6A 3G5QA 3UKAA 1GRAA 2BRYA 3HYXA 2GR2A 2VRMA 3BI4A 1Q1RA 3L8KA 3UTGA 3F8PA 2YVJA 1B4VA 2TMDA 4PAAA 4J34A 4YSYA 3VRDB 3BNMA 4A9WA 3O0HA 3AYLA 2R0PA 4BJZA 3T37A 1IUSA 3AECA 3LXDA 4Z2RA 1FL2A 1CC6A 3WE0A 3FPZA 3FG2P 3REDA 2X99A 1PS9A 3NLCA 2ZZCA 1DJQA 4J56A 4OPIA 1LVLA 4BK1A 1GV4A 4GR1A 2YM2A 2CDUA 1NG3A 1BKWA 3AYIA 2J3NA 1D7LA 3BHFA 3KPFA 1E1NA 3P4RA 3S61A 5FS9A 1RYIA 3NK1X 3Q9TA 3AE6A 3SXIA 3PS9A 3VRBA 3IC9A 4YSZA 3EANA 4MJWA 4OCGA 1EL5A 1F8RA 5HHFA 1O95A 1LJ1A 2RGJA 3IWAA 4CCQA 4YKFA 2GB0A 4ZCCA 5KNLA 1D4EA 2OALA 3QVRA 2R0GA 1RP0A 4AOXA 2YLTA 4B69A 3NHOX 3M12A 3L1RA 1ZKQA 2YR6A 4M52A 2BK3A 5EB5A 4K5SA 1EL9A 4J57A 1FOHA 2FJEA 2PYXA 1BF3A 1TDKA 1IJHA 2C67A 1GALA 5BUKA 2JB3A 4U2SA 2IVEA 4BK2A 1JRZA 2BS3A 3AEGA 4OPCA 3UOVA 3SZCA 4HA6A 1PBBA 2CULA 3GWDA 1IUWA 3GYXA 4ECHA 4U2TA 1F8WA 1X31B 5LV9A 1PBEA 2E1MA 3DJJA 1OJAA 1S3BA 4TLXA 1VG9A 4ZCDA 2GEWA 1CJ2A 4Y4MA 4Z24A 3LZWA 1O94A 4B1BA 4H4XA 3C4AA 1ZDLA 3NNEA 5JCMA 3AEBA 1B5QA 1RSGA 2EQ9A 4Z25A 3UOXA 3IHMA 4IV9A 4Z2UA 4OPGA 2C4CA 1CC2A 2XFOA 3AEFA 4K22A 5EBKA 2GAGB 3GYJA 4U8MA 3M13A 4J31A 2VRLA 1H7WA 2VVLA 3DA1A 3QFBA 4KPRA 1ZX9A 4YXDA 1PHHA 4G73A 3OZ2A 3AEAA 2Q0KA 2R0CA 2H89A 2X8CA 2XVFA 3NH3X 4BK3A 4Z2TA 5J7XA 2GMHA 3CPJG 3II4A 3UKKA 3UKLA 2WP5A 1VG0A 1JU2A 3ATRA 4AT0A 3I3LA 4EM4A 3T14A 1CJ3A 2DKHA 4DSGA 3AD9B 1L9EA 2BCGG 2IIDA 3SYIA 3NGCX 2GV8A 3K7MX 3RP7A 2Z5XA 5JCKA 4B65A 1LPFA 4N9XA 1YY5A 2XFUA 3COXA 1OJCA 1TDNA 1CJ4A 3D1CA 4REKA 2YLRA 3H8IA 2PHHA 2HQMA 2X8HA 4JY3A 4CNKA 4D04A 1F3PA 3ALMA 2AR8A 1FEAA 4OPTA 1E1KA 4B67A 2WHDA 3QVPA 3S5WA 1M6IA 4LU6A 2TPRA 4YSXA 3NIXA 4CBQA 4B68A 4EQSA 5FMHA 2VZ2A 4A79A 4LIIA 4UDPA 1GRGA 2BCPA 3AB1A 4FX9A 1TDEA 4NNJA 2DKIA 4C74A 1OJDA 5EOWA 2GR1A 2BRAA 3AE8A 3AE5A 4RG3A 4U8LA 4ZN0A 5JCNA 1MOKA 1NHPA 1DOCA 1PXBA 4Y4NA 1IUTA 1EL7A 2R45A 2GQWA 2GH5A 3KLJA 1QO8A 1XANA 1PBCA 3KKJA 5TR3A 4DSHA 3H4KA 2V6OA 1D5TA 2BC0A 2B9WA 1CHUA 2V3AA 4APNA 1GXFA 1HYUA 3DGZA 1DOBA 4DNAA 2WEUA 1GRHA 5C2TA 3T2KA 3NN6X 3VR8A 3M0OA 1XPQA 1GSNA 3AEEA 3V3OA 3HYWA 4TLZA 3ICTA 2C70A 4AP1A 1CF3A 3GWFA 3NK0X 3NTDA 3SZWA 4C5OA 4EMJA 4RSLA 2YLXA 1Q9IA 2BABA 4GF7A 3QSSA 2E5VA 4GDPA 2B7RA 4H4VA 2YR4A 4G6HA 3RP8A 4WX1A 1PBDA 2WOVA 3DK9A 3AEDA 1KDGA 3CIRA 5BRTA 1P2EA 3P4PA 1NPXA 2R4JA 1GTEA 1JRYA 3EF6A 4ICYA 3DK4A 4H4TA 1EL8A 1GESA 3GYIA 1DNCA 3CN8A 2X3NA 3GDPA 1P2HA 2JBVA 2YG6A 2Z5YA 1KSUA 2VVMA 3G5RA 3GD3A 3LJPA 4IVMB 1LQTA 5L46A 5DBJA 4YT0A 4X9MA 3GRSA 3NTAA 3P4QA 3ZDNA 2C66A 1DODA 3D8XA 3T2ZA 3AE9A 2Y6QA 3AE7A 1MXTA 3G5SA 3CNTA 4NEWA 3QSEA 3GRTA 5BVAA 2C3DA 3VR9A 1H83A 1JNRA 2QA1A 3BI5A 4CY6A 2BS4A 4O5UA 3BI2A 1TDFA 2B76A 1D7YA 2GQFA 2YLWA 4H4RA 4TM1A 5FS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GMB A;  1H82 A;  3KU9 A;  1FCD A;  1H7X A;  4NTD A;  2WS3 A;  4GCM A;  2GMJ A;  3E1T A;  2QCU A;  1K0I A;  2XLS A;  4NZH A;  2YG3 A;  2RGO A;  2XLP A;  3CND A;  4NTC A;  1IUX A;  3K7T A;  1YQ3 A;  2C64 A;  4H4P A;  4CCR A;  2WES A;  4UDR A;  3NG7 X;  3RP6 A;  3UOY A;  1CC4 A;  2FJA A;  1EBD A;  4JNA A;  1V59 A;  2B9Y A;  2XLT A;  3GD4 A;  2VQB A;  4H4W A;  2BXR A;  2XYO A;  3DGH A;  1Y56 A;  4TM3 A;  4YSH A;  2A89 A;  3H8L A;  3NRN A;  5KOW A;  1F8S A;  4B66 A;  4C3X A;  2ZBW A;  1DJN A;  2C7G A;  4EIP A;  1VRQ B;  4A6N A;  2OA1 A;  3P9U A;  5JCL A;  3NK2 X;  2C76 A;  3UCL A;  3UKQ A;  3FMW A;  5J60 A;  3DME A;  1CBO A;  1N4W A;  1D4C A;  1E39 A;  4JNQ A;  1QLB A;  3NKS A;  2C65 A;  3SQP A;  3UKH A;  1D4D A;  3DH9 A;  3NYC A;  4H7U A;  1COY A;  1NHS A;  3CNS A;  1H84 A;  1Q1W A;  3DJG X;  2JAE A;  3HZL A;  1K0J A;  1E6E A;  3AD7 B;  4I59 A;  2C73 A;  4OVI A;  2GR0 A;  2BYB A;  4OPL A;  4XWZ A;  4H2R A;  1DXL A;  4OPD A;  4BUR A;  1IUU A;  3ATQ A;  4CNJ A;  2EQ8 A;  5M10 A;  1YQZ A;  4Y4L A;  3UTE A;  3QSM A;  4K2X A;  2XFQ A;  3DK8 A;  2NVK X;  3NT6 A;  1ZP0 A;  1O5W A;  3GMC A;  2GAH B;  3B6D A;  1W4X A;  1XHC A;  1CJC A;  4B63 A;  4EQW A;  2WU2 A;  4EMW A;  2FJD A;  2GR3 A;  3CPH G;  1JEH A;  2BK4 A;  3ICS A;  5KVI A;  1S2Y A;  3VQR A;  2YVG A;  5HY5 A;  2ACZ A;  3UTH A;  3P4S A;  3V3N A;  4USR A;  1CL0 A;  5U25 A;  2QAE A;  1GOS A;  1S3E A;  2OLN A;  1YQ4 A;  5KOX A;  1TYT A;  3PVC A;  1E1L A;  1VQW A;  1H6V A;  4U8J A;  2XCG A;  2YAU A;  4UDQ A;  3F8D A;  1N4U A;  4C77 A;  3LOV A;  1NEN A;  2XVE A;  3SFD A;  3NN0 X;  2A8X A;  4BJY A;  4FDC B;  3IF9 A;  3KA7 A;  3DJE A;  4AOS A;  1JRX A;  1L9D A;  2BXS A;  4NTE A;  2GVC A;  4J33 A;  3F8R A;  4B64 A;  2ZZ0 A;  3LZX A;  5KWF A;  3JSK A;  2C3C A;  1KNP A;  4ADW A;  5JCI A;  4AT2 A;  2GRT A;  4Z26 A;  4DGK A;  3CNP A;  2WDR A;  3ICR A;  2OAM A;  2C72 A;  4U2L A;  1PN0 A;  2B9X A;  3SM8 A;  4H4Y A;  3K30 A;  1FEC A;  2R9Z A;  1ZY8 A;  2RGH A;  3B3R A;  2BA9 A;  2BS2 A;  4JN9 A;  1Y56 B;  2F5Z A;  2XFN A;  3CGC A;  1BWC A;  3CGD A;  1K4Q A;  3ADA B;  3ABV A;  1GRT A;  1OJ9 A;  3V76 A;  3I6D A;  4GUV A;  1TDO A;  4A6N B;  3CGE A;  3ZYX A;  1N1P A;  1NHQ A;  3URH A;  4BV6 A;  2CVJ A;  3AE1 A;  2UZZ A;  2YM1 A;  5HYM A;  2V60 A;  4K7Z A;  3AD8 B;  4AP3 A;  2JB2 A;  4XWR A;  2VOU A;  1NHR A;  2JKC A;  3Q6J A;  4USQ A;  3AWI A;  4FK1 A;  3AE3 A;  1NDA A;  3ALJ A;  4XXG A;  5GRT A;  4JY2 A;  2YQU A;  3ALL A;  2Q6U A;  1ZMD A;  3NYE A;  1TYP A;  3EPT A;  3IHG A;  1GPE A;  1B37 A;  3AXB A;  5EB4 A;  2WDQ A;  1QJD A;  1IUV A;  2LFC A;  3QJ4 A;  2YLS A;  1ONF A;  4H4S A;  1TRB A;  1L0V A;  4CRT A;  2WOW A;  1XDI A;  3UTF A;  2Q7V A;  3QFA A;  4YTN A;  2BK5 A;  2XVJ A;  3ISH A;  3BNU A;  1YKJ A;  1NG4 A;  3ITJ A;  1AOG A;  3BHK A;  1PXA A;  5CQF A;  1PXC A;  2IVD A;  2VQ7 A;  1Z6L A;  2WPE A;  2QA2 A;  2NPX A;  5KRQ A;  5U63 A;  3RNM A;  1REO A;  4A5L A;  1GTH A;  2JB1 A;  2Y6R A;  3C4N A;  4H2N A;  3SFE A;  4Z44 A;  1F6M A;  2XFP A;  3P1W A;  4KX6 A;  2GF3 A;  2RAB A;  2EQ7 A;  2O9Z A;  1GT8 A;  2V61 A;  4EMI A;  4TM4 A;  1JNZ A;  3AYJ A;  2WP6 A;  3KVE A;  3UOZ A;  4K5R A;  4A7A A;  3AE4 A;  5HXI A;  4GDE A;  1KSS A;  2YLZ A;  2W0H A;  4TM0 A;  3K7Q X;  2ARD A;  4HB9 A;  1K0L A;  4NEV A;  1NEK A;  2FBW A;  4H4Q A;  4H2Q A;  5IQ1 A;  4JQ9 A;  3FBS A;  4U8O A;  1JOA A;  1KF6 A;  4K8D A;  2YWL A;  5FS7 A;  5BUL A;  1SEZ A;  1ZMC A;  1L9C A;  3R9U A;  2X8G A;  1BZL A;  1LV0 A;  2JK6 A;  2WP9 A;  4YTM A;  1GRB A;  5M0Z A;  2V5Z A;  2OLO A;  2WPF A;  1Y0P A;  3OC4 A;  4H2P A;  4C3Y A;  3GDN A;  2CFY A;  3RHA A;  5C3J A;  4H50 A;  2WET A;  1PJ7 A;  4YWO A;  3LAD A;  4X9N A;  2WPC A;  4UP3 A;  2WOI A;  1PBF A;  4YTP A;  4X4J A;  1FEB A;  3DJD A;  2AAQ A;  2YR5 A;  2WDV A;  3EAO A;  3UKP A;  4E0V A;  4PAB A;  4EM3 A;  2VVL G;  4OPU A;  1NAA A;  4O5Q A;  3C96 A;  5KXJ A;  1N4V A;  4I58 A;  4LA1 A;  4WCT A;  1KFY A;  1OJT A;  4U8K A;  1DOE A;  3LB8 A;  4CY8 A;  3SGL A;  4EQX A;  5IPY A;  1UKV G;  1ZOY A;  4H4U A;  1MO9 A;  2EQ6 A;  1GEU A;  3FIM B;  2YG5 A;  1M64 A;  2YG7 A;  2YG4 A;  4J2W A;  3KD9 A;  2WBA A;  5ER0 A;  1BGN A;  2XLR A;  2XVI A;  2XLU A;  1GER A;  2WQY A;  2XVH A;  4EIQ A;  1VDC A;  5CKU A;  4EQR A;  2APG A;  4Z43 A;  2YVF A;  4U8N A;  1S2Q A;  4P9S A;  4U8P A;  1E7P A;  4IVO B;  3GSI A;  3UP4 A;  1KNR A;  4A99 A;  1ELI A;  4JDR A;  5U1O A;  1GRF A;  2C75 A;  3UP5 A;  3NYF A;  1E1M A;  3CPI G;  2R46 A;  2BAC A;  2B7S A;  1LTX R;  5GSN A;  2V3B A;  3CTY A;  2FJB A;  1GET A;  1PJ5 A;  2WU5 A;  1ZOV A;  2E4G A;  4IA5 A;  3PO7 A;  4D03 A;  4H4Z A;  1BGJ A;  1ZK7 A;  1B8S A;  1LQU A;  2H88 A;  1GRE A;  1GND A;  3VRA A;  2I0Z A;  2BC1 A;  5KVH A;  5FS6 A;  4GRT A;  2A87 A;  1H86 A;  4A65 A;  2XDO A;  4FK1 C;  3CGB A;  4YKG A;  2ZZB A;  4U8I A;  2X50 A;  5IQ4 A;  2Q0L A;  1H81 A;  3UKF A;  3CNJ A;  3AE2 A;  4IA6 A;  2AQJ A;  2R4E A;  4RG4 A;  4J36 A;  1PDH A;  1PJ6 A;  3G5Q A;  3UKA A;  1GRA A;  2GR2 A;  2VRM A;  3BI4 A;  1Q1R A;  3L8K A;  3UTG A;  3F8P A;  2YVJ A;  1B4V A;  2TMD A;  4PAA A;  4J34 A;  4YSY A;  3VRD B;  3BNM A;  4A9W A;  3O0H A;  3AYL A;  2R0P A;  4BJZ A;  3T37 A;  1IUS A;  3AEC A;  3LXD A;  4Z2R A;  1FL2 A;  1CC6 A;  3WE0 A;  3FPZ A;  3FG2 P;  3RED A;  2X99 A;  1PS9 A;  3NLC A;  2ZZC A;  1DJQ A;  4J56 A;  4OPI A;  1LVL A;  4BK1 A;  1GV4 A;  4GR1 A;  2YM2 A;  2CDU A;  1NG3 A;  1BKW A;  3AYI A;  2J3N A;  1D7L A;  3BHF A;  3KPF A;  1E1N A;  3P4R A;  3S61 A;  5FS9 A;  1RYI A;  3NK1 X;  3Q9T A;  3AE6 A;  3VRB A;  3PS9 A;  3IC9 A;  4YSZ A;  3EAN A;  4MJW A;  4OCG A;  1EL5 A;  1F8R A;  5HHF A;  1O95 A;  1LJ1 A;  2RGJ A;  3IWA A;  4CCQ A;  4YKF A;  2GB0 A;  4ZCC A;  1D4E A;  2OAL A;  3QVR A;  2R0G A;  1RP0 A;  4AOX A;  2YLT A;  4B69 A;  3NHO X;  3M12 A;  3L1R A;  1ZKQ A;  2YR6 A;  4M52 A;  2BK3 A;  5EB5 A;  4K5S A;  1EL9 A;  4J57 A;  1FOH A;  2FJE A;  2PYX A;  1BF3 A;  1TDK A;  1IJH A;  2C67 A;  1GAL A;  5BUK A;  2JB3 A;  4U2S A;  2IVE A;  4BK2 A;  1JRZ A;  2BS3 A;  3AEG A;  4OPC A;  3UOV A;  4HA6 A;  1PBB A;  2CUL A;  3GWD A;  1IUW A;  3GYX A;  4ECH A;  4U2T A;  1F8W A;  1X31 B;  5LV9 A;  1PBE A;  2E1M A;  3DJJ A;  1OJA A;  1S3B A;  4TLX A;  1VG9 A;  4ZCD A;  2GEW A;  1CJ2 A;  4Y4M A;  4Z24 A;  3LZW A;  1O94 A;  4B1B A;  4H4X A;  3C4A A;  1ZDL A;  3NNE A;  5JCM A;  3AEB A;  1B5Q A;  1RSG A;  2EQ9 A;  4Z25 A;  3UOX A;  3IHM A;  4IV9 A;  4Z2U A;  4OPG A;  1CC2 A;  2XFO A;  3AEF A;  4K22 A;  5EBK A;  2GAG B;  3GYJ A;  4U8M A;  3M13 A;  4J31 A;  2VRL A;  1H7W A;  2VVL A;  3DA1 A;  3QFB A;  4KPR A;  1ZX9 A;  4YXD A;  1PHH A;  3OZ2 A;  3AEA A;  2Q0K A;  2R0C A;  2H89 A;  2X8C A;  2XVF A;  3NH3 X;  4BK3 A;  4Z2T A;  5J7X A;  2GMH A;  3CPJ G;  3II4 A;  3UKK A;  3UKL A;  2WP5 A;  1VG0 A;  1JU2 A;  3ATR A;  4AT0 A;  3I3L A;  4EM4 A;  1CJ3 A;  2DKH A;  4DSG A;  3AD9 B;  1L9E A;  2BCG G;  2IID A;  3NGC X;  2GV8 A;  3K7M X;  3RP7 A;  2Z5X A;  5JCK A;  4B65 A;  1LPF A;  4N9X A;  1YY5 A;  2XFU A;  3COX A;  1OJC A;  1TDN A;  1CJ4 A;  3D1C A;  4REK A;  2YLR A;  3H8I A;  2PHH A;  2HQM A;  2X8H A;  4JY3 A;  4CNK A;  4D04 A;  1F3P A;  3ALM A;  2AR8 A;  1FEA A;  4OPT A;  1E1K A;  4B67 A;  2WHD A;  3QVP A;  3S5W A;  1M6I A;  4LU6 A;  2TPR A;  4YSX A;  3NIX A;  4CBQ A;  4B68 A;  4EQS A;  5FMH A;  2VZ2 A;  4A79 A;  4LII A;  4UDP A;  1GRG A;  2BCP A;  3AB1 A;  4FX9 A;  1TDE A;  2DKI A;  4C74 A;  1OJD A;  5EOW A;  2GR1 A;  3AE8 A;  3AE5 A;  4RG3 A;  4U8L A;  4ZN0 A;  5JCN A;  1MOK A;  1NHP A;  1DOC A;  1PXB A;  4Y4N A;  1IUT A;  1EL7 A;  2R45 A;  2GQW A;  2GH5 A;  3KLJ A;  1QO8 A;  1XAN A;  1PBC A;  3KKJ A;  5TR3 A;  4DSH A;  3H4K A;  2V6O A;  1D5T A;  2BC0 A;  2B9W A;  1CHU A;  2V3A A;  4APN A;  1GXF A;  1HYU A;  3DGZ A;  1DOB A;  4DNA A;  2WEU A;  1GRH A;  5C2T A;  3NN6 X;  3VR8 A;  3M0O A;  1XPQ A;  1GSN A;  3AEE A;  3V3O A;  4TLZ A;  3ICT A;  2C70 A;  4AP1 A;  1CF3 A;  3GWF A;  3NK0 X;  3NTD A;  4EMJ A;  4C5O A;  4RSL A;  2YLX A;  1Q9I A;  2BAB A;  4GF7 A;  3QSS A;  2E5V A;  4GDP A;  2B7R A;  4H4V A;  2YR4 A;  3RP8 A;  4WX1 A;  1PBD A;  2WOV A;  3DK9 A;  3AED A;  1KDG A;  3CIR A;  5BRT A;  1P2E A;  3P4P A;  1NPX A;  2R4J A;  1GTE A;  1JRY A;  3EF6 A;  4ICY A;  3DK4 A;  4H4T A;  1EL8 A;  1GES A;  3GYI A;  1DNC A;  3CN8 A;  2X3N A;  3GDP A;  1P2H A;  2JBV A;  2YG6 A;  2Z5Y A;  1KSU A;  2VVM A;  3G5R A;  3GD3 A;  3LJP A;  4IVM B;  1LQT A;  5L46 A;  5DBJ A;  4YT0 A;  4X9M A;  3GRS A;  3NTA A;  3P4Q A;  3ZDN A;  2C66 A;  1DOD A;  3D8X A;  3AE9 A;  2Y6Q A;  3AE7 A;  1MXT A;  3G5S A;  3CNT A;  4NEW A;  3QSE A;  3GRT A;  5BVA A;  2C3D A;  3VR9 A;  1H83 A;  1JNR A;  2QA1 A;  3BI5 A;  4CY6 A;  2BS4 A;  4O5U A;  3BI2 A;  1TDF A;  2B76 A;  1D7Y A;  2GQF A;  2YLW A;  4H4R A;  4TM1 A;  5FS8 A; 
#chains in the Genus database with same CATH topology
 3GMB A;  1H82 A;  3KU9 A;  1FCD A;  1H7X A;  4NTD A;  2WS3 A;  4GCM A;  2GMJ A;  3E1T A;  2QCU A;  1K0I A;  2XLS A;  4NZH A;  2YG3 A;  2RGO A;  2XLP A;  3CND A;  4NTC A;  1IUX A;  3CMM A;  3K7T A;  1YQ3 A;  2C64 A;  4H4P A;  4CCR A;  2WES A;  4UDR A;  3NG7 X;  3RP6 A;  3UOY A;  1CC4 A;  2FJA A;  1EBD A;  4JNA A;  1V59 A;  2B9Y A;  2XLT A;  3GD4 A;  2VQB A;  4H4W A;  2BXR A;  2XYO A;  3DGH A;  1Y56 A;  4TM3 A;  4YSH A;  2A89 A;  3H8L A;  3NRN A;  5KOW A;  1F8S A;  4B66 A;  4C3X A;  2ZBW A;  1DJN A;  2C7G A;  3HYV A;  4EIP A;  1VRQ B;  4A6N A;  2OA1 A;  3P9U A;  5JCL A;  3NK2 X;  2C76 A;  3UCL A;  3UKQ A;  3FMW A;  5J60 A;  3DME A;  1CBO A;  1N4W A;  1D4C A;  1E39 A;  4JNQ A;  1QLB A;  3NKS A;  3T31 A;  2C65 A;  3SQP A;  3UKH A;  1D4D A;  3DH9 A;  3NYC A;  4H7U A;  1COY A;  1NHS A;  3CNS A;  1H84 A;  1Q1W A;  3DJG X;  2JAE A;  3HZL A;  1K0J A;  1E6E A;  3AD7 B;  4I59 A;  2C73 A;  4OVI A;  2GR0 A;  2BYB A;  4OPL A;  4XWZ A;  4H2R A;  1DXL A;  4OPD A;  4BUR A;  1IUU A;  3ATQ A;  4CNJ A;  2EQ8 A;  5M10 A;  1YQZ A;  4Y4L A;  3UTE A;  3QSM A;  4II3 A;  4K2X A;  2XFQ A;  3DK8 A;  2NVK X;  3NT6 A;  1ZP0 A;  1O5W A;  3GMC A;  2GAH B;  3B6D A;  1W4X A;  1XHC A;  1CJC A;  4B63 A;  4EQW A;  2WU2 A;  4EMW A;  2FJD A;  2GR3 A;  3CPH G;  1JEH A;  2BK4 A;  3ICS A;  5KVI A;  1S2Y A;  3VQR A;  2YVG A;  5HY5 A;  2ACZ A;  3UTH A;  3P4S A;  3V3N A;  4USR A;  1CL0 A;  5U25 A;  2QAE A;  1GOS A;  1S3E A;  2OLN A;  1YQ4 A;  5KOX A;  1TYT A;  3PVC A;  1E1L A;  1VQW A;  1H6V A;  4U8J A;  2XCG A;  2YAU A;  4UDQ A;  3F8D A;  1N4U A;  4C77 A;  3LOV A;  1NEN A;  2XVE A;  3SFD A;  3NN0 X;  2A8X A;  4BJY A;  4FDC B;  4G6G A;  3IF9 A;  3KA7 A;  3DJE A;  4AOS A;  1JRX A;  1L9D A;  2BXS A;  4NTE A;  2GVC A;  4J33 A;  3F8R A;  4B64 A;  2ZZ0 A;  3LZX A;  5KWF A;  3JSK A;  2C3C A;  1KNP A;  4ADW A;  5JCI A;  4AT2 A;  2GRT A;  4Z26 A;  4DGK A;  3CNP A;  2WDR A;  3ICR A;  2OAM A;  2C72 A;  4U2L A;  1PN0 A;  2B9X A;  3SM8 A;  4H4Y A;  3K30 A;  1FEC A;  2R9Z A;  1ZY8 A;  2RGH A;  3B3R A;  2BA9 A;  2BS2 A;  4JN9 A;  1Y56 B;  4G9K A;  2F5Z A;  2XFN A;  3CGC A;  1BWC A;  3CGD A;  1K4Q A;  3ADA B;  3ABV A;  1GRT A;  1OJ9 A;  3V76 A;  3I6D A;  4GUV A;  1TDO A;  4A6N B;  3CGE A;  3ZYX A;  1N1P A;  1NHQ A;  3URH A;  4BV6 A;  2CVJ A;  3AE1 A;  2UZZ A;  2YM1 A;  5HYM A;  2V60 A;  4K7Z A;  3AD8 B;  4AP3 A;  2JB2 A;  4XWR A;  2VOU A;  1NHR A;  2JKC A;  3Q6J A;  4USQ A;  3AWI A;  4FK1 A;  3AE3 A;  1NDA A;  3ALJ A;  4XXG A;  5GRT A;  4JY2 A;  2YQU A;  3ALL A;  2Q6U A;  5KMP A;  1ZMD A;  3NYE A;  1TYP A;  3EPT A;  3IHG A;  1GPE A;  1B37 A;  3AXB A;  3T2Y A;  5EB4 A;  2WDQ A;  1QJD A;  1IUV A;  2LFC A;  3QJ4 A;  3T0K A;  2YLS A;  1ONF A;  4H4S A;  1TRB A;  1L0V A;  4CRT A;  2WOW A;  1XDI A;  3UTF A;  2Q7V A;  3QFA A;  4YTN A;  2BK5 A;  2XVJ A;  3ISH A;  3BNU A;  1YKJ A;  1NG4 A;  3ITJ A;  1AOG A;  3BHK A;  1PXA A;  5CQF A;  1PXC A;  2IVD A;  2VQ7 A;  4NWZ A;  1Z6L A;  2WPE A;  2QA2 A;  2NPX A;  5KRQ A;  5U63 A;  3RNM A;  1REO A;  4A5L A;  1GTH A;  2JB1 A;  2Y6R A;  3C4N A;  4H2N A;  3SFE A;  4Z44 A;  1F6M A;  2XFP A;  3P1W A;  4G74 A;  4KX6 A;  2GF3 A;  2RAB A;  2EQ7 A;  2O9Z A;  1GT8 A;  2V61 A;  4EMI A;  4TM4 A;  1JNZ A;  3AYJ A;  2WP6 A;  3KVE A;  3UOZ A;  4K5R A;  4A7A A;  3AE4 A;  5HXI A;  4GDE A;  5KMS A;  1KSS A;  2YLZ A;  2W0H A;  4TM0 A;  3K7Q X;  2ARD A;  4HB9 A;  1K0L A;  4NEV A;  5KMR A;  1NEK A;  2FBW A;  4H4Q A;  4H2Q A;  5IQ1 A;  4JQ9 A;  5KMQ A;  3FBS A;  4U8O A;  1JOA A;  1KF6 A;  4K8D A;  2YWL A;  5FS7 A;  5BUL A;  1SEZ A;  1ZMC A;  1L9C A;  3R9U A;  2X8G A;  1BZL A;  1LV0 A;  2JK6 A;  2WP9 A;  4YTM A;  3SY4 A;  1GRB A;  5M0Z A;  2V5Z A;  2OLO A;  2WPF A;  1Y0P A;  3OC4 A;  4H2P A;  4C3Y A;  3GDN A;  2CFY A;  3RHA A;  5C3J A;  4H50 A;  2WET A;  1PJ7 A;  4YWO A;  3LAD A;  4X9N A;  2WPC A;  4UP3 A;  2WOI A;  1PBF A;  4YTP A;  4X4J A;  1FEB A;  3DJD A;  2AAQ A;  2YR5 A;  2WDV A;  3EAO A;  3UKP A;  4E0V A;  4PAB A;  4GAP A;  4EM3 A;  2VVL G;  4OPU A;  1NAA A;  4O5Q A;  3C96 A;  5KXJ A;  1N4V A;  4I58 A;  4LA1 A;  3KPK A;  4WCT A;  4GAV A;  1KFY A;  1OJT A;  4U8K A;  1DOE A;  3LB8 A;  4CY8 A;  3SGL A;  4EQX A;  5IPY A;  1UKV G;  1ZOY A;  4H4U A;  1MO9 A;  2EQ6 A;  1GEU A;  3FIM B;  2YG5 A;  1M64 A;  2YG7 A;  2YG4 A;  4J2W A;  3KD9 A;  2WBA A;  5ER0 A;  1BGN A;  2XLR A;  3SZ0 A;  2XVI A;  2XLU A;  1GER A;  2WQY A;  2XVH A;  4II2 A;  4EIQ A;  1VDC A;  5CKU A;  4EQR A;  2APG A;  4Z43 A;  2YVF A;  4U8N A;  1S2Q A;  4P9S A;  4U8P A;  1E7P A;  4IVO B;  3GSI A;  3UP4 A;  1KNR A;  4A99 A;  1ELI A;  4JDR A;  5U1O A;  3SX6 A;  1GRF A;  2C75 A;  3UP5 A;  3NYF A;  1E1M A;  3CPI G;  2R46 A;  2BAC A;  2B7S A;  1LTX R;  5GSN A;  2V3B A;  3CTY A;  2FJB A;  1GET A;  1PJ5 A;  2WU5 A;  1ZOV A;  2E4G A;  4IA5 A;  3PO7 A;  4D03 A;  4H4Z A;  1BGJ A;  1ZK7 A;  1B8S A;  1LQU A;  2H88 A;  1GRE A;  1GND A;  3VRA A;  2I0Z A;  2BC1 A;  5KVH A;  5FS6 A;  4GRT A;  2A87 A;  1H86 A;  4A65 A;  2XDO A;  4FK1 C;  3CGB A;  4YKG A;  2ZZB A;  4U8I A;  3SZF A;  2X50 A;  5IQ4 A;  2Q0L A;  1H81 A;  3UKF A;  3CNJ A;  3AE2 A;  4IA6 A;  2AQJ A;  2R4E A;  4RG4 A;  4J36 A;  1PDH A;  1PJ6 A;  3G5Q A;  3UKA A;  1GRA A;  2BRY A;  3HYX A;  2GR2 A;  2VRM A;  3BI4 A;  1Q1R A;  3L8K A;  3UTG A;  3F8P A;  2YVJ A;  1B4V A;  2TMD A;  4PAA A;  4J34 A;  4YSY A;  3VRD B;  3BNM A;  4A9W A;  3O0H A;  3AYL A;  2R0P A;  4BJZ A;  3T37 A;  1IUS A;  3AEC A;  3LXD A;  4Z2R A;  1FL2 A;  1CC6 A;  3WE0 A;  3FPZ A;  3FG2 P;  3RED A;  2X99 A;  1PS9 A;  3NLC A;  2ZZC A;  1DJQ A;  4J56 A;  4OPI A;  1LVL A;  4BK1 A;  1GV4 A;  4GR1 A;  2YM2 A;  2CDU A;  1NG3 A;  1BKW A;  3AYI A;  2J3N A;  1D7L A;  3BHF A;  3KPF A;  1E1N A;  3P4R A;  3S61 A;  5FS9 A;  1RYI A;  3NK1 X;  3Q9T A;  3AE6 A;  3SXI A;  3PS9 A;  3VRB A;  3IC9 A;  4YSZ A;  3EAN A;  4MJW A;  4OCG A;  1EL5 A;  1F8R A;  5HHF A;  1O95 A;  1LJ1 A;  2RGJ A;  3IWA A;  4CCQ A;  4YKF A;  2GB0 A;  4ZCC A;  5KNL A;  1D4E A;  2OAL A;  3QVR A;  2R0G A;  1RP0 A;  4AOX A;  2YLT A;  4B69 A;  3NHO X;  3M12 A;  3L1R A;  1ZKQ A;  2YR6 A;  4M52 A;  2BK3 A;  5EB5 A;  4K5S A;  1EL9 A;  4J57 A;  1FOH A;  2FJE A;  2PYX A;  1BF3 A;  1TDK A;  1IJH A;  2C67 A;  1GAL A;  5BUK A;  2JB3 A;  4U2S A;  2IVE A;  4BK2 A;  1JRZ A;  2BS3 A;  3AEG A;  4OPC A;  3UOV A;  3SZC A;  4HA6 A;  1PBB A;  2CUL A;  3GWD A;  1IUW A;  3GYX A;  4ECH A;  4U2T A;  1F8W A;  1X31 B;  5LV9 A;  1PBE A;  2E1M A;  3DJJ A;  1OJA A;  1S3B A;  4TLX A;  1VG9 A;  4ZCD A;  2GEW A;  1CJ2 A;  4Y4M A;  4Z24 A;  3LZW A;  1O94 A;  4B1B A;  4H4X A;  3C4A A;  1ZDL A;  3NNE A;  5JCM A;  3AEB A;  1B5Q A;  1RSG A;  2EQ9 A;  4Z25 A;  3UOX A;  3IHM A;  4IV9 A;  4Z2U A;  4OPG A;  2C4C A;  1CC2 A;  2XFO A;  3AEF A;  4K22 A;  5EBK A;  2GAG B;  3GYJ A;  4U8M A;  3M13 A;  4J31 A;  2VRL A;  1H7W A;  2VVL A;  3DA1 A;  3QFB A;  4KPR A;  1ZX9 A;  4YXD A;  1PHH A;  4G73 A;  3OZ2 A;  3AEA A;  2Q0K A;  2R0C A;  2H89 A;  2X8C A;  2XVF A;  3NH3 X;  4BK3 A;  4Z2T A;  5J7X A;  2GMH A;  3CPJ G;  3II4 A;  3UKK A;  3UKL A;  2WP5 A;  1VG0 A;  1JU2 A;  3ATR A;  4AT0 A;  3I3L A;  4EM4 A;  3T14 A;  1CJ3 A;  2DKH A;  4DSG A;  3AD9 B;  1L9E A;  2BCG G;  2IID A;  3SYI A;  3NGC X;  2GV8 A;  3K7M X;  3RP7 A;  2Z5X A;  5JCK A;  4B65 A;  1LPF A;  4N9X A;  1YY5 A;  2XFU A;  3COX A;  1OJC A;  1TDN A;  1CJ4 A;  3D1C A;  4REK A;  2YLR A;  3H8I A;  2PHH A;  2HQM A;  2X8H A;  4JY3 A;  4CNK A;  4D04 A;  1F3P A;  3ALM A;  2AR8 A;  1FEA A;  4OPT A;  1E1K A;  4B67 A;  2WHD A;  3QVP A;  3S5W A;  1M6I A;  4LU6 A;  2TPR A;  4YSX A;  3NIX A;  4CBQ A;  4B68 A;  4EQS A;  5FMH A;  2VZ2 A;  4A79 A;  4LII A;  4UDP A;  1GRG A;  2BCP A;  3AB1 A;  4FX9 A;  1TDE A;  4NNJ A;  2DKI A;  4C74 A;  1OJD A;  5EOW A;  2GR1 A;  2BRA A;  3AE8 A;  3AE5 A;  4RG3 A;  4U8L A;  4ZN0 A;  5JCN A;  1MOK A;  1NHP A;  1DOC A;  1PXB A;  4Y4N A;  1IUT A;  1EL7 A;  2R45 A;  2GQW A;  2GH5 A;  3KLJ A;  1QO8 A;  1XAN A;  1PBC A;  3KKJ A;  5TR3 A;  4DSH A;  3H4K A;  2V6O A;  1D5T A;  2BC0 A;  2B9W A;  1CHU A;  2V3A A;  4APN A;  1GXF A;  1HYU A;  3DGZ A;  1DOB A;  4DNA A;  2WEU A;  1GRH A;  5C2T A;  3T2K A;  3NN6 X;  3VR8 A;  3M0O A;  1XPQ A;  1GSN A;  3AEE A;  3V3O A;  3HYW A;  4TLZ A;  3ICT A;  2C70 A;  4AP1 A;  1CF3 A;  3GWF A;  3NK0 X;  3NTD A;  3SZW A;  4C5O A;  4EMJ A;  4RSL A;  2YLX A;  1Q9I A;  2BAB A;  4GF7 A;  3QSS A;  2E5V A;  4GDP A;  2B7R A;  4H4V A;  2YR4 A;  4G6H A;  3RP8 A;  4WX1 A;  1PBD A;  2WOV A;  3DK9 A;  3AED A;  1KDG A;  3CIR A;  5BRT A;  1P2E A;  3P4P A;  1NPX A;  2R4J A;  1GTE A;  1JRY A;  3EF6 A;  4ICY A;  3DK4 A;  4H4T A;  1EL8 A;  1GES A;  3GYI A;  1DNC A;  3CN8 A;  2X3N A;  3GDP A;  1P2H A;  2JBV A;  2YG6 A;  2Z5Y A;  1KSU A;  2VVM A;  3G5R A;  3GD3 A;  3LJP A;  4IVM B;  1LQT A;  5L46 A;  5DBJ A;  4YT0 A;  4X9M A;  3GRS A;  3NTA A;  3P4Q A;  3ZDN A;  2C66 A;  1DOD A;  3D8X A;  3T2Z A;  3AE9 A;  2Y6Q A;  3AE7 A;  1MXT A;  3G5S A;  3CNT A;  4NEW A;  3QSE A;  3GRT A;  5BVA A;  2C3D A;  3VR9 A;  1H83 A;  1JNR A;  2QA1 A;  3BI5 A;  4CY6 A;  2BS4 A;  4O5U A;  3BI2 A;  1TDF A;  2B76 A;  1D7Y A;  2GQF A;  2YLW A;  4H4R A;  4TM1 A;  5FS8 A; 
#chains in the Genus database with same CATH homology
 3GMB A;  1H82 A;  3KU9 A;  1FCD A;  1H7X A;  4NTD A;  2WS3 A;  4GCM A;  2GMJ A;  3E1T A;  2QCU A;  1K0I A;  2XLS A;  4NZH A;  2YG3 A;  2RGO A;  2XLP A;  3CND A;  4NTC A;  1IUX A;  3CMM A;  3K7T A;  1YQ3 A;  2C64 A;  4H4P A;  4CCR A;  2WES A;  4UDR A;  3NG7 X;  3RP6 A;  3UOY A;  1CC4 A;  2FJA A;  1EBD A;  4JNA A;  1V59 A;  2B9Y A;  2XLT A;  3GD4 A;  2VQB A;  4H4W A;  2BXR A;  2XYO A;  3DGH A;  1Y56 A;  4TM3 A;  4YSH A;  2A89 A;  3H8L A;  3NRN A;  5KOW A;  1F8S A;  4B66 A;  4C3X A;  2ZBW A;  1DJN A;  2C7G A;  3HYV A;  4EIP A;  1VRQ B;  4A6N A;  2OA1 A;  3P9U A;  5JCL A;  3NK2 X;  2C76 A;  3UCL A;  3UKQ A;  3FMW A;  5J60 A;  3DME A;  1CBO A;  1N4W A;  1D4C A;  1E39 A;  4JNQ A;  1QLB A;  3NKS A;  3T31 A;  2C65 A;  3SQP A;  3UKH A;  1D4D A;  3DH9 A;  3NYC A;  4H7U A;  1COY A;  1NHS A;  3CNS A;  1H84 A;  1Q1W A;  3DJG X;  2JAE A;  3HZL A;  1K0J A;  1E6E A;  3AD7 B;  4I59 A;  2C73 A;  4OVI A;  2GR0 A;  2BYB A;  4OPL A;  4XWZ A;  4H2R A;  1DXL A;  4OPD A;  4BUR A;  1IUU A;  3ATQ A;  4CNJ A;  2EQ8 A;  5M10 A;  1YQZ A;  4Y4L A;  3UTE A;  3QSM A;  4II3 A;  4K2X A;  2XFQ A;  3DK8 A;  2NVK X;  3NT6 A;  1ZP0 A;  1O5W A;  3GMC A;  2GAH B;  3B6D A;  1W4X A;  1XHC A;  1CJC A;  4B63 A;  4EQW A;  2WU2 A;  4EMW A;  2FJD A;  2GR3 A;  3CPH G;  1JEH A;  2BK4 A;  3ICS A;  5KVI A;  1S2Y A;  3VQR A;  2YVG A;  5HY5 A;  2ACZ A;  3UTH A;  3P4S A;  3V3N A;  4USR A;  1CL0 A;  5U25 A;  2QAE A;  1GOS A;  1S3E A;  2OLN A;  1YQ4 A;  5KOX A;  1TYT A;  3PVC A;  1E1L A;  1VQW A;  1H6V A;  4U8J A;  2XCG A;  2YAU A;  4UDQ A;  3F8D A;  1N4U A;  4C77 A;  3LOV A;  1NEN A;  2XVE A;  3SFD A;  3NN0 X;  2A8X A;  4BJY A;  4FDC B;  4G6G A;  3IF9 A;  3KA7 A;  3DJE A;  4AOS A;  1JRX A;  1L9D A;  2BXS A;  4NTE A;  2GVC A;  4J33 A;  3F8R A;  4B64 A;  2ZZ0 A;  3LZX A;  5KWF A;  3JSK A;  2C3C A;  1KNP A;  4ADW A;  5JCI A;  4AT2 A;  2GRT A;  4Z26 A;  4DGK A;  3CNP A;  2WDR A;  3ICR A;  2OAM A;  2C72 A;  4U2L A;  1PN0 A;  2B9X A;  3SM8 A;  4H4Y A;  3K30 A;  1FEC A;  2R9Z A;  1ZY8 A;  2RGH A;  3B3R A;  2BA9 A;  2BS2 A;  4JN9 A;  1Y56 B;  4G9K A;  2F5Z A;  2XFN A;  3CGC A;  1BWC A;  3CGD A;  1K4Q A;  3ADA B;  3ABV A;  1GRT A;  1OJ9 A;  3V76 A;  3I6D A;  4GUV A;  1TDO A;  4A6N B;  3CGE A;  3ZYX A;  1N1P A;  1NHQ A;  3URH A;  4BV6 A;  2CVJ A;  3AE1 A;  2UZZ A;  2YM1 A;  5HYM A;  2V60 A;  4K7Z A;  3AD8 B;  4AP3 A;  2JB2 A;  4XWR A;  2VOU A;  1NHR A;  2JKC A;  3Q6J A;  4USQ A;  3AWI A;  4FK1 A;  3AE3 A;  1NDA A;  3ALJ A;  4XXG A;  5GRT A;  4JY2 A;  2YQU A;  3ALL A;  2Q6U A;  5KMP A;  1ZMD A;  3NYE A;  1TYP A;  3EPT A;  3IHG A;  1GPE A;  1B37 A;  3AXB A;  3T2Y A;  5EB4 A;  2WDQ A;  1QJD A;  1IUV A;  2LFC A;  3QJ4 A;  3T0K A;  2YLS A;  1ONF A;  4H4S A;  1TRB A;  1L0V A;  4CRT A;  2WOW A;  1XDI A;  3UTF A;  2Q7V A;  3QFA A;  4YTN A;  2BK5 A;  2XVJ A;  3ISH A;  3BNU A;  1YKJ A;  1NG4 A;  3ITJ A;  1AOG A;  3BHK A;  1PXA A;  5CQF A;  1PXC A;  2IVD A;  2VQ7 A;  4NWZ A;  1Z6L A;  2WPE A;  2QA2 A;  2NPX A;  5KRQ A;  5U63 A;  3RNM A;  1REO A;  4A5L A;  1GTH A;  2JB1 A;  2Y6R A;  3C4N A;  4H2N A;  3SFE A;  4Z44 A;  1F6M A;  2XFP A;  3P1W A;  4G74 A;  4KX6 A;  2GF3 A;  2RAB A;  2EQ7 A;  2O9Z A;  1GT8 A;  2V61 A;  4EMI A;  4TM4 A;  1JNZ A;  3AYJ A;  2WP6 A;  3KVE A;  3UOZ A;  4K5R A;  4A7A A;  3AE4 A;  5HXI A;  4GDE A;  5KMS A;  1KSS A;  2YLZ A;  2W0H A;  4TM0 A;  3K7Q X;  2ARD A;  4HB9 A;  1K0L A;  4NEV A;  5KMR A;  1NEK A;  2FBW A;  4H4Q A;  4H2Q A;  5IQ1 A;  4JQ9 A;  5KMQ A;  3FBS A;  4U8O A;  1JOA A;  1KF6 A;  4K8D A;  2YWL A;  5FS7 A;  5BUL A;  1SEZ A;  1ZMC A;  1L9C A;  3R9U A;  2X8G A;  1BZL A;  1LV0 A;  2JK6 A;  2WP9 A;  4YTM A;  3SY4 A;  1GRB A;  5M0Z A;  2V5Z A;  2OLO A;  2WPF A;  1Y0P A;  3OC4 A;  4H2P A;  4C3Y A;  3GDN A;  2CFY A;  3RHA A;  5C3J A;  4H50 A;  2WET A;  1PJ7 A;  4YWO A;  3LAD A;  4X9N A;  2WPC A;  4UP3 A;  2WOI A;  1PBF A;  4YTP A;  4X4J A;  1FEB A;  3DJD A;  2AAQ A;  2YR5 A;  2WDV A;  3EAO A;  3UKP A;  4E0V A;  4PAB A;  4GAP A;  4EM3 A;  2VVL G;  4OPU A;  1NAA A;  4O5Q A;  3C96 A;  5KXJ A;  1N4V A;  4I58 A;  4LA1 A;  3KPK A;  4WCT A;  4GAV A;  1KFY A;  1OJT A;  4U8K A;  1DOE A;  3LB8 A;  4CY8 A;  3SGL A;  4EQX A;  5IPY A;  1UKV G;  1ZOY A;  4H4U A;  1MO9 A;  2EQ6 A;  1GEU A;  3FIM B;  2YG5 A;  1M64 A;  2YG7 A;  2YG4 A;  4J2W A;  3KD9 A;  2WBA A;  5ER0 A;  1BGN A;  2XLR A;  3SZ0 A;  2XVI A;  2XLU A;  1GER A;  2WQY A;  2XVH A;  4II2 A;  4EIQ A;  1VDC A;  5CKU A;  4EQR A;  2APG A;  4Z43 A;  2YVF A;  4U8N A;  1S2Q A;  4P9S A;  4U8P A;  1E7P A;  4IVO B;  3GSI A;  3UP4 A;  1KNR A;  4A99 A;  1ELI A;  4JDR A;  5U1O A;  3SX6 A;  1GRF A;  2C75 A;  3UP5 A;  3NYF A;  1E1M A;  3CPI G;  2R46 A;  2BAC A;  2B7S A;  1LTX R;  5GSN A;  2V3B A;  3CTY A;  2FJB A;  1GET A;  1PJ5 A;  2WU5 A;  1ZOV A;  2E4G A;  4IA5 A;  3PO7 A;  4D03 A;  4H4Z A;  1BGJ A;  1ZK7 A;  1B8S A;  1LQU A;  2H88 A;  1GRE A;  1GND A;  3VRA A;  2I0Z A;  2BC1 A;  5KVH A;  5FS6 A;  4GRT A;  2A87 A;  1H86 A;  4A65 A;  2XDO A;  4FK1 C;  3CGB A;  4YKG A;  2ZZB A;  4U8I A;  3SZF A;  2X50 A;  5IQ4 A;  2Q0L A;  1H81 A;  3UKF A;  3CNJ A;  3AE2 A;  4IA6 A;  2AQJ A;  2R4E A;  4RG4 A;  4J36 A;  1PDH A;  1PJ6 A;  3G5Q A;  3UKA A;  1GRA A;  2BRY A;  3HYX A;  2GR2 A;  2VRM A;  3BI4 A;  1Q1R A;  3L8K A;  3UTG A;  3F8P A;  2YVJ A;  1B4V A;  2TMD A;  4PAA A;  4J34 A;  4YSY A;  3VRD B;  3BNM A;  4A9W A;  3O0H A;  3AYL A;  2R0P A;  4BJZ A;  3T37 A;  1IUS A;  3AEC A;  3LXD A;  4Z2R A;  1FL2 A;  1CC6 A;  3WE0 A;  3FPZ A;  3FG2 P;  3RED A;  2X99 A;  1PS9 A;  3NLC A;  2ZZC A;  1DJQ A;  4J56 A;  4OPI A;  1LVL A;  4BK1 A;  1GV4 A;  4GR1 A;  2YM2 A;  2CDU A;  1NG3 A;  1BKW A;  3AYI A;  2J3N A;  1D7L A;  3BHF A;  3KPF A;  1E1N A;  3P4R A;  3S61 A;  5FS9 A;  1RYI A;  3NK1 X;  3Q9T A;  3AE6 A;  3SXI A;  3PS9 A;  3VRB A;  3IC9 A;  4YSZ A;  3EAN A;  4MJW A;  4OCG A;  1EL5 A;  1F8R A;  5HHF A;  1O95 A;  1LJ1 A;  2RGJ A;  3IWA A;  4CCQ A;  4YKF A;  2GB0 A;  4ZCC A;  5KNL A;  1D4E A;  2OAL A;  3QVR A;  2R0G A;  1RP0 A;  4AOX A;  2YLT A;  4B69 A;  3NHO X;  3M12 A;  3L1R A;  1ZKQ A;  2YR6 A;  4M52 A;  2BK3 A;  5EB5 A;  4K5S A;  1EL9 A;  4J57 A;  1FOH A;  2FJE A;  2PYX A;  1BF3 A;  1TDK A;  1IJH A;  2C67 A;  1GAL A;  5BUK A;  2JB3 A;  4U2S A;  2IVE A;  4BK2 A;  1JRZ A;  2BS3 A;  3AEG A;  4OPC A;  3UOV A;  3SZC A;  4HA6 A;  1PBB A;  2CUL A;  3GWD A;  1IUW A;  3GYX A;  4ECH A;  4U2T A;  1F8W A;  1X31 B;  5LV9 A;  1PBE A;  2E1M A;  3DJJ A;  1OJA A;  1S3B A;  4TLX A;  1VG9 A;  4ZCD A;  2GEW A;  1CJ2 A;  4Y4M A;  4Z24 A;  3LZW A;  1O94 A;  4B1B A;  4H4X A;  3C4A A;  1ZDL A;  3NNE A;  5JCM A;  3AEB A;  1B5Q A;  1RSG A;  2EQ9 A;  4Z25 A;  3UOX A;  3IHM A;  4IV9 A;  4Z2U A;  4OPG A;  2C4C A;  1CC2 A;  2XFO A;  3AEF A;  4K22 A;  5EBK A;  2GAG B;  3GYJ A;  4U8M A;  3M13 A;  4J31 A;  2VRL A;  1H7W A;  2VVL A;  3DA1 A;  3QFB A;  4KPR A;  1ZX9 A;  4YXD A;  1PHH A;  4G73 A;  3OZ2 A;  3AEA A;  2Q0K A;  2R0C A;  2H89 A;  2X8C A;  2XVF A;  3NH3 X;  4BK3 A;  4Z2T A;  5J7X A;  2GMH A;  3CPJ G;  3II4 A;  3UKK A;  3UKL A;  2WP5 A;  1VG0 A;  1JU2 A;  3ATR A;  4AT0 A;  3I3L A;  4EM4 A;  3T14 A;  1CJ3 A;  2DKH A;  4DSG A;  3AD9 B;  1L9E A;  2BCG G;  2IID A;  3SYI A;  3NGC X;  2GV8 A;  3K7M X;  3RP7 A;  2Z5X A;  5JCK A;  4B65 A;  1LPF A;  4N9X A;  1YY5 A;  2XFU A;  3COX A;  1OJC A;  1TDN A;  1CJ4 A;  3D1C A;  4REK A;  2YLR A;  3H8I A;  2PHH A;  2HQM A;  2X8H A;  4JY3 A;  4CNK A;  4D04 A;  1F3P A;  3ALM A;  2AR8 A;  1FEA A;  4OPT A;  1E1K A;  4B67 A;  2WHD A;  3QVP A;  3S5W A;  1M6I A;  4LU6 A;  2TPR A;  4YSX A;  3NIX A;  4CBQ A;  4B68 A;  4EQS A;  5FMH A;  2VZ2 A;  4A79 A;  4LII A;  4UDP A;  1GRG A;  2BCP A;  3AB1 A;  4FX9 A;  1TDE A;  4NNJ A;  2DKI A;  4C74 A;  1OJD A;  5EOW A;  2GR1 A;  2BRA A;  3AE8 A;  3AE5 A;  4RG3 A;  4U8L A;  4ZN0 A;  5JCN A;  1MOK A;  1NHP A;  1DOC A;  1PXB A;  4Y4N A;  1IUT A;  1EL7 A;  2R45 A;  2GQW A;  2GH5 A;  3KLJ A;  1QO8 A;  1XAN A;  1PBC A;  3KKJ A;  5TR3 A;  4DSH A;  3H4K A;  2V6O A;  1D5T A;  2BC0 A;  2B9W A;  1CHU A;  2V3A A;  4APN A;  1GXF A;  1HYU A;  3DGZ A;  1DOB A;  4DNA A;  2WEU A;  1GRH A;  5C2T A;  3T2K A;  3NN6 X;  3VR8 A;  3M0O A;  1XPQ A;  1GSN A;  3AEE A;  3V3O A;  3HYW A;  4TLZ A;  3ICT A;  2C70 A;  4AP1 A;  1CF3 A;  3GWF A;  3NK0 X;  3NTD A;  3SZW A;  4C5O A;  4EMJ A;  4RSL A;  2YLX A;  1Q9I A;  2BAB A;  4GF7 A;  3QSS A;  2E5V A;  4GDP A;  2B7R A;  4H4V A;  2YR4 A;  4G6H A;  3RP8 A;  4WX1 A;  1PBD A;  2WOV A;  3DK9 A;  3AED A;  1KDG A;  3CIR A;  5BRT A;  1P2E A;  3P4P A;  1NPX A;  2R4J A;  1GTE A;  1JRY A;  3EF6 A;  4ICY A;  3DK4 A;  4H4T A;  1EL8 A;  1GES A;  3GYI A;  1DNC A;  3CN8 A;  2X3N A;  3GDP A;  1P2H A;  2JBV A;  2YG6 A;  2Z5Y A;  1KSU A;  2VVM A;  3G5R A;  3GD3 A;  3LJP A;  4IVM B;  1LQT A;  5L46 A;  5DBJ A;  4YT0 A;  4X9M A;  3GRS A;  3NTA A;  3P4Q A;  3ZDN A;  2C66 A;  1DOD A;  3D8X A;  3T2Z A;  3AE9 A;  2Y6Q A;  3AE7 A;  1MXT A;  3G5S A;  3CNT A;  4NEW A;  3QSE A;  3GRT A;  5BVA A;  2C3D A;  3VR9 A;  1H83 A;  1JNR A;  2QA1 A;  3BI5 A;  4CY6 A;  2BS4 A;  4O5U A;  3BI2 A;  1TDF A;  2B76 A;  1D7Y A;  2GQF A;  2YLW A;  4H4R A;  4TM1 A;  5FS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...