4AT2A

The crystal structure of 3-ketosteroid-delta4-(5alpha)-dehydrogenase from rhodococcus jostii rha1 in complex with 4-androstene-3,17- dione
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
483
structure length
483
Chain Sequence
IRPRSATTVTEWDYEADVVVAGYGIAGVAASIEAARAGADVLVLERTSGWGGATALAGGFIYLGGGTPLQKACGFDDSPENMKTFMMAALGPGADEEKITDYCEGSVEHYNWLVDCGVPFKESFWGEPGWEPPFDDGLMYSGGENAAPFNEIAAPAPRGHVPQMDGKRTGEKGGGYMLMKPLVETAEKLGVRAEYDMRVQTLVTDDTGRVVGIVAKQYGKEVAVRARRGVVLATGSFAYNDKMIEAHAPRLIGRPGAAIEEHDGRSILMAQALGADLAHMDATEVAFVCDPQLIVRGILVNGRGQRYVPEDTYSGRIGQMTLFHQDNQAFLIIDEASYEEGAAATTATPFLRVQPKWAAETVEELESDMGLPAGALQSTVEVYNKHAAEGSDPLLHKKSEWVKPIGTPVAALDLRGFTLGFTLGGLRTTVNSEVLHVSGEPIPGLFAAGRCTSGVCAGGYASGTSLGDGSFYGRRAGISAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Catalytic Mechanism of 3-Ketosteroid-{Delta}4-(5Alpha)-Dehydrogenase from Rhodococcus Jostii Rha1 Genome.
pubmed doi rcsb
source organism Rhodococcus jostii
molecule tags Oxidoreductase
molecule keywords 3-KETOSTEROID-DELTA4-5ALPHA-DEHYDROGENASE
total genus 163
structure length 483
sequence length 483
ec nomenclature ec 1.3.99.5: 3-oxo-5-alpha-steroid 4-dehydrogenase (acceptor).
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4at2A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4at2A02
3QSMA 2WESA 4Z44A 1KSUA 3RP6A 2H89A 1PBDA 1PJ5A 2A87A 2BABA 2XFUA 3NGCX 1TDKA 3COXA 4NZHA 1GALA 1DOCA 3AEBA 1GESA 1GRAA 1N4VA 1VG0A 4LU6A 3BI4A 3AE5A 4H4WA 3ATRA 4JY3A 2BK4A 1D4CA 1TYTA 2C64A 4A6NB 5C3JA 1CJCA 2CULA 1OJCA 1ZP0A 2TPRA 2YM2A 4A5LA 1MO9A 3Q6JA 2C66A 2R4JA 2YM1A 2E4GA 4B66A 1GERA 3UKPA 4NEVA 4K7ZA 3ISHA 2RGOA 4U8PA 2C76A 3UKLA 2XVEA 3ITJA 1SEZA 3NLCA 1GPEA 2C67A 4Z24A 2YLZA 2BCGG 3V76A 1GV4A 4H4VA 5M10A 4O5QA 1LJ1A 2V3BA 4H2QA 1ZOYA 2VOUA 4B65A 3NYCA 1NG4A 4CY6A 3BNMA 2CDUA 3CNSA 3ICTA 5KVIA 4Z2UA 4CCQA 1HYUA 2GEWA 3ADAB 2YVJA 3ALMA 1GREA 2GAGB 3AD7B 4YTMA 3VR9A 3DGHA 1BWCA 2AR8A 3D8XA 3F8PA 3KVEA 2XLRA 4OPTA 1KNPA 4EMWA 4RG3A 3UKFA 3URHA 3GYXA 2YG4A 1GETA 2BXSA 3AB1A 1GRBA 1XANA 2VVLA 2JK6A 3UOVA 1D4EA 3L1RA 3VQRA 1LQTA 2WP5A 4C74A 1NEKA 1DODA 1PS9A 3T37A 3NYFA 2GV8A 3NNEA 3ABVA 1D4DA 4RSLA 2IVDA 3EPTA 1NAAA 3G5RA 3AE4A 3GRTA 3P4PA 1DXLA 2H88A 2YLSA 3KA7A 4TLZA 4Y4NA 2XLUA 2ZZCA 4AT0A 3LADA 3QVRA 4YSHA 3AE1A 2ZZBA 4TM0A 4YSZA 4JNAA 5KVHA 3BI2A 2BXRA 3GYJA 1N4UA 1S3EA 4JDRA 2J3NA 1Y56A 3I3LA 4ADWA 1PN0A 3NK1X 2YR5A 3AE8A 4E0VA 1ONFA 1ELIA 4K22A 4NEWA 3LZXA 2B9YA 4BK1A 4CCRA 5C2TA 2X3NA 1H84A 1CJ2A 4EQXA 3P1WA 2QA2A 4HB9A 3VRAA 1PHHA 4J56A 1K0JA 2E1MA 5IQ1A 4FK1A 3SFDA 3AEFA 2WEUA 4B68A 2F5ZA 1DNCA 2XVFA 3CIRA 4A9WA 1JRYA 1F3PA 3EF6A 1VQWA 3CGCA 1IUWA 1FL2A 3GMBA 2WHDA 2WP6A 1IUVA 5J60A 4APNA 3LJPA 3RP8A 3ALLA 5L46A 2WPCA 1BZLA 1ZOVA 3GWFA 3GD3A 4H2NA 4H4ZA 4USRA 4X9NA 5DBJA 3CGEA 1CJ4A 2FBWA 1ZMCA 2YWLA 5BRTA 3CNTA 1COYA 1EL8A 5KWFA 1PBCA 3DJDA 3NT6A 2YG3A 1EL5A 2C3DA 2WDQA 4CY8A 3NHOX 5J7XA 3UKQA 4D03A 3CGDA 3LXDA 2C65A 3GSIA 3Q9TA 2OAMA 2ACZA 4Y4MA 3F8DA 1H86A 4U2TA 2GQFA 4GF7A 4YSYA 3NH3X 5GRTA 2Z5XA 4U8IA 3C96A 5IPYA 1FEAA 1B4VA 1D7LA 1NPXA 1CC6A 1YKJA 3OC4A 3UOYA 5JCIA 2EQ7A 1L0VA 3UOZA 3C4NA 3QFBA 4IA5A 3K7QX 4JNQA 1S2QA 5KRQA 3AD9B 1N4WA 3KPFA 4LIIA 2B9XA 2OA1A 1D5TA 2C75A 3NYEA 2XCGA 3GD4A 3AWIA 4ZCCA 1PXBA 2YLTA 2ZBWA 4J31A 2HQMA 4NTCA 4FX9A 3LB8A 3WE0A 2V6OA 4P9SA 4HA6A 2WQYA 2X50A 3R9UA 3FIMB 4YT0A 2WPEA 3FPZA 1DOEA 2YLRA 4GCMA 4A7AA 1B5QA 1CHUA 1ZK7A 4YXDA 2WU5A 1GXFA 1TDEA 2OLNA 2OALA 1GOSA 2XLPA 5HHFA 4X4JA 3S5WA 1O5WA 3SFEA 3CNPA 4C77A 3BNUA 1YQZA 5HYMA 4M52A 3PS9A 4U2SA 5FS8A 3ATQA 1UKVG 1P2HA 5JCLA 1NHSA 2V61A 2YG6A 2DKIA 2OLOA 4NTEA 5JCNA 3NG7X 2V60A 1M64A 4J2WA 4K5SA 5CQFA 4BJZA 3AE2A 3UTEA 1NHPA 4WCTA 3DK8A 4BV6A 3M0OA 3KU9A 1JNZA 5JCMA 2R9ZA 1GNDA 4H4YA 5IQ4A 4BK2A 1LPFA 5M0ZA 4EQWA 3GMCA 4GDPA 2CFYA 2B7RA 2JB1A 1YY5A 1Q9IA 3AECA 3IHMA 3G5SA 3ICSA 2BA9A 4H4RA 2VRLA 2YVFA 3UP5A 2VVLG 1IUTA 2XFPA 2XLSA 2EQ9A 2I0ZA 4YWOA 3M12A 5ER0A 3UKAA 3CPIG 5HY5A 4N9XA 3HZLA 2VRMA 2WBAA 2BS2A 1TDOA 3REDA 4J33A 4OCGA 3O0HA 2R46A 2R0CA 2WU2A 4JN9A 5KOWA 2UZZA 3QJ4A 2BACA 1KDGA 2FJAA 1CC4A 2GR1A 1EL9A 1H83A 3FMWA 3SGLA 4AOXA 2YG7A 3C4AA 3NKSA 4B1BA 3K7MX 3AD8B 4BK3A 3D1CA 2QAEA 4DSGA 1F8RA 4EIPA 1L9CA 1P2EA 4LA1A 3G5QA 4ECHA 2WP9A 2Q0LA 3IC9A 4CNKA 2GRTA 1VDCA 3AXBA 4USQA 3AYIA 4JY2A 2WDVA 3JSKA 1H7XA 4Y4LA 1H82A 4XWZA 4EQRA 2RGHA 4DGKA 2WPFA 4H2RA 1CF3A 4C5OA 1BGNA 2XFQA 1PXCA 3CGBA 4UDQA 3DMEA 1X31B 3RNMA 2VZ2A 4U8LA 1FEBA 5BULA 2GF3A 3P4QA 1S3BA 4EQSA 2WOVA 2X8GA 4J57A 4UP3A 4U8MA 3V3OA 4Z43A 2GB0A 3AE6A 1D7YA 4H7UA 3FBSA 2EQ6A 3CNDA 2JKCA 1PJ6A 1E7PA 1JRZA 2GR0A 2GMHA 1JU2A 2IIDA 3NN0X 2C3CA 4OPUA 1N1PA 1YQ3A 2ZZ0A 1REOA 4I59A 3NK0X 1XDIA 2V5ZA 4AP3A 1GTHA 4C3XA 2GMJA 2TMDA 4EM4A 4EM3A 1Q1RA 4IVOB 3ALJA 5LV9A 1E1MA 1O95A 3VR8A 4U2LA 1F8SA 1E39A 1IJHA 1GRTA 4K5RA 3V3NA 4TLXA 5TR3A 3DK4A 4B63A 3CPHG 4Z2RA 1KFYA 3NK2X 1OJDA 4IV9A 1JEHA 2XVJA 1OJAA 3FG2P 4NTDA 2WETA 3S61A 1S2YA 1QJDA 1H81A 4Z25A 2GQWA 5KXJA 1BKWA 1RSGA 3DJGX 4ZCDA 4U8KA 2B76A 1KF6A 5U25A 1YQ4A 3AEDA 4MJWA 1PJ7A 2QA1A 1BGJA 2FJEA 1B37A 5EB4A 1DJQA 3KKJA 4AT2A 3BI5A 5FS9A 1NDAA 1F8WA 3OZ2A 4XXGA 1VG9A 3UKKA 3UP4A 5FS7A 1PBBA 2EQ8A 2GAHB 5EBKA 4OVIA 1DJNA 4KPRA 1PBFA 3DJJA 2YVGA 4H4QA 4CBQA 1PBEA 2ARDA 2C7GA 3NTDA 4DSHA 2YG5A 4D04A 4A6NA 1IUXA 1NHQA 2Y6QA 3AE7A 4EMJA 4BURA 4B64A 2AAQA 2BC0A 1EL7A 2GVCA 2BS3A 4EIQA 3L8KA 4J34A 4UDPA 3SQPA 1H7WA 3PO7A 3VRDB 4X9MA 2NPXA 2PHHA 1E1LA 2Q7VA 1GRFA 4H2PA 1JRXA 3ICRA 1IUSA 2V3AA 4KX6A 1RP0A 2GR3A 3QVPA 4WX1A 3AE9A 1FCDA 1L9EA 4H4UA 1XPQA 5GSNA 1VRQB 2B7SA 1GT8A 2XVIA 1FOHA 2YLWA 3UKHA 3B3RA 4UDRA 3QFAA 4J36A 4Z2TA 1QLBA 4K2XA 2YAUA 3IWAA 4FDCB 2C72A 5EOWA 4I58A 4TM1A 2YQUA 1K0LA 3ZYXA 3SM8A 4REKA 1KSSA 3GRSA 3DK9A 4IVMB 3H8IA 2R0PA 3F8RA 4TM3A 4PAAA 3GDNA 2GH5A 4H4SA 4IA6A 2YR4A 4OPIA 1O94A 2XLTA 4PABA 1CBOA 5FS6A 3ZDNA 4AP1A 3H4KA 3UCLA 1KNRA 4YSXA 2RGJA 3DH9A 4H4TA 5BUKA 4A65A 5JCKA 3EANA 3AE3A 3K30A 2VQBA 2XFOA 4H4PA 2B9WA 1PDHA 1M6IA 3H8LA 2FJDA 4GUVA 4H4XA 4A99A 2W0HA 4AOSA 1RYIA 3NN6X 1GSNA 3II4A 1LV0A 1K4QA 4YKGA 2R4EA 1TDNA 2R45A 3CN8A 2IVEA 1MOKA 1ZDLA 1GTEA 1JOAA 2FJBA 2QCUA 4C3YA 1TYPA 3UTFA 1MXTA 3VRBA 3I6DA 1CC2A 3KD9A 2AQJA 4U8NA 2VVMA 1OJ9A 4CNJA 3AEAA 1LVLA 4A79A 3P4SA 4OPDA 1FECA 3NTAA 4FK1C 1NG3A 1ZX9A 4U8JA 2JB3A 4OPCA 3P4RA 1Y56B 3B6DA 3M13A 3PVCA 4CRTA 3UOXA 1Z6LA 1ZKQA 4O5UA 4B67A 1ZMDA 1TRBA 2JBVA 2YLXA 4JQ9A 3K7TA 1TDFA 4GRTA 2RABA 3AYLA 4YTPA 1LQUA 1LTXR 1Y0PA 2BC1A 3DJEA 2Q6UA 2R0GA 1NHRA 2BS4A 2WOIA 1CJ3A 3CNJA 4RG4A 3CPJG 5FMHA 1F6MA 4Z26A 3DA1A 3LZWA 3BHKA 3KLJA 1E1NA 4GDEA 3AYJA 2WDRA 1JNRA 3P9UA 3UTHA 2A8XA 3GWDA 2Q0KA 2JAEA 1GRHA 5CKUA 4OPGA 4YKFA 1OJTA 2APGA 2YR6A 3AEGA 3UTGA 5BVAA 2WS3A 4K8DA 2Y6RA 4H50A 2PYXA 1XHCA 4YTNA 3DGZA 1PXAA 1B8SA 3RHAA 2E5VA 4EMIA 3EAOA 4OPLA 1E1KA 4ICYA 5U1OA 1W4XA 3BHFA 4B69A 3NIXA 2O9ZA 3IHGA 3QSEA 3NRNA 2NVKX 1QO8A 2C70A 4BJYA 3IF9A 4ZN0A 1Q1WA 5KOXA 3E1TA 5HXIA 2XDOA 1NENA 2XFNA 5EB5A 3GDPA 2Z5YA 2BK5A 3QSSA 1H6VA 2BK3A 2X8CA 2CVJA 4DNAA 2JB2A 1GEUA 1ZY8A 3AEEA 2X8HA 2LFCA 2X99A 1K0IA 1E6EA 2C73A 4GR1A 2BCPA 2GR2A 1AOGA 3RP7A 2WOWA 1EBDA 1V59A 2BYBA 1L9DA 2A89A 1DOBA 2DKHA 2XYOA 4U8OA 1IUUA 1GRGA 3CTYA 1BF3A 4TM4A 4XWRA 1CL0A 3GYIA 2VQ7A 2XVHA 3LOVA 5U63A
chains in the Genus database with same CATH superfamily
3QSMA 2WESA 4Z44A 1KSUA 3RP6A 2H89A 1PBDA 1PJ5A 2A87A 2BABA 2XFUA 3NGCX 1TDKA 3COXA 4NZHA 1GALA 1DOCA 4GAPA 3AEBA 1GESA 1GRAA 1N4VA 1VG0A 2C4CA 3HYWA 3BI4A 3AE5A 4H4WA 4LU6A 3ATRA 4JY3A 2BK4A 1D4CA 1TYTA 2C64A 4A6NB 5C3JA 1CJCA 2CULA 3SYIA 1OJCA 1ZP0A 3T2ZA 2TPRA 2YM2A 4A5LA 1MO9A 3Q6JA 2C66A 2R4JA 2YM1A 2E4GA 4B66A 1GERA 3UKPA 4NEVA 4K7ZA 3ISHA 2RGOA 4U8PA 2C76A 3UKLA 2XVEA 3ITJA 1SEZA 3NLCA 1GPEA 2C67A 4Z24A 2YLZA 2BCGG 3SX6A 3V76A 1GV4A 4H4VA 5M10A 4O5QA 1LJ1A 2V3BA 4H2QA 1ZOYA 2VOUA 4B65A 3NYCA 1NG4A 4CY6A 3BNMA 2CDUA 3CNSA 3ICTA 4GAVA 5KVIA 4Z2UA 4CCQA 1HYUA 2GEWA 3ADAB 2YVJA 3ALMA 1GREA 2GAGB 3AD7B 4YTMA 3T2YA 3VR9A 3DGHA 1BWCA 2AR8A 3D8XA 3F8PA 3KVEA 2XLRA 3KPKA 1KNPA 4G73A 4OPTA 4RG3A 3SZFA 3GYXA 3UKFA 2YG4A 3URHA 1GETA 2BXSA 3AB1A 1GRBA 1XANA 2VVLA 2JK6A 3UOVA 1D4EA 3L1RA 3VQRA 1LQTA 2WP5A 4C74A 1NEKA 1DODA 1PS9A 3T37A 3NYFA 2GV8A 3NNEA 3ABVA 1D4DA 4RSLA 2IVDA 3EPTA 1NAAA 3G5RA 3AE4A 3GRTA 3P4PA 1DXLA 2H88A 2YLSA 3KA7A 4TLZA 4Y4NA 2XLUA 2ZZCA 4AT0A 4G9KA 3LADA 3QVRA 4YSHA 3AE1A 2ZZBA 4TM0A 4YSZA 4JNAA 5KVHA 3BI2A 2BXRA 3GYJA 1N4UA 1S3EA 4JDRA 2J3NA 1Y56A 3I3LA 4ADWA 1PN0A 3NK1X 2YR5A 3AE8A 5KNLA 4E0VA 1ONFA 1ELIA 4K22A 4NEWA 3LZXA 2B9YA 4BK1A 4CCRA 5C2TA 2X3NA 1H84A 1CJ2A 4EQXA 3P1WA 2QA2A 4HB9A 3VRAA 1PHHA 4J56A 1K0JA 2E1MA 5IQ1A 4FK1A 3SFDA 3AEFA 2WEUA 4B68A 2F5ZA 1DNCA 2XVFA 3CIRA 4A9WA 1JRYA 1F3PA 3EF6A 1VQWA 3CGCA 1IUWA 3HYVA 1FL2A 3GMBA 2WHDA 2WP6A 1IUVA 5J60A 4APNA 3LJPA 3RP8A 3ALLA 5L46A 2WPCA 1BZLA 1ZOVA 3GWFA 3GD3A 4H2NA 4H4ZA 4USRA 4X9NA 5DBJA 3CGEA 1CJ4A 2FBWA 1ZMCA 2YWLA 5BRTA 3CNTA 1COYA 1EL8A 5KWFA 1PBCA 3DJDA 4II2A 3NT6A 2YG3A 1EL5A 2C3DA 2WDQA 4CY8A 3NHOX 5J7XA 3UKQA 4D03A 3CGDA 3LXDA 2C65A 3GSIA 3Q9TA 3SZWA 2OAMA 2ACZA 4Y4MA 3F8DA 1H86A 4U2TA 2GQFA 4GF7A 4YSYA 3NH3X 4NWZA 2Z5XA 4U8IA 5GRTA 3C96A 5IPYA 1FEAA 1B4VA 1D7LA 1NPXA 1CC6A 1YKJA 3OC4A 3UOYA 5JCIA 2EQ7A 1L0VA 3UOZA 3C4NA 3QFBA 4IA5A 3K7QX 4JNQA 1S2QA 5KRQA 3AD9B 1N4WA 3KPFA 4LIIA 2B9XA 2OA1A 1D5TA 2C75A 3NYEA 2XCGA 3GD4A 3AWIA 4ZCCA 1PXBA 2YLTA 2ZBWA 4J31A 2HQMA 4NTCA 4FX9A 3LB8A 3WE0A 2V6OA 4P9SA 4HA6A 2WQYA 2X50A 3R9UA 3FIMB 4YT0A 2WPEA 3FPZA 1DOEA 2YLRA 4GCMA 4A7AA 1B5QA 1CHUA 1ZK7A 4YXDA 2WU5A 1GXFA 1TDEA 2OLNA 2OALA 1GOSA 2XLPA 5HHFA 4X4JA 3S5WA 1O5WA 3SFEA 3CNPA 4C77A 3BNUA 1YQZA 5HYMA 4M52A 3PS9A 4U2SA 5FS8A 3ATQA 1UKVG 1P2HA 4NNJA 5JCLA 1NHSA 2V61A 2YG6A 2DKIA 2OLOA 4NTEA 5JCNA 3NG7X 2V60A 1M64A 4J2WA 4K5SA 5CQFA 4BJZA 3AE2A 3UTEA 1NHPA 4WCTA 3DK8A 4BV6A 3M0OA 3KU9A 1JNZA 5JCMA 2R9ZA 4II3A 1GNDA 4H4YA 5IQ4A 4BK2A 1LPFA 5M0ZA 4EQWA 3GMCA 4GDPA 2CFYA 2B7RA 2JB1A 1YY5A 1Q9IA 3AECA 3IHMA 3G5SA 3ICSA 2BA9A 4H4RA 2VRLA 2YVFA 3UP5A 2VVLG 1IUTA 2XFPA 2XLSA 2EQ9A 2I0ZA 4YWOA 3M12A 5ER0A 3UKAA 3CPIG 3HYXA 5HY5A 4N9XA 3HZLA 2VRMA 2WBAA 2BS2A 1TDOA 3REDA 4J33A 4OCGA 3O0HA 2R46A 2R0CA 2WU2A 4JN9A 5KOWA 2UZZA 3QJ4A 2BACA 1KDGA 2BRAA 2FJAA 1CC4A 2GR1A 1EL9A 1H83A 3FMWA 3SGLA 4AOXA 2YG7A 3C4AA 3NKSA 4B1BA 3K7MX 3AD8B 4BK3A 3D1CA 2QAEA 4DSGA 1F8RA 4EIPA 1L9CA 3T0KA 1P2EA 4LA1A 3G5QA 4ECHA 2WP9A 2Q0LA 3IC9A 4CNKA 2GRTA 1VDCA 3AXBA 4USQA 3AYIA 4JY2A 2WDVA 3JSKA 1H7XA 4Y4LA 1H82A 4XWZA 4EQRA 2RGHA 4DGKA 2WPFA 4H2RA 1CF3A 4C5OA 1BGNA 2XFQA 1PXCA 3CGBA 4UDQA 3DMEA 1X31B 3RNMA 2VZ2A 3T2KA 4U8LA 1FEBA 5BULA 2GF3A 3P4QA 1S3BA 4EQSA 2WOVA 2X8GA 4J57A 4UP3A 4U8MA 3V3OA 4Z43A 2GB0A 3AE6A 1D7YA 4H7UA 3FBSA 2EQ6A 3CNDA 2JKCA 1PJ6A 1E7PA 1JRZA 2GR0A 2GMHA 1JU2A 2IIDA 3NN0X 2C3CA 4OPUA 1N1PA 1YQ3A 2ZZ0A 1REOA 4I59A 3NK0X 1XDIA 2V5ZA 4AP3A 1GTHA 4C3XA 2GMJA 2TMDA 4EM4A 4EM3A 1Q1RA 4IVOB 3T14A 3ALJA 5LV9A 5KMPA 1E1MA 1O95A 3VR8A 4U2LA 1F8SA 1E39A 1IJHA 1GRTA 4K5RA 3V3NA 4TLXA 5TR3A 3DK4A 4B63A 3CPHG 4Z2RA 1KFYA 3NK2X 1OJDA 4IV9A 1JEHA 2XVJA 1OJAA 3FG2P 4NTDA 2BRYA 2WETA 3S61A 1S2YA 1QJDA 1H81A 4Z25A 2GQWA 5KXJA 1BKWA 1RSGA 3DJGX 4ZCDA 4U8KA 2B76A 1KF6A 5U25A 1YQ4A 3AEDA 4MJWA 1PJ7A 2QA1A 3T31A 1BGJA 2FJEA 1B37A 5EB4A 1DJQA 3KKJA 4G6HA 4AT2A 3BI5A 5FS9A 1NDAA 1F8WA 3OZ2A 4XXGA 1VG9A 3UKKA 4G74A 5FS7A 3UP4A 1PBBA 4EMWA 2EQ8A 2GAHB 5EBKA 4OVIA 1DJNA 4KPRA 1PBFA 3DJJA 2YVGA 4H4QA 4CBQA 1PBEA 2ARDA 2C7GA 3NTDA 4DSHA 2YG5A 4D04A 4A6NA 1IUXA 1NHQA 2Y6QA 3AE7A 4EMJA 4BURA 4B64A 2AAQA 2BC0A 1EL7A 2GVCA 2BS3A 4EIQA 3L8KA 4J34A 4UDPA 3SQPA 1H7WA 5KMRA 3PO7A 3VRDB 4X9MA 2NPXA 2PHHA 1E1LA 2Q7VA 1GRFA 4H2PA 1JRXA 3ICRA 4G6GA 1IUSA 2V3AA 4KX6A 1RP0A 2GR3A 3QVPA 4WX1A 3AE9A 1FCDA 1L9EA 4H4UA 1XPQA 5GSNA 1VRQB 2B7SA 1GT8A 2XVIA 1FOHA 2YLWA 3UKHA 3B3RA 4UDRA 3QFAA 4J36A 4Z2TA 1QLBA 4K2XA 2YAUA 3IWAA 4FDCB 2C72A 5EOWA 4I58A 4TM1A 2YQUA 1K0LA 3ZYXA 3SM8A 4REKA 1KSSA 3GRSA 3DK9A 4IVMB 3H8IA 2R0PA 3F8RA 4TM3A 4PAAA 3GDNA 2GH5A 4H4SA 4IA6A 2YR4A 4OPIA 1O94A 2XLTA 4PABA 1CBOA 5FS6A 3SXIA 3ZDNA 4AP1A 3H4KA 3UCLA 1KNRA 4YSXA 2RGJA 3DH9A 4H4TA 5BUKA 4A65A 5JCKA 3CMMA 3EANA 3AE3A 3K30A 2VQBA 2XFOA 4H4PA 2B9WA 1PDHA 1M6IA 3H8LA 2FJDA 4GUVA 4H4XA 5KMQA 4A99A 2W0HA 4AOSA 1RYIA 3NN6X 1GSNA 3II4A 1LV0A 1K4QA 4YKGA 2R4EA 1TDNA 2R45A 3CN8A 2IVEA 1MOKA 1ZDLA 1GTEA 1JOAA 2FJBA 2QCUA 4C3YA 1TYPA 3UTFA 1MXTA 3VRBA 3I6DA 1CC2A 3KD9A 2AQJA 4U8NA 2VVMA 1OJ9A 4CNJA 3AEAA 1LVLA 4A79A 3P4SA 4OPDA 1FECA 3NTAA 4FK1C 1NG3A 1ZX9A 4U8JA 2JB3A 4OPCA 3P4RA 1Y56B 3B6DA 3M13A 3PVCA 4CRTA 3UOXA 1Z6LA 1ZKQA 4O5UA 4B67A 5KMSA 1ZMDA 1TRBA 2JBVA 2YLXA 4JQ9A 3K7TA 1TDFA 4GRTA 2RABA 3AYLA 3SZCA 4YTPA 1LQUA 1LTXR 1Y0PA 2BC1A 3DJEA 2Q6UA 2R0GA 1NHRA 2BS4A 2WOIA 1CJ3A 3CNJA 4RG4A 3CPJG 5FMHA 1F6MA 4Z26A 3DA1A 3LZWA 3BHKA 3KLJA 1E1NA 4GDEA 3SZ0A 3AYJA 2WDRA 1JNRA 3P9UA 3UTHA 2A8XA 3GWDA 2Q0KA 2JAEA 1GRHA 5CKUA 4OPGA 4YKFA 1OJTA 2APGA 2YR6A 3AEGA 3UTGA 5BVAA 2WS3A 4K8DA 3SY4A 2Y6RA 4H50A 2PYXA 1XHCA 4YTNA 3DGZA 1PXAA 1B8SA 3RHAA 2E5VA 4EMIA 3EAOA 4OPLA 1E1KA 4ICYA 5U1OA 1W4XA 3BHFA 4B69A 3NIXA 2O9ZA 3IHGA 3QSEA 3NRNA 2NVKX 1QO8A 2C70A 4BJYA 3IF9A 4ZN0A 1Q1WA 5KOXA 3E1TA 5HXIA 2XDOA 1NENA 2XFNA 5EB5A 3GDPA 2Z5YA 2BK5A 3QSSA 1H6VA 2BK3A 2X8CA 2CVJA 4DNAA 2JB2A 1GEUA 1ZY8A 3AEEA 2X8HA 2LFCA 2X99A 1K0IA 1E6EA 2C73A 4GR1A 2BCPA 2GR2A 1AOGA 3RP7A 2WOWA 1EBDA 1V59A 2BYBA 1L9DA 2A89A 1DOBA 2DKHA 2XYOA 4U8OA 1IUUA 1GRGA 3CTYA 1BF3A 4TM4A 4XWRA 1CL0A 3GYIA 2VQ7A 2XVHA 3LOVA 5U63A
chains in the Genus database with same CATH topology
3QSMA 2WESA 4Z44A 1KSUA 3RP6A 2H89A 1PBDA 1PJ5A 2A87A 2BABA 2XFUA 3NGCX 1TDKA 3COXA 4NZHA 1GALA 1DOCA 4GAPA 3AEBA 1GESA 1GRAA 1N4VA 1VG0A 2C4CA 3HYWA 3BI4A 3AE5A 4H4WA 4LU6A 3ATRA 4JY3A 2BK4A 1D4CA 1TYTA 2C64A 4A6NB 5C3JA 1CJCA 2CULA 3SYIA 1OJCA 1ZP0A 3T2ZA 2TPRA 2YM2A 4A5LA 1MO9A 3Q6JA 2C66A 2R4JA 2YM1A 2E4GA 4B66A 1GERA 3UKPA 4NEVA 4K7ZA 3ISHA 2RGOA 4U8PA 2C76A 3UKLA 2XVEA 3ITJA 1SEZA 3NLCA 1GPEA 2C67A 4Z24A 2YLZA 2BCGG 3SX6A 3V76A 1GV4A 4H4VA 5M10A 4O5QA 1LJ1A 2V3BA 4H2QA 1ZOYA 2VOUA 4B65A 3NYCA 1NG4A 4CY6A 3BNMA 2CDUA 3CNSA 3ICTA 4GAVA 5KVIA 4Z2UA 4CCQA 1HYUA 2GEWA 3ADAB 2YVJA 3ALMA 1GREA 2GAGB 3AD7B 4YTMA 3T2YA 3VR9A 3DGHA 1BWCA 2AR8A 3D8XA 3F8PA 3KVEA 2XLRA 3KPKA 1KNPA 4G73A 4OPTA 4RG3A 3SZFA 3GYXA 3UKFA 2YG4A 3URHA 1GETA 2BXSA 3AB1A 1GRBA 1XANA 2VVLA 2JK6A 3UOVA 1D4EA 3L1RA 3VQRA 1LQTA 2WP5A 4C74A 1NEKA 1DODA 1PS9A 3T37A 3NYFA 2GV8A 3NNEA 3ABVA 1D4DA 4RSLA 2IVDA 3EPTA 1NAAA 3G5RA 3AE4A 3GRTA 3P4PA 1DXLA 2H88A 2YLSA 3KA7A 4TLZA 4Y4NA 2XLUA 2ZZCA 4AT0A 4G9KA 3LADA 3QVRA 4YSHA 3AE1A 2ZZBA 4TM0A 4YSZA 4JNAA 5KVHA 3BI2A 2BXRA 3GYJA 1N4UA 1S3EA 4JDRA 2J3NA 1Y56A 3I3LA 4ADWA 1PN0A 3NK1X 2YR5A 3AE8A 5KNLA 4E0VA 1ONFA 1ELIA 4K22A 4NEWA 3LZXA 2B9YA 4BK1A 4CCRA 5C2TA 2X3NA 1H84A 1CJ2A 4EQXA 3P1WA 2QA2A 4HB9A 3VRAA 1PHHA 4J56A 1K0JA 2E1MA 5IQ1A 4FK1A 3SFDA 3AEFA 2WEUA 4B68A 2F5ZA 1DNCA 2XVFA 3CIRA 4A9WA 1JRYA 1F3PA 3EF6A 1VQWA 3CGCA 1IUWA 3HYVA 1FL2A 3GMBA 2WHDA 2WP6A 1IUVA 5J60A 4APNA 3LJPA 3RP8A 3ALLA 5L46A 2WPCA 1BZLA 1ZOVA 3GWFA 3GD3A 4H2NA 4H4ZA 4USRA 4X9NA 5DBJA 3CGEA 1CJ4A 2FBWA 1ZMCA 2YWLA 5BRTA 3CNTA 1COYA 1EL8A 5KWFA 1PBCA 3DJDA 4II2A 3NT6A 2YG3A 1EL5A 2C3DA 2WDQA 4CY8A 3NHOX 5J7XA 3UKQA 4D03A 3CGDA 3LXDA 2C65A 3GSIA 3Q9TA 3SZWA 2OAMA 2ACZA 4Y4MA 3F8DA 1H86A 4U2TA 2GQFA 4GF7A 4YSYA 3NH3X 4NWZA 2Z5XA 4U8IA 5GRTA 3C96A 5IPYA 1FEAA 1B4VA 1D7LA 1NPXA 1CC6A 1YKJA 3OC4A 3UOYA 5JCIA 2EQ7A 1L0VA 3UOZA 3C4NA 3QFBA 4IA5A 3K7QX 4JNQA 1S2QA 5KRQA 3AD9B 1N4WA 3KPFA 4LIIA 2B9XA 2OA1A 1D5TA 2C75A 3NYEA 2XCGA 3GD4A 3AWIA 4ZCCA 1PXBA 2YLTA 2ZBWA 4J31A 2HQMA 4NTCA 4FX9A 3LB8A 3WE0A 2V6OA 4P9SA 4HA6A 2WQYA 2X50A 3R9UA 3FIMB 4YT0A 2WPEA 3FPZA 1DOEA 2YLRA 4GCMA 4A7AA 1B5QA 1CHUA 1ZK7A 4YXDA 2WU5A 1GXFA 1TDEA 2OLNA 2OALA 1GOSA 2XLPA 5HHFA 4X4JA 3S5WA 1O5WA 3SFEA 3CNPA 4C77A 3BNUA 1YQZA 5HYMA 4M52A 3PS9A 4U2SA 5FS8A 3ATQA 1UKVG 1P2HA 4NNJA 5JCLA 1NHSA 2V61A 2YG6A 2DKIA 2OLOA 4NTEA 5JCNA 3NG7X 2V60A 1M64A 4J2WA 4K5SA 5CQFA 4BJZA 3AE2A 3UTEA 1NHPA 4WCTA 3DK8A 4BV6A 3M0OA 3KU9A 1JNZA 5JCMA 2R9ZA 4II3A 1GNDA 4H4YA 5IQ4A 4BK2A 1LPFA 5M0ZA 4EQWA 3GMCA 4GDPA 2CFYA 2B7RA 2JB1A 1YY5A 1Q9IA 3AECA 3IHMA 3G5SA 3ICSA 2BA9A 4H4RA 2VRLA 2YVFA 3UP5A 2VVLG 1IUTA 2XFPA 2XLSA 2EQ9A 2I0ZA 4YWOA 3M12A 5ER0A 3UKAA 3CPIG 3HYXA 5HY5A 4N9XA 3HZLA 2VRMA 2WBAA 2BS2A 1TDOA 3REDA 4J33A 4OCGA 3O0HA 2R46A 2R0CA 2WU2A 4JN9A 5KOWA 2UZZA 3QJ4A 2BACA 1KDGA 2BRAA 2FJAA 1CC4A 2GR1A 1EL9A 1H83A 3FMWA 3SGLA 4AOXA 2YG7A 3C4AA 3NKSA 4B1BA 3K7MX 3AD8B 4BK3A 3D1CA 2QAEA 4DSGA 1F8RA 4EIPA 1L9CA 3T0KA 1P2EA 4LA1A 3G5QA 4ECHA 2WP9A 2Q0LA 3IC9A 4CNKA 2GRTA 1VDCA 3AXBA 4USQA 3AYIA 4JY2A 2WDVA 3JSKA 1H7XA 4Y4LA 1H82A 4XWZA 4EQRA 2RGHA 4DGKA 2WPFA 4H2RA 1CF3A 4C5OA 1BGNA 2XFQA 1PXCA 3CGBA 4UDQA 3DMEA 1X31B 3RNMA 2VZ2A 3T2KA 4U8LA 1FEBA 5BULA 2GF3A 3P4QA 1S3BA 4EQSA 2WOVA 2X8GA 4J57A 4UP3A 4U8MA 3V3OA 4Z43A 2GB0A 3AE6A 1D7YA 4H7UA 3FBSA 2EQ6A 3CNDA 2JKCA 1PJ6A 1E7PA 1JRZA 2GR0A 2GMHA 1JU2A 2IIDA 3NN0X 2C3CA 4OPUA 1N1PA 1YQ3A 2ZZ0A 1REOA 4I59A 3NK0X 1XDIA 2V5ZA 4AP3A 1GTHA 4C3XA 2GMJA 2TMDA 4EM4A 4EM3A 1Q1RA 4IVOB 3T14A 3ALJA 5LV9A 5KMPA 1E1MA 1O95A 3VR8A 4U2LA 1F8SA 1E39A 1IJHA 1GRTA 4K5RA 3V3NA 4TLXA 5TR3A 3DK4A 4B63A 3CPHG 4Z2RA 1KFYA 3NK2X 1OJDA 4IV9A 1JEHA 2XVJA 1OJAA 3FG2P 4NTDA 2BRYA 2WETA 3S61A 1S2YA 1QJDA 1H81A 4Z25A 2GQWA 5KXJA 1BKWA 1RSGA 3DJGX 4ZCDA 4U8KA 2B76A 1KF6A 5U25A 1YQ4A 3AEDA 4MJWA 1PJ7A 2QA1A 3T31A 1BGJA 2FJEA 1B37A 5EB4A 1DJQA 3KKJA 4G6HA 4AT2A 3BI5A 5FS9A 1NDAA 1F8WA 3OZ2A 4XXGA 1VG9A 3UKKA 4G74A 5FS7A 3UP4A 1PBBA 4EMWA 2EQ8A 2GAHB 5EBKA 4OVIA 1DJNA 4KPRA 1PBFA 3DJJA 2YVGA 4H4QA 4CBQA 1PBEA 2ARDA 2C7GA 3NTDA 4DSHA 2YG5A 4D04A 4A6NA 1IUXA 1NHQA 2Y6QA 3AE7A 4EMJA 4BURA 4B64A 2AAQA 2BC0A 1EL7A 2GVCA 2BS3A 4EIQA 3L8KA 4J34A 4UDPA 3SQPA 1H7WA 5KMRA 3PO7A 3VRDB 4X9MA 2NPXA 2PHHA 1E1LA 2Q7VA 1GRFA 4H2PA 1JRXA 3ICRA 4G6GA 1IUSA 2V3AA 4KX6A 1RP0A 2GR3A 3QVPA 4WX1A 3AE9A 1FCDA 1L9EA 4H4UA 1XPQA 5GSNA 1VRQB 2B7SA 1GT8A 2XVIA 1FOHA 2YLWA 3UKHA 3B3RA 4UDRA 3QFAA 4J36A 4Z2TA 1QLBA 4K2XA 2YAUA 3IWAA 4FDCB 2C72A 5EOWA 4I58A 4TM1A 2YQUA 1K0LA 3ZYXA 3SM8A 4REKA 1KSSA 3GRSA 3DK9A 4IVMB 3H8IA 2R0PA 3F8RA 4TM3A 4PAAA 3GDNA 2GH5A 4H4SA 4IA6A 2YR4A 4OPIA 1O94A 2XLTA 4PABA 1CBOA 5FS6A 3SXIA 3ZDNA 4AP1A 3H4KA 3UCLA 1KNRA 4YSXA 2RGJA 3DH9A 4H4TA 5BUKA 4A65A 5JCKA 3CMMA 3EANA 3AE3A 3K30A 2VQBA 2XFOA 4H4PA 2B9WA 1PDHA 1M6IA 3H8LA 2FJDA 4GUVA 4H4XA 5KMQA 4A99A 2W0HA 4AOSA 1RYIA 3NN6X 1GSNA 3II4A 1LV0A 1K4QA 4YKGA 2R4EA 1TDNA 2R45A 3CN8A 2IVEA 1MOKA 1ZDLA 1GTEA 1JOAA 2FJBA 2QCUA 4C3YA 1TYPA 3UTFA 1MXTA 3VRBA 3I6DA 1CC2A 3KD9A 2AQJA 4U8NA 2VVMA 1OJ9A 4CNJA 3AEAA 1LVLA 4A79A 3P4SA 4OPDA 1FECA 3NTAA 4FK1C 1NG3A 1ZX9A 4U8JA 2JB3A 4OPCA 3P4RA 1Y56B 3B6DA 3M13A 3PVCA 4CRTA 3UOXA 1Z6LA 1ZKQA 4O5UA 4B67A 5KMSA 1ZMDA 1TRBA 2JBVA 2YLXA 4JQ9A 3K7TA 1TDFA 4GRTA 2RABA 3AYLA 3SZCA 4YTPA 1LQUA 1LTXR 1Y0PA 2BC1A 3DJEA 2Q6UA 2R0GA 1NHRA 2BS4A 2WOIA 1CJ3A 3CNJA 4RG4A 3CPJG 5FMHA 1F6MA 4Z26A 3DA1A 3LZWA 3BHKA 3KLJA 1E1NA 4GDEA 3SZ0A 3AYJA 2WDRA 1JNRA 3P9UA 3UTHA 2A8XA 3GWDA 2Q0KA 2JAEA 1GRHA 5CKUA 4OPGA 4YKFA 1OJTA 2APGA 2YR6A 3AEGA 3UTGA 5BVAA 2WS3A 4K8DA 3SY4A 2Y6RA 4H50A 2PYXA 1XHCA 4YTNA 3DGZA 1PXAA 1B8SA 3RHAA 2E5VA 4EMIA 3EAOA 4OPLA 1E1KA 4ICYA 5U1OA 1W4XA 3BHFA 4B69A 3NIXA 2O9ZA 3IHGA 3QSEA 3NRNA 2NVKX 1QO8A 2C70A 4BJYA 3IF9A 4ZN0A 1Q1WA 5KOXA 3E1TA 5HXIA 2XDOA 1NENA 2XFNA 5EB5A 3GDPA 2Z5YA 2BK5A 3QSSA 1H6VA 2BK3A 2X8CA 2CVJA 4DNAA 2JB2A 1GEUA 1ZY8A 3AEEA 2X8HA 2LFCA 2X99A 1K0IA 1E6EA 2C73A 4GR1A 2BCPA 2GR2A 1AOGA 3RP7A 2WOWA 1EBDA 1V59A 2BYBA 1L9DA 2A89A 1DOBA 2DKHA 2XYOA 4U8OA 1IUUA 1GRGA 3CTYA 1BF3A 4TM4A 4XWRA 1CL0A 3GYIA 2VQ7A 2XVHA 3LOVA 5U63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSM A;  2WES A;  4Z44 A;  1KSU A;  3RP6 A;  2H89 A;  1PBD A;  1PJ5 A;  2A87 A;  2BAB A;  2XFU A;  3NGC X;  1TDK A;  3COX A;  4NZH A;  1GAL A;  1DOC A;  3AEB A;  1GES A;  1GRA A;  1N4V A;  1VG0 A;  4LU6 A;  3BI4 A;  3AE5 A;  4H4W A;  3ATR A;  4JY3 A;  2BK4 A;  1D4C A;  1TYT A;  2C64 A;  4A6N B;  5C3J A;  1CJC A;  2CUL A;  1OJC A;  1ZP0 A;  2TPR A;  2YM2 A;  4A5L A;  1MO9 A;  3Q6J A;  2C66 A;  2R4J A;  2YM1 A;  2E4G A;  4B66 A;  1GER A;  3UKP A;  4NEV A;  4K7Z A;  3ISH A;  2RGO A;  4U8P A;  2C76 A;  3UKL A;  2XVE A;  3ITJ A;  1SEZ A;  3NLC A;  1GPE A;  2C67 A;  4Z24 A;  2YLZ A;  2BCG G;  3V76 A;  1GV4 A;  4H4V A;  5M10 A;  4O5Q A;  1LJ1 A;  2V3B A;  4H2Q A;  1ZOY A;  2VOU A;  4B65 A;  3NYC A;  1NG4 A;  4CY6 A;  3BNM A;  2CDU A;  3CNS A;  3ICT A;  5KVI A;  4Z2U A;  4CCQ A;  1HYU A;  2GEW A;  3ADA B;  2YVJ A;  3ALM A;  1GRE A;  2GAG B;  3AD7 B;  4YTM A;  3VR9 A;  3DGH A;  1BWC A;  2AR8 A;  3D8X A;  3F8P A;  3KVE A;  2XLR A;  4OPT A;  1KNP A;  4EMW A;  4RG3 A;  3UKF A;  3URH A;  3GYX A;  2YG4 A;  1GET A;  2BXS A;  3AB1 A;  1GRB A;  1XAN A;  2VVL A;  2JK6 A;  3UOV A;  1D4E A;  3L1R A;  3VQR A;  1LQT A;  2WP5 A;  4C74 A;  1NEK A;  1DOD A;  1PS9 A;  3T37 A;  3NYF A;  2GV8 A;  3NNE A;  3ABV A;  1D4D A;  4RSL A;  2IVD A;  3EPT A;  1NAA A;  3G5R A;  3AE4 A;  3GRT A;  3P4P A;  1DXL A;  2H88 A;  2YLS A;  3KA7 A;  4TLZ A;  4Y4N A;  2XLU A;  2ZZC A;  4AT0 A;  3LAD A;  3QVR A;  4YSH A;  3AE1 A;  2ZZB A;  4TM0 A;  4YSZ A;  4JNA A;  5KVH A;  3BI2 A;  2BXR A;  3GYJ A;  1N4U A;  1S3E A;  4JDR A;  2J3N A;  1Y56 A;  3I3L A;  4ADW A;  1PN0 A;  3NK1 X;  2YR5 A;  3AE8 A;  4E0V A;  1ONF A;  1ELI A;  4K22 A;  4NEW A;  3LZX A;  2B9Y A;  4BK1 A;  4CCR A;  5C2T A;  2X3N A;  1H84 A;  1CJ2 A;  4EQX A;  3P1W A;  2QA2 A;  4HB9 A;  3VRA A;  1PHH A;  4J56 A;  1K0J A;  2E1M A;  5IQ1 A;  4FK1 A;  3SFD A;  3AEF A;  2WEU A;  4B68 A;  2F5Z A;  1DNC A;  2XVF A;  3CIR A;  4A9W A;  1JRY A;  1F3P A;  3EF6 A;  1VQW A;  3CGC A;  1IUW A;  1FL2 A;  3GMB A;  2WHD A;  2WP6 A;  1IUV A;  5J60 A;  4APN A;  3LJP A;  3RP8 A;  3ALL A;  5L46 A;  2WPC A;  1BZL A;  1ZOV A;  3GWF A;  3GD3 A;  4H2N A;  4H4Z A;  4USR A;  4X9N A;  5DBJ A;  3CGE A;  1CJ4 A;  2FBW A;  1ZMC A;  2YWL A;  5BRT A;  3CNT A;  1COY A;  1EL8 A;  5KWF A;  1PBC A;  3DJD A;  3NT6 A;  2YG3 A;  1EL5 A;  2C3D A;  2WDQ A;  4CY8 A;  3NHO X;  5J7X A;  3UKQ A;  4D03 A;  3CGD A;  3LXD A;  2C65 A;  3GSI A;  3Q9T A;  2OAM A;  2ACZ A;  4Y4M A;  3F8D A;  1H86 A;  4U2T A;  2GQF A;  4GF7 A;  4YSY A;  3NH3 X;  5GRT A;  2Z5X A;  4U8I A;  3C96 A;  5IPY A;  1FEA A;  1B4V A;  1D7L A;  1NPX A;  1CC6 A;  1YKJ A;  3OC4 A;  3UOY A;  5JCI A;  2EQ7 A;  1L0V A;  3UOZ A;  3C4N A;  3QFB A;  4IA5 A;  3K7Q X;  4JNQ A;  1S2Q A;  5KRQ A;  3AD9 B;  1N4W A;  3KPF A;  4LII A;  2B9X A;  2OA1 A;  1D5T A;  2C75 A;  3NYE A;  2XCG A;  3GD4 A;  3AWI A;  4ZCC A;  1PXB A;  2YLT A;  2ZBW A;  4J31 A;  2HQM A;  4NTC A;  4FX9 A;  3LB8 A;  3WE0 A;  2V6O A;  4P9S A;  4HA6 A;  2WQY A;  2X50 A;  3R9U A;  3FIM B;  4YT0 A;  2WPE A;  3FPZ A;  1DOE A;  2YLR A;  4GCM A;  4A7A A;  1B5Q A;  1CHU A;  1ZK7 A;  4YXD A;  2WU5 A;  1GXF A;  1TDE A;  2OLN A;  2OAL A;  1GOS A;  2XLP A;  5HHF A;  4X4J A;  3S5W A;  1O5W A;  3SFE A;  3CNP A;  4C77 A;  3BNU A;  1YQZ A;  5HYM A;  4M52 A;  3PS9 A;  4U2S A;  5FS8 A;  3ATQ A;  1UKV G;  1P2H A;  5JCL A;  1NHS A;  2V61 A;  2YG6 A;  2DKI A;  2OLO A;  4NTE A;  5JCN A;  3NG7 X;  2V60 A;  1M64 A;  4J2W A;  4K5S A;  5CQF A;  4BJZ A;  3AE2 A;  3UTE A;  1NHP A;  4WCT A;  3DK8 A;  4BV6 A;  3M0O A;  3KU9 A;  1JNZ A;  5JCM A;  2R9Z A;  1GND A;  4H4Y A;  5IQ4 A;  4BK2 A;  1LPF A;  5M0Z A;  4EQW A;  3GMC A;  4GDP A;  2CFY A;  2B7R A;  2JB1 A;  1YY5 A;  1Q9I A;  3AEC A;  3IHM A;  3G5S A;  3ICS A;  2BA9 A;  4H4R A;  2VRL A;  2YVF A;  3UP5 A;  2VVL G;  1IUT A;  2XFP A;  2XLS A;  2EQ9 A;  2I0Z A;  4YWO A;  3M12 A;  5ER0 A;  3UKA A;  3CPI G;  5HY5 A;  4N9X A;  3HZL A;  2VRM A;  2WBA A;  2BS2 A;  1TDO A;  3RED A;  4J33 A;  4OCG A;  3O0H A;  2R46 A;  2R0C A;  2WU2 A;  4JN9 A;  5KOW A;  2UZZ A;  3QJ4 A;  2BAC A;  1KDG A;  2FJA A;  1CC4 A;  2GR1 A;  1EL9 A;  1H83 A;  3FMW A;  3SGL A;  4AOX A;  2YG7 A;  3C4A A;  3NKS A;  4B1B A;  3K7M X;  3AD8 B;  4BK3 A;  3D1C A;  2QAE A;  4DSG A;  1F8R A;  4EIP A;  1L9C A;  1P2E A;  4LA1 A;  3G5Q A;  4ECH A;  2WP9 A;  2Q0L A;  3IC9 A;  4CNK A;  2GRT A;  1VDC A;  3AXB A;  4USQ A;  3AYI A;  4JY2 A;  2WDV A;  3JSK A;  1H7X A;  4Y4L A;  1H82 A;  4XWZ A;  4EQR A;  2RGH A;  4DGK A;  2WPF A;  4H2R A;  1CF3 A;  4C5O A;  1BGN A;  2XFQ A;  1PXC A;  3CGB A;  4UDQ A;  3DME A;  1X31 B;  3RNM A;  2VZ2 A;  4U8L A;  1FEB A;  5BUL A;  2GF3 A;  3P4Q A;  1S3B A;  4EQS A;  2WOV A;  2X8G A;  4J57 A;  4UP3 A;  4U8M A;  3V3O A;  4Z43 A;  2GB0 A;  3AE6 A;  1D7Y A;  4H7U A;  3FBS A;  2EQ6 A;  3CND A;  2JKC A;  1PJ6 A;  1E7P A;  1JRZ A;  2GR0 A;  2GMH A;  1JU2 A;  2IID A;  3NN0 X;  2C3C A;  4OPU A;  1N1P A;  1YQ3 A;  2ZZ0 A;  1REO A;  4I59 A;  3NK0 X;  1XDI A;  2V5Z A;  4AP3 A;  1GTH A;  4C3X A;  2GMJ A;  2TMD A;  4EM4 A;  4EM3 A;  1Q1R A;  4IVO B;  3ALJ A;  5LV9 A;  1E1M A;  1O95 A;  3VR8 A;  4U2L A;  1F8S A;  1E39 A;  1IJH A;  1GRT A;  4K5R A;  3V3N A;  4TLX A;  5TR3 A;  3DK4 A;  4B63 A;  3CPH G;  4Z2R A;  1KFY A;  3NK2 X;  1OJD A;  4IV9 A;  1JEH A;  2XVJ A;  1OJA A;  3FG2 P;  4NTD A;  2WET A;  3S61 A;  1S2Y A;  1QJD A;  1H81 A;  4Z25 A;  2GQW A;  5KXJ A;  1BKW A;  1RSG A;  3DJG X;  4ZCD A;  4U8K A;  2B76 A;  1KF6 A;  5U25 A;  1YQ4 A;  3AED A;  4MJW A;  1PJ7 A;  2QA1 A;  1BGJ A;  2FJE A;  1B37 A;  5EB4 A;  1DJQ A;  3KKJ A;  4AT2 A;  3BI5 A;  5FS9 A;  1NDA A;  1F8W A;  3OZ2 A;  4XXG A;  1VG9 A;  3UKK A;  3UP4 A;  5FS7 A;  1PBB A;  2EQ8 A;  2GAH B;  5EBK A;  4OVI A;  1DJN A;  4KPR A;  1PBF A;  3DJJ A;  2YVG A;  4H4Q A;  4CBQ A;  1PBE A;  2ARD A;  2C7G A;  3NTD A;  4DSH A;  2YG5 A;  4D04 A;  4A6N A;  1IUX A;  1NHQ A;  2Y6Q A;  3AE7 A;  4EMJ A;  4BUR A;  4B64 A;  2AAQ A;  2BC0 A;  1EL7 A;  2GVC A;  2BS3 A;  4EIQ A;  3L8K A;  4J34 A;  4UDP A;  3SQP A;  1H7W A;  3PO7 A;  3VRD B;  4X9M A;  2NPX A;  2PHH A;  1E1L A;  2Q7V A;  1GRF A;  4H2P A;  1JRX A;  3ICR A;  1IUS A;  2V3A A;  4KX6 A;  1RP0 A;  2GR3 A;  3QVP A;  4WX1 A;  3AE9 A;  1FCD A;  1L9E A;  4H4U A;  1XPQ A;  5GSN A;  1VRQ B;  2B7S A;  1GT8 A;  2XVI A;  1FOH A;  2YLW A;  3UKH A;  3B3R A;  4UDR A;  3QFA A;  4J36 A;  4Z2T A;  1QLB A;  4K2X A;  2YAU A;  3IWA A;  4FDC B;  2C72 A;  5EOW A;  4I58 A;  4TM1 A;  2YQU A;  1K0L A;  3ZYX A;  3SM8 A;  4REK A;  1KSS A;  3GRS A;  3DK9 A;  4IVM B;  3H8I A;  2R0P A;  3F8R A;  4TM3 A;  4PAA A;  3GDN A;  2GH5 A;  4H4S A;  4IA6 A;  2YR4 A;  4OPI A;  1O94 A;  2XLT A;  4PAB A;  1CBO A;  5FS6 A;  3ZDN A;  4AP1 A;  3H4K A;  3UCL A;  1KNR A;  4YSX A;  2RGJ A;  3DH9 A;  4H4T A;  5BUK A;  4A65 A;  5JCK A;  3EAN A;  3AE3 A;  3K30 A;  2VQB A;  2XFO A;  4H4P A;  2B9W A;  1PDH A;  1M6I A;  3H8L A;  2FJD A;  4GUV A;  4H4X A;  4A99 A;  2W0H A;  4AOS A;  1RYI A;  3NN6 X;  1GSN A;  3II4 A;  1LV0 A;  1K4Q A;  4YKG A;  2R4E A;  1TDN A;  2R45 A;  3CN8 A;  2IVE A;  1MOK A;  1ZDL A;  1GTE A;  1JOA A;  2FJB A;  2QCU A;  4C3Y A;  1TYP A;  3UTF A;  1MXT A;  3VRB A;  3I6D A;  1CC2 A;  3KD9 A;  2AQJ A;  4U8N A;  2VVM A;  1OJ9 A;  4CNJ A;  3AEA A;  1LVL A;  4A79 A;  3P4S A;  4OPD A;  1FEC A;  3NTA A;  4FK1 C;  1NG3 A;  1ZX9 A;  4U8J A;  2JB3 A;  4OPC A;  3P4R A;  1Y56 B;  3B6D A;  3M13 A;  3PVC A;  4CRT A;  3UOX A;  1Z6L A;  1ZKQ A;  4O5U A;  4B67 A;  1ZMD A;  1TRB A;  2JBV A;  2YLX A;  4JQ9 A;  3K7T A;  1TDF A;  4GRT A;  2RAB A;  3AYL A;  4YTP A;  1LQU A;  1LTX R;  1Y0P A;  2BC1 A;  3DJE A;  2Q6U A;  2R0G A;  1NHR A;  2BS4 A;  2WOI A;  1CJ3 A;  3CNJ A;  4RG4 A;  3CPJ G;  5FMH A;  1F6M A;  4Z26 A;  3DA1 A;  3LZW A;  3BHK A;  3KLJ A;  1E1N A;  4GDE A;  3AYJ A;  2WDR A;  1JNR A;  3P9U A;  3UTH A;  2A8X A;  3GWD A;  2Q0K A;  2JAE A;  1GRH A;  5CKU A;  4OPG A;  4YKF A;  1OJT A;  2APG A;  2YR6 A;  3AEG A;  3UTG A;  5BVA A;  2WS3 A;  4K8D A;  2Y6R A;  4H50 A;  2PYX A;  1XHC A;  4YTN A;  3DGZ A;  1PXA A;  1B8S A;  3RHA A;  2E5V A;  4EMI A;  3EAO A;  4OPL A;  1E1K A;  4ICY A;  5U1O A;  1W4X A;  3BHF A;  4B69 A;  3NIX A;  2O9Z A;  3IHG A;  3QSE A;  3NRN A;  2NVK X;  1QO8 A;  2C70 A;  4BJY A;  3IF9 A;  4ZN0 A;  1Q1W A;  5KOX A;  3E1T A;  5HXI A;  2XDO A;  1NEN A;  2XFN A;  5EB5 A;  3GDP A;  2Z5Y A;  2BK5 A;  3QSS A;  1H6V A;  2BK3 A;  2X8C A;  2CVJ A;  4DNA A;  2JB2 A;  1GEU A;  1ZY8 A;  3AEE A;  2X8H A;  2LFC A;  2X99 A;  1K0I A;  1E6E A;  2C73 A;  4GR1 A;  2BCP A;  2GR2 A;  1AOG A;  3RP7 A;  2WOW A;  1EBD A;  1V59 A;  2BYB A;  1L9D A;  2A89 A;  1DOB A;  2DKH A;  2XYO A;  4U8O A;  1IUU A;  1GRG A;  3CTY A;  1BF3 A;  4TM4 A;  4XWR A;  1CL0 A;  3GYI A;  2VQ7 A;  2XVH A;  3LOV A;  5U63 A; 
#chains in the Genus database with same CATH topology
 3QSM A;  2WES A;  4Z44 A;  1KSU A;  3RP6 A;  2H89 A;  1PBD A;  1PJ5 A;  2A87 A;  2BAB A;  2XFU A;  3NGC X;  1TDK A;  3COX A;  4NZH A;  1GAL A;  1DOC A;  4GAP A;  3AEB A;  1GES A;  1GRA A;  1N4V A;  1VG0 A;  2C4C A;  3HYW A;  3BI4 A;  3AE5 A;  4H4W A;  4LU6 A;  3ATR A;  4JY3 A;  2BK4 A;  1D4C A;  1TYT A;  2C64 A;  4A6N B;  5C3J A;  1CJC A;  2CUL A;  3SYI A;  1OJC A;  1ZP0 A;  3T2Z A;  2TPR A;  2YM2 A;  4A5L A;  1MO9 A;  3Q6J A;  2C66 A;  2R4J A;  2YM1 A;  2E4G A;  4B66 A;  1GER A;  3UKP A;  4NEV A;  4K7Z A;  3ISH A;  2RGO A;  4U8P A;  2C76 A;  3UKL A;  2XVE A;  3ITJ A;  1SEZ A;  3NLC A;  1GPE A;  2C67 A;  4Z24 A;  2YLZ A;  2BCG G;  3SX6 A;  3V76 A;  1GV4 A;  4H4V A;  5M10 A;  4O5Q A;  1LJ1 A;  2V3B A;  4H2Q A;  1ZOY A;  2VOU A;  4B65 A;  3NYC A;  1NG4 A;  4CY6 A;  3BNM A;  2CDU A;  3CNS A;  3ICT A;  4GAV A;  5KVI A;  4Z2U A;  4CCQ A;  1HYU A;  2GEW A;  3ADA B;  2YVJ A;  3ALM A;  1GRE A;  2GAG B;  3AD7 B;  4YTM A;  3T2Y A;  3VR9 A;  3DGH A;  1BWC A;  2AR8 A;  3D8X A;  3F8P A;  3KVE A;  2XLR A;  3KPK A;  1KNP A;  4G73 A;  4OPT A;  4RG3 A;  3SZF A;  3GYX A;  3UKF A;  2YG4 A;  3URH A;  1GET A;  2BXS A;  3AB1 A;  1GRB A;  1XAN A;  2VVL A;  2JK6 A;  3UOV A;  1D4E A;  3L1R A;  3VQR A;  1LQT A;  2WP5 A;  4C74 A;  1NEK A;  1DOD A;  1PS9 A;  3T37 A;  3NYF A;  2GV8 A;  3NNE A;  3ABV A;  1D4D A;  4RSL A;  2IVD A;  3EPT A;  1NAA A;  3G5R A;  3AE4 A;  3GRT A;  3P4P A;  1DXL A;  2H88 A;  2YLS A;  3KA7 A;  4TLZ A;  4Y4N A;  2XLU A;  2ZZC A;  4AT0 A;  4G9K A;  3LAD A;  3QVR A;  4YSH A;  3AE1 A;  2ZZB A;  4TM0 A;  4YSZ A;  4JNA A;  5KVH A;  3BI2 A;  2BXR A;  3GYJ A;  1N4U A;  1S3E A;  4JDR A;  2J3N A;  1Y56 A;  3I3L A;  4ADW A;  1PN0 A;  3NK1 X;  2YR5 A;  3AE8 A;  5KNL A;  4E0V A;  1ONF A;  1ELI A;  4K22 A;  4NEW A;  3LZX A;  2B9Y A;  4BK1 A;  4CCR A;  5C2T A;  2X3N A;  1H84 A;  1CJ2 A;  4EQX A;  3P1W A;  2QA2 A;  4HB9 A;  3VRA A;  1PHH A;  4J56 A;  1K0J A;  2E1M A;  5IQ1 A;  4FK1 A;  3SFD A;  3AEF A;  2WEU A;  4B68 A;  2F5Z A;  1DNC A;  2XVF A;  3CIR A;  4A9W A;  1JRY A;  1F3P A;  3EF6 A;  1VQW A;  3CGC A;  1IUW A;  3HYV A;  1FL2 A;  3GMB A;  2WHD A;  2WP6 A;  1IUV A;  5J60 A;  4APN A;  3LJP A;  3RP8 A;  3ALL A;  5L46 A;  2WPC A;  1BZL A;  1ZOV A;  3GWF A;  3GD3 A;  4H2N A;  4H4Z A;  4USR A;  4X9N A;  5DBJ A;  3CGE A;  1CJ4 A;  2FBW A;  1ZMC A;  2YWL A;  5BRT A;  3CNT A;  1COY A;  1EL8 A;  5KWF A;  1PBC A;  3DJD A;  4II2 A;  3NT6 A;  2YG3 A;  1EL5 A;  2C3D A;  2WDQ A;  4CY8 A;  3NHO X;  5J7X A;  3UKQ A;  4D03 A;  3CGD A;  3LXD A;  2C65 A;  3GSI A;  3Q9T A;  3SZW A;  2OAM A;  2ACZ A;  4Y4M A;  3F8D A;  1H86 A;  4U2T A;  2GQF A;  4GF7 A;  4YSY A;  3NH3 X;  4NWZ A;  2Z5X A;  4U8I A;  5GRT A;  3C96 A;  5IPY A;  1FEA A;  1B4V A;  1D7L A;  1NPX A;  1CC6 A;  1YKJ A;  3OC4 A;  3UOY A;  5JCI A;  2EQ7 A;  1L0V A;  3UOZ A;  3C4N A;  3QFB A;  4IA5 A;  3K7Q X;  4JNQ A;  1S2Q A;  5KRQ A;  3AD9 B;  1N4W A;  3KPF A;  4LII A;  2B9X A;  2OA1 A;  1D5T A;  2C75 A;  3NYE A;  2XCG A;  3GD4 A;  3AWI A;  4ZCC A;  1PXB A;  2YLT A;  2ZBW A;  4J31 A;  2HQM A;  4NTC A;  4FX9 A;  3LB8 A;  3WE0 A;  2V6O A;  4P9S A;  4HA6 A;  2WQY A;  2X50 A;  3R9U A;  3FIM B;  4YT0 A;  2WPE A;  3FPZ A;  1DOE A;  2YLR A;  4GCM A;  4A7A A;  1B5Q A;  1CHU A;  1ZK7 A;  4YXD A;  2WU5 A;  1GXF A;  1TDE A;  2OLN A;  2OAL A;  1GOS A;  2XLP A;  5HHF A;  4X4J A;  3S5W A;  1O5W A;  3SFE A;  3CNP A;  4C77 A;  3BNU A;  1YQZ A;  5HYM A;  4M52 A;  3PS9 A;  4U2S A;  5FS8 A;  3ATQ A;  1UKV G;  1P2H A;  4NNJ A;  5JCL A;  1NHS A;  2V61 A;  2YG6 A;  2DKI A;  2OLO A;  4NTE A;  5JCN A;  3NG7 X;  2V60 A;  1M64 A;  4J2W A;  4K5S A;  5CQF A;  4BJZ A;  3AE2 A;  3UTE A;  1NHP A;  4WCT A;  3DK8 A;  4BV6 A;  3M0O A;  3KU9 A;  1JNZ A;  5JCM A;  2R9Z A;  4II3 A;  1GND A;  4H4Y A;  5IQ4 A;  4BK2 A;  1LPF A;  5M0Z A;  4EQW A;  3GMC A;  4GDP A;  2CFY A;  2B7R A;  2JB1 A;  1YY5 A;  1Q9I A;  3AEC A;  3IHM A;  3G5S A;  3ICS A;  2BA9 A;  4H4R A;  2VRL A;  2YVF A;  3UP5 A;  2VVL G;  1IUT A;  2XFP A;  2XLS A;  2EQ9 A;  2I0Z A;  4YWO A;  3M12 A;  5ER0 A;  3UKA A;  3CPI G;  3HYX A;  5HY5 A;  4N9X A;  3HZL A;  2VRM A;  2WBA A;  2BS2 A;  1TDO A;  3RED A;  4J33 A;  4OCG A;  3O0H A;  2R46 A;  2R0C A;  2WU2 A;  4JN9 A;  5KOW A;  2UZZ A;  3QJ4 A;  2BAC A;  1KDG A;  2BRA A;  2FJA A;  1CC4 A;  2GR1 A;  1EL9 A;  1H83 A;  3FMW A;  3SGL A;  4AOX A;  2YG7 A;  3C4A A;  3NKS A;  4B1B A;  3K7M X;  3AD8 B;  4BK3 A;  3D1C A;  2QAE A;  4DSG A;  1F8R A;  4EIP A;  1L9C A;  3T0K A;  1P2E A;  4LA1 A;  3G5Q A;  4ECH A;  2WP9 A;  2Q0L A;  3IC9 A;  4CNK A;  2GRT A;  1VDC A;  3AXB A;  4USQ A;  3AYI A;  4JY2 A;  2WDV A;  3JSK A;  1H7X A;  4Y4L A;  1H82 A;  4XWZ A;  4EQR A;  2RGH A;  4DGK A;  2WPF A;  4H2R A;  1CF3 A;  4C5O A;  1BGN A;  2XFQ A;  1PXC A;  3CGB A;  4UDQ A;  3DME A;  1X31 B;  3RNM A;  2VZ2 A;  3T2K A;  4U8L A;  1FEB A;  5BUL A;  2GF3 A;  3P4Q A;  1S3B A;  4EQS A;  2WOV A;  2X8G A;  4J57 A;  4UP3 A;  4U8M A;  3V3O A;  4Z43 A;  2GB0 A;  3AE6 A;  1D7Y A;  4H7U A;  3FBS A;  2EQ6 A;  3CND A;  2JKC A;  1PJ6 A;  1E7P A;  1JRZ A;  2GR0 A;  2GMH A;  1JU2 A;  2IID A;  3NN0 X;  2C3C A;  4OPU A;  1N1P A;  1YQ3 A;  2ZZ0 A;  1REO A;  4I59 A;  3NK0 X;  1XDI A;  2V5Z A;  4AP3 A;  1GTH A;  4C3X A;  2GMJ A;  2TMD A;  4EM4 A;  4EM3 A;  1Q1R A;  4IVO B;  3T14 A;  3ALJ A;  5LV9 A;  5KMP A;  1E1M A;  1O95 A;  3VR8 A;  4U2L A;  1F8S A;  1E39 A;  1IJH A;  1GRT A;  4K5R A;  3V3N A;  4TLX A;  5TR3 A;  3DK4 A;  4B63 A;  3CPH G;  4Z2R A;  1KFY A;  3NK2 X;  1OJD A;  4IV9 A;  1JEH A;  2XVJ A;  1OJA A;  3FG2 P;  4NTD A;  2BRY A;  2WET A;  3S61 A;  1S2Y A;  1QJD A;  1H81 A;  4Z25 A;  2GQW A;  5KXJ A;  1BKW A;  1RSG A;  3DJG X;  4ZCD A;  4U8K A;  2B76 A;  1KF6 A;  5U25 A;  1YQ4 A;  3AED A;  4MJW A;  1PJ7 A;  2QA1 A;  3T31 A;  1BGJ A;  2FJE A;  1B37 A;  5EB4 A;  1DJQ A;  3KKJ A;  4G6H A;  4AT2 A;  3BI5 A;  5FS9 A;  1NDA A;  1F8W A;  3OZ2 A;  4XXG A;  1VG9 A;  3UKK A;  4G74 A;  5FS7 A;  3UP4 A;  1PBB A;  4EMW A;  2EQ8 A;  2GAH B;  5EBK A;  4OVI A;  1DJN A;  4KPR A;  1PBF A;  3DJJ A;  2YVG A;  4H4Q A;  4CBQ A;  1PBE A;  2ARD A;  2C7G A;  3NTD A;  4DSH A;  2YG5 A;  4D04 A;  4A6N A;  1IUX A;  1NHQ A;  2Y6Q A;  3AE7 A;  4EMJ A;  4BUR A;  4B64 A;  2AAQ A;  2BC0 A;  1EL7 A;  2GVC A;  2BS3 A;  4EIQ A;  3L8K A;  4J34 A;  4UDP A;  3SQP A;  1H7W A;  5KMR A;  3PO7 A;  3VRD B;  4X9M A;  2NPX A;  2PHH A;  1E1L A;  2Q7V A;  1GRF A;  4H2P A;  1JRX A;  3ICR A;  4G6G A;  1IUS A;  2V3A A;  4KX6 A;  1RP0 A;  2GR3 A;  3QVP A;  4WX1 A;  3AE9 A;  1FCD A;  1L9E A;  4H4U A;  1XPQ A;  5GSN A;  1VRQ B;  2B7S A;  1GT8 A;  2XVI A;  1FOH A;  2YLW A;  3UKH A;  3B3R A;  4UDR A;  3QFA A;  4J36 A;  4Z2T A;  1QLB A;  4K2X A;  2YAU A;  3IWA A;  4FDC B;  2C72 A;  5EOW A;  4I58 A;  4TM1 A;  2YQU A;  1K0L A;  3ZYX A;  3SM8 A;  4REK A;  1KSS A;  3GRS A;  3DK9 A;  4IVM B;  3H8I A;  2R0P A;  3F8R A;  4TM3 A;  4PAA A;  3GDN A;  2GH5 A;  4H4S A;  4IA6 A;  2YR4 A;  4OPI A;  1O94 A;  2XLT A;  4PAB A;  1CBO A;  5FS6 A;  3SXI A;  3ZDN A;  4AP1 A;  3H4K A;  3UCL A;  1KNR A;  4YSX A;  2RGJ A;  3DH9 A;  4H4T A;  5BUK A;  4A65 A;  5JCK A;  3CMM A;  3EAN A;  3AE3 A;  3K30 A;  2VQB A;  2XFO A;  4H4P A;  2B9W A;  1PDH A;  1M6I A;  3H8L A;  2FJD A;  4GUV A;  4H4X A;  5KMQ A;  4A99 A;  2W0H A;  4AOS A;  1RYI A;  3NN6 X;  1GSN A;  3II4 A;  1LV0 A;  1K4Q A;  4YKG A;  2R4E A;  1TDN A;  2R45 A;  3CN8 A;  2IVE A;  1MOK A;  1ZDL A;  1GTE A;  1JOA A;  2FJB A;  2QCU A;  4C3Y A;  1TYP A;  3UTF A;  1MXT A;  3VRB A;  3I6D A;  1CC2 A;  3KD9 A;  2AQJ A;  4U8N A;  2VVM A;  1OJ9 A;  4CNJ A;  3AEA A;  1LVL A;  4A79 A;  3P4S A;  4OPD A;  1FEC A;  3NTA A;  4FK1 C;  1NG3 A;  1ZX9 A;  4U8J A;  2JB3 A;  4OPC A;  3P4R A;  1Y56 B;  3B6D A;  3M13 A;  3PVC A;  4CRT A;  3UOX A;  1Z6L A;  1ZKQ A;  4O5U A;  4B67 A;  5KMS A;  1ZMD A;  1TRB A;  2JBV A;  2YLX A;  4JQ9 A;  3K7T A;  1TDF A;  4GRT A;  2RAB A;  3AYL A;  3SZC A;  4YTP A;  1LQU A;  1LTX R;  1Y0P A;  2BC1 A;  3DJE A;  2Q6U A;  2R0G A;  1NHR A;  2BS4 A;  2WOI A;  1CJ3 A;  3CNJ A;  4RG4 A;  3CPJ G;  5FMH A;  1F6M A;  4Z26 A;  3DA1 A;  3LZW A;  3BHK A;  3KLJ A;  1E1N A;  4GDE A;  3SZ0 A;  3AYJ A;  2WDR A;  1JNR A;  3P9U A;  3UTH A;  2A8X A;  3GWD A;  2Q0K A;  2JAE A;  1GRH A;  5CKU A;  4OPG A;  4YKF A;  1OJT A;  2APG A;  2YR6 A;  3AEG A;  3UTG A;  5BVA A;  2WS3 A;  4K8D A;  3SY4 A;  2Y6R A;  4H50 A;  2PYX A;  1XHC A;  4YTN A;  3DGZ A;  1PXA A;  1B8S A;  3RHA A;  2E5V A;  4EMI A;  3EAO A;  4OPL A;  1E1K A;  4ICY A;  5U1O A;  1W4X A;  3BHF A;  4B69 A;  3NIX A;  2O9Z A;  3IHG A;  3QSE A;  3NRN A;  2NVK X;  1QO8 A;  2C70 A;  4BJY A;  3IF9 A;  4ZN0 A;  1Q1W A;  5KOX A;  3E1T A;  5HXI A;  2XDO A;  1NEN A;  2XFN A;  5EB5 A;  3GDP A;  2Z5Y A;  2BK5 A;  3QSS A;  1H6V A;  2BK3 A;  2X8C A;  2CVJ A;  4DNA A;  2JB2 A;  1GEU A;  1ZY8 A;  3AEE A;  2X8H A;  2LFC A;  2X99 A;  1K0I A;  1E6E A;  2C73 A;  4GR1 A;  2BCP A;  2GR2 A;  1AOG A;  3RP7 A;  2WOW A;  1EBD A;  1V59 A;  2BYB A;  1L9D A;  2A89 A;  1DOB A;  2DKH A;  2XYO A;  4U8O A;  1IUU A;  1GRG A;  3CTY A;  1BF3 A;  4TM4 A;  4XWR A;  1CL0 A;  3GYI A;  2VQ7 A;  2XVH A;  3LOV A;  5U63 A; 
#chains in the Genus database with same CATH homology
 3QSM A;  2WES A;  4Z44 A;  1KSU A;  3RP6 A;  2H89 A;  1PBD A;  1PJ5 A;  2A87 A;  2BAB A;  2XFU A;  3NGC X;  1TDK A;  3COX A;  4NZH A;  1GAL A;  1DOC A;  4GAP A;  3AEB A;  1GES A;  1GRA A;  1N4V A;  1VG0 A;  2C4C A;  3HYW A;  3BI4 A;  3AE5 A;  4H4W A;  4LU6 A;  3ATR A;  4JY3 A;  2BK4 A;  1D4C A;  1TYT A;  2C64 A;  4A6N B;  5C3J A;  1CJC A;  2CUL A;  3SYI A;  1OJC A;  1ZP0 A;  3T2Z A;  2TPR A;  2YM2 A;  4A5L A;  1MO9 A;  3Q6J A;  2C66 A;  2R4J A;  2YM1 A;  2E4G A;  4B66 A;  1GER A;  3UKP A;  4NEV A;  4K7Z A;  3ISH A;  2RGO A;  4U8P A;  2C76 A;  3UKL A;  2XVE A;  3ITJ A;  1SEZ A;  3NLC A;  1GPE A;  2C67 A;  4Z24 A;  2YLZ A;  2BCG G;  3SX6 A;  3V76 A;  1GV4 A;  4H4V A;  5M10 A;  4O5Q A;  1LJ1 A;  2V3B A;  4H2Q A;  1ZOY A;  2VOU A;  4B65 A;  3NYC A;  1NG4 A;  4CY6 A;  3BNM A;  2CDU A;  3CNS A;  3ICT A;  4GAV A;  5KVI A;  4Z2U A;  4CCQ A;  1HYU A;  2GEW A;  3ADA B;  2YVJ A;  3ALM A;  1GRE A;  2GAG B;  3AD7 B;  4YTM A;  3T2Y A;  3VR9 A;  3DGH A;  1BWC A;  2AR8 A;  3D8X A;  3F8P A;  3KVE A;  2XLR A;  3KPK A;  1KNP A;  4G73 A;  4OPT A;  4RG3 A;  3SZF A;  3GYX A;  3UKF A;  2YG4 A;  3URH A;  1GET A;  2BXS A;  3AB1 A;  1GRB A;  1XAN A;  2VVL A;  2JK6 A;  3UOV A;  1D4E A;  3L1R A;  3VQR A;  1LQT A;  2WP5 A;  4C74 A;  1NEK A;  1DOD A;  1PS9 A;  3T37 A;  3NYF A;  2GV8 A;  3NNE A;  3ABV A;  1D4D A;  4RSL A;  2IVD A;  3EPT A;  1NAA A;  3G5R A;  3AE4 A;  3GRT A;  3P4P A;  1DXL A;  2H88 A;  2YLS A;  3KA7 A;  4TLZ A;  4Y4N A;  2XLU A;  2ZZC A;  4AT0 A;  4G9K A;  3LAD A;  3QVR A;  4YSH A;  3AE1 A;  2ZZB A;  4TM0 A;  4YSZ A;  4JNA A;  5KVH A;  3BI2 A;  2BXR A;  3GYJ A;  1N4U A;  1S3E A;  4JDR A;  2J3N A;  1Y56 A;  3I3L A;  4ADW A;  1PN0 A;  3NK1 X;  2YR5 A;  3AE8 A;  5KNL A;  4E0V A;  1ONF A;  1ELI A;  4K22 A;  4NEW A;  3LZX A;  2B9Y A;  4BK1 A;  4CCR A;  5C2T A;  2X3N A;  1H84 A;  1CJ2 A;  4EQX A;  3P1W A;  2QA2 A;  4HB9 A;  3VRA A;  1PHH A;  4J56 A;  1K0J A;  2E1M A;  5IQ1 A;  4FK1 A;  3SFD A;  3AEF A;  2WEU A;  4B68 A;  2F5Z A;  1DNC A;  2XVF A;  3CIR A;  4A9W A;  1JRY A;  1F3P A;  3EF6 A;  1VQW A;  3CGC A;  1IUW A;  3HYV A;  1FL2 A;  3GMB A;  2WHD A;  2WP6 A;  1IUV A;  5J60 A;  4APN A;  3LJP A;  3RP8 A;  3ALL A;  5L46 A;  2WPC A;  1BZL A;  1ZOV A;  3GWF A;  3GD3 A;  4H2N A;  4H4Z A;  4USR A;  4X9N A;  5DBJ A;  3CGE A;  1CJ4 A;  2FBW A;  1ZMC A;  2YWL A;  5BRT A;  3CNT A;  1COY A;  1EL8 A;  5KWF A;  1PBC A;  3DJD A;  4II2 A;  3NT6 A;  2YG3 A;  1EL5 A;  2C3D A;  2WDQ A;  4CY8 A;  3NHO X;  5J7X A;  3UKQ A;  4D03 A;  3CGD A;  3LXD A;  2C65 A;  3GSI A;  3Q9T A;  3SZW A;  2OAM A;  2ACZ A;  4Y4M A;  3F8D A;  1H86 A;  4U2T A;  2GQF A;  4GF7 A;  4YSY A;  3NH3 X;  4NWZ A;  2Z5X A;  4U8I A;  5GRT A;  3C96 A;  5IPY A;  1FEA A;  1B4V A;  1D7L A;  1NPX A;  1CC6 A;  1YKJ A;  3OC4 A;  3UOY A;  5JCI A;  2EQ7 A;  1L0V A;  3UOZ A;  3C4N A;  3QFB A;  4IA5 A;  3K7Q X;  4JNQ A;  1S2Q A;  5KRQ A;  3AD9 B;  1N4W A;  3KPF A;  4LII A;  2B9X A;  2OA1 A;  1D5T A;  2C75 A;  3NYE A;  2XCG A;  3GD4 A;  3AWI A;  4ZCC A;  1PXB A;  2YLT A;  2ZBW A;  4J31 A;  2HQM A;  4NTC A;  4FX9 A;  3LB8 A;  3WE0 A;  2V6O A;  4P9S A;  4HA6 A;  2WQY A;  2X50 A;  3R9U A;  3FIM B;  4YT0 A;  2WPE A;  3FPZ A;  1DOE A;  2YLR A;  4GCM A;  4A7A A;  1B5Q A;  1CHU A;  1ZK7 A;  4YXD A;  2WU5 A;  1GXF A;  1TDE A;  2OLN A;  2OAL A;  1GOS A;  2XLP A;  5HHF A;  4X4J A;  3S5W A;  1O5W A;  3SFE A;  3CNP A;  4C77 A;  3BNU A;  1YQZ A;  5HYM A;  4M52 A;  3PS9 A;  4U2S A;  5FS8 A;  3ATQ A;  1UKV G;  1P2H A;  4NNJ A;  5JCL A;  1NHS A;  2V61 A;  2YG6 A;  2DKI A;  2OLO A;  4NTE A;  5JCN A;  3NG7 X;  2V60 A;  1M64 A;  4J2W A;  4K5S A;  5CQF A;  4BJZ A;  3AE2 A;  3UTE A;  1NHP A;  4WCT A;  3DK8 A;  4BV6 A;  3M0O A;  3KU9 A;  1JNZ A;  5JCM A;  2R9Z A;  4II3 A;  1GND A;  4H4Y A;  5IQ4 A;  4BK2 A;  1LPF A;  5M0Z A;  4EQW A;  3GMC A;  4GDP A;  2CFY A;  2B7R A;  2JB1 A;  1YY5 A;  1Q9I A;  3AEC A;  3IHM A;  3G5S A;  3ICS A;  2BA9 A;  4H4R A;  2VRL A;  2YVF A;  3UP5 A;  2VVL G;  1IUT A;  2XFP A;  2XLS A;  2EQ9 A;  2I0Z A;  4YWO A;  3M12 A;  5ER0 A;  3UKA A;  3CPI G;  3HYX A;  5HY5 A;  4N9X A;  3HZL A;  2VRM A;  2WBA A;  2BS2 A;  1TDO A;  3RED A;  4J33 A;  4OCG A;  3O0H A;  2R46 A;  2R0C A;  2WU2 A;  4JN9 A;  5KOW A;  2UZZ A;  3QJ4 A;  2BAC A;  1KDG A;  2BRA A;  2FJA A;  1CC4 A;  2GR1 A;  1EL9 A;  1H83 A;  3FMW A;  3SGL A;  4AOX A;  2YG7 A;  3C4A A;  3NKS A;  4B1B A;  3K7M X;  3AD8 B;  4BK3 A;  3D1C A;  2QAE A;  4DSG A;  1F8R A;  4EIP A;  1L9C A;  3T0K A;  1P2E A;  4LA1 A;  3G5Q A;  4ECH A;  2WP9 A;  2Q0L A;  3IC9 A;  4CNK A;  2GRT A;  1VDC A;  3AXB A;  4USQ A;  3AYI A;  4JY2 A;  2WDV A;  3JSK A;  1H7X A;  4Y4L A;  1H82 A;  4XWZ A;  4EQR A;  2RGH A;  4DGK A;  2WPF A;  4H2R A;  1CF3 A;  4C5O A;  1BGN A;  2XFQ A;  1PXC A;  3CGB A;  4UDQ A;  3DME A;  1X31 B;  3RNM A;  2VZ2 A;  3T2K A;  4U8L A;  1FEB A;  5BUL A;  2GF3 A;  3P4Q A;  1S3B A;  4EQS A;  2WOV A;  2X8G A;  4J57 A;  4UP3 A;  4U8M A;  3V3O A;  4Z43 A;  2GB0 A;  3AE6 A;  1D7Y A;  4H7U A;  3FBS A;  2EQ6 A;  3CND A;  2JKC A;  1PJ6 A;  1E7P A;  1JRZ A;  2GR0 A;  2GMH A;  1JU2 A;  2IID A;  3NN0 X;  2C3C A;  4OPU A;  1N1P A;  1YQ3 A;  2ZZ0 A;  1REO A;  4I59 A;  3NK0 X;  1XDI A;  2V5Z A;  4AP3 A;  1GTH A;  4C3X A;  2GMJ A;  2TMD A;  4EM4 A;  4EM3 A;  1Q1R A;  4IVO B;  3T14 A;  3ALJ A;  5LV9 A;  5KMP A;  1E1M A;  1O95 A;  3VR8 A;  4U2L A;  1F8S A;  1E39 A;  1IJH A;  1GRT A;  4K5R A;  3V3N A;  4TLX A;  5TR3 A;  3DK4 A;  4B63 A;  3CPH G;  4Z2R A;  1KFY A;  3NK2 X;  1OJD A;  4IV9 A;  1JEH A;  2XVJ A;  1OJA A;  3FG2 P;  4NTD A;  2BRY A;  2WET A;  3S61 A;  1S2Y A;  1QJD A;  1H81 A;  4Z25 A;  2GQW A;  5KXJ A;  1BKW A;  1RSG A;  3DJG X;  4ZCD A;  4U8K A;  2B76 A;  1KF6 A;  5U25 A;  1YQ4 A;  3AED A;  4MJW A;  1PJ7 A;  2QA1 A;  3T31 A;  1BGJ A;  2FJE A;  1B37 A;  5EB4 A;  1DJQ A;  3KKJ A;  4G6H A;  4AT2 A;  3BI5 A;  5FS9 A;  1NDA A;  1F8W A;  3OZ2 A;  4XXG A;  1VG9 A;  3UKK A;  4G74 A;  5FS7 A;  3UP4 A;  1PBB A;  4EMW A;  2EQ8 A;  2GAH B;  5EBK A;  4OVI A;  1DJN A;  4KPR A;  1PBF A;  3DJJ A;  2YVG A;  4H4Q A;  4CBQ A;  1PBE A;  2ARD A;  2C7G A;  3NTD A;  4DSH A;  2YG5 A;  4D04 A;  4A6N A;  1IUX A;  1NHQ A;  2Y6Q A;  3AE7 A;  4EMJ A;  4BUR A;  4B64 A;  2AAQ A;  2BC0 A;  1EL7 A;  2GVC A;  2BS3 A;  4EIQ A;  3L8K A;  4J34 A;  4UDP A;  3SQP A;  1H7W A;  5KMR A;  3PO7 A;  3VRD B;  4X9M A;  2NPX A;  2PHH A;  1E1L A;  2Q7V A;  1GRF A;  4H2P A;  1JRX A;  3ICR A;  4G6G A;  1IUS A;  2V3A A;  4KX6 A;  1RP0 A;  2GR3 A;  3QVP A;  4WX1 A;  3AE9 A;  1FCD A;  1L9E A;  4H4U A;  1XPQ A;  5GSN A;  1VRQ B;  2B7S A;  1GT8 A;  2XVI A;  1FOH A;  2YLW A;  3UKH A;  3B3R A;  4UDR A;  3QFA A;  4J36 A;  4Z2T A;  1QLB A;  4K2X A;  2YAU A;  3IWA A;  4FDC B;  2C72 A;  5EOW A;  4I58 A;  4TM1 A;  2YQU A;  1K0L A;  3ZYX A;  3SM8 A;  4REK A;  1KSS A;  3GRS A;  3DK9 A;  4IVM B;  3H8I A;  2R0P A;  3F8R A;  4TM3 A;  4PAA A;  3GDN A;  2GH5 A;  4H4S A;  4IA6 A;  2YR4 A;  4OPI A;  1O94 A;  2XLT A;  4PAB A;  1CBO A;  5FS6 A;  3SXI A;  3ZDN A;  4AP1 A;  3H4K A;  3UCL A;  1KNR A;  4YSX A;  2RGJ A;  3DH9 A;  4H4T A;  5BUK A;  4A65 A;  5JCK A;  3CMM A;  3EAN A;  3AE3 A;  3K30 A;  2VQB A;  2XFO A;  4H4P A;  2B9W A;  1PDH A;  1M6I A;  3H8L A;  2FJD A;  4GUV A;  4H4X A;  5KMQ A;  4A99 A;  2W0H A;  4AOS A;  1RYI A;  3NN6 X;  1GSN A;  3II4 A;  1LV0 A;  1K4Q A;  4YKG A;  2R4E A;  1TDN A;  2R45 A;  3CN8 A;  2IVE A;  1MOK A;  1ZDL A;  1GTE A;  1JOA A;  2FJB A;  2QCU A;  4C3Y A;  1TYP A;  3UTF A;  1MXT A;  3VRB A;  3I6D A;  1CC2 A;  3KD9 A;  2AQJ A;  4U8N A;  2VVM A;  1OJ9 A;  4CNJ A;  3AEA A;  1LVL A;  4A79 A;  3P4S A;  4OPD A;  1FEC A;  3NTA A;  4FK1 C;  1NG3 A;  1ZX9 A;  4U8J A;  2JB3 A;  4OPC A;  3P4R A;  1Y56 B;  3B6D A;  3M13 A;  3PVC A;  4CRT A;  3UOX A;  1Z6L A;  1ZKQ A;  4O5U A;  4B67 A;  5KMS A;  1ZMD A;  1TRB A;  2JBV A;  2YLX A;  4JQ9 A;  3K7T A;  1TDF A;  4GRT A;  2RAB A;  3AYL A;  3SZC A;  4YTP A;  1LQU A;  1LTX R;  1Y0P A;  2BC1 A;  3DJE A;  2Q6U A;  2R0G A;  1NHR A;  2BS4 A;  2WOI A;  1CJ3 A;  3CNJ A;  4RG4 A;  3CPJ G;  5FMH A;  1F6M A;  4Z26 A;  3DA1 A;  3LZW A;  3BHK A;  3KLJ A;  1E1N A;  4GDE A;  3SZ0 A;  3AYJ A;  2WDR A;  1JNR A;  3P9U A;  3UTH A;  2A8X A;  3GWD A;  2Q0K A;  2JAE A;  1GRH A;  5CKU A;  4OPG A;  4YKF A;  1OJT A;  2APG A;  2YR6 A;  3AEG A;  3UTG A;  5BVA A;  2WS3 A;  4K8D A;  3SY4 A;  2Y6R A;  4H50 A;  2PYX A;  1XHC A;  4YTN A;  3DGZ A;  1PXA A;  1B8S A;  3RHA A;  2E5V A;  4EMI A;  3EAO A;  4OPL A;  1E1K A;  4ICY A;  5U1O A;  1W4X A;  3BHF A;  4B69 A;  3NIX A;  2O9Z A;  3IHG A;  3QSE A;  3NRN A;  2NVK X;  1QO8 A;  2C70 A;  4BJY A;  3IF9 A;  4ZN0 A;  1Q1W A;  5KOX A;  3E1T A;  5HXI A;  2XDO A;  1NEN A;  2XFN A;  5EB5 A;  3GDP A;  2Z5Y A;  2BK5 A;  3QSS A;  1H6V A;  2BK3 A;  2X8C A;  2CVJ A;  4DNA A;  2JB2 A;  1GEU A;  1ZY8 A;  3AEE A;  2X8H A;  2LFC A;  2X99 A;  1K0I A;  1E6E A;  2C73 A;  4GR1 A;  2BCP A;  2GR2 A;  1AOG A;  3RP7 A;  2WOW A;  1EBD A;  1V59 A;  2BYB A;  1L9D A;  2A89 A;  1DOB A;  2DKH A;  2XYO A;  4U8O A;  1IUU A;  1GRG A;  3CTY A;  1BF3 A;  4TM4 A;  4XWR A;  1CL0 A;  3GYI A;  2VQ7 A;  2XVH A;  3LOV A;  5U63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...