4AT2A

The crystal structure of 3-ketosteroid-delta4-(5alpha)-dehydrogenase from rhodococcus jostii rha1 in complex with 4-androstene-3,17- dione
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
483
structure length
483
Chain Sequence
b'IRPRSATTVTEWDYEADVVVAGYGIAGVAASIEAARAGADVLVLERTSGWGGATALAGGFIYLGGGTPLQKACGFDDSPENMKTFMMAALGPGADEEKITDYCEGSVEHYNWLVDCGVPFKESFWGEPGWEPPFDDGLMYSGGENAAPFNEIAAPAPRGHVPQMDGKRTGEKGGGYMLMKPLVETAEKLGVRAEYDMRVQTLVTDDTGRVVGIVAKQYGKEVAVRARRGVVLATGSFAYNDKMIEAHAPRLIGRPGAAIEEHDGRSILMAQALGADLAHMDATEVAFVCDPQLIVRGILVNGRGQRYVPEDTYSGRIGQMTLFHQDNQAFLIIDEASYEEGAAATTATPFLRVQPKWAAETVEELESDMGLPAGALQSTVEVYNKHAAEGSDPLLHKKSEWVKPIGTPVAALDLRGFTLGFTLGGLRTTVNSEVLHVSGEPIPGLFAAGRCTSGVCAGGYASGTSLGDGSFYGRRAGISAAKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-KETOSTEROID-DELTA4-5ALPHA-DEHYDROGENASE
publication title Structure and Catalytic Mechanism of 3-Ketosteroid-{Delta}4-(5Alpha)-Dehydrogenase from Rhodococcus Jostii Rha1 Genome.
pubmed doi rcsb
source organism Rhodococcus jostii
molecule tags Oxidoreductase
total genus 163
structure length 483
sequence length 483
ec nomenclature ec 1.3.99.5: 3-oxo-5-alpha-steroid 4-dehydrogenase (acceptor).
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4at2A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4at2A02
3OZ2A 4XXGA 4J57A 1O5WA 3AEAA 1E1KA 4OPLA 2RABA 2YG5A 3GD3A 3VRBA 2E1MA 2UZZA 4WCTA 4I59A 4H4SA 4IVOB 2VOUA 2V3AA 3CN8A 1DODA 4EIPA 2A87A 4NEVA 1NPXA 1CJCA 1H84A 1NHPA 1PS9A 4CNKA 4A9WA 2V5ZA 1COYA 2B9XA 4J31A 1DJNA 1S2QA 4H2RA 4OPGA 5FS6A 1IUWA 2WPFA 2WOVA 4A79A 1VG9A 4TM0A 1RSGA 2BXRA 4OPCA 4U8NA 4Y4LA 4GUVA 4C3XA 1B4VA 2BYBA 2XLTA 1KNRA 4Z2TA 2GVCA 4H2QA 3FMWA 2GH5A 3H8IA 3UTHA 1ZX9A 1JU2A 3CGBA 1BGJA 1N4VA 2TMDA 5CKUA 2R4JA 3QFAA 1GALA 4TLXA 1FL2A 2WOWA 3AECA 4J56A 5C2TA 3NYFA 3ABVA 4NTDA 2R45A 1Y0PA 2XLSA 1EL7A 4B64A 4CCRA 4X9NA 4FK1C 2OALA 1L0VA 1Z6LA 4EQSA 2BCGG 2EQ8A 2JB3A 2WS3A 2X50A 2YG4A 1JNRA 1EL8A 4CY8A 5DBJA 5C3JA 1F8SA 1B8SA 2JAEA 3UOVA 3HZLA 2IVEA 2JBVA 1F3PA 1RP0A 3NLCA 2BS3A 4Z44A 5KWFA 3ISHA 1JEHA 2ARDA 4AP3A 1KFYA 3AEFA 2X99A 1N4UA 2IVDA 4AT2A 4B68A 3NYCA 1H83A 3COXA 1TDKA 3LZWA 4K2XA 3ALLA 2OA1A 3GRTA 2CULA 4K22A 3BI5A 1BGNA 2X8GA 3DJEA 3P4PA 4Z26A 1PXCA 1PJ5A 4A5LA 1KNPA 4K5RA 1K0JA 2X8CA 5U63A 3NK2X 5EOWA 1QO8A 3H8LA 3NG7X 1DOBA 3KLJA 3Q6JA 2YR4A 1LJ1A 4J33A 3H4KA 1YQ4A 2WETA 3C4NA 1BKWA 2CDUA 2E5VA 4H4PA 5HHFA 3QSSA 1GRAA 3F8DA 1DOEA 1PBFA 5IQ1A 4EMWA 4DNAA 3IWAA 1GNDA 1ZOYA 3C96A 4EQRA 1PJ7A 2XCGA 3M12A 4XWZA 2YLSA 3D8XA 4U8OA 1KSUA 2J3NA 3V3OA 2GB0A 3REDA 4JNQA 3EF6A 3S5WA 2BK3A 4IV9A 1K4QA 4YWOA 1D4CA 1PHHA 2WU5A 2WU2A 3KVEA 4I58A 5JCMA 1CJ2A 3G5SA 1GESA 1LQUA 4NTCA 3NH3X 3IC9A 3QSEA 3AE9A 1D7YA 2YG6A 3VRAA 4Z25A 2GEWA 5ER0A 3UKFA 4B1BA 2WQYA 5L46A 4O5UA 2YVGA 3BI4A 1YQZA 3NHOX 3QSMA 4XWRA 1SEZA 5KXJA 1QLBA 3AYLA 2QA2A 2QCUA 5TR3A 3UKKA 5U25A 4APNA 2R0CA 1GREA 2C75A 3VR9A 3AE8A 2AR8A 5LV9A 3T37A 1KF6A 4HB9A 1E7PA 3DMEA 5M10A 1YKJA 3P4RA 2ZZ0A 3M13A 1E6EA 3SM8A 4CBQA 3SFEA 2XYOA 4YTNA 4AOXA 2GRTA 4JN9A 4RG4A 2EQ9A 2WHDA 1GEUA 1NEKA 3EANA 3ZDNA 4E0VA 4A6NA 2C66A 3AD8B 3L1RA 4FX9A 4YSZA 3ALJA 5M0ZA 3VQRA 1Y56A 3LB8A 3UP4A 1QJDA 1PXBA 4IA5A 1CC2A 3AE6A 2RGOA 1L9DA 1H81A 3P1WA 3AE7A 3I3LA 4H4WA 2R46A 1FEAA 2BK5A 1GOSA 2XFNA 3AE5A 1K0IA 2YAUA 1ZK7A 1V59A 1EL9A 2XFOA 3QVRA 3BI2A 2GMHA 2FJBA 3ICRA 2XVIA 2R4EA 3KPFA 4TLZA 4Y4NA 4H4YA 3UTEA 3GYJA 2IIDA 4H4VA 1OJ9A 4USRA 4BK2A 4EM3A 4KPRA 3DJDA 2VVMA 3NN6X 2ACZA 2BC1A 1AOGA 4BK3A 4PAAA 1ELIA 1XDIA 2WP5A 2VVLG 2XFQA 2FJEA 4J34A 2C76A 3FIMB 1CC4A 4C77A 2C7GA 2GV8A 3OC4A 4ZCCA 5J7XA 4AP1A 3ADAB 2YR6A 1IUXA 3E1TA 4OCGA 2WP9A 2YLXA 4MJWA 4DGKA 1S2YA 2VQ7A 4JNAA 5J60A 2BC0A 5JCIA 1JRYA 3NT6A 1H86A 4GDPA 1DNCA 4NEWA 1IUUA 4RSLA 1F8RA 2QAEA 2WOIA 4K7ZA 3DA1A 5FMHA 3K7MX 2YLZA 4J2WA 4U8KA 1TRBA 4B65A 1IJHA 2W0HA 2WP6A 3GMCA 1JRZA 3RP6A 1TYTA 2R9ZA 1S3EA 4B67A 1PBDA 4BJZA 1NHSA 3CGEA 4ECHA 3SFDA 3AXBA 4DSHA 4K5SA 4UDQA 2WDVA 3NRNA 3DJJA 4P9SA 3LOVA 1REOA 2YVFA 5FS7A 2VRLA 2GR2A 4UDRA 2VRMA 2WEUA 2XVJA 1S3BA 3NGCX 1RYIA 4ZCDA 5HY5A 4OPUA 2R0PA 3JSKA 3UKPA 2BS4A 3DK4A 4Z2UA 1L9EA 1TDNA 1IUVA 3G5QA 3CNJA 3CGCA 4JDRA 3BHKA 2Q6UA 1CHUA 1CJ3A 2YLTA 1KSSA 1NHQA 2F5ZA 2WDRA 3B3RA 3GWDA 3PS9A 1FCDA 4GR1A 3AD9B 3LZXA 3UOYA 2RGJA 3AWIA 1GETA 4JQ9A 4O5QA 1O95A 2AAQA 3NNEA 4LU6A 4BK1A 1H7WA 1E1MA 1OJTA 2C67A 1PDHA 1DXLA 3GD4A 2E4GA 4TM1A 5FS8A 4YSYA 4D04A 3AE3A 3P9UA 5GSNA 2V6OA 2CVJA 5KVHA 2A8XA 3UOZA 4USQA 4IA6A 4U2SA 2Z5YA 4WX1A 4A7AA 3V3NA 4A6NB 3VRDB 2OLNA 3UOXA 2GQFA 1XHCA 1Y56B 3DK9A 3CPIG 2XFPA 3LXDA 2BACA 1D4EA 3BNMA 3GDNA 2Q0KA 3QVPA 1VRQB 4EMIA 2HQMA 1GERA 2WESA 2JB2A 2XFUA 1Q1WA 3GYIA 4H4RA 2BK4A 1GT8A 2C3CA 1NAAA 3NTDA 4H4ZA 1LV0A 1MOKA 2WPCA 3GMBA 2FBWA 1CF3A 5FS9A 1N4WA 1CL0A 3SGLA 1KDGA 3AE1A 3AE4A 1CC6A 2JB1A 4H2PA 2XVHA 1PBBA 3GRSA 1PBEA 2PYXA 3AYIA 4GCMA 4U8JA 4X4JA 4ZN0A 3L8KA 4CY6A 5EBKA 4B69A 4Z24A 1Q1RA 3NN0X 4U8LA 2GF3A 3PO7A 5BRTA 3F8RA 1HYUA 1VQWA 2OLOA 3KA7A 4OPIA 2PHHA 4H4QA 2XDOA 1NHRA 2I0ZA 5JCLA 2FJAA 4FK1A 3ATRA 2BABA 3FPZA 4DSGA 2NVKX 1X31B 1ZOVA 1GRBA 1LTXR 1BZLA 3ZYXA 3CGDA 2YG3A 1B5QA 4GRTA 3RP7A 4H50A 4YTMA 5KVIA 1CBOA 4J36A 3K7QX 5U1OA 3URHA 1N1PA 1ZP0A 4YSHA 3ICTA 4ICYA 4NZHA 3AYJA 1DOCA 4JY3A 3IF9A 4H4XA 1JNZA 3UTGA 4EQWA 1GRGA 5BVAA 2DKHA 1BF3A 4H7UA 1MXTA 4M52A 4LIIA 2FJDA 1GRFA 2NPXA 4U8PA 1GRHA 4C3YA 2BA9A 1ZDLA 1W4XA 4EM4A 1JRXA 4GDEA 2X8HA 4YT0A 2XVEA 3QJ4A 4BURA 3KKJA 3NTAA 3DGZA 1NG3A 2ZBWA 1TDOA 2B9WA 2YM2A 2A89A 2C65A 1TDFA 2B76A 1D4DA 3GYXA 1DJQA 2AQJA 3AEDA 1P2EA 2O9ZA 2GR3A 2X3NA 4YKFA 5JCNA 1VG0A 2OAMA 3RP8A 3K30A 4K8DA 3SQPA 2YQUA 1B37A 2WBAA 4EIQA 2R0GA 2XLRA 1BWCA 2XLUA 4CRTA 3IHGA 1FEBA 1PN0A 2QA1A 4D03A 1YY5A 1H6VA 2EQ6A 2YVJA 2V61A 3AE2A 3RNMA 1D5TA 1VDCA 2LFCA 1Q9IA 3ITJA 3O0HA 2YLRA 3DK8A 4A99A 3C4AA 3AB1A 4H4TA 3B6DA 3S61A 3UKHA 1M64A 3EPTA 1OJDA 3Q9TA 1K0LA 1ZKQA 2YG7A 1PJ6A 1UKVG 4KX6A 3LJPA 4NTEA 3CIRA 4H2NA 4HA6A 5HYMA 1TDEA 2V60A 2EQ7A 2WDQA 1D7LA 3V76A 5KOWA 1E1LA 2BS2A 4YKGA 1FECA 5EB5A 3DGHA 3FG2P 1XPQA 3KD9A 4H4UA 3UCLA 4BV6A 3GDPA 2XVFA 4GF7A 3UTFA 3DJGX 2C72A 4U2LA 3M0OA 1H7XA 2WPEA 3PVCA 2JKCA 3R9UA 3AEEA 5IPYA 2XLPA 1NENA 1GTEA 2GQWA 3UP5A 1YQ3A 4A65A 4N9XA 1EL5A 1NDAA 3WE0A 1XANA 3ALMA 3NIXA 1OJAA 4B63A 1E39A 4PABA 1CJ4A 3K7TA 1IUTA 2H88A 2ZZCA 3KU9A 5BULA 3NKSA 4TM3A 1GSNA 4C5OA 3UKQA 3CPJG 3II4A 3BNUA 1GTHA 2GAHB 3CNTA 1MO9A 3G5RA 5GRTA 1ZMCA 4TM4A 3IHMA 2JK6A 1EBDA 4EQXA 4B66A 2ZZBA 1NG4A 2VVLA 2YR5A 1ZY8A 2V3BA 2GR1A 3FBSA 1GRTA 3NYEA 1GXFA 3NK0X 5KRQA 1ONFA 4REKA 3UKAA 2CFYA 2VQBA 4OPTA 2TPRA 3UKLA 3F8PA 3P4QA 4ADWA 3DH9A 2C3DA 4CNJA 4Z2RA 1LPFA 1OJCA 2VZ2A 2H89A 1ZMDA 1TYPA 3ICSA 4OPDA 4X9MA 4YSXA 5KOXA 2RGHA 4LA1A 1F8WA 1LQTA 3GWFA 4Y4MA 2B7SA 1PBCA 2Q0LA 2Q7VA 3CNSA 3I6DA 4Z43A 1P2HA 2BXSA 3CNDA 2B7RA 2B9YA 1E1NA 2C73A 2GAGB 1L9CA 3CTYA 3NK1X 2YLWA 3P4SA 1IUSA 3CPHG 4BJYA 3BHFA 4YXDA 1O94A 2Y6QA 2BCPA 1M6IA 3AD7B 4U8IA 5JCKA 3AEGA 5EB4A 4YTPA 2C70A 4IVMB 2YM1A 2YWLA 4UP3A 1GV4A 3ATQA 2C64A 4JY2A 4OVIA 5IQ4A 1F6MA 3AEBA 4C74A 3VR8A 1PXAA 1LVLA 1H82A 4RG3A 4AT0A 4FDCB 3QFBA 2APGA 2GR0A 4CCQA 5BUKA 3D1CA 2Z5XA 4U2TA 1FOHA 4U8MA 4AOSA 4EMJA 2GMJA 5CQFA 5HXIA 3LADA 4UDPA 1JOAA 2DKIA 2Y6RA 3GSIA 3CNPA 1GPEA 3RHAA 3EAOA
chains in the Genus database with same CATH superfamily
3OZ2A 4XXGA 4J57A 1O5WA 3AEAA 1E1KA 4OPLA 2RABA 2YG5A 3GD3A 3VRBA 2E1MA 2UZZA 4WCTA 4I59A 4H4SA 4IVOB 2VOUA 2V3AA 3CN8A 1DODA 4EIPA 2A87A 4NEVA 1NPXA 1CJCA 1H84A 1NHPA 1PS9A 4CNKA 4A9WA 3CMMA 4II3A 2V5ZA 1COYA 2B9XA 4J31A 1DJNA 1S2QA 4H2RA 4OPGA 5FS6A 1IUWA 2WPFA 2WOVA 4GAVA 4A79A 3SZCA 1VG9A 4TM0A 2C4CA 1RSGA 2BXRA 4OPCA 4U8NA 5KMQA 4Y4LA 2BRYA 4GUVA 4C3XA 1B4VA 2BYBA 2XLTA 1KNRA 3T31A 4Z2TA 2GVCA 4H2QA 3FMWA 2GH5A 3H8IA 3UTHA 1ZX9A 1JU2A 3CGBA 1BGJA 1N4VA 2TMDA 5CKUA 2R4JA 3QFAA 1GALA 4TLXA 1FL2A 2WOWA 3AECA 4J56A 5C2TA 3NYFA 3ABVA 4NTDA 2R45A 1Y0PA 2XLSA 1EL7A 4B64A 4CCRA 4X9NA 4FK1C 2OALA 1L0VA 1Z6LA 4EQSA 2BCGG 2EQ8A 2JB3A 2WS3A 2X50A 2YG4A 1JNRA 1EL8A 4CY8A 5DBJA 5C3JA 1F8SA 1B8SA 2JAEA 3UOVA 3HZLA 2IVEA 2JBVA 1F3PA 3SX6A 1RP0A 3NLCA 2BS3A 4Z44A 5KWFA 3ISHA 1JEHA 2ARDA 4AP3A 1KFYA 3AEFA 2X99A 3SZFA 1N4UA 2IVDA 4AT2A 4B68A 3T14A 3NYCA 4NWZA 1H83A 3COXA 1TDKA 3LZWA 4K2XA 3ALLA 2OA1A 3GRTA 2CULA 4K22A 3BI5A 1BGNA 2X8GA 3DJEA 3P4PA 4Z26A 1PXCA 1PJ5A 4A5LA 1KNPA 4K5RA 1K0JA 2X8CA 5U63A 3NK2X 5EOWA 1QO8A 3H8LA 3NG7X 1DOBA 3KLJA 3Q6JA 2YR4A 1LJ1A 4J33A 3H4KA 1YQ4A 2WETA 3C4NA 1BKWA 4G9KA 2CDUA 2E5VA 4H4PA 5HHFA 3QSSA 1GRAA 3F8DA 1DOEA 1PBFA 5IQ1A 4EMWA 4DNAA 3IWAA 1GNDA 1ZOYA 3C96A 4EQRA 1PJ7A 2XCGA 3M12A 4XWZA 2YLSA 3D8XA 4U8OA 1KSUA 2J3NA 3SY4A 3V3OA 3HYXA 2GB0A 3REDA 4JNQA 3EF6A 3S5WA 2BK3A 4IV9A 1K4QA 4YWOA 1D4CA 1PHHA 2WU5A 2WU2A 3KVEA 4I58A 5JCMA 1CJ2A 3G5SA 1GESA 1LQUA 4II2A 4NTCA 3NH3X 3IC9A 3QSEA 3AE9A 1D7YA 2YG6A 3VRAA 4Z25A 2GEWA 5ER0A 3UKFA 4B1BA 2WQYA 5L46A 3T2KA 4O5UA 5KNLA 2YVGA 3BI4A 1YQZA 3NHOX 3QSMA 4XWRA 1SEZA 3T2ZA 1QLBA 5KXJA 3AYLA 2QA2A 2QCUA 5TR3A 3UKKA 5U25A 4APNA 2R0CA 1GREA 2C75A 3VR9A 3AE8A 2AR8A 5LV9A 3T37A 1KF6A 4HB9A 1E7PA 3DMEA 5M10A 1YKJA 3P4RA 2ZZ0A 3M13A 1E6EA 4NNJA 3SM8A 3SFEA 4CBQA 2XYOA 4YTNA 4AOXA 2GRTA 4JN9A 4RG4A 2EQ9A 2WHDA 1GEUA 1NEKA 3EANA 3ZDNA 4E0VA 3SZ0A 2C66A 3AD8B 3L1RA 4A6NA 4FX9A 4YSZA 3ALJA 5M0ZA 3VQRA 1Y56A 3LB8A 3UP4A 1QJDA 1PXBA 4IA5A 1CC2A 3SYIA 3AE6A 2RGOA 1L9DA 1H81A 3P1WA 3AE7A 3I3LA 4H4WA 2R46A 1FEAA 2BK5A 1GOSA 2XFNA 3AE5A 1K0IA 2YAUA 1ZK7A 1V59A 1EL9A 2XFOA 3QVRA 3BI2A 2GMHA 2FJBA 3ICRA 2XVIA 2R4EA 3KPFA 4TLZA 4Y4NA 4H4YA 3UTEA 3GYJA 2IIDA 4H4VA 1OJ9A 4USRA 4BK2A 4EM3A 4KPRA 3DJDA 2VVMA 3NN6X 3T2YA 2ACZA 2BC1A 1AOGA 4BK3A 4PAAA 1ELIA 1XDIA 2WP5A 2VVLG 2XFQA 2FJEA 3HYWA 4J34A 2C76A 3FIMB 1CC4A 4C77A 2C7GA 2GV8A 3OC4A 4ZCCA 5J7XA 4AP1A 3ADAB 2YR6A 1IUXA 3E1TA 4OCGA 2WP9A 2YLXA 4MJWA 4DGKA 1S2YA 2VQ7A 4JNAA 5J60A 2BC0A 5JCIA 1JRYA 3NT6A 1H86A 4GDPA 1DNCA 4NEWA 4GAPA 1IUUA 4RSLA 1F8RA 2QAEA 2WOIA 4K7ZA 3DA1A 5FMHA 3K7MX 2YLZA 4J2WA 4U8KA 1TRBA 4B65A 1IJHA 2W0HA 2WP6A 3GMCA 1JRZA 3RP6A 1TYTA 2R9ZA 1S3EA 4B67A 1PBDA 4BJZA 1NHSA 3CGEA 4ECHA 3SFDA 3AXBA 4DSHA 4K5SA 4UDQA 2WDVA 3NRNA 3DJJA 4P9SA 3LOVA 1REOA 2YVFA 5FS7A 2VRLA 2GR2A 4UDRA 2VRMA 2WEUA 2XVJA 1S3BA 3NGCX 1RYIA 4ZCDA 5HY5A 4OPUA 2R0PA 3JSKA 3UKPA 2BS4A 3DK4A 4Z2UA 1L9EA 1TDNA 1IUVA 3G5QA 3CNJA 3CGCA 4JDRA 3BHKA 2Q6UA 1CHUA 1CJ3A 2YLTA 1KSSA 1NHQA 2F5ZA 2WDRA 3B3RA 3GWDA 3PS9A 1FCDA 4GR1A 3AD9B 3LZXA 3UOYA 2RGJA 3AWIA 1GETA 4JQ9A 3SZWA 4O5QA 1O95A 2AAQA 3NNEA 4LU6A 4BK1A 1H7WA 1E1MA 1OJTA 2C67A 1PDHA 1DXLA 3GD4A 2E4GA 4TM1A 5FS8A 4YSYA 4D04A 3AE3A 3P9UA 5GSNA 2V6OA 3HYVA 2CVJA 5KVHA 2A8XA 3UOZA 4USQA 4IA6A 4U2SA 2Z5YA 4WX1A 4A7AA 3V3NA 4A6NB 3VRDB 2OLNA 3UOXA 2GQFA 1XHCA 1Y56B 3DK9A 3CPIG 2XFPA 3LXDA 2BACA 1D4EA 3BNMA 3GDNA 2Q0KA 3QVPA 1VRQB 4EMIA 2HQMA 1GERA 2WESA 2JB2A 2XFUA 1Q1WA 3GYIA 4H4RA 2BK4A 1GT8A 2C3CA 1NAAA 3NTDA 4H4ZA 1LV0A 1MOKA 2WPCA 3GMBA 2FBWA 1CF3A 5FS9A 1N4WA 1CL0A 3SGLA 1KDGA 3AE1A 3AE4A 1CC6A 2JB1A 4H2PA 2XVHA 1PBBA 3GRSA 1PBEA 2PYXA 3AYIA 4GCMA 4U8JA 4X4JA 4ZN0A 3L8KA 4CY6A 5EBKA 4B69A 4Z24A 1Q1RA 3NN0X 4U8LA 2GF3A 3PO7A 5BRTA 3F8RA 1HYUA 1VQWA 2OLOA 3KA7A 4OPIA 2PHHA 4H4QA 2XDOA 1NHRA 2I0ZA 5JCLA 2FJAA 4FK1A 3ATRA 2BABA 3FPZA 4DSGA 2NVKX 1X31B 1ZOVA 1GRBA 1LTXR 1BZLA 3ZYXA 3CGDA 2YG3A 3SXIA 1B5QA 4GRTA 3RP7A 4H50A 4YTMA 5KVIA 1CBOA 4G6HA 4J36A 3K7QX 5U1OA 3URHA 1N1PA 1ZP0A 4YSHA 3ICTA 4ICYA 4NZHA 3AYJA 1DOCA 4JY3A 3IF9A 4H4XA 1JNZA 3UTGA 4EQWA 1GRGA 5BVAA 2DKHA 1BF3A 4H7UA 5KMPA 1MXTA 4M52A 4LIIA 2FJDA 1GRFA 2NPXA 4U8PA 1GRHA 4C3YA 2BA9A 1ZDLA 1W4XA 4EM4A 1JRXA 4GDEA 2X8HA 4YT0A 2XVEA 3QJ4A 4BURA 3KKJA 3NTAA 3DGZA 1NG3A 2ZBWA 1TDOA 2B9WA 2YM2A 2A89A 2C65A 1TDFA 2B76A 1D4DA 3GYXA 1DJQA 2AQJA 3AEDA 1P2EA 2O9ZA 2GR3A 2X3NA 4YKFA 5JCNA 1VG0A 2OAMA 3RP8A 3K30A 4K8DA 3SQPA 2YQUA 1B37A 2WBAA 4EIQA 2R0GA 2XLRA 1BWCA 2XLUA 4CRTA 3IHGA 1FEBA 1PN0A 2QA1A 4D03A 1YY5A 1H6VA 2EQ6A 2YVJA 2V61A 3AE2A 3RNMA 1D5TA 1VDCA 2LFCA 1Q9IA 3ITJA 3O0HA 2YLRA 3DK8A 4A99A 3C4AA 3AB1A 4H4TA 3B6DA 3S61A 3UKHA 1M64A 3EPTA 1OJDA 3Q9TA 1K0LA 1ZKQA 2YG7A 1PJ6A 1UKVG 4KX6A 3LJPA 4NTEA 3CIRA 4H2NA 4HA6A 5HYMA 1TDEA 2V60A 2EQ7A 5KMRA 2WDQA 1D7LA 3V76A 5KOWA 1E1LA 2BS2A 4YKGA 1FECA 5EB5A 3DGHA 3FG2P 1XPQA 3KD9A 4H4UA 3UCLA 4BV6A 3GDPA 4G74A 2XVFA 4GF7A 3UTFA 3DJGX 2C72A 4U2LA 3M0OA 1H7XA 2WPEA 3PVCA 2JKCA 4G6GA 3AEEA 4G73A 3R9UA 2XLPA 1NENA 5IPYA 1GTEA 2GQWA 3UP5A 1YQ3A 4A65A 4N9XA 1EL5A 1NDAA 3WE0A 1XANA 3ALMA 3NIXA 1OJAA 4B63A 1E39A 4PABA 1CJ4A 3K7TA 1IUTA 2H88A 2ZZCA 3KU9A 5BULA 3NKSA 4TM3A 1GSNA 4C5OA 3UKQA 3CPJG 3II4A 3BNUA 1GTHA 2GAHB 3CNTA 1MO9A 3G5RA 5GRTA 1ZMCA 4TM4A 3IHMA 2JK6A 1EBDA 4EQXA 4B66A 2ZZBA 1NG4A 2VVLA 2YR5A 1ZY8A 2V3BA 2GR1A 3FBSA 3T0KA 1GRTA 3NYEA 1GXFA 3NK0X 5KRQA 1ONFA 4REKA 3UKAA 2CFYA 2VQBA 4OPTA 2TPRA 3UKLA 3F8PA 3P4QA 4ADWA 3DH9A 2C3DA 4CNJA 4Z2RA 1LPFA 1OJCA 2VZ2A 2H89A 1ZMDA 1TYPA 3ICSA 4OPDA 4X9MA 4YSXA 5KOXA 2RGHA 4LA1A 1F8WA 1LQTA 3GWFA 4Y4MA 2B7SA 1PBCA 2Q0LA 2Q7VA 3CNSA 3I6DA 4Z43A 1P2HA 2BXSA 3CNDA 2B7RA 2BRAA 2B9YA 1E1NA 2C73A 2GAGB 1L9CA 3CTYA 3NK1X 2YLWA 3P4SA 1IUSA 3CPHG 4BJYA 3BHFA 4YXDA 1O94A 2Y6QA 2BCPA 5KMSA 1M6IA 3AD7B 4U8IA 5JCKA 3AEGA 5EB4A 4YTPA 2C70A 4IVMB 2YM1A 2YWLA 4UP3A 1GV4A 3ATQA 2C64A 4JY2A 4OVIA 5IQ4A 1F6MA 3AEBA 4C74A 3VR8A 1PXAA 1LVLA 1H82A 4RG3A 4AT0A 4FDCB 3QFBA 2APGA 2GR0A 4CCQA 5BUKA 3D1CA 2Z5XA 4U2TA 1FOHA 4U8MA 4AOSA 4EMJA 2GMJA 5CQFA 5HXIA 3LADA 4UDPA 1JOAA 2DKIA 2Y6RA 3GSIA 3CNPA 1GPEA 3KPKA 3RHAA 3EAOA
chains in the Genus database with same CATH topology
3OZ2A 4XXGA 4J57A 1O5WA 3AEAA 1E1KA 4OPLA 2RABA 2YG5A 3GD3A 3VRBA 2E1MA 2UZZA 4WCTA 4I59A 4H4SA 4IVOB 2VOUA 2V3AA 3CN8A 1DODA 4EIPA 2A87A 4NEVA 1NPXA 1CJCA 1H84A 1NHPA 1PS9A 4CNKA 4A9WA 3CMMA 4II3A 2V5ZA 1COYA 2B9XA 4J31A 1DJNA 1S2QA 4H2RA 4OPGA 5FS6A 1IUWA 2WPFA 2WOVA 4GAVA 4A79A 3SZCA 1VG9A 4TM0A 2C4CA 1RSGA 2BXRA 4OPCA 4U8NA 5KMQA 4Y4LA 2BRYA 4GUVA 4C3XA 1B4VA 2BYBA 2XLTA 1KNRA 3T31A 4Z2TA 2GVCA 4H2QA 3FMWA 2GH5A 3H8IA 3UTHA 1ZX9A 1JU2A 3CGBA 1BGJA 1N4VA 2TMDA 5CKUA 2R4JA 3QFAA 1GALA 4TLXA 1FL2A 2WOWA 3AECA 4J56A 5C2TA 3NYFA 3ABVA 4NTDA 2R45A 1Y0PA 2XLSA 1EL7A 4B64A 4CCRA 4X9NA 4FK1C 2OALA 1L0VA 1Z6LA 4EQSA 2BCGG 2EQ8A 2JB3A 2WS3A 2X50A 2YG4A 1JNRA 1EL8A 4CY8A 5DBJA 5C3JA 1F8SA 1B8SA 2JAEA 3UOVA 3HZLA 2IVEA 2JBVA 1F3PA 3SX6A 1RP0A 3NLCA 2BS3A 4Z44A 5KWFA 3ISHA 1JEHA 2ARDA 4AP3A 1KFYA 3AEFA 2X99A 3SZFA 1N4UA 2IVDA 4AT2A 4B68A 3T14A 3NYCA 4NWZA 1H83A 3COXA 1TDKA 3LZWA 4K2XA 3ALLA 2OA1A 3GRTA 2CULA 4K22A 3BI5A 1BGNA 2X8GA 3DJEA 3P4PA 4Z26A 1PXCA 1PJ5A 4A5LA 1KNPA 4K5RA 1K0JA 2X8CA 5U63A 3NK2X 5EOWA 1QO8A 3H8LA 3NG7X 1DOBA 3KLJA 3Q6JA 2YR4A 1LJ1A 4J33A 3H4KA 1YQ4A 2WETA 3C4NA 1BKWA 4G9KA 2CDUA 2E5VA 4H4PA 5HHFA 3QSSA 1GRAA 3F8DA 1DOEA 1PBFA 5IQ1A 4EMWA 4DNAA 3IWAA 1GNDA 1ZOYA 3C96A 4EQRA 1PJ7A 2XCGA 3M12A 4XWZA 2YLSA 3D8XA 4U8OA 1KSUA 2J3NA 3SY4A 3V3OA 3HYXA 2GB0A 3REDA 4JNQA 3EF6A 3S5WA 2BK3A 4IV9A 1K4QA 4YWOA 1D4CA 1PHHA 2WU5A 2WU2A 3KVEA 4I58A 5JCMA 1CJ2A 3G5SA 1GESA 1LQUA 4II2A 4NTCA 3NH3X 3IC9A 3QSEA 3AE9A 1D7YA 2YG6A 3VRAA 4Z25A 2GEWA 5ER0A 3UKFA 4B1BA 2WQYA 5L46A 3T2KA 4O5UA 5KNLA 2YVGA 3BI4A 1YQZA 3NHOX 3QSMA 4XWRA 1SEZA 3T2ZA 1QLBA 5KXJA 3AYLA 2QA2A 2QCUA 5TR3A 3UKKA 5U25A 4APNA 2R0CA 1GREA 2C75A 3VR9A 3AE8A 2AR8A 5LV9A 3T37A 1KF6A 4HB9A 1E7PA 3DMEA 5M10A 1YKJA 3P4RA 2ZZ0A 3M13A 1E6EA 4NNJA 3SM8A 3SFEA 4CBQA 2XYOA 4YTNA 4AOXA 2GRTA 4JN9A 4RG4A 2EQ9A 2WHDA 1GEUA 1NEKA 3EANA 3ZDNA 4E0VA 3SZ0A 2C66A 3AD8B 3L1RA 4A6NA 4FX9A 4YSZA 3ALJA 5M0ZA 3VQRA 1Y56A 3LB8A 3UP4A 1QJDA 1PXBA 4IA5A 1CC2A 3SYIA 3AE6A 2RGOA 1L9DA 1H81A 3P1WA 3AE7A 3I3LA 4H4WA 2R46A 1FEAA 2BK5A 1GOSA 2XFNA 3AE5A 1K0IA 2YAUA 1ZK7A 1V59A 1EL9A 2XFOA 3QVRA 3BI2A 2GMHA 2FJBA 3ICRA 2XVIA 2R4EA 3KPFA 4TLZA 4Y4NA 4H4YA 3UTEA 3GYJA 2IIDA 4H4VA 1OJ9A 4USRA 4BK2A 4EM3A 4KPRA 3DJDA 2VVMA 3NN6X 3T2YA 2ACZA 2BC1A 1AOGA 4BK3A 4PAAA 1ELIA 1XDIA 2WP5A 2VVLG 2XFQA 2FJEA 3HYWA 4J34A 2C76A 3FIMB 1CC4A 4C77A 2C7GA 2GV8A 3OC4A 4ZCCA 5J7XA 4AP1A 3ADAB 2YR6A 1IUXA 3E1TA 4OCGA 2WP9A 2YLXA 4MJWA 4DGKA 1S2YA 2VQ7A 4JNAA 5J60A 2BC0A 5JCIA 1JRYA 3NT6A 1H86A 4GDPA 1DNCA 4NEWA 4GAPA 1IUUA 4RSLA 1F8RA 2QAEA 2WOIA 4K7ZA 3DA1A 5FMHA 3K7MX 2YLZA 4J2WA 4U8KA 1TRBA 4B65A 1IJHA 2W0HA 2WP6A 3GMCA 1JRZA 3RP6A 1TYTA 2R9ZA 1S3EA 4B67A 1PBDA 4BJZA 1NHSA 3CGEA 4ECHA 3SFDA 3AXBA 4DSHA 4K5SA 4UDQA 2WDVA 3NRNA 3DJJA 4P9SA 3LOVA 1REOA 2YVFA 5FS7A 2VRLA 2GR2A 4UDRA 2VRMA 2WEUA 2XVJA 1S3BA 3NGCX 1RYIA 4ZCDA 5HY5A 4OPUA 2R0PA 3JSKA 3UKPA 2BS4A 3DK4A 4Z2UA 1L9EA 1TDNA 1IUVA 3G5QA 3CNJA 3CGCA 4JDRA 3BHKA 2Q6UA 1CHUA 1CJ3A 2YLTA 1KSSA 1NHQA 2F5ZA 2WDRA 3B3RA 3GWDA 3PS9A 1FCDA 4GR1A 3AD9B 3LZXA 3UOYA 2RGJA 3AWIA 1GETA 4JQ9A 3SZWA 4O5QA 1O95A 2AAQA 3NNEA 4LU6A 4BK1A 1H7WA 1E1MA 1OJTA 2C67A 1PDHA 1DXLA 3GD4A 2E4GA 4TM1A 5FS8A 4YSYA 4D04A 3AE3A 3P9UA 5GSNA 2V6OA 3HYVA 2CVJA 5KVHA 2A8XA 3UOZA 4USQA 4IA6A 4U2SA 2Z5YA 4WX1A 4A7AA 3V3NA 4A6NB 3VRDB 2OLNA 3UOXA 2GQFA 1XHCA 1Y56B 3DK9A 3CPIG 2XFPA 3LXDA 2BACA 1D4EA 3BNMA 3GDNA 2Q0KA 3QVPA 1VRQB 4EMIA 2HQMA 1GERA 2WESA 2JB2A 2XFUA 1Q1WA 3GYIA 4H4RA 2BK4A 1GT8A 2C3CA 1NAAA 3NTDA 4H4ZA 1LV0A 1MOKA 2WPCA 3GMBA 2FBWA 1CF3A 5FS9A 1N4WA 1CL0A 3SGLA 1KDGA 3AE1A 3AE4A 1CC6A 2JB1A 4H2PA 2XVHA 1PBBA 3GRSA 1PBEA 2PYXA 3AYIA 4GCMA 4U8JA 4X4JA 4ZN0A 3L8KA 4CY6A 5EBKA 4B69A 4Z24A 1Q1RA 3NN0X 4U8LA 2GF3A 3PO7A 5BRTA 3F8RA 1HYUA 1VQWA 2OLOA 3KA7A 4OPIA 2PHHA 4H4QA 2XDOA 1NHRA 2I0ZA 5JCLA 2FJAA 4FK1A 3ATRA 2BABA 3FPZA 4DSGA 2NVKX 1X31B 1ZOVA 1GRBA 1LTXR 1BZLA 3ZYXA 3CGDA 2YG3A 3SXIA 1B5QA 4GRTA 3RP7A 4H50A 4YTMA 5KVIA 1CBOA 4G6HA 4J36A 3K7QX 5U1OA 3URHA 1N1PA 1ZP0A 4YSHA 3ICTA 4ICYA 4NZHA 3AYJA 1DOCA 4JY3A 3IF9A 4H4XA 1JNZA 3UTGA 4EQWA 1GRGA 5BVAA 2DKHA 1BF3A 4H7UA 5KMPA 1MXTA 4M52A 4LIIA 2FJDA 1GRFA 2NPXA 4U8PA 1GRHA 4C3YA 2BA9A 1ZDLA 1W4XA 4EM4A 1JRXA 4GDEA 2X8HA 4YT0A 2XVEA 3QJ4A 4BURA 3KKJA 3NTAA 3DGZA 1NG3A 2ZBWA 1TDOA 2B9WA 2YM2A 2A89A 2C65A 1TDFA 2B76A 1D4DA 3GYXA 1DJQA 2AQJA 3AEDA 1P2EA 2O9ZA 2GR3A 2X3NA 4YKFA 5JCNA 1VG0A 2OAMA 3RP8A 3K30A 4K8DA 3SQPA 2YQUA 1B37A 2WBAA 4EIQA 2R0GA 2XLRA 1BWCA 2XLUA 4CRTA 3IHGA 1FEBA 1PN0A 2QA1A 4D03A 1YY5A 1H6VA 2EQ6A 2YVJA 2V61A 3AE2A 3RNMA 1D5TA 1VDCA 2LFCA 1Q9IA 3ITJA 3O0HA 2YLRA 3DK8A 4A99A 3C4AA 3AB1A 4H4TA 3B6DA 3S61A 3UKHA 1M64A 3EPTA 1OJDA 3Q9TA 1K0LA 1ZKQA 2YG7A 1PJ6A 1UKVG 4KX6A 3LJPA 4NTEA 3CIRA 4H2NA 4HA6A 5HYMA 1TDEA 2V60A 2EQ7A 5KMRA 2WDQA 1D7LA 3V76A 5KOWA 1E1LA 2BS2A 4YKGA 1FECA 5EB5A 3DGHA 3FG2P 1XPQA 3KD9A 4H4UA 3UCLA 4BV6A 3GDPA 4G74A 2XVFA 4GF7A 3UTFA 3DJGX 2C72A 4U2LA 3M0OA 1H7XA 2WPEA 3PVCA 2JKCA 4G6GA 3AEEA 4G73A 3R9UA 2XLPA 1NENA 5IPYA 1GTEA 2GQWA 3UP5A 1YQ3A 4A65A 4N9XA 1EL5A 1NDAA 3WE0A 1XANA 3ALMA 3NIXA 1OJAA 4B63A 1E39A 4PABA 1CJ4A 3K7TA 1IUTA 2H88A 2ZZCA 3KU9A 5BULA 3NKSA 4TM3A 1GSNA 4C5OA 3UKQA 3CPJG 3II4A 3BNUA 1GTHA 2GAHB 3CNTA 1MO9A 3G5RA 5GRTA 1ZMCA 4TM4A 3IHMA 2JK6A 1EBDA 4EQXA 4B66A 2ZZBA 1NG4A 2VVLA 2YR5A 1ZY8A 2V3BA 2GR1A 3FBSA 3T0KA 1GRTA 3NYEA 1GXFA 3NK0X 5KRQA 1ONFA 4REKA 3UKAA 2CFYA 2VQBA 4OPTA 2TPRA 3UKLA 3F8PA 3P4QA 4ADWA 3DH9A 2C3DA 4CNJA 4Z2RA 1LPFA 1OJCA 2VZ2A 2H89A 1ZMDA 1TYPA 3ICSA 4OPDA 4X9MA 4YSXA 5KOXA 2RGHA 4LA1A 1F8WA 1LQTA 3GWFA 4Y4MA 2B7SA 1PBCA 2Q0LA 2Q7VA 3CNSA 3I6DA 4Z43A 1P2HA 2BXSA 3CNDA 2B7RA 2BRAA 2B9YA 1E1NA 2C73A 2GAGB 1L9CA 3CTYA 3NK1X 2YLWA 3P4SA 1IUSA 3CPHG 4BJYA 3BHFA 4YXDA 1O94A 2Y6QA 2BCPA 5KMSA 1M6IA 3AD7B 4U8IA 5JCKA 3AEGA 5EB4A 4YTPA 2C70A 4IVMB 2YM1A 2YWLA 4UP3A 1GV4A 3ATQA 2C64A 4JY2A 4OVIA 5IQ4A 1F6MA 3AEBA 4C74A 3VR8A 1PXAA 1LVLA 1H82A 4RG3A 4AT0A 4FDCB 3QFBA 2APGA 2GR0A 4CCQA 5BUKA 3D1CA 2Z5XA 4U2TA 1FOHA 4U8MA 4AOSA 4EMJA 2GMJA 5CQFA 5HXIA 3LADA 4UDPA 1JOAA 2DKIA 2Y6RA 3GSIA 3CNPA 1GPEA 3KPKA 3RHAA 3EAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OZ2 A;  4XXG A;  4J57 A;  1O5W A;  3AEA A;  1E1K A;  4OPL A;  2RAB A;  2YG5 A;  3GD3 A;  3VRB A;  2E1M A;  2UZZ A;  4WCT A;  4I59 A;  4H4S A;  4IVO B;  2VOU A;  2V3A A;  3CN8 A;  1DOD A;  4EIP A;  2A87 A;  4NEV A;  1NPX A;  1CJC A;  1H84 A;  1NHP A;  1PS9 A;  4CNK A;  4A9W A;  2V5Z A;  1COY A;  2B9X A;  4J31 A;  1DJN A;  1S2Q A;  4H2R A;  4OPG A;  5FS6 A;  1IUW A;  2WPF A;  2WOV A;  4A79 A;  1VG9 A;  4TM0 A;  1RSG A;  2BXR A;  4OPC A;  4U8N A;  4Y4L A;  4GUV A;  4C3X A;  1B4V A;  2BYB A;  2XLT A;  1KNR A;  4Z2T A;  2GVC A;  4H2Q A;  3FMW A;  2GH5 A;  3H8I A;  3UTH A;  1ZX9 A;  1JU2 A;  3CGB A;  1BGJ A;  1N4V A;  2TMD A;  5CKU A;  2R4J A;  3QFA A;  1GAL A;  4TLX A;  1FL2 A;  2WOW A;  3AEC A;  4J56 A;  5C2T A;  3NYF A;  3ABV A;  4NTD A;  2R45 A;  1Y0P A;  2XLS A;  1EL7 A;  4B64 A;  4CCR A;  4X9N A;  4FK1 C;  2OAL A;  1L0V A;  1Z6L A;  4EQS A;  2BCG G;  2EQ8 A;  2JB3 A;  2WS3 A;  2X50 A;  2YG4 A;  1JNR A;  1EL8 A;  4CY8 A;  5DBJ A;  5C3J A;  1F8S A;  1B8S A;  2JAE A;  3UOV A;  3HZL A;  2IVE A;  2JBV A;  1F3P A;  1RP0 A;  3NLC A;  2BS3 A;  4Z44 A;  5KWF A;  3ISH A;  1JEH A;  2ARD A;  4AP3 A;  1KFY A;  3AEF A;  2X99 A;  1N4U A;  2IVD A;  4AT2 A;  4B68 A;  3NYC A;  1H83 A;  3COX A;  1TDK A;  3LZW A;  4K2X A;  3ALL A;  2OA1 A;  3GRT A;  2CUL A;  4K22 A;  3BI5 A;  1BGN A;  2X8G A;  3DJE A;  3P4P A;  4Z26 A;  1PXC A;  1PJ5 A;  4A5L A;  1KNP A;  4K5R A;  1K0J A;  2X8C A;  5U63 A;  3NK2 X;  5EOW A;  1QO8 A;  3H8L A;  3NG7 X;  1DOB A;  3KLJ A;  3Q6J A;  2YR4 A;  1LJ1 A;  4J33 A;  3H4K A;  1YQ4 A;  2WET A;  3C4N A;  1BKW A;  2CDU A;  2E5V A;  4H4P A;  5HHF A;  3QSS A;  1GRA A;  3F8D A;  1DOE A;  1PBF A;  5IQ1 A;  4EMW A;  4DNA A;  3IWA A;  1GND A;  1ZOY A;  3C96 A;  4EQR A;  1PJ7 A;  2XCG A;  3M12 A;  4XWZ A;  2YLS A;  3D8X A;  4U8O A;  1KSU A;  2J3N A;  3V3O A;  2GB0 A;  3RED A;  4JNQ A;  3EF6 A;  3S5W A;  2BK3 A;  4IV9 A;  1K4Q A;  4YWO A;  1D4C A;  1PHH A;  2WU5 A;  2WU2 A;  3KVE A;  4I58 A;  5JCM A;  1CJ2 A;  3G5S A;  1GES A;  1LQU A;  4NTC A;  3NH3 X;  3IC9 A;  3QSE A;  3AE9 A;  1D7Y A;  2YG6 A;  3VRA A;  4Z25 A;  2GEW A;  5ER0 A;  3UKF A;  4B1B A;  2WQY A;  5L46 A;  4O5U A;  2YVG A;  3BI4 A;  1YQZ A;  3NHO X;  3QSM A;  4XWR A;  1SEZ A;  5KXJ A;  1QLB A;  3AYL A;  2QA2 A;  2QCU A;  5TR3 A;  3UKK A;  5U25 A;  4APN A;  2R0C A;  1GRE A;  2C75 A;  3VR9 A;  3AE8 A;  2AR8 A;  5LV9 A;  3T37 A;  1KF6 A;  4HB9 A;  1E7P A;  3DME A;  5M10 A;  1YKJ A;  3P4R A;  2ZZ0 A;  3M13 A;  1E6E A;  3SM8 A;  4CBQ A;  3SFE A;  2XYO A;  4YTN A;  4AOX A;  2GRT A;  4JN9 A;  4RG4 A;  2EQ9 A;  2WHD A;  1GEU A;  1NEK A;  3EAN A;  3ZDN A;  4E0V A;  4A6N A;  2C66 A;  3AD8 B;  3L1R A;  4FX9 A;  4YSZ A;  3ALJ A;  5M0Z A;  3VQR A;  1Y56 A;  3LB8 A;  3UP4 A;  1QJD A;  1PXB A;  4IA5 A;  1CC2 A;  3AE6 A;  2RGO A;  1L9D A;  1H81 A;  3P1W A;  3AE7 A;  3I3L A;  4H4W A;  2R46 A;  1FEA A;  2BK5 A;  1GOS A;  2XFN A;  3AE5 A;  1K0I A;  2YAU A;  1ZK7 A;  1V59 A;  1EL9 A;  2XFO A;  3QVR A;  3BI2 A;  2GMH A;  2FJB A;  3ICR A;  2XVI A;  2R4E A;  3KPF A;  4TLZ A;  4Y4N A;  4H4Y A;  3UTE A;  3GYJ A;  2IID A;  4H4V A;  1OJ9 A;  4USR A;  4BK2 A;  4EM3 A;  4KPR A;  3DJD A;  2VVM A;  3NN6 X;  2ACZ A;  2BC1 A;  1AOG A;  4BK3 A;  4PAA A;  1ELI A;  1XDI A;  2WP5 A;  2VVL G;  2XFQ A;  2FJE A;  4J34 A;  2C76 A;  3FIM B;  1CC4 A;  4C77 A;  2C7G A;  2GV8 A;  3OC4 A;  4ZCC A;  5J7X A;  4AP1 A;  3ADA B;  2YR6 A;  1IUX A;  3E1T A;  4OCG A;  2WP9 A;  2YLX A;  4MJW A;  4DGK A;  1S2Y A;  2VQ7 A;  4JNA A;  5J60 A;  2BC0 A;  5JCI A;  1JRY A;  3NT6 A;  1H86 A;  4GDP A;  1DNC A;  4NEW A;  1IUU A;  4RSL A;  1F8R A;  2QAE A;  2WOI A;  4K7Z A;  3DA1 A;  5FMH A;  3K7M X;  2YLZ A;  4J2W A;  4U8K A;  1TRB A;  4B65 A;  1IJH A;  2W0H A;  2WP6 A;  3GMC A;  1JRZ A;  3RP6 A;  1TYT A;  2R9Z A;  1S3E A;  4B67 A;  1PBD A;  4BJZ A;  1NHS A;  3CGE A;  4ECH A;  3SFD A;  3AXB A;  4DSH A;  4K5S A;  4UDQ A;  2WDV A;  3NRN A;  3DJJ A;  4P9S A;  3LOV A;  1REO A;  2YVF A;  5FS7 A;  2VRL A;  2GR2 A;  4UDR A;  2VRM A;  2WEU A;  2XVJ A;  1S3B A;  3NGC X;  1RYI A;  4ZCD A;  5HY5 A;  4OPU A;  2R0P A;  3JSK A;  3UKP A;  2BS4 A;  3DK4 A;  4Z2U A;  1L9E A;  1TDN A;  1IUV A;  3G5Q A;  3CNJ A;  3CGC A;  4JDR A;  3BHK A;  2Q6U A;  1CHU A;  1CJ3 A;  2YLT A;  1KSS A;  1NHQ A;  2F5Z A;  2WDR A;  3B3R A;  3GWD A;  3PS9 A;  1FCD A;  4GR1 A;  3AD9 B;  3LZX A;  3UOY A;  2RGJ A;  3AWI A;  1GET A;  4JQ9 A;  4O5Q A;  1O95 A;  2AAQ A;  3NNE A;  4LU6 A;  4BK1 A;  1H7W A;  1E1M A;  1OJT A;  2C67 A;  1PDH A;  1DXL A;  3GD4 A;  2E4G A;  4TM1 A;  5FS8 A;  4YSY A;  4D04 A;  3AE3 A;  3P9U A;  5GSN A;  2V6O A;  2CVJ A;  5KVH A;  2A8X A;  3UOZ A;  4USQ A;  4IA6 A;  4U2S A;  2Z5Y A;  4WX1 A;  4A7A A;  3V3N A;  4A6N B;  3VRD B;  2OLN A;  3UOX A;  2GQF A;  1XHC A;  1Y56 B;  3DK9 A;  3CPI G;  2XFP A;  3LXD A;  2BAC A;  1D4E A;  3BNM A;  3GDN A;  2Q0K A;  3QVP A;  1VRQ B;  4EMI A;  2HQM A;  1GER A;  2WES A;  2JB2 A;  2XFU A;  1Q1W A;  3GYI A;  4H4R A;  2BK4 A;  1GT8 A;  2C3C A;  1NAA A;  3NTD A;  4H4Z A;  1LV0 A;  1MOK A;  2WPC A;  3GMB A;  2FBW A;  1CF3 A;  5FS9 A;  1N4W A;  1CL0 A;  3SGL A;  1KDG A;  3AE1 A;  3AE4 A;  1CC6 A;  2JB1 A;  4H2P A;  2XVH A;  1PBB A;  3GRS A;  1PBE A;  2PYX A;  3AYI A;  4GCM A;  4U8J A;  4X4J A;  4ZN0 A;  3L8K A;  4CY6 A;  5EBK A;  4B69 A;  4Z24 A;  1Q1R A;  3NN0 X;  4U8L A;  2GF3 A;  3PO7 A;  5BRT A;  3F8R A;  1HYU A;  1VQW A;  2OLO A;  3KA7 A;  4OPI A;  2PHH A;  4H4Q A;  2XDO A;  1NHR A;  2I0Z A;  5JCL A;  2FJA A;  4FK1 A;  3ATR A;  2BAB A;  3FPZ A;  4DSG A;  2NVK X;  1X31 B;  1ZOV A;  1GRB A;  1LTX R;  1BZL A;  3ZYX A;  3CGD A;  2YG3 A;  1B5Q A;  4GRT A;  3RP7 A;  4H50 A;  4YTM A;  5KVI A;  1CBO A;  4J36 A;  3K7Q X;  5U1O A;  3URH A;  1N1P A;  1ZP0 A;  4YSH A;  3ICT A;  4ICY A;  4NZH A;  3AYJ A;  1DOC A;  4JY3 A;  3IF9 A;  4H4X A;  1JNZ A;  3UTG A;  4EQW A;  1GRG A;  5BVA A;  2DKH A;  1BF3 A;  4H7U A;  1MXT A;  4M52 A;  4LII A;  2FJD A;  1GRF A;  2NPX A;  4U8P A;  1GRH A;  4C3Y A;  2BA9 A;  1ZDL A;  1W4X A;  4EM4 A;  1JRX A;  4GDE A;  2X8H A;  4YT0 A;  2XVE A;  3QJ4 A;  4BUR A;  3KKJ A;  3NTA A;  3DGZ A;  1NG3 A;  2ZBW A;  1TDO A;  2B9W A;  2YM2 A;  2A89 A;  2C65 A;  1TDF A;  2B76 A;  1D4D A;  3GYX A;  1DJQ A;  2AQJ A;  3AED A;  1P2E A;  2O9Z A;  2GR3 A;  2X3N A;  4YKF A;  5JCN A;  1VG0 A;  2OAM A;  3RP8 A;  3K30 A;  4K8D A;  3SQP A;  2YQU A;  1B37 A;  2WBA A;  4EIQ A;  2R0G A;  2XLR A;  1BWC A;  2XLU A;  4CRT A;  3IHG A;  1FEB A;  1PN0 A;  2QA1 A;  4D03 A;  1YY5 A;  1H6V A;  2EQ6 A;  2YVJ A;  2V61 A;  3AE2 A;  3RNM A;  1D5T A;  1VDC A;  2LFC A;  1Q9I A;  3ITJ A;  3O0H A;  2YLR A;  3DK8 A;  4A99 A;  3C4A A;  3AB1 A;  4H4T A;  3B6D A;  3S61 A;  3UKH A;  1M64 A;  3EPT A;  1OJD A;  3Q9T A;  1K0L A;  1ZKQ A;  2YG7 A;  1PJ6 A;  1UKV G;  4KX6 A;  3LJP A;  4NTE A;  3CIR A;  4H2N A;  4HA6 A;  5HYM A;  1TDE A;  2V60 A;  2EQ7 A;  2WDQ A;  1D7L A;  3V76 A;  5KOW A;  1E1L A;  2BS2 A;  4YKG A;  1FEC A;  5EB5 A;  3DGH A;  3FG2 P;  1XPQ A;  3KD9 A;  4H4U A;  3UCL A;  4BV6 A;  3GDP A;  2XVF A;  4GF7 A;  3UTF A;  3DJG X;  2C72 A;  4U2L A;  3M0O A;  1H7X A;  2WPE A;  3PVC A;  2JKC A;  3R9U A;  3AEE A;  5IPY A;  2XLP A;  1NEN A;  1GTE A;  2GQW A;  3UP5 A;  1YQ3 A;  4A65 A;  4N9X A;  1EL5 A;  1NDA A;  3WE0 A;  1XAN A;  3ALM A;  3NIX A;  1OJA A;  4B63 A;  1E39 A;  4PAB A;  1CJ4 A;  3K7T A;  1IUT A;  2H88 A;  2ZZC A;  3KU9 A;  5BUL A;  3NKS A;  4TM3 A;  1GSN A;  4C5O A;  3UKQ A;  3CPJ G;  3II4 A;  3BNU A;  1GTH A;  2GAH B;  3CNT A;  1MO9 A;  3G5R A;  5GRT A;  1ZMC A;  4TM4 A;  3IHM A;  2JK6 A;  1EBD A;  4EQX A;  4B66 A;  2ZZB A;  1NG4 A;  2VVL A;  2YR5 A;  1ZY8 A;  2V3B A;  2GR1 A;  3FBS A;  1GRT A;  3NYE A;  1GXF A;  3NK0 X;  5KRQ A;  1ONF A;  4REK A;  3UKA A;  2CFY A;  2VQB A;  4OPT A;  2TPR A;  3UKL A;  3F8P A;  3P4Q A;  4ADW A;  3DH9 A;  2C3D A;  4CNJ A;  4Z2R A;  1LPF A;  1OJC A;  2VZ2 A;  2H89 A;  1ZMD A;  1TYP A;  3ICS A;  4OPD A;  4X9M A;  4YSX A;  5KOX A;  2RGH A;  4LA1 A;  1F8W A;  1LQT A;  3GWF A;  4Y4M A;  2B7S A;  1PBC A;  2Q0L A;  2Q7V A;  3CNS A;  3I6D A;  4Z43 A;  1P2H A;  2BXS A;  3CND A;  2B7R A;  2B9Y A;  1E1N A;  2C73 A;  2GAG B;  1L9C A;  3CTY A;  3NK1 X;  2YLW A;  3P4S A;  1IUS A;  3CPH G;  4BJY A;  3BHF A;  4YXD A;  1O94 A;  2Y6Q A;  2BCP A;  1M6I A;  3AD7 B;  4U8I A;  5JCK A;  3AEG A;  5EB4 A;  4YTP A;  2C70 A;  4IVM B;  2YM1 A;  2YWL A;  4UP3 A;  1GV4 A;  3ATQ A;  2C64 A;  4JY2 A;  4OVI A;  5IQ4 A;  1F6M A;  3AEB A;  4C74 A;  3VR8 A;  1PXA A;  1LVL A;  1H82 A;  4RG3 A;  4AT0 A;  4FDC B;  3QFB A;  2APG A;  2GR0 A;  4CCQ A;  5BUK A;  3D1C A;  2Z5X A;  4U2T A;  1FOH A;  4U8M A;  4AOS A;  4EMJ A;  2GMJ A;  5CQF A;  5HXI A;  3LAD A;  4UDP A;  1JOA A;  2DKI A;  2Y6R A;  3GSI A;  3CNP A;  1GPE A;  3RHA A;  3EAO A; 
#chains in the Genus database with same CATH topology
 3OZ2 A;  4XXG A;  4J57 A;  1O5W A;  3AEA A;  1E1K A;  4OPL A;  2RAB A;  2YG5 A;  3GD3 A;  3VRB A;  2E1M A;  2UZZ A;  4WCT A;  4I59 A;  4H4S A;  4IVO B;  2VOU A;  2V3A A;  3CN8 A;  1DOD A;  4EIP A;  2A87 A;  4NEV A;  1NPX A;  1CJC A;  1H84 A;  1NHP A;  1PS9 A;  4CNK A;  4A9W A;  3CMM A;  4II3 A;  2V5Z A;  1COY A;  2B9X A;  4J31 A;  1DJN A;  1S2Q A;  4H2R A;  4OPG A;  5FS6 A;  1IUW A;  2WPF A;  2WOV A;  4GAV A;  4A79 A;  3SZC A;  1VG9 A;  4TM0 A;  2C4C A;  1RSG A;  2BXR A;  4OPC A;  4U8N A;  5KMQ A;  4Y4L A;  2BRY A;  4GUV A;  4C3X A;  1B4V A;  2BYB A;  2XLT A;  1KNR A;  3T31 A;  4Z2T A;  2GVC A;  4H2Q A;  3FMW A;  2GH5 A;  3H8I A;  3UTH A;  1ZX9 A;  1JU2 A;  3CGB A;  1BGJ A;  1N4V A;  2TMD A;  5CKU A;  2R4J A;  3QFA A;  1GAL A;  4TLX A;  1FL2 A;  2WOW A;  3AEC A;  4J56 A;  5C2T A;  3NYF A;  3ABV A;  4NTD A;  2R45 A;  1Y0P A;  2XLS A;  1EL7 A;  4B64 A;  4CCR A;  4X9N A;  4FK1 C;  2OAL A;  1L0V A;  1Z6L A;  4EQS A;  2BCG G;  2EQ8 A;  2JB3 A;  2WS3 A;  2X50 A;  2YG4 A;  1JNR A;  1EL8 A;  4CY8 A;  5DBJ A;  5C3J A;  1F8S A;  1B8S A;  2JAE A;  3UOV A;  3HZL A;  2IVE A;  2JBV A;  1F3P A;  3SX6 A;  1RP0 A;  3NLC A;  2BS3 A;  4Z44 A;  5KWF A;  3ISH A;  1JEH A;  2ARD A;  4AP3 A;  1KFY A;  3AEF A;  2X99 A;  3SZF A;  1N4U A;  2IVD A;  4AT2 A;  4B68 A;  3T14 A;  3NYC A;  4NWZ A;  1H83 A;  3COX A;  1TDK A;  3LZW A;  4K2X A;  3ALL A;  2OA1 A;  3GRT A;  2CUL A;  4K22 A;  3BI5 A;  1BGN A;  2X8G A;  3DJE A;  3P4P A;  4Z26 A;  1PXC A;  1PJ5 A;  4A5L A;  1KNP A;  4K5R A;  1K0J A;  2X8C A;  5U63 A;  3NK2 X;  5EOW A;  1QO8 A;  3H8L A;  3NG7 X;  1DOB A;  3KLJ A;  3Q6J A;  2YR4 A;  1LJ1 A;  4J33 A;  3H4K A;  1YQ4 A;  2WET A;  3C4N A;  1BKW A;  4G9K A;  2CDU A;  2E5V A;  4H4P A;  5HHF A;  3QSS A;  1GRA A;  3F8D A;  1DOE A;  1PBF A;  5IQ1 A;  4EMW A;  4DNA A;  3IWA A;  1GND A;  1ZOY A;  3C96 A;  4EQR A;  1PJ7 A;  2XCG A;  3M12 A;  4XWZ A;  2YLS A;  3D8X A;  4U8O A;  1KSU A;  2J3N A;  3SY4 A;  3V3O A;  3HYX A;  2GB0 A;  3RED A;  4JNQ A;  3EF6 A;  3S5W A;  2BK3 A;  4IV9 A;  1K4Q A;  4YWO A;  1D4C A;  1PHH A;  2WU5 A;  2WU2 A;  3KVE A;  4I58 A;  5JCM A;  1CJ2 A;  3G5S A;  1GES A;  1LQU A;  4II2 A;  4NTC A;  3NH3 X;  3IC9 A;  3QSE A;  3AE9 A;  1D7Y A;  2YG6 A;  3VRA A;  4Z25 A;  2GEW A;  5ER0 A;  3UKF A;  4B1B A;  2WQY A;  5L46 A;  3T2K A;  4O5U A;  5KNL A;  2YVG A;  3BI4 A;  1YQZ A;  3NHO X;  3QSM A;  4XWR A;  1SEZ A;  3T2Z A;  1QLB A;  5KXJ A;  3AYL A;  2QA2 A;  2QCU A;  5TR3 A;  3UKK A;  5U25 A;  4APN A;  2R0C A;  1GRE A;  2C75 A;  3VR9 A;  3AE8 A;  2AR8 A;  5LV9 A;  3T37 A;  1KF6 A;  4HB9 A;  1E7P A;  3DME A;  5M10 A;  1YKJ A;  3P4R A;  2ZZ0 A;  3M13 A;  1E6E A;  4NNJ A;  3SM8 A;  3SFE A;  4CBQ A;  2XYO A;  4YTN A;  4AOX A;  2GRT A;  4JN9 A;  4RG4 A;  2EQ9 A;  2WHD A;  1GEU A;  1NEK A;  3EAN A;  3ZDN A;  4E0V A;  3SZ0 A;  2C66 A;  3AD8 B;  3L1R A;  4A6N A;  4FX9 A;  4YSZ A;  3ALJ A;  5M0Z A;  3VQR A;  1Y56 A;  3LB8 A;  3UP4 A;  1QJD A;  1PXB A;  4IA5 A;  1CC2 A;  3SYI A;  3AE6 A;  2RGO A;  1L9D A;  1H81 A;  3P1W A;  3AE7 A;  3I3L A;  4H4W A;  2R46 A;  1FEA A;  2BK5 A;  1GOS A;  2XFN A;  3AE5 A;  1K0I A;  2YAU A;  1ZK7 A;  1V59 A;  1EL9 A;  2XFO A;  3QVR A;  3BI2 A;  2GMH A;  2FJB A;  3ICR A;  2XVI A;  2R4E A;  3KPF A;  4TLZ A;  4Y4N A;  4H4Y A;  3UTE A;  3GYJ A;  2IID A;  4H4V A;  1OJ9 A;  4USR A;  4BK2 A;  4EM3 A;  4KPR A;  3DJD A;  2VVM A;  3NN6 X;  3T2Y A;  2ACZ A;  2BC1 A;  1AOG A;  4BK3 A;  4PAA A;  1ELI A;  1XDI A;  2WP5 A;  2VVL G;  2XFQ A;  2FJE A;  3HYW A;  4J34 A;  2C76 A;  3FIM B;  1CC4 A;  4C77 A;  2C7G A;  2GV8 A;  3OC4 A;  4ZCC A;  5J7X A;  4AP1 A;  3ADA B;  2YR6 A;  1IUX A;  3E1T A;  4OCG A;  2WP9 A;  2YLX A;  4MJW A;  4DGK A;  1S2Y A;  2VQ7 A;  4JNA A;  5J60 A;  2BC0 A;  5JCI A;  1JRY A;  3NT6 A;  1H86 A;  4GDP A;  1DNC A;  4NEW A;  4GAP A;  1IUU A;  4RSL A;  1F8R A;  2QAE A;  2WOI A;  4K7Z A;  3DA1 A;  5FMH A;  3K7M X;  2YLZ A;  4J2W A;  4U8K A;  1TRB A;  4B65 A;  1IJH A;  2W0H A;  2WP6 A;  3GMC A;  1JRZ A;  3RP6 A;  1TYT A;  2R9Z A;  1S3E A;  4B67 A;  1PBD A;  4BJZ A;  1NHS A;  3CGE A;  4ECH A;  3SFD A;  3AXB A;  4DSH A;  4K5S A;  4UDQ A;  2WDV A;  3NRN A;  3DJJ A;  4P9S A;  3LOV A;  1REO A;  2YVF A;  5FS7 A;  2VRL A;  2GR2 A;  4UDR A;  2VRM A;  2WEU A;  2XVJ A;  1S3B A;  3NGC X;  1RYI A;  4ZCD A;  5HY5 A;  4OPU A;  2R0P A;  3JSK A;  3UKP A;  2BS4 A;  3DK4 A;  4Z2U A;  1L9E A;  1TDN A;  1IUV A;  3G5Q A;  3CNJ A;  3CGC A;  4JDR A;  3BHK A;  2Q6U A;  1CHU A;  1CJ3 A;  2YLT A;  1KSS A;  1NHQ A;  2F5Z A;  2WDR A;  3B3R A;  3GWD A;  3PS9 A;  1FCD A;  4GR1 A;  3AD9 B;  3LZX A;  3UOY A;  2RGJ A;  3AWI A;  1GET A;  4JQ9 A;  3SZW A;  4O5Q A;  1O95 A;  2AAQ A;  3NNE A;  4LU6 A;  4BK1 A;  1H7W A;  1E1M A;  1OJT A;  2C67 A;  1PDH A;  1DXL A;  3GD4 A;  2E4G A;  4TM1 A;  5FS8 A;  4YSY A;  4D04 A;  3AE3 A;  3P9U A;  5GSN A;  2V6O A;  3HYV A;  2CVJ A;  5KVH A;  2A8X A;  3UOZ A;  4USQ A;  4IA6 A;  4U2S A;  2Z5Y A;  4WX1 A;  4A7A A;  3V3N A;  4A6N B;  3VRD B;  2OLN A;  3UOX A;  2GQF A;  1XHC A;  1Y56 B;  3DK9 A;  3CPI G;  2XFP A;  3LXD A;  2BAC A;  1D4E A;  3BNM A;  3GDN A;  2Q0K A;  3QVP A;  1VRQ B;  4EMI A;  2HQM A;  1GER A;  2WES A;  2JB2 A;  2XFU A;  1Q1W A;  3GYI A;  4H4R A;  2BK4 A;  1GT8 A;  2C3C A;  1NAA A;  3NTD A;  4H4Z A;  1LV0 A;  1MOK A;  2WPC A;  3GMB A;  2FBW A;  1CF3 A;  5FS9 A;  1N4W A;  1CL0 A;  3SGL A;  1KDG A;  3AE1 A;  3AE4 A;  1CC6 A;  2JB1 A;  4H2P A;  2XVH A;  1PBB A;  3GRS A;  1PBE A;  2PYX A;  3AYI A;  4GCM A;  4U8J A;  4X4J A;  4ZN0 A;  3L8K A;  4CY6 A;  5EBK A;  4B69 A;  4Z24 A;  1Q1R A;  3NN0 X;  4U8L A;  2GF3 A;  3PO7 A;  5BRT A;  3F8R A;  1HYU A;  1VQW A;  2OLO A;  3KA7 A;  4OPI A;  2PHH A;  4H4Q A;  2XDO A;  1NHR A;  2I0Z A;  5JCL A;  2FJA A;  4FK1 A;  3ATR A;  2BAB A;  3FPZ A;  4DSG A;  2NVK X;  1X31 B;  1ZOV A;  1GRB A;  1LTX R;  1BZL A;  3ZYX A;  3CGD A;  2YG3 A;  3SXI A;  1B5Q A;  4GRT A;  3RP7 A;  4H50 A;  4YTM A;  5KVI A;  1CBO A;  4G6H A;  4J36 A;  3K7Q X;  5U1O A;  3URH A;  1N1P A;  1ZP0 A;  4YSH A;  3ICT A;  4ICY A;  4NZH A;  3AYJ A;  1DOC A;  4JY3 A;  3IF9 A;  4H4X A;  1JNZ A;  3UTG A;  4EQW A;  1GRG A;  5BVA A;  2DKH A;  1BF3 A;  4H7U A;  5KMP A;  1MXT A;  4M52 A;  4LII A;  2FJD A;  1GRF A;  2NPX A;  4U8P A;  1GRH A;  4C3Y A;  2BA9 A;  1ZDL A;  1W4X A;  4EM4 A;  1JRX A;  4GDE A;  2X8H A;  4YT0 A;  2XVE A;  3QJ4 A;  4BUR A;  3KKJ A;  3NTA A;  3DGZ A;  1NG3 A;  2ZBW A;  1TDO A;  2B9W A;  2YM2 A;  2A89 A;  2C65 A;  1TDF A;  2B76 A;  1D4D A;  3GYX A;  1DJQ A;  2AQJ A;  3AED A;  1P2E A;  2O9Z A;  2GR3 A;  2X3N A;  4YKF A;  5JCN A;  1VG0 A;  2OAM A;  3RP8 A;  3K30 A;  4K8D A;  3SQP A;  2YQU A;  1B37 A;  2WBA A;  4EIQ A;  2R0G A;  2XLR A;  1BWC A;  2XLU A;  4CRT A;  3IHG A;  1FEB A;  1PN0 A;  2QA1 A;  4D03 A;  1YY5 A;  1H6V A;  2EQ6 A;  2YVJ A;  2V61 A;  3AE2 A;  3RNM A;  1D5T A;  1VDC A;  2LFC A;  1Q9I A;  3ITJ A;  3O0H A;  2YLR A;  3DK8 A;  4A99 A;  3C4A A;  3AB1 A;  4H4T A;  3B6D A;  3S61 A;  3UKH A;  1M64 A;  3EPT A;  1OJD A;  3Q9T A;  1K0L A;  1ZKQ A;  2YG7 A;  1PJ6 A;  1UKV G;  4KX6 A;  3LJP A;  4NTE A;  3CIR A;  4H2N A;  4HA6 A;  5HYM A;  1TDE A;  2V60 A;  2EQ7 A;  5KMR A;  2WDQ A;  1D7L A;  3V76 A;  5KOW A;  1E1L A;  2BS2 A;  4YKG A;  1FEC A;  5EB5 A;  3DGH A;  3FG2 P;  1XPQ A;  3KD9 A;  4H4U A;  3UCL A;  4BV6 A;  3GDP A;  4G74 A;  2XVF A;  4GF7 A;  3UTF A;  3DJG X;  2C72 A;  4U2L A;  3M0O A;  1H7X A;  2WPE A;  3PVC A;  2JKC A;  4G6G A;  3AEE A;  4G73 A;  3R9U A;  2XLP A;  1NEN A;  5IPY A;  1GTE A;  2GQW A;  3UP5 A;  1YQ3 A;  4A65 A;  4N9X A;  1EL5 A;  1NDA A;  3WE0 A;  1XAN A;  3ALM A;  3NIX A;  1OJA A;  4B63 A;  1E39 A;  4PAB A;  1CJ4 A;  3K7T A;  1IUT A;  2H88 A;  2ZZC A;  3KU9 A;  5BUL A;  3NKS A;  4TM3 A;  1GSN A;  4C5O A;  3UKQ A;  3CPJ G;  3II4 A;  3BNU A;  1GTH A;  2GAH B;  3CNT A;  1MO9 A;  3G5R A;  5GRT A;  1ZMC A;  4TM4 A;  3IHM A;  2JK6 A;  1EBD A;  4EQX A;  4B66 A;  2ZZB A;  1NG4 A;  2VVL A;  2YR5 A;  1ZY8 A;  2V3B A;  2GR1 A;  3FBS A;  3T0K A;  1GRT A;  3NYE A;  1GXF A;  3NK0 X;  5KRQ A;  1ONF A;  4REK A;  3UKA A;  2CFY A;  2VQB A;  4OPT A;  2TPR A;  3UKL A;  3F8P A;  3P4Q A;  4ADW A;  3DH9 A;  2C3D A;  4CNJ A;  4Z2R A;  1LPF A;  1OJC A;  2VZ2 A;  2H89 A;  1ZMD A;  1TYP A;  3ICS A;  4OPD A;  4X9M A;  4YSX A;  5KOX A;  2RGH A;  4LA1 A;  1F8W A;  1LQT A;  3GWF A;  4Y4M A;  2B7S A;  1PBC A;  2Q0L A;  2Q7V A;  3CNS A;  3I6D A;  4Z43 A;  1P2H A;  2BXS A;  3CND A;  2B7R A;  2BRA A;  2B9Y A;  1E1N A;  2C73 A;  2GAG B;  1L9C A;  3CTY A;  3NK1 X;  2YLW A;  3P4S A;  1IUS A;  3CPH G;  4BJY A;  3BHF A;  4YXD A;  1O94 A;  2Y6Q A;  2BCP A;  5KMS A;  1M6I A;  3AD7 B;  4U8I A;  5JCK A;  3AEG A;  5EB4 A;  4YTP A;  2C70 A;  4IVM B;  2YM1 A;  2YWL A;  4UP3 A;  1GV4 A;  3ATQ A;  2C64 A;  4JY2 A;  4OVI A;  5IQ4 A;  1F6M A;  3AEB A;  4C74 A;  3VR8 A;  1PXA A;  1LVL A;  1H82 A;  4RG3 A;  4AT0 A;  4FDC B;  3QFB A;  2APG A;  2GR0 A;  4CCQ A;  5BUK A;  3D1C A;  2Z5X A;  4U2T A;  1FOH A;  4U8M A;  4AOS A;  4EMJ A;  2GMJ A;  5CQF A;  5HXI A;  3LAD A;  4UDP A;  1JOA A;  2DKI A;  2Y6R A;  3GSI A;  3CNP A;  1GPE A;  3KPK A;  3RHA A;  3EAO A; 
#chains in the Genus database with same CATH homology
 3OZ2 A;  4XXG A;  4J57 A;  1O5W A;  3AEA A;  1E1K A;  4OPL A;  2RAB A;  2YG5 A;  3GD3 A;  3VRB A;  2E1M A;  2UZZ A;  4WCT A;  4I59 A;  4H4S A;  4IVO B;  2VOU A;  2V3A A;  3CN8 A;  1DOD A;  4EIP A;  2A87 A;  4NEV A;  1NPX A;  1CJC A;  1H84 A;  1NHP A;  1PS9 A;  4CNK A;  4A9W A;  3CMM A;  4II3 A;  2V5Z A;  1COY A;  2B9X A;  4J31 A;  1DJN A;  1S2Q A;  4H2R A;  4OPG A;  5FS6 A;  1IUW A;  2WPF A;  2WOV A;  4GAV A;  4A79 A;  3SZC A;  1VG9 A;  4TM0 A;  2C4C A;  1RSG A;  2BXR A;  4OPC A;  4U8N A;  5KMQ A;  4Y4L A;  2BRY A;  4GUV A;  4C3X A;  1B4V A;  2BYB A;  2XLT A;  1KNR A;  3T31 A;  4Z2T A;  2GVC A;  4H2Q A;  3FMW A;  2GH5 A;  3H8I A;  3UTH A;  1ZX9 A;  1JU2 A;  3CGB A;  1BGJ A;  1N4V A;  2TMD A;  5CKU A;  2R4J A;  3QFA A;  1GAL A;  4TLX A;  1FL2 A;  2WOW A;  3AEC A;  4J56 A;  5C2T A;  3NYF A;  3ABV A;  4NTD A;  2R45 A;  1Y0P A;  2XLS A;  1EL7 A;  4B64 A;  4CCR A;  4X9N A;  4FK1 C;  2OAL A;  1L0V A;  1Z6L A;  4EQS A;  2BCG G;  2EQ8 A;  2JB3 A;  2WS3 A;  2X50 A;  2YG4 A;  1JNR A;  1EL8 A;  4CY8 A;  5DBJ A;  5C3J A;  1F8S A;  1B8S A;  2JAE A;  3UOV A;  3HZL A;  2IVE A;  2JBV A;  1F3P A;  3SX6 A;  1RP0 A;  3NLC A;  2BS3 A;  4Z44 A;  5KWF A;  3ISH A;  1JEH A;  2ARD A;  4AP3 A;  1KFY A;  3AEF A;  2X99 A;  3SZF A;  1N4U A;  2IVD A;  4AT2 A;  4B68 A;  3T14 A;  3NYC A;  4NWZ A;  1H83 A;  3COX A;  1TDK A;  3LZW A;  4K2X A;  3ALL A;  2OA1 A;  3GRT A;  2CUL A;  4K22 A;  3BI5 A;  1BGN A;  2X8G A;  3DJE A;  3P4P A;  4Z26 A;  1PXC A;  1PJ5 A;  4A5L A;  1KNP A;  4K5R A;  1K0J A;  2X8C A;  5U63 A;  3NK2 X;  5EOW A;  1QO8 A;  3H8L A;  3NG7 X;  1DOB A;  3KLJ A;  3Q6J A;  2YR4 A;  1LJ1 A;  4J33 A;  3H4K A;  1YQ4 A;  2WET A;  3C4N A;  1BKW A;  4G9K A;  2CDU A;  2E5V A;  4H4P A;  5HHF A;  3QSS A;  1GRA A;  3F8D A;  1DOE A;  1PBF A;  5IQ1 A;  4EMW A;  4DNA A;  3IWA A;  1GND A;  1ZOY A;  3C96 A;  4EQR A;  1PJ7 A;  2XCG A;  3M12 A;  4XWZ A;  2YLS A;  3D8X A;  4U8O A;  1KSU A;  2J3N A;  3SY4 A;  3V3O A;  3HYX A;  2GB0 A;  3RED A;  4JNQ A;  3EF6 A;  3S5W A;  2BK3 A;  4IV9 A;  1K4Q A;  4YWO A;  1D4C A;  1PHH A;  2WU5 A;  2WU2 A;  3KVE A;  4I58 A;  5JCM A;  1CJ2 A;  3G5S A;  1GES A;  1LQU A;  4II2 A;  4NTC A;  3NH3 X;  3IC9 A;  3QSE A;  3AE9 A;  1D7Y A;  2YG6 A;  3VRA A;  4Z25 A;  2GEW A;  5ER0 A;  3UKF A;  4B1B A;  2WQY A;  5L46 A;  3T2K A;  4O5U A;  5KNL A;  2YVG A;  3BI4 A;  1YQZ A;  3NHO X;  3QSM A;  4XWR A;  1SEZ A;  3T2Z A;  1QLB A;  5KXJ A;  3AYL A;  2QA2 A;  2QCU A;  5TR3 A;  3UKK A;  5U25 A;  4APN A;  2R0C A;  1GRE A;  2C75 A;  3VR9 A;  3AE8 A;  2AR8 A;  5LV9 A;  3T37 A;  1KF6 A;  4HB9 A;  1E7P A;  3DME A;  5M10 A;  1YKJ A;  3P4R A;  2ZZ0 A;  3M13 A;  1E6E A;  4NNJ A;  3SM8 A;  3SFE A;  4CBQ A;  2XYO A;  4YTN A;  4AOX A;  2GRT A;  4JN9 A;  4RG4 A;  2EQ9 A;  2WHD A;  1GEU A;  1NEK A;  3EAN A;  3ZDN A;  4E0V A;  3SZ0 A;  2C66 A;  3AD8 B;  3L1R A;  4A6N A;  4FX9 A;  4YSZ A;  3ALJ A;  5M0Z A;  3VQR A;  1Y56 A;  3LB8 A;  3UP4 A;  1QJD A;  1PXB A;  4IA5 A;  1CC2 A;  3SYI A;  3AE6 A;  2RGO A;  1L9D A;  1H81 A;  3P1W A;  3AE7 A;  3I3L A;  4H4W A;  2R46 A;  1FEA A;  2BK5 A;  1GOS A;  2XFN A;  3AE5 A;  1K0I A;  2YAU A;  1ZK7 A;  1V59 A;  1EL9 A;  2XFO A;  3QVR A;  3BI2 A;  2GMH A;  2FJB A;  3ICR A;  2XVI A;  2R4E A;  3KPF A;  4TLZ A;  4Y4N A;  4H4Y A;  3UTE A;  3GYJ A;  2IID A;  4H4V A;  1OJ9 A;  4USR A;  4BK2 A;  4EM3 A;  4KPR A;  3DJD A;  2VVM A;  3NN6 X;  3T2Y A;  2ACZ A;  2BC1 A;  1AOG A;  4BK3 A;  4PAA A;  1ELI A;  1XDI A;  2WP5 A;  2VVL G;  2XFQ A;  2FJE A;  3HYW A;  4J34 A;  2C76 A;  3FIM B;  1CC4 A;  4C77 A;  2C7G A;  2GV8 A;  3OC4 A;  4ZCC A;  5J7X A;  4AP1 A;  3ADA B;  2YR6 A;  1IUX A;  3E1T A;  4OCG A;  2WP9 A;  2YLX A;  4MJW A;  4DGK A;  1S2Y A;  2VQ7 A;  4JNA A;  5J60 A;  2BC0 A;  5JCI A;  1JRY A;  3NT6 A;  1H86 A;  4GDP A;  1DNC A;  4NEW A;  4GAP A;  1IUU A;  4RSL A;  1F8R A;  2QAE A;  2WOI A;  4K7Z A;  3DA1 A;  5FMH A;  3K7M X;  2YLZ A;  4J2W A;  4U8K A;  1TRB A;  4B65 A;  1IJH A;  2W0H A;  2WP6 A;  3GMC A;  1JRZ A;  3RP6 A;  1TYT A;  2R9Z A;  1S3E A;  4B67 A;  1PBD A;  4BJZ A;  1NHS A;  3CGE A;  4ECH A;  3SFD A;  3AXB A;  4DSH A;  4K5S A;  4UDQ A;  2WDV A;  3NRN A;  3DJJ A;  4P9S A;  3LOV A;  1REO A;  2YVF A;  5FS7 A;  2VRL A;  2GR2 A;  4UDR A;  2VRM A;  2WEU A;  2XVJ A;  1S3B A;  3NGC X;  1RYI A;  4ZCD A;  5HY5 A;  4OPU A;  2R0P A;  3JSK A;  3UKP A;  2BS4 A;  3DK4 A;  4Z2U A;  1L9E A;  1TDN A;  1IUV A;  3G5Q A;  3CNJ A;  3CGC A;  4JDR A;  3BHK A;  2Q6U A;  1CHU A;  1CJ3 A;  2YLT A;  1KSS A;  1NHQ A;  2F5Z A;  2WDR A;  3B3R A;  3GWD A;  3PS9 A;  1FCD A;  4GR1 A;  3AD9 B;  3LZX A;  3UOY A;  2RGJ A;  3AWI A;  1GET A;  4JQ9 A;  3SZW A;  4O5Q A;  1O95 A;  2AAQ A;  3NNE A;  4LU6 A;  4BK1 A;  1H7W A;  1E1M A;  1OJT A;  2C67 A;  1PDH A;  1DXL A;  3GD4 A;  2E4G A;  4TM1 A;  5FS8 A;  4YSY A;  4D04 A;  3AE3 A;  3P9U A;  5GSN A;  2V6O A;  3HYV A;  2CVJ A;  5KVH A;  2A8X A;  3UOZ A;  4USQ A;  4IA6 A;  4U2S A;  2Z5Y A;  4WX1 A;  4A7A A;  3V3N A;  4A6N B;  3VRD B;  2OLN A;  3UOX A;  2GQF A;  1XHC A;  1Y56 B;  3DK9 A;  3CPI G;  2XFP A;  3LXD A;  2BAC A;  1D4E A;  3BNM A;  3GDN A;  2Q0K A;  3QVP A;  1VRQ B;  4EMI A;  2HQM A;  1GER A;  2WES A;  2JB2 A;  2XFU A;  1Q1W A;  3GYI A;  4H4R A;  2BK4 A;  1GT8 A;  2C3C A;  1NAA A;  3NTD A;  4H4Z A;  1LV0 A;  1MOK A;  2WPC A;  3GMB A;  2FBW A;  1CF3 A;  5FS9 A;  1N4W A;  1CL0 A;  3SGL A;  1KDG A;  3AE1 A;  3AE4 A;  1CC6 A;  2JB1 A;  4H2P A;  2XVH A;  1PBB A;  3GRS A;  1PBE A;  2PYX A;  3AYI A;  4GCM A;  4U8J A;  4X4J A;  4ZN0 A;  3L8K A;  4CY6 A;  5EBK A;  4B69 A;  4Z24 A;  1Q1R A;  3NN0 X;  4U8L A;  2GF3 A;  3PO7 A;  5BRT A;  3F8R A;  1HYU A;  1VQW A;  2OLO A;  3KA7 A;  4OPI A;  2PHH A;  4H4Q A;  2XDO A;  1NHR A;  2I0Z A;  5JCL A;  2FJA A;  4FK1 A;  3ATR A;  2BAB A;  3FPZ A;  4DSG A;  2NVK X;  1X31 B;  1ZOV A;  1GRB A;  1LTX R;  1BZL A;  3ZYX A;  3CGD A;  2YG3 A;  3SXI A;  1B5Q A;  4GRT A;  3RP7 A;  4H50 A;  4YTM A;  5KVI A;  1CBO A;  4G6H A;  4J36 A;  3K7Q X;  5U1O A;  3URH A;  1N1P A;  1ZP0 A;  4YSH A;  3ICT A;  4ICY A;  4NZH A;  3AYJ A;  1DOC A;  4JY3 A;  3IF9 A;  4H4X A;  1JNZ A;  3UTG A;  4EQW A;  1GRG A;  5BVA A;  2DKH A;  1BF3 A;  4H7U A;  5KMP A;  1MXT A;  4M52 A;  4LII A;  2FJD A;  1GRF A;  2NPX A;  4U8P A;  1GRH A;  4C3Y A;  2BA9 A;  1ZDL A;  1W4X A;  4EM4 A;  1JRX A;  4GDE A;  2X8H A;  4YT0 A;  2XVE A;  3QJ4 A;  4BUR A;  3KKJ A;  3NTA A;  3DGZ A;  1NG3 A;  2ZBW A;  1TDO A;  2B9W A;  2YM2 A;  2A89 A;  2C65 A;  1TDF A;  2B76 A;  1D4D A;  3GYX A;  1DJQ A;  2AQJ A;  3AED A;  1P2E A;  2O9Z A;  2GR3 A;  2X3N A;  4YKF A;  5JCN A;  1VG0 A;  2OAM A;  3RP8 A;  3K30 A;  4K8D A;  3SQP A;  2YQU A;  1B37 A;  2WBA A;  4EIQ A;  2R0G A;  2XLR A;  1BWC A;  2XLU A;  4CRT A;  3IHG A;  1FEB A;  1PN0 A;  2QA1 A;  4D03 A;  1YY5 A;  1H6V A;  2EQ6 A;  2YVJ A;  2V61 A;  3AE2 A;  3RNM A;  1D5T A;  1VDC A;  2LFC A;  1Q9I A;  3ITJ A;  3O0H A;  2YLR A;  3DK8 A;  4A99 A;  3C4A A;  3AB1 A;  4H4T A;  3B6D A;  3S61 A;  3UKH A;  1M64 A;  3EPT A;  1OJD A;  3Q9T A;  1K0L A;  1ZKQ A;  2YG7 A;  1PJ6 A;  1UKV G;  4KX6 A;  3LJP A;  4NTE A;  3CIR A;  4H2N A;  4HA6 A;  5HYM A;  1TDE A;  2V60 A;  2EQ7 A;  5KMR A;  2WDQ A;  1D7L A;  3V76 A;  5KOW A;  1E1L A;  2BS2 A;  4YKG A;  1FEC A;  5EB5 A;  3DGH A;  3FG2 P;  1XPQ A;  3KD9 A;  4H4U A;  3UCL A;  4BV6 A;  3GDP A;  4G74 A;  2XVF A;  4GF7 A;  3UTF A;  3DJG X;  2C72 A;  4U2L A;  3M0O A;  1H7X A;  2WPE A;  3PVC A;  2JKC A;  4G6G A;  3AEE A;  4G73 A;  3R9U A;  2XLP A;  1NEN A;  5IPY A;  1GTE A;  2GQW A;  3UP5 A;  1YQ3 A;  4A65 A;  4N9X A;  1EL5 A;  1NDA A;  3WE0 A;  1XAN A;  3ALM A;  3NIX A;  1OJA A;  4B63 A;  1E39 A;  4PAB A;  1CJ4 A;  3K7T A;  1IUT A;  2H88 A;  2ZZC A;  3KU9 A;  5BUL A;  3NKS A;  4TM3 A;  1GSN A;  4C5O A;  3UKQ A;  3CPJ G;  3II4 A;  3BNU A;  1GTH A;  2GAH B;  3CNT A;  1MO9 A;  3G5R A;  5GRT A;  1ZMC A;  4TM4 A;  3IHM A;  2JK6 A;  1EBD A;  4EQX A;  4B66 A;  2ZZB A;  1NG4 A;  2VVL A;  2YR5 A;  1ZY8 A;  2V3B A;  2GR1 A;  3FBS A;  3T0K A;  1GRT A;  3NYE A;  1GXF A;  3NK0 X;  5KRQ A;  1ONF A;  4REK A;  3UKA A;  2CFY A;  2VQB A;  4OPT A;  2TPR A;  3UKL A;  3F8P A;  3P4Q A;  4ADW A;  3DH9 A;  2C3D A;  4CNJ A;  4Z2R A;  1LPF A;  1OJC A;  2VZ2 A;  2H89 A;  1ZMD A;  1TYP A;  3ICS A;  4OPD A;  4X9M A;  4YSX A;  5KOX A;  2RGH A;  4LA1 A;  1F8W A;  1LQT A;  3GWF A;  4Y4M A;  2B7S A;  1PBC A;  2Q0L A;  2Q7V A;  3CNS A;  3I6D A;  4Z43 A;  1P2H A;  2BXS A;  3CND A;  2B7R A;  2BRA A;  2B9Y A;  1E1N A;  2C73 A;  2GAG B;  1L9C A;  3CTY A;  3NK1 X;  2YLW A;  3P4S A;  1IUS A;  3CPH G;  4BJY A;  3BHF A;  4YXD A;  1O94 A;  2Y6Q A;  2BCP A;  5KMS A;  1M6I A;  3AD7 B;  4U8I A;  5JCK A;  3AEG A;  5EB4 A;  4YTP A;  2C70 A;  4IVM B;  2YM1 A;  2YWL A;  4UP3 A;  1GV4 A;  3ATQ A;  2C64 A;  4JY2 A;  4OVI A;  5IQ4 A;  1F6M A;  3AEB A;  4C74 A;  3VR8 A;  1PXA A;  1LVL A;  1H82 A;  4RG3 A;  4AT0 A;  4FDC B;  3QFB A;  2APG A;  2GR0 A;  4CCQ A;  5BUK A;  3D1C A;  2Z5X A;  4U2T A;  1FOH A;  4U8M A;  4AOS A;  4EMJ A;  2GMJ A;  5CQF A;  5HXI A;  3LAD A;  4UDP A;  1JOA A;  2DKI A;  2Y6R A;  3GSI A;  3CNP A;  1GPE A;  3KPK A;  3RHA A;  3EAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...