4AT9A

Crystal structure of the nf90-nf45 dimerisation domain complex with utp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
332
Chain Sequence
b'GSHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNRQPLALNVYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN ENHANCER-BINDING FACTOR 2
publication title NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 99
structure length 332
sequence length 335
ec nomenclature
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07528 DZF DZF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4at9A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4at9A02
5IILA 3HIYA 1KNYA 3OVAA 4I2BA 4Z6EA 8ICLA 4QZHA 3JPTA 3AUOA 5J2DA 4RQ0A 4P2HA 8ICBA 4I2CA 9ICWA 4UB4A 3AQLA 4O68A 4DOBA 2DVIA 1OU5A 3RJEA 4PGYA 4KB6A 4X0BA 4YD2A 2ZH3A 4GXKA 5HRBA 1ZQZA 4YN4A 8ICZA 1UETA 2DR9A 5J2AA 4MFFA 3JPOA 2ZH4A 5DECA 4UAWA 4RQ2A 4ATBA 7ICSA 9ICMA 4MFCA 4XQ8A 2BCRA 1NO5A 5DB9A 4F5OA 4FO6A 4NXZA 4RPZA 4LEZA 3JPPA 1ZJMA 3RJJA 3UPQA 3C18A 5HRDA 4YCXA 5J2BA 8ICGA 5HRKA 4X4VA 8ICMA 4AT9A 1ZJNA 5CB1A 9ICLA 3V72A 4O69A 1HUZA 4KLUA 4AT8B 4KLDA 5J0TA 3WFOA 5IIIA 3B0YA 4OAIZ 5DKWA 4O5CA 4I2EA 4F5RA 5BOLA 4YMOA 8ICRA 3HW8A 7ICUA 2BPFA 4X4RA 4ATBB 4I2FA 4I2JA 4IQVA 4EBKA 4R65A 3MGHA 1MIWA 2BCUA 3RJGA 3UXPA 2ZHBA 3C66A 4X4TA 3B0XA 3MBYA 4RWNA 5CP2A 5J2EA 2PFQA 1ZQUA 1TVAA 2ZH2A 8ICWA 4I2HA 5J0PA 1ZQHA 4AT9B 3UQ2A 4NLKA 8ICAA 9ICQA 3UQ0A 8ICKA 7ICMA 4XQ7A 2PFNA 4I28A 4X4UA 1JAJA 4K98A 9ICEA 4I2IA 3H37A 2ID1A 2BCSA 4KLOA 2BPCA 1MIYA 5D49A 4NM2A 7ICFA 4MKPA 4WC6A 1ZQIA 5DB6A 4QZEA 4DOAA 4YMMA 4EP7A 3RJIA 1KEJA 4DO9A 4GXJA 3PNCA 1KDHA 1MIVA 7ICNA 2DR8A 4UB3A 1MQ2A 5J0QA 4PGXA 4RQ4A 8ICEA 4NLNA 4KLHA 5F2VO 4NXXA 3AQMA 1ZQLA 2BCQA 3GDXA 4OAGA 4QZ8A 4RT2A 5HC9A 4JWNA 2W9MA 1BPZA 5IINA 1ZQJA 1ZQTA 1RZTA 2DRAA 8ICTA 2PXIA 5J0UA 3RJHA 4O67A 4FHWA 4LEWA 4IG8A 4R66A 5HHIA 4I27A 4M9LA 4K97A 4PGQA 4QZAA 2PFPA 1NOMA 4KLIA 4M0AA 5DDMA 8ICHA 4R63A 9ICJA 4QZIA 1UEUA 1PX5A 4KLLA 4O5EA 1BPEA 4UD4A 4Z6FA 4RQ7A 4WOYA 8ICJA 4QZ9A 5DBBA 4JLXA 4WC1A 1ZQDA 8ICUA 2HHPA 7ICQA 4AT8A 5J2GA 4MFAA 4RQ5A 1XSLA 9ICFA 9ICXA 5IIOA 3ISDA 4K4IA 1YLQA 1ZQPA 7ICVA 1TFYA 4Z6CA 4P4MA 7ICKA 1ZQCA 2I9GA 1BPDA 3K75D 3OV7A 2BE3A 9ICGA 2DRBA 4X5VA 4PHAA 3OVBA 4X4PA 3HJ4A 4M47A 4M9HA 4X4SA 8ICVA 2DR5A 3H39A 4O6AA 4KLSA 9ICOA 3TFRA 5DB8A 4UAYA 4UD5A 3RH4A 9ICSA 4NXTA 4LEYA 4XRHA 4FHPA 1ZQWA 4RT3A 1ZQGA 4F5PA 5EOZA 4LEVA 2IHMA 5CA7A 1Q78A 4JLZA 5J0RA 7ICRA 5CWRA 4QZFA 1HUOA 4KLFA 8ICCA 1ZQBA 4TUPA 4KLTA 5D46A 4E80A 2FMPA 4NXVA 3RH5A 2ZH7A 4QZDA 1R89A 3OUYA 3NYBA 4UB2A 5BPCA 1VJ7A 3ISCA 3C5GA 4F5QA 4FHYA 3C5FA 1R8CA 5TZVA 4OAFA 2ZH9A 4RWOA 5HHHA 2Q66A 4UB1A 4M04A 4WC4A 2M2TA 4WC5A 3L9DA 2FMSA 4I29A 5HRHA 4NY8A 4KLQA 1XSNA 4LT6A 2GWSA 2RFFA 2BPGA 4NXWA 4WBYA 4EBJA 5IIKA 2DR7A 4AT7B 4RQ6A 4FH5A 4WC2A 4NKTA 9ICUA 1VFGA 3OUYB 2O5AA 4UB5A 4FHVA 1ZQXA 3WFPA 4GXIA 3AU6A 4MF8A 4K9BA 5HRLA 4I2GA 4NM1A 9ICIA 5D4BA 4TURA 4KLGA 4YMNA 5HRGA 5IIMA 7ICLA 3UXNA 4MF2A 9ICTA 1JMSA 4O5KA 4RWPA 4UBBA 3TFSA 4IQUA 4KLMA 4I2AA 7ICEA 2FMQA 7ICHA 5HREA 1TV9A 4R64A 2ZH6A 4LZDA 3V7JA 2P66A 4KLJA 3OVSA 2BCVA 2ISOA 4Z6DA 3C2LA 4WC3A 8ICQA 1MQ3A 5CR0A 4E7XA 4FHXA 3AQNA 4X4QA 4XUSA 4I2DA 4WCWA 7ICGA 5HRFA 3C2MA 4LVSA 9ICVA 4K9AA 3LQCB 4RPYA 8ICPA 1V4AA 1ZQMA 4P4OA 3HJ1A 3OGUA 4WBZA 5J29A 1ZQSA 7ICTA 1RPLA 3HWTA 9ICBA 5J0XA 2ZH5A 3JZ0A 3HX0A 9ICKA 1ZQEA 4WC7A 4S3NA 4X0AA 4OAHA 3H3AA 4K8VA 4K99A 4RWQA 1ZQOA 4QZBA 8ICYA 1ZQNA 3AU2A 5J0WA 3JPRA 4M9GA 2O1PA 4TUSA 4WC0A 5J0OA 2VANA 5J2HA 4X4NA 4PHPA 3ISBA 7ICOA 9ICRA 5DB7A 3JPNA 2PFOA 4PPXA 2ISPA 2PBEA 2M2WA 1ZQAA 3JPQA 4RPXA 9ICHA 4AT7A 4X4OA 1Q79A 1R8AA 4NLZA 1JN3A 4M9JA 3MDCA 4K4GA 3RJKA 2ZH8A 1ZQFA 3H38A 3MDAA 3V7KA 5CHGA 4JWMA 5BOMA 1ZQYA 1F5AA 4QZGA 5DBAA 4PH5A 2ZH1A 3RJFA 1ZQQA 4XA5A 4YD1A 4E8FA 3WFSC 4K4HA 5DBCA 4M5DA 3WFRE 4RQ3A 9ICAA 7ICIA 1R8BA 5J0YA 5DEDA 5HRIA 4IQWA 4PHEA 1ZQKA 3RH6A 1TFWA 5HR9A 5J2JA 7ICJA 1JQRA 4P4PA 3C2KA 4KM5A 2ZHAA 8ICXA 4RQ8A 3JYYA 4UBCA 1ZQRA 4TUQA 4M9NA 5J2FA 9ICNA 3PMLA 8ICIA 4FH3A 3V7LA 4PHDA 1FA0A 1XSPA 4O9MA 4RQ1A 4K96A 4NKUA 4F5NA 4KLEA 4QZCA 3MGIA 4LZGA 4UAZA 3UPSA 1BPBA 3LK9A 5J2IA 1BPXA 9ICCA 3JPSA 5J0SA 3PMNA 2M2UA 5J2KA 7ICPA 8ICFA 5IIJA 2M2VA 3WFQE 4NXUA 1WOTA 1ZQVA 5DDYA 8ICNA 8ICSA 1BPYA 5J2CA 3AQKA 8ICOA 4DOCA 2NRKA 4IQTA 4M2YA 1UEVA 9ICPA 5CJ7A 3UXOA
chains in the Genus database with same CATH superfamily
3NKUA 5IILA 3HIYA 4WQKA 1KNYA 3OVAA 4I2BA 4Z6EA 4EV6A 8ICLA 4QZHA 3JPTA 3AUOA 5J2DA 4RQ0A 4P2HA 8ICBA 4I2CA 9ICWA 4UB4A 3AQLA 4O68A 4DOBA 4EGWA 2DVIA 1OU5A 3RJEA 4PGYA 4KB6A 4X0BA 4YD2A 2ZH3A 4GXKA 5HRBA 1ZQZA 4YN4A 8ICZA 1UETA 2DR9A 2FCLA 5J2AA 2HN1A 3JPOA 4MFFA 2ZH4A 5DECA 4UAWA 4RQ2A 4ATBA 7ICSA 9ICMA 4MFCA 4XQ8A 2B4VA 1NO5A 3OWGA 5DB9A 4F5OA 4FO6A 2BCRA 4NXZA 4RPZA 4LEZA 3JPPA 1ZJMA 3RJJA 3UPQA 3C18A 5HRDA 4YCXA 5J2BA 8ICGA 5HRKA 4X4VA 8ICMA 4AT9A 1ZJNA 5CB1A 9ICLA 2B56A 3V72A 4O69A 1HUZA 4KLUA 4AT8B 4KLDA 5J0TA 3WFOA 5IIIA 3B0YA 4OAIZ 5DKWA 5CFTA 4I2EA 4O5CA 4F5RA 5BOLA 4YMOA 8ICRA 3HW8A 3ERCC 7ICUA 2BPFA 4X4RA 4ATBB 4I2FA 4I2JA 4IQVA 4EBKA 4R65A 3MGHA 1MIWA 2BCUA 3RJGA 3UXPA 2ZHBA 3C66A 4X4TA 2BBJA 3B0XA 3MBYA 4RWNA 5CP2A 5J2EA 2PFQA 1ZQUA 1TVAA 2ZH2A 8ICWA 4I2HA 5J0PA 1ZQHA 4AT9B 3UQ2A 4NLKA 8ICAA 9ICQA 3UQ0A 8ICKA 7ICMA 4XQ7A 2PFNA 4X4UA 4I28A 1JAJA 2IHOA 4K98A 9ICEA 4I2IA 3H37A 2ID1A 2BCSA 4KLOA 2BPCA 1MIYA 5D49A 2GAFD 4NM2A 7ICFA 4MKPA 4WC6A 1ZQIA 5DB6A 4QZEA 4DOAA 4YMMA 4EP7A 3RJIA 1GPJA 1KEJA 4DO9A 4GXJA 3PNCA 1KDHA 1MIVA 4EEBA 2DR8A 7ICNA 4UB3A 4HX0A 1MQ2A 5J0QA 4PGXA 4RQ4A 8ICEA 4NLNA 5CHEA 5F2VO 4KLHA 4NXXA 3AQMA 1ZQLA 2BCQA 3GDXA 4OAGA 4QZ8A 4RT2A 5HC9A 4JWNA 2W9MA 1BPZA 5IINA 1ZQJA 2DRAA 1RZTA 1ZQTA 8ICTA 2PXIA 5J0UA 3RJHA 4O67A 4FHWA 4LEWA 4IG8A 2GA9D 4R66A 5HHIA 4I27A 4M9LA 4K97A 4PGQA 4QZAA 2PFPA 1NOMA 4KLIA 4M0AA 5DDMA 8ICHA 4R63A 9ICJA 4QZIA 1UEUA 1PX5A 4KLLA 4O5EA 4UD4A 1BPEA 4Z6FA 4RQ7A 4WOYA 8ICJA 4QZ9A 5DBBA 4JLXA 4WC1A 1ZQDA 8ICUA 2HHPA 7ICQA 4AT8A 5J2GA 4EEDA 4RQ5A 4MFAA 1XSLA 9ICFA 9ICXA 4N7RA 5IIOA 3ISDA 4K4IA 1YLQA 1ZQPA 7ICVA 1TFYA 4Z6CA 4P4MA 7ICKA 1ZQCA 2I9GA 1BPDA 3K75D 3OV7A 2BE3A 9ICGA 2DRBA 4X5VA 4PHAA 3OVBA 4X4PA 3HJ4A 4M47A 4M9HA 4X4SA 8ICVA 2DR5A 3H39A 4O6AA 4KLSA 9ICOA 4I0UA 3TFRA 5DB8A 4UAYA 4UD5A 3RH4A 9ICSA 4NXTA 4LEYA 4XRHA 4FHPA 1ZQWA 4RT3A 1ZQGA 4F5PA 5EOZA 4LEVA 2IHMA 5CA7A 1Q78A 4JLZA 3JCFA 5J0RA 7ICRA 5CWRA 4QZFA 1HUOA 4KLFA 8ICCA 1ZQBA 4TUPA 4KLTA 5D46A 4E80A 2FMPA 4NXVA 3RH5A 2ZH7A 4QZDA 1R89A 3OUYA 3NYBA 4UB2A 5BPCA 1VJ7A 3ISCA 3C5GA 4F5QA 3NVOA 4FHYA 3C5FA 1R8CA 5TZVA 4OAFA 2ZH9A 3PHZA 4RWOA 5HHHA 2Q66A 4UB1A 4M04A 4WC4A 2M2TA 4WC5A 3L9DA 2FMSA 3ER8C 4I29A 5HRHA 4NY8A 4KLQA 1XSNA 4LT6A 2GWSA 2RFFA 2BPGA 4NXWA 4WBYA 4EBJA 5IIKA 2DR7A 4AT7B 4RQ6A 4FH5A 4WC2A 4NKTA 2EWRA 9ICUA 1VFGA 3OUYB 2O5AA 4UB5A 4FHVA 1ZQXA 3WFPA 4GXIA 3AU6A 4MF8A 4K9BA 5HRLA 4I2GA 4NM1A 9ICIA 5D4BA 4TURA 4KLGA 4YMNA 5HRGA 5IIMA 7ICLA 3UXNA 4MF2A 9ICTA 1JMSA 4O5KA 4RWPA 4UBBA 3TFSA 4IQUA 4KLMA 4I2AA 7ICEA 2FMQA 7ICHA 5HREA 1TV9A 4R64A 2ZH6A 4LZDA 3V7JA 2P66A 4KLJA 3OVSA 4XJEA 2BCVA 4Z6DA 2ISOA 2BBHA 3C2LA 4WC3A 8ICQA 1MQ3A 4E7XA 5CR0A 4FHXA 3AQNA 4X4QA 5JTGA 4XUSA 5D62A 4I2DA 4WCWA 7ICGA 5HRFA 3C2MA 4LVSA 9ICVA 5CFUA 4K9AA 3LQCB 4RPYA 8ICPA 1V4AA 1ZQMA 4P4OA 3HJ1A 3OGUA 4WBZA 5D63A 5J29A 5CFSA 1ZQSA 3NWIA 7ICTA 1RPLA 3HWTA 9ICBA 2ZH5A 5J0XA 3JZ0A 3HX0A 9ICKA 3CK6A 1ZQEA 4FO1A 4S3NA 4WC7A 3H3AA 4OAHA 4X0AA 4K8VA 4RWQA 4K99A 1ZQOA 4QZBA 8ICYA 1ZQNA 3AU2A 4WH5A 5J0WA 3JPRA 4M9GA 2O1PA 2HN2A 4TUSA 4WC0A 2B51A 5J0OA 4X4NA 2VANA 5J2HA 4PHPA 3ISBA 7ICOA 4WQLA 9ICRA 5DB7A 3JPNA 2PFOA 4PPXA 2ISPA 2PBEA 2M2WA 1ZQAA 3JPQA 4RPXA 9ICHA 4AT7A 4X4OA 1Q79A 1R8AA 4NLZA 1JN3A 4M9JA 3K7DA 3MDCA 4K4GA 3RJKA 2ZH8A 1ZQFA 3H38A 3MDAA 3V7KA 3ER9B 5CHGA 4JWMA 5BOMA 1ZQYA 1F5AA 4QZGA 5DBAA 4PH5A 2ZH1A 3RJFA 1ZQQA 4XA5A 5B3PA 4YD1A 4E8FA 3WFSC 4K4HA 5DBCA 4M5DA 3WFRE 4RQ3A 9ICAA 7ICIA 1R8BA 5J0YA 5DEDA 5D61A 5HRIA 4IQWA 4PHEA 1ZQKA 3RH6A 1TFWA 5HR9A 5J2JA 7ICJA 1JQRA 4P4PA 3C2KA 4KM5A 2ZHAA 8ICXA 4RQ8A 3JYYA 4UBCA 1ZQRA 4TUQA 4M9NA 5J2FA 9ICNA 3EF2A 3PMLA 8ICIA 4FH3A 3V7LA 4PHDA 1FA0A 1XSPA 4O9MA 4RQ1A 4K96A 4NKUA 4F5NA 4KLEA 4QZCA 3MGIA 4LZGA 4UAZA 3UPSA 5B3QA 1BPBA 3LK9A 5J2IA 1BPXA 9ICCA 3JPSA 3MCRA 5J0SA 3PMNA 2IUBA 2M2UA 5J2KA 7ICPA 8ICFA 5IIJA 2M2VA 3WFQE 4NXUA 1WOTA 1ZQVA 5DDYA 8ICNA 8ICSA 1BPYA 5J2CA 3AQKA 8ICOA 4DOCA 2NRKA 4IQTA 4M2YA 1UEVA 9ICPA 5CJ7A 3UXOA
chains in the Genus database with same CATH topology
5IILA 3HIYA 1KNYA 3OVAA 4I2BA 4Z6EA 8ICLA 4QZHA 3JPTA 3AUOA 5J2DA 4RQ0A 4P2HA 8ICBA 4I2CA 9ICWA 4UB4A 3AQLA 4O68A 4DOBA 2DVIA 1OU5A 3RJEA 4PGYA 4KB6A 4X0BA 4YD2A 2ZH3A 4GXKA 5HRBA 1ZQZA 4YN4A 8ICZA 1UETA 2DR9A 5J2AA 4MFFA 3JPOA 2ZH4A 5DECA 4UAWA 4RQ2A 4ATBA 7ICSA 9ICMA 4MFCA 4XQ8A 2B4VA 1NO5A 5DB9A 4F5OA 4FO6A 2BCRA 4NXZA 4RPZA 4LEZA 3JPPA 1ZJMA 3RJJA 3UPQA 3C18A 5HRDA 4YCXA 5J2BA 8ICGA 5HRKA 4X4VA 8ICMA 4AT9A 1ZJNA 5CB1A 9ICLA 2B56A 3V72A 4O69A 1HUZA 4KLUA 4AT8B 4KLDA 5J0TA 3WFOA 5IIIA 3B0YA 4OAIZ 5DKWA 4O5CA 4I2EA 4F5RA 5BOLA 4YMOA 8ICRA 3HW8A 7ICUA 2BPFA 4X4RA 4ATBB 4I2FA 4I2JA 4IQVA 4EBKA 4R65A 3MGHA 1MIWA 2BCUA 3RJGA 3UXPA 2ZHBA 3C66A 4X4TA 3B0XA 3MBYA 4RWNA 5CP2A 5J2EA 2PFQA 1ZQUA 1TVAA 2ZH2A 8ICWA 4I2HA 5J0PA 1ZQHA 4AT9B 3UQ2A 4NLKA 8ICAA 9ICQA 3UQ0A 8ICKA 7ICMA 4XQ7A 2PFNA 4X4UA 4I28A 1JAJA 4K98A 9ICEA 4I2IA 3H37A 2ID1A 2BCSA 4KLOA 2BPCA 1MIYA 5D49A 4NM2A 7ICFA 4MKPA 4WC6A 1ZQIA 5DB6A 4QZEA 4DOAA 4YMMA 4EP7A 3RJIA 1KEJA 4DO9A 4GXJA 3PNCA 1KDHA 1MIVA 7ICNA 2DR8A 4UB3A 1MQ2A 5J0QA 4PGXA 4RQ4A 8ICEA 4NLNA 4KLHA 5F2VO 4NXXA 3AQMA 1ZQLA 2BCQA 3GDXA 4OAGA 4QZ8A 4RT2A 5HC9A 4JWNA 2W9MA 1BPZA 5IINA 1ZQJA 2DRAA 1RZTA 1ZQTA 8ICTA 2PXIA 5J0UA 3RJHA 4O67A 4FHWA 4LEWA 4IG8A 4R66A 5HHIA 4I27A 4M9LA 4K97A 4PGQA 4QZAA 2PFPA 1NOMA 4KLIA 4M0AA 5DDMA 8ICHA 4R63A 9ICJA 4QZIA 1UEUA 1PX5A 4KLLA 4O5EA 4UD4A 1BPEA 4Z6FA 4RQ7A 4WOYA 8ICJA 4QZ9A 5DBBA 4JLXA 4WC1A 1ZQDA 8ICUA 2HHPA 7ICQA 4AT8A 5J2GA 4MFAA 4RQ5A 1XSLA 9ICFA 9ICXA 5IIOA 3ISDA 4K4IA 1YLQA 1ZQPA 7ICVA 1TFYA 4Z6CA 4P4MA 7ICKA 1ZQCA 2I9GA 1BPDA 3K75D 3OV7A 2BE3A 9ICGA 2DRBA 4X5VA 4PHAA 3OVBA 4X4PA 3HJ4A 4M47A 4M9HA 4X4SA 8ICVA 2DR5A 3H39A 4O6AA 4KLSA 9ICOA 3TFRA 5DB8A 4UAYA 4UD5A 3RH4A 9ICSA 4NXTA 4LEYA 4XRHA 4FHPA 1ZQWA 4RT3A 1ZQGA 4F5PA 5EOZA 4LEVA 2IHMA 5CA7A 1Q78A 4JLZA 5J0RA 7ICRA 5CWRA 4QZFA 1HUOA 4KLFA 8ICCA 1ZQBA 4TUPA 4KLTA 5D46A 4E80A 2FMPA 4NXVA 3RH5A 2ZH7A 4QZDA 1R89A 3OUYA 3NYBA 4UB2A 5BPCA 1VJ7A 3ISCA 3C5GA 4F5QA 4FHYA 3C5FA 1R8CA 5TZVA 4OAFA 2ZH9A 4RWOA 5HHHA 2Q66A 4UB1A 4M04A 4WC4A 2M2TA 4WC5A 3L9DA 2FMSA 4I29A 5HRHA 4NY8A 4KLQA 1XSNA 4LT6A 2GWSA 2RFFA 2BPGA 4NXWA 4WBYA 4EBJA 5IIKA 2DR7A 4AT7B 4RQ6A 4FH5A 4WC2A 4NKTA 9ICUA 1VFGA 3OUYB 2O5AA 4UB5A 4FHVA 1ZQXA 3WFPA 4GXIA 3AU6A 4MF8A 4K9BA 5HRLA 4I2GA 4NM1A 9ICIA 5D4BA 4TURA 4KLGA 4YMNA 5HRGA 5IIMA 7ICLA 3UXNA 4MF2A 9ICTA 1JMSA 4O5KA 4RWPA 4UBBA 3TFSA 4IQUA 4KLMA 4I2AA 7ICEA 2FMQA 7ICHA 5HREA 1TV9A 4R64A 2ZH6A 4LZDA 3V7JA 2P66A 4KLJA 3OVSA 2BCVA 2ISOA 4Z6DA 3C2LA 4WC3A 8ICQA 1MQ3A 4E7XA 5CR0A 4FHXA 3AQNA 4X4QA 4XUSA 4I2DA 4WCWA 7ICGA 5HRFA 3C2MA 4LVSA 9ICVA 4K9AA 3LQCB 4RPYA 8ICPA 1V4AA 1ZQMA 4P4OA 3HJ1A 3OGUA 4WBZA 5J29A 1ZQSA 7ICTA 1RPLA 3HWTA 9ICBA 2ZH5A 5J0XA 3JZ0A 3HX0A 9ICKA 1ZQEA 4WC7A 4S3NA 3H3AA 4OAHA 4X0AA 4K8VA 4K99A 4RWQA 1ZQOA 4QZBA 8ICYA 1ZQNA 3AU2A 5J0WA 3JPRA 4M9GA 2O1PA 4TUSA 4WC0A 2B51A 5J0OA 4X4NA 2VANA 5J2HA 4PHPA 3ISBA 7ICOA 9ICRA 5DB7A 3JPNA 2PFOA 4PPXA 2ISPA 2PBEA 2M2WA 1ZQAA 3JPQA 4RPXA 9ICHA 4AT7A 4X4OA 1Q79A 1R8AA 4NLZA 1JN3A 4M9JA 3MDCA 4K4GA 3RJKA 2ZH8A 1ZQFA 3H38A 3MDAA 3V7KA 5CHGA 4JWMA 5BOMA 1ZQYA 1F5AA 4QZGA 5DBAA 4PH5A 2ZH1A 3RJFA 1ZQQA 4XA5A 4YD1A 4E8FA 3WFSC 4K4HA 5DBCA 4M5DA 3WFRE 4RQ3A 9ICAA 7ICIA 1R8BA 5J0YA 5DEDA 5HRIA 4IQWA 4PHEA 1ZQKA 3RH6A 1TFWA 5HR9A 5J2JA 7ICJA 1JQRA 4P4PA 3C2KA 4KM5A 2ZHAA 8ICXA 4RQ8A 3JYYA 4UBCA 1ZQRA 4TUQA 4M9NA 5J2FA 9ICNA 3PMLA 8ICIA 4FH3A 3V7LA 4PHDA 1FA0A 1XSPA 4O9MA 4RQ1A 4K96A 4NKUA 4F5NA 4KLEA 4QZCA 3MGIA 4LZGA 4UAZA 3UPSA 1BPBA 3LK9A 5J2IA 1BPXA 9ICCA 3JPSA 5J0SA 3PMNA 2M2UA 5J2KA 7ICPA 8ICFA 5IIJA 2M2VA 3WFQE 4NXUA 1WOTA 1ZQVA 5DDYA 8ICNA 8ICSA 1BPYA 5J2CA 3AQKA 8ICOA 4DOCA 2NRKA 4IQTA 4M2YA 1UEVA 9ICPA 5CJ7A 3UXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IIL A;  3HIY A;  1KNY A;  3OVA A;  4I2B A;  4Z6E A;  8ICL A;  4QZH A;  3JPT A;  3AUO A;  5J2D A;  4RQ0 A;  4P2H A;  8ICB A;  4I2C A;  9ICW A;  4UB4 A;  3AQL A;  4O68 A;  4DOB A;  2DVI A;  1OU5 A;  3RJE A;  4PGY A;  4KB6 A;  4X0B A;  4YD2 A;  2ZH3 A;  4GXK A;  5HRB A;  1ZQZ A;  4YN4 A;  8ICZ A;  1UET A;  2DR9 A;  5J2A A;  4MFF A;  3JPO A;  2ZH4 A;  5DEC A;  4UAW A;  4RQ2 A;  4ATB A;  7ICS A;  9ICM A;  4MFC A;  4XQ8 A;  2BCR A;  1NO5 A;  5DB9 A;  4F5O A;  4FO6 A;  4NXZ A;  4RPZ A;  4LEZ A;  3JPP A;  1ZJM A;  3RJJ A;  3UPQ A;  3C18 A;  5HRD A;  4YCX A;  5J2B A;  8ICG A;  5HRK A;  4X4V A;  8ICM A;  4AT9 A;  1ZJN A;  5CB1 A;  9ICL A;  3V72 A;  4O69 A;  1HUZ A;  4KLU A;  4AT8 B;  4KLD A;  5J0T A;  3WFO A;  5III A;  3B0Y A;  4OAI Z;  5DKW A;  4O5C A;  4I2E A;  4F5R A;  5BOL A;  4YMO A;  8ICR A;  3HW8 A;  7ICU A;  2BPF A;  4X4R A;  4ATB B;  4I2F A;  4I2J A;  4IQV A;  4EBK A;  4R65 A;  3MGH A;  1MIW A;  2BCU A;  3RJG A;  3UXP A;  2ZHB A;  3C66 A;  4X4T A;  3B0X A;  3MBY A;  4RWN A;  5CP2 A;  5J2E A;  2PFQ A;  1ZQU A;  1TVA A;  2ZH2 A;  8ICW A;  4I2H A;  5J0P A;  1ZQH A;  4AT9 B;  3UQ2 A;  4NLK A;  8ICA A;  9ICQ A;  3UQ0 A;  8ICK A;  7ICM A;  4XQ7 A;  2PFN A;  4I28 A;  4X4U A;  1JAJ A;  4K98 A;  9ICE A;  4I2I A;  3H37 A;  2ID1 A;  2BCS A;  4KLO A;  2BPC A;  1MIY A;  5D49 A;  4NM2 A;  7ICF A;  4MKP A;  4WC6 A;  1ZQI A;  5DB6 A;  4QZE A;  4DOA A;  4YMM A;  4EP7 A;  3RJI A;  1KEJ A;  4DO9 A;  4GXJ A;  3PNC A;  1KDH A;  1MIV A;  7ICN A;  2DR8 A;  4UB3 A;  1MQ2 A;  5J0Q A;  4PGX A;  4RQ4 A;  8ICE A;  4NLN A;  4KLH A;  5F2V O;  4NXX A;  3AQM A;  1ZQL A;  2BCQ A;  3GDX A;  4OAG A;  4QZ8 A;  4RT2 A;  5HC9 A;  4JWN A;  2W9M A;  1BPZ A;  5IIN A;  1ZQJ A;  1ZQT A;  1RZT A;  2DRA A;  8ICT A;  2PXI A;  5J0U A;  3RJH A;  4O67 A;  4FHW A;  4LEW A;  4IG8 A;  4R66 A;  5HHI A;  4I27 A;  4M9L A;  4K97 A;  4PGQ A;  4QZA A;  2PFP A;  1NOM A;  4KLI A;  4M0A A;  5DDM A;  8ICH A;  4R63 A;  9ICJ A;  4QZI A;  1UEU A;  1PX5 A;  4KLL A;  4O5E A;  1BPE A;  4UD4 A;  4Z6F A;  4RQ7 A;  4WOY A;  8ICJ A;  4QZ9 A;  5DBB A;  4JLX A;  4WC1 A;  1ZQD A;  8ICU A;  2HHP A;  7ICQ A;  4AT8 A;  5J2G A;  4MFA A;  4RQ5 A;  1XSL A;  9ICF A;  9ICX A;  5IIO A;  3ISD A;  4K4I A;  1YLQ A;  1ZQP A;  7ICV A;  1TFY A;  4Z6C A;  4P4M A;  7ICK A;  1ZQC A;  2I9G A;  1BPD A;  3K75 D;  3OV7 A;  2BE3 A;  9ICG A;  2DRB A;  4X5V A;  4PHA A;  3OVB A;  4X4P A;  3HJ4 A;  4M47 A;  4M9H A;  4X4S A;  8ICV A;  2DR5 A;  3H39 A;  4O6A A;  4KLS A;  9ICO A;  3TFR A;  5DB8 A;  4UAY A;  4UD5 A;  3RH4 A;  9ICS A;  4NXT A;  4LEY A;  4XRH A;  4FHP A;  1ZQW A;  4RT3 A;  1ZQG A;  4F5P A;  5EOZ A;  4LEV A;  2IHM A;  5CA7 A;  1Q78 A;  4JLZ A;  5J0R A;  7ICR A;  5CWR A;  4QZF A;  1HUO A;  4KLF A;  8ICC A;  1ZQB A;  4TUP A;  4KLT A;  5D46 A;  4E80 A;  2FMP A;  4NXV A;  3RH5 A;  2ZH7 A;  4QZD A;  1R89 A;  3OUY A;  3NYB A;  4UB2 A;  5BPC A;  1VJ7 A;  3ISC A;  3C5G A;  4F5Q A;  4FHY A;  3C5F A;  1R8C A;  5TZV A;  4OAF A;  2ZH9 A;  4RWO A;  5HHH A;  2Q66 A;  4UB1 A;  4M04 A;  4WC4 A;  2M2T A;  4WC5 A;  3L9D A;  2FMS A;  4I29 A;  5HRH A;  4NY8 A;  4KLQ A;  1XSN A;  4LT6 A;  2GWS A;  2RFF A;  2BPG A;  4NXW A;  4WBY A;  4EBJ A;  5IIK A;  2DR7 A;  4AT7 B;  4RQ6 A;  4FH5 A;  4WC2 A;  4NKT A;  9ICU A;  1VFG A;  3OUY B;  2O5A A;  4UB5 A;  4FHV A;  1ZQX A;  3WFP A;  4GXI A;  3AU6 A;  4MF8 A;  4K9B A;  5HRL A;  4I2G A;  4NM1 A;  9ICI A;  5D4B A;  4TUR A;  4KLG A;  4YMN A;  5HRG A;  5IIM A;  7ICL A;  3UXN A;  4MF2 A;  9ICT A;  1JMS A;  4O5K A;  4RWP A;  4UBB A;  3TFS A;  4IQU A;  4KLM A;  4I2A A;  7ICE A;  2FMQ A;  7ICH A;  5HRE A;  1TV9 A;  4R64 A;  2ZH6 A;  4LZD A;  3V7J A;  2P66 A;  4KLJ A;  3OVS A;  2BCV A;  2ISO A;  4Z6D A;  3C2L A;  4WC3 A;  8ICQ A;  1MQ3 A;  5CR0 A;  4E7X A;  4FHX A;  3AQN A;  4X4Q A;  4XUS A;  4I2D A;  4WCW A;  7ICG A;  5HRF A;  3C2M A;  4LVS A;  9ICV A;  4K9A A;  3LQC B;  4RPY A;  8ICP A;  1V4A A;  1ZQM A;  4P4O A;  3HJ1 A;  3OGU A;  4WBZ A;  5J29 A;  1ZQS A;  7ICT A;  1RPL A;  3HWT A;  9ICB A;  5J0X A;  2ZH5 A;  3JZ0 A;  3HX0 A;  9ICK A;  1ZQE A;  4WC7 A;  4S3N A;  4X0A A;  4OAH A;  3H3A A;  4K8V A;  4K99 A;  4RWQ A;  1ZQO A;  4QZB A;  8ICY A;  1ZQN A;  3AU2 A;  5J0W A;  3JPR A;  4M9G A;  2O1P A;  4TUS A;  4WC0 A;  5J0O A;  2VAN A;  5J2H A;  4X4N A;  4PHP A;  3ISB A;  7ICO A;  9ICR A;  5DB7 A;  3JPN A;  2PFO A;  4PPX A;  2ISP A;  2PBE A;  2M2W A;  1ZQA A;  3JPQ A;  4RPX A;  9ICH A;  4AT7 A;  4X4O A;  1Q79 A;  1R8A A;  4NLZ A;  1JN3 A;  4M9J A;  3MDC A;  4K4G A;  3RJK A;  2ZH8 A;  1ZQF A;  3H38 A;  3MDA A;  3V7K A;  5CHG A;  4JWM A;  5BOM A;  1ZQY A;  1F5A A;  4QZG A;  5DBA A;  4PH5 A;  2ZH1 A;  3RJF A;  1ZQQ A;  4XA5 A;  4YD1 A;  4E8F A;  3WFS C;  4K4H A;  5DBC A;  4M5D A;  3WFR E;  4RQ3 A;  9ICA A;  7ICI A;  1R8B A;  5J0Y A;  5DED A;  5HRI A;  4IQW A;  4PHE A;  1ZQK A;  3RH6 A;  1TFW A;  5HR9 A;  5J2J A;  7ICJ A;  1JQR A;  4P4P A;  3C2K A;  4KM5 A;  2ZHA A;  8ICX A;  4RQ8 A;  3JYY A;  4UBC A;  1ZQR A;  4TUQ A;  4M9N A;  5J2F A;  9ICN A;  3PML A;  8ICI A;  4FH3 A;  3V7L A;  4PHD A;  1FA0 A;  1XSP A;  4O9M A;  4RQ1 A;  4K96 A;  4NKU A;  4F5N A;  4KLE A;  4QZC A;  3MGI A;  4LZG A;  4UAZ A;  3UPS A;  1BPB A;  3LK9 A;  5J2I A;  1BPX A;  9ICC A;  3JPS A;  5J0S A;  3PMN A;  2M2U A;  5J2K A;  7ICP A;  8ICF A;  5IIJ A;  2M2V A;  3WFQ E;  4NXU A;  1WOT A;  1ZQV A;  5DDY A;  8ICN A;  8ICS A;  1BPY A;  5J2C A;  3AQK A;  8ICO A;  4DOC A;  2NRK A;  4IQT A;  4M2Y A;  1UEV A;  9ICP A;  5CJ7 A;  3UXO A; 
#chains in the Genus database with same CATH topology
 3NKU A;  5IIL A;  3HIY A;  4WQK A;  1KNY A;  3OVA A;  4I2B A;  4Z6E A;  4EV6 A;  8ICL A;  4QZH A;  3JPT A;  3AUO A;  5J2D A;  4RQ0 A;  4P2H A;  8ICB A;  4I2C A;  9ICW A;  4UB4 A;  3AQL A;  4O68 A;  4DOB A;  4EGW A;  2DVI A;  1OU5 A;  3RJE A;  4PGY A;  4KB6 A;  4X0B A;  4YD2 A;  2ZH3 A;  4GXK A;  5HRB A;  1ZQZ A;  4YN4 A;  8ICZ A;  1UET A;  2DR9 A;  2FCL A;  5J2A A;  2HN1 A;  3JPO A;  4MFF A;  2ZH4 A;  5DEC A;  4UAW A;  4RQ2 A;  4ATB A;  7ICS A;  9ICM A;  4MFC A;  4XQ8 A;  2B4V A;  1NO5 A;  3OWG A;  5DB9 A;  4F5O A;  4FO6 A;  2BCR A;  4NXZ A;  4RPZ A;  4LEZ A;  3JPP A;  1ZJM A;  3RJJ A;  3UPQ A;  3C18 A;  5HRD A;  4YCX A;  5J2B A;  8ICG A;  5HRK A;  4X4V A;  8ICM A;  4AT9 A;  1ZJN A;  5CB1 A;  9ICL A;  2B56 A;  3V72 A;  4O69 A;  1HUZ A;  4KLU A;  4AT8 B;  4KLD A;  5J0T A;  3WFO A;  5III A;  3B0Y A;  4OAI Z;  5DKW A;  5CFT A;  4I2E A;  4O5C A;  4F5R A;  5BOL A;  4YMO A;  8ICR A;  3HW8 A;  3ERC C;  7ICU A;  2BPF A;  4X4R A;  4ATB B;  4I2F A;  4I2J A;  4IQV A;  4EBK A;  4R65 A;  3MGH A;  1MIW A;  2BCU A;  3RJG A;  3UXP A;  2ZHB A;  3C66 A;  4X4T A;  2BBJ A;  3B0X A;  3MBY A;  4RWN A;  5CP2 A;  5J2E A;  2PFQ A;  1ZQU A;  1TVA A;  2ZH2 A;  8ICW A;  4I2H A;  5J0P A;  1ZQH A;  4AT9 B;  3UQ2 A;  4NLK A;  8ICA A;  9ICQ A;  3UQ0 A;  8ICK A;  7ICM A;  4XQ7 A;  2PFN A;  4X4U A;  4I28 A;  1JAJ A;  2IHO A;  4K98 A;  9ICE A;  4I2I A;  3H37 A;  2ID1 A;  2BCS A;  4KLO A;  2BPC A;  1MIY A;  5D49 A;  2GAF D;  4NM2 A;  7ICF A;  4MKP A;  4WC6 A;  1ZQI A;  5DB6 A;  4QZE A;  4DOA A;  4YMM A;  4EP7 A;  3RJI A;  1GPJ A;  1KEJ A;  4DO9 A;  4GXJ A;  3PNC A;  1KDH A;  1MIV A;  4EEB A;  2DR8 A;  7ICN A;  4UB3 A;  4HX0 A;  1MQ2 A;  5J0Q A;  4PGX A;  4RQ4 A;  8ICE A;  4NLN A;  5CHE A;  5F2V O;  4KLH A;  4NXX A;  3AQM A;  1ZQL A;  2BCQ A;  3GDX A;  4OAG A;  4QZ8 A;  4RT2 A;  5HC9 A;  4JWN A;  2W9M A;  1BPZ A;  5IIN A;  1ZQJ A;  2DRA A;  1RZT A;  1ZQT A;  8ICT A;  2PXI A;  5J0U A;  3RJH A;  4O67 A;  4FHW A;  4LEW A;  4IG8 A;  2GA9 D;  4R66 A;  5HHI A;  4I27 A;  4M9L A;  4K97 A;  4PGQ A;  4QZA A;  2PFP A;  1NOM A;  4KLI A;  4M0A A;  5DDM A;  8ICH A;  4R63 A;  9ICJ A;  4QZI A;  1UEU A;  1PX5 A;  4KLL A;  4O5E A;  4UD4 A;  1BPE A;  4Z6F A;  4RQ7 A;  4WOY A;  8ICJ A;  4QZ9 A;  5DBB A;  4JLX A;  4WC1 A;  1ZQD A;  8ICU A;  2HHP A;  7ICQ A;  4AT8 A;  5J2G A;  4EED A;  4RQ5 A;  4MFA A;  1XSL A;  9ICF A;  9ICX A;  4N7R A;  5IIO A;  3ISD A;  4K4I A;  1YLQ A;  1ZQP A;  7ICV A;  1TFY A;  4Z6C A;  4P4M A;  7ICK A;  1ZQC A;  2I9G A;  1BPD A;  3K75 D;  3OV7 A;  2BE3 A;  9ICG A;  2DRB A;  4X5V A;  4PHA A;  3OVB A;  4X4P A;  3HJ4 A;  4M47 A;  4M9H A;  4X4S A;  8ICV A;  2DR5 A;  3H39 A;  4O6A A;  4KLS A;  9ICO A;  4I0U A;  3TFR A;  5DB8 A;  4UAY A;  4UD5 A;  3RH4 A;  9ICS A;  4NXT A;  4LEY A;  4XRH A;  4FHP A;  1ZQW A;  4RT3 A;  1ZQG A;  4F5P A;  5EOZ A;  4LEV A;  2IHM A;  5CA7 A;  1Q78 A;  4JLZ A;  3JCF A;  5J0R A;  7ICR A;  5CWR A;  4QZF A;  1HUO A;  4KLF A;  8ICC A;  1ZQB A;  4TUP A;  4KLT A;  5D46 A;  4E80 A;  2FMP A;  4NXV A;  3RH5 A;  2ZH7 A;  4QZD A;  1R89 A;  3OUY A;  3NYB A;  4UB2 A;  5BPC A;  1VJ7 A;  3ISC A;  3C5G A;  4F5Q A;  3NVO A;  4FHY A;  3C5F A;  1R8C A;  5TZV A;  4OAF A;  2ZH9 A;  3PHZ A;  4RWO A;  5HHH A;  2Q66 A;  4UB1 A;  4M04 A;  4WC4 A;  2M2T A;  4WC5 A;  3L9D A;  2FMS A;  3ER8 C;  4I29 A;  5HRH A;  4NY8 A;  4KLQ A;  1XSN A;  4LT6 A;  2GWS A;  2RFF A;  2BPG A;  4NXW A;  4WBY A;  4EBJ A;  5IIK A;  2DR7 A;  4AT7 B;  4RQ6 A;  4FH5 A;  4WC2 A;  4NKT A;  2EWR A;  9ICU A;  1VFG A;  3OUY B;  2O5A A;  4UB5 A;  4FHV A;  1ZQX A;  3WFP A;  4GXI A;  3AU6 A;  4MF8 A;  4K9B A;  5HRL A;  4I2G A;  4NM1 A;  9ICI A;  5D4B A;  4TUR A;  4KLG A;  4YMN A;  5HRG A;  5IIM A;  7ICL A;  3UXN A;  4MF2 A;  9ICT A;  1JMS A;  4O5K A;  4RWP A;  4UBB A;  3TFS A;  4IQU A;  4KLM A;  4I2A A;  7ICE A;  2FMQ A;  7ICH A;  5HRE A;  1TV9 A;  4R64 A;  2ZH6 A;  4LZD A;  3V7J A;  2P66 A;  4KLJ A;  3OVS A;  4XJE A;  2BCV A;  4Z6D A;  2ISO A;  2BBH A;  3C2L A;  4WC3 A;  8ICQ A;  1MQ3 A;  4E7X A;  5CR0 A;  4FHX A;  3AQN A;  4X4Q A;  5JTG A;  4XUS A;  5D62 A;  4I2D A;  4WCW A;  7ICG A;  5HRF A;  3C2M A;  4LVS A;  9ICV A;  5CFU A;  4K9A A;  3LQC B;  4RPY A;  8ICP A;  1V4A A;  1ZQM A;  4P4O A;  3HJ1 A;  3OGU A;  4WBZ A;  5D63 A;  5J29 A;  5CFS A;  1ZQS A;  3NWI A;  7ICT A;  1RPL A;  3HWT A;  9ICB A;  2ZH5 A;  5J0X A;  3JZ0 A;  3HX0 A;  9ICK A;  3CK6 A;  1ZQE A;  4FO1 A;  4S3N A;  4WC7 A;  3H3A A;  4OAH A;  4X0A A;  4K8V A;  4RWQ A;  4K99 A;  1ZQO A;  4QZB A;  8ICY A;  1ZQN A;  3AU2 A;  4WH5 A;  5J0W A;  3JPR A;  4M9G A;  2O1P A;  2HN2 A;  4TUS A;  4WC0 A;  2B51 A;  5J0O A;  4X4N A;  2VAN A;  5J2H A;  4PHP A;  3ISB A;  7ICO A;  4WQL A;  9ICR A;  5DB7 A;  3JPN A;  2PFO A;  4PPX A;  2ISP A;  2PBE A;  2M2W A;  1ZQA A;  3JPQ A;  4RPX A;  9ICH A;  4AT7 A;  4X4O A;  1Q79 A;  1R8A A;  4NLZ A;  1JN3 A;  4M9J A;  3K7D A;  3MDC A;  4K4G A;  3RJK A;  2ZH8 A;  1ZQF A;  3H38 A;  3MDA A;  3V7K A;  3ER9 B;  5CHG A;  4JWM A;  5BOM A;  1ZQY A;  1F5A A;  4QZG A;  5DBA A;  4PH5 A;  2ZH1 A;  3RJF A;  1ZQQ A;  4XA5 A;  5B3P A;  4YD1 A;  4E8F A;  3WFS C;  4K4H A;  5DBC A;  4M5D A;  3WFR E;  4RQ3 A;  9ICA A;  7ICI A;  1R8B A;  5J0Y A;  5DED A;  5D61 A;  5HRI A;  4IQW A;  4PHE A;  1ZQK A;  3RH6 A;  1TFW A;  5HR9 A;  5J2J A;  7ICJ A;  1JQR A;  4P4P A;  3C2K A;  4KM5 A;  2ZHA A;  8ICX A;  4RQ8 A;  3JYY A;  4UBC A;  1ZQR A;  4TUQ A;  4M9N A;  5J2F A;  9ICN A;  3EF2 A;  3PML A;  8ICI A;  4FH3 A;  3V7L A;  4PHD A;  1FA0 A;  1XSP A;  4O9M A;  4RQ1 A;  4K96 A;  4NKU A;  4F5N A;  4KLE A;  4QZC A;  3MGI A;  4LZG A;  4UAZ A;  3UPS A;  5B3Q A;  1BPB A;  3LK9 A;  5J2I A;  1BPX A;  9ICC A;  3JPS A;  3MCR A;  5J0S A;  3PMN A;  2IUB A;  2M2U A;  5J2K A;  7ICP A;  8ICF A;  5IIJ A;  2M2V A;  3WFQ E;  4NXU A;  1WOT A;  1ZQV A;  5DDY A;  8ICN A;  8ICS A;  1BPY A;  5J2C A;  3AQK A;  8ICO A;  4DOC A;  2NRK A;  4IQT A;  4M2Y A;  1UEV A;  9ICP A;  5CJ7 A;  3UXO A; 
#chains in the Genus database with same CATH homology
 5IIL A;  3HIY A;  1KNY A;  3OVA A;  4I2B A;  4Z6E A;  8ICL A;  4QZH A;  3JPT A;  3AUO A;  5J2D A;  4RQ0 A;  4P2H A;  8ICB A;  4I2C A;  9ICW A;  4UB4 A;  3AQL A;  4O68 A;  4DOB A;  2DVI A;  1OU5 A;  3RJE A;  4PGY A;  4KB6 A;  4X0B A;  4YD2 A;  2ZH3 A;  4GXK A;  5HRB A;  1ZQZ A;  4YN4 A;  8ICZ A;  1UET A;  2DR9 A;  5J2A A;  4MFF A;  3JPO A;  2ZH4 A;  5DEC A;  4UAW A;  4RQ2 A;  4ATB A;  7ICS A;  9ICM A;  4MFC A;  4XQ8 A;  2B4V A;  1NO5 A;  5DB9 A;  4F5O A;  4FO6 A;  2BCR A;  4NXZ A;  4RPZ A;  4LEZ A;  3JPP A;  1ZJM A;  3RJJ A;  3UPQ A;  3C18 A;  5HRD A;  4YCX A;  5J2B A;  8ICG A;  5HRK A;  4X4V A;  8ICM A;  4AT9 A;  1ZJN A;  5CB1 A;  9ICL A;  2B56 A;  3V72 A;  4O69 A;  1HUZ A;  4KLU A;  4AT8 B;  4KLD A;  5J0T A;  3WFO A;  5III A;  3B0Y A;  4OAI Z;  5DKW A;  4O5C A;  4I2E A;  4F5R A;  5BOL A;  4YMO A;  8ICR A;  3HW8 A;  7ICU A;  2BPF A;  4X4R A;  4ATB B;  4I2F A;  4I2J A;  4IQV A;  4EBK A;  4R65 A;  3MGH A;  1MIW A;  2BCU A;  3RJG A;  3UXP A;  2ZHB A;  3C66 A;  4X4T A;  3B0X A;  3MBY A;  4RWN A;  5CP2 A;  5J2E A;  2PFQ A;  1ZQU A;  1TVA A;  2ZH2 A;  8ICW A;  4I2H A;  5J0P A;  1ZQH A;  4AT9 B;  3UQ2 A;  4NLK A;  8ICA A;  9ICQ A;  3UQ0 A;  8ICK A;  7ICM A;  4XQ7 A;  2PFN A;  4X4U A;  4I28 A;  1JAJ A;  4K98 A;  9ICE A;  4I2I A;  3H37 A;  2ID1 A;  2BCS A;  4KLO A;  2BPC A;  1MIY A;  5D49 A;  4NM2 A;  7ICF A;  4MKP A;  4WC6 A;  1ZQI A;  5DB6 A;  4QZE A;  4DOA A;  4YMM A;  4EP7 A;  3RJI A;  1KEJ A;  4DO9 A;  4GXJ A;  3PNC A;  1KDH A;  1MIV A;  7ICN A;  2DR8 A;  4UB3 A;  1MQ2 A;  5J0Q A;  4PGX A;  4RQ4 A;  8ICE A;  4NLN A;  4KLH A;  5F2V O;  4NXX A;  3AQM A;  1ZQL A;  2BCQ A;  3GDX A;  4OAG A;  4QZ8 A;  4RT2 A;  5HC9 A;  4JWN A;  2W9M A;  1BPZ A;  5IIN A;  1ZQJ A;  2DRA A;  1RZT A;  1ZQT A;  8ICT A;  2PXI A;  5J0U A;  3RJH A;  4O67 A;  4FHW A;  4LEW A;  4IG8 A;  4R66 A;  5HHI A;  4I27 A;  4M9L A;  4K97 A;  4PGQ A;  4QZA A;  2PFP A;  1NOM A;  4KLI A;  4M0A A;  5DDM A;  8ICH A;  4R63 A;  9ICJ A;  4QZI A;  1UEU A;  1PX5 A;  4KLL A;  4O5E A;  4UD4 A;  1BPE A;  4Z6F A;  4RQ7 A;  4WOY A;  8ICJ A;  4QZ9 A;  5DBB A;  4JLX A;  4WC1 A;  1ZQD A;  8ICU A;  2HHP A;  7ICQ A;  4AT8 A;  5J2G A;  4MFA A;  4RQ5 A;  1XSL A;  9ICF A;  9ICX A;  5IIO A;  3ISD A;  4K4I A;  1YLQ A;  1ZQP A;  7ICV A;  1TFY A;  4Z6C A;  4P4M A;  7ICK A;  1ZQC A;  2I9G A;  1BPD A;  3K75 D;  3OV7 A;  2BE3 A;  9ICG A;  2DRB A;  4X5V A;  4PHA A;  3OVB A;  4X4P A;  3HJ4 A;  4M47 A;  4M9H A;  4X4S A;  8ICV A;  2DR5 A;  3H39 A;  4O6A A;  4KLS A;  9ICO A;  3TFR A;  5DB8 A;  4UAY A;  4UD5 A;  3RH4 A;  9ICS A;  4NXT A;  4LEY A;  4XRH A;  4FHP A;  1ZQW A;  4RT3 A;  1ZQG A;  4F5P A;  5EOZ A;  4LEV A;  2IHM A;  5CA7 A;  1Q78 A;  4JLZ A;  5J0R A;  7ICR A;  5CWR A;  4QZF A;  1HUO A;  4KLF A;  8ICC A;  1ZQB A;  4TUP A;  4KLT A;  5D46 A;  4E80 A;  2FMP A;  4NXV A;  3RH5 A;  2ZH7 A;  4QZD A;  1R89 A;  3OUY A;  3NYB A;  4UB2 A;  5BPC A;  1VJ7 A;  3ISC A;  3C5G A;  4F5Q A;  4FHY A;  3C5F A;  1R8C A;  5TZV A;  4OAF A;  2ZH9 A;  4RWO A;  5HHH A;  2Q66 A;  4UB1 A;  4M04 A;  4WC4 A;  2M2T A;  4WC5 A;  3L9D A;  2FMS A;  4I29 A;  5HRH A;  4NY8 A;  4KLQ A;  1XSN A;  4LT6 A;  2GWS A;  2RFF A;  2BPG A;  4NXW A;  4WBY A;  4EBJ A;  5IIK A;  2DR7 A;  4AT7 B;  4RQ6 A;  4FH5 A;  4WC2 A;  4NKT A;  9ICU A;  1VFG A;  3OUY B;  2O5A A;  4UB5 A;  4FHV A;  1ZQX A;  3WFP A;  4GXI A;  3AU6 A;  4MF8 A;  4K9B A;  5HRL A;  4I2G A;  4NM1 A;  9ICI A;  5D4B A;  4TUR A;  4KLG A;  4YMN A;  5HRG A;  5IIM A;  7ICL A;  3UXN A;  4MF2 A;  9ICT A;  1JMS A;  4O5K A;  4RWP A;  4UBB A;  3TFS A;  4IQU A;  4KLM A;  4I2A A;  7ICE A;  2FMQ A;  7ICH A;  5HRE A;  1TV9 A;  4R64 A;  2ZH6 A;  4LZD A;  3V7J A;  2P66 A;  4KLJ A;  3OVS A;  2BCV A;  2ISO A;  4Z6D A;  3C2L A;  4WC3 A;  8ICQ A;  1MQ3 A;  4E7X A;  5CR0 A;  4FHX A;  3AQN A;  4X4Q A;  4XUS A;  4I2D A;  4WCW A;  7ICG A;  5HRF A;  3C2M A;  4LVS A;  9ICV A;  4K9A A;  3LQC B;  4RPY A;  8ICP A;  1V4A A;  1ZQM A;  4P4O A;  3HJ1 A;  3OGU A;  4WBZ A;  5J29 A;  1ZQS A;  7ICT A;  1RPL A;  3HWT A;  9ICB A;  2ZH5 A;  5J0X A;  3JZ0 A;  3HX0 A;  9ICK A;  1ZQE A;  4WC7 A;  4S3N A;  3H3A A;  4OAH A;  4X0A A;  4K8V A;  4K99 A;  4RWQ A;  1ZQO A;  4QZB A;  8ICY A;  1ZQN A;  3AU2 A;  5J0W A;  3JPR A;  4M9G A;  2O1P A;  4TUS A;  4WC0 A;  2B51 A;  5J0O A;  4X4N A;  2VAN A;  5J2H A;  4PHP A;  3ISB A;  7ICO A;  9ICR A;  5DB7 A;  3JPN A;  2PFO A;  4PPX A;  2ISP A;  2PBE A;  2M2W A;  1ZQA A;  3JPQ A;  4RPX A;  9ICH A;  4AT7 A;  4X4O A;  1Q79 A;  1R8A A;  4NLZ A;  1JN3 A;  4M9J A;  3MDC A;  4K4G A;  3RJK A;  2ZH8 A;  1ZQF A;  3H38 A;  3MDA A;  3V7K A;  5CHG A;  4JWM A;  5BOM A;  1ZQY A;  1F5A A;  4QZG A;  5DBA A;  4PH5 A;  2ZH1 A;  3RJF A;  1ZQQ A;  4XA5 A;  4YD1 A;  4E8F A;  3WFS C;  4K4H A;  5DBC A;  4M5D A;  3WFR E;  4RQ3 A;  9ICA A;  7ICI A;  1R8B A;  5J0Y A;  5DED A;  5HRI A;  4IQW A;  4PHE A;  1ZQK A;  3RH6 A;  1TFW A;  5HR9 A;  5J2J A;  7ICJ A;  1JQR A;  4P4P A;  3C2K A;  4KM5 A;  2ZHA A;  8ICX A;  4RQ8 A;  3JYY A;  4UBC A;  1ZQR A;  4TUQ A;  4M9N A;  5J2F A;  9ICN A;  3PML A;  8ICI A;  4FH3 A;  3V7L A;  4PHD A;  1FA0 A;  1XSP A;  4O9M A;  4RQ1 A;  4K96 A;  4NKU A;  4F5N A;  4KLE A;  4QZC A;  3MGI A;  4LZG A;  4UAZ A;  3UPS A;  1BPB A;  3LK9 A;  5J2I A;  1BPX A;  9ICC A;  3JPS A;  5J0S A;  3PMN A;  2M2U A;  5J2K A;  7ICP A;  8ICF A;  5IIJ A;  2M2V A;  3WFQ E;  4NXU A;  1WOT A;  1ZQV A;  5DDY A;  8ICN A;  8ICS A;  1BPY A;  5J2C A;  3AQK A;  8ICO A;  4DOC A;  2NRK A;  4IQT A;  4M2Y A;  1UEV A;  9ICP A;  5CJ7 A;  3UXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...