4AT9A

Crystal structure of the nf90-nf45 dimerisation domain complex with utp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
332
Chain Sequence
GSHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNRQPLALNVYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords INTERLEUKIN ENHANCER-BINDING FACTOR 2
total genus 99
structure length 332
sequence length 335
ec nomenclature
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07528 DZF DZF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4at9A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4at9A02
4I2HA 3JPPA 2BPFA 8ICUA 5J0PA 4RPZA 4AT7A 1BPDA 8ICOA 7ICOA 4F5PA 4X5VA 4NXWA 1ZQWA 5BPCA 3MDCA 4FH3A 3HX0A 1HUOA 4QZHA 4NM2A 4WC6A 2M2WA 4E7XA 5DBAA 3B0YA 2ZHAA 4I2FA 4AT9A 4RWOA 4Z6EA 4Z6FA 3RJHA 5J0UA 1BPZA 7ICKA 2BCQA 8ICJA 1ZQJA 3AUOA 3RJGA 4KLGA 4I2IA 1UEVA 5HHHA 4RQ8A 4O5CA 4K8VA 1R8CA 3MDAA 3MGIA 4KLOA 1Q79A 4IQTA 3TFSA 1ZQXA 3V7JA 4M9NA 3RJEA 5J2AA 4JWNA 4WC0A 5BOLA 5DKWA 4X4QA 8ICGA 4M2YA 1ZQYA 3LK9A 4S3NA 2BCVA 5DB8A 5HRIA 5CB1A 2ZH7A 4UD5A 4KLJA 4M47A 1HUZA 4K4IA 2ZH5A 4I2JA 4E80A 4YCXA 4PGQA 5CHGA 5J0WA 2PFPA 4NKTA 3OVSA 4Z6CA 4K4HA 4RQ6A 2FMPA 5J2DA 4RQ3A 4M0AA 5IINA 4O9MA 1YLQA 2ZH6A 4X4OA 3WFQE 4O69A 1R8AA 5IIOA 4YMNA 3UXOA 4NXZA 4RWQA 2VANA 4NKUA 3L9DA 5DB7A 1TVAA 4MF8A 3WFPA 3C5FA 2RFFA 4XRHA 5J0TA 3OUYB 3JPRA 4XQ7A 5HRGA 5J2KA 2GWSA 8ICFA 4UB5A 4K96A 2HHPA 4YMOA 4PHPA 1ZQAA 7ICLA 1ZQLA 4IQWA 4QZGA 8ICYA 4LEYA 4M9GA 4O68A 3UPSA 7ICQA 4WOYA 4O67A 3HW8A 9ICXA 4KLLA 1FA0A 4OAIZ 4UAZA 5DB9A 3JPQA 4PGXA 4WC2A 8ICWA 8ICQA 2DR9A 4P4PA 4O5EA 4AT7B 3PMLA 5J2GA 2BCRA 2ZH4A 2BCUA 4XUSA 8ICSA 1ZQIA 8ICIA 2PFQA 2DR8A 4RPXA 1ZQEA 4NLNA 1V4AA 9ICSA 5CWRA 4QZFA 4QZ8A 4X4TA 4FHWA 4RWPA 9ICBA 3H38A 1ZQZA 2FMSA 3AQNA 7ICGA 5HRDA 1TFYA 5J0QA 4YMMA 9ICKA 4KLSA 7ICNA 5DB6A 9ICEA 4WC3A 9ICLA 1ZQDA 2ID1A 1ZQBA 2W9MA 1MQ2A 5DDYA 4I2BA 4M9JA 4KLEA 3ISCA 3UPQA 8ICNA 4PGYA 1JN3A 4P4OA 8ICHA 1TFWA 4FHVA 8ICBA 4Z6DA 2M2TA 4K9BA 4X0BA 3MGHA 4UB3A 1ZQSA 4KLMA 3OV7A 3HIYA 2ZH9A 9ICHA 7ICRA 3WFSC 5DEDA 5J0YA 2DR5A 3WFRE 4LVSA 1ZQOA 4LZDA 3V72A 1ZJMA 4I2GA 4F5OA 5J2BA 4K4GA 2Q66A 4UB1A 4QZCA 3JZ0A 8ICZA 2PBEA 5IIMA 4K99A 2ZH8A 9ICWA 4JLXA 3H39A 4K98A 4RQ1A 4YD2A 1VJ7A 4AT9B 4DOCA 1KDHA 7ICSA 4F5QA 4XA5A 4TUSA 3C2LA 1UETA 5J2EA 4FHXA 5J0RA 4UB2A 4TUPA 4R65A 4PPXA 1ZQNA 4O5KA 1RZTA 8ICAA 4X4RA 2M2UA 4KLQA 1ZQKA 4TUQA 4KLIA 3WFOA 3H37A 1ZQTA 3OVAA 4RPYA 1TV9A 4RT3A 4KB6A 9ICMA 5IIKA 4MFAA 4MF2A 5HRBA 1RPLA 4QZIA 1MIYA 4TURA 3UXPA 5IIIA 3JPSA 9ICRA 4IQUA 3UXNA 4EP7A 1BPBA 3JPOA 4UAWA 1XSNA 1ZQHA 4RT2A 9ICTA 4QZAA 7ICIA 4EBJA 2ISPA 4ATBA 1BPXA 5J2CA 4RQ5A 3C18A 4OAFA 4XQ8A 9ICNA 4M04A 3B0XA 3RJFA 4O6AA 3ISDA 5TZVA 4R64A 5DDMA 4I28A 3AU2A 9ICAA 7ICVA 5J2HA 7ICJA 4KLUA 5D46A 5HRFA 3JYYA 1NO5A 2O5AA 5J0OA 8ICCA 7ICEA 4M9HA 4X4SA 3C2KA 3LQCB 1BPYA 5HHIA 3ISBA 4X4NA 2ZH1A 5J0SA 3PNCA 3K75D 1PX5A 2DR7A 9ICQA 4F5RA 4GXIA 1VFGA 1WOTA 4I2CA 1JQRA 9ICVA 5HRKA 5BOMA 1KEJA 3AQMA 7ICPA 4IG8A 2BCSA 5DBCA 1JMSA 1ZQMA 5HRLA 2BE3A 5F2VO 3JPTA 2I9GA 2ZH3A 5J0XA 1MIWA 8ICLA 1ZQPA 2FMQA 4MKPA 2DRBA 8ICRA 1MIVA 4WBYA 4E8FA 3RH4A 4NXXA 9ICIA 4PHDA 5CR0A 3UQ0A 4ATBB 4GXJA 4K97A 4OAHA 5HC9A 1JAJA 1UEUA 2DRAA 5HREA 3RJKA 5D49A 4PH5A 4WC4A 4I2AA 3AU6A 3MBYA 4FO6A 3V7KA 8ICXA 1ZQFA 4FHPA 4KLDA 3RJJA 8ICMA 4NLKA 4I29A 1XSPA 3RJIA 1ZJNA 5CP2A 4WC5A 4NXVA 5HRHA 4NY8A 3PMNA 4NXTA 4DOAA 4AT8A 4UAYA 5HR9A 5J2IA 4MFCA 8ICTA 4EBKA 2PXIA 4PHAA 4WC7A 4QZ9A 4F5NA 9ICCA 4LEZA 4RQ2A 4GXKA 3AQKA 3C2MA 7ICTA 2BPCA 4I2EA 1MQ3A 4NLZA 7ICFA 3JPNA 4R63A 2BPGA 8ICPA 4I27A 4P4MA 5IIJA 7ICMA 9ICUA 5DBBA 4RWNA 4AT8B 2O1PA 4M9LA 9ICFA 4RQ7A 3RH6A 2PFOA 1KNYA 1NOMA 4X4VA 5IILA 3NYBA 4IQVA 1R89A 3GDXA 5D4BA 2IHMA 8ICVA 1ZQCA 3TFRA 4WC1A 4LEVA 4UBCA 7ICUA 4P2HA 3UQ2A 1R8BA 4YN4A 1F5AA 3C5GA 4JLZA 4DOBA 1ZQVA 3RH5A 5EOZA 1Q78A 4X4UA 4LZGA 4LT6A 4DO9A 9ICJA 3C66A 4X4PA 3HJ1A 4KLTA 4NXUA 2ISOA 4RQ0A 4UD4A 2NRKA 8ICEA 4KLFA 9ICGA 3AQLA 1BPEA 4NM1A 5J2JA 4KLHA 5CA7A 4JWMA 4R66A 2P66A 4UB4A 4K9AA 9ICPA 4FH5A 4RQ4A 1ZQRA 3OUYA 4KM5A 4LEWA 4UBBA 4X0AA 4YD1A 4QZDA 1ZQGA 2ZH2A 1XSLA 4MFFA 3OVBA 4QZBA 4WCWA 1OU5A 2DVIA 7ICHA 4WBZA 4I2DA 9ICOA 4QZEA 5DECA 1ZQQA 5J29A 8ICKA 4FHYA 5J2FA 2ZHBA 2M2VA 3HWTA 4PHEA 3V7LA 3OGUA 2PFNA 4OAGA 3HJ4A 1ZQUA 4M5DA 3H3AA 5CJ7A
chains in the Genus database with same CATH superfamily
4I2HA 3JPPA 2BPFA 8ICUA 5J0PA 4RPZA 5JTGA 4AT7A 1BPDA 8ICOA 7ICOA 4F5PA 4X5VA 4NXWA 1ZQWA 5BPCA 3MDCA 4FH3A 3HX0A 1HUOA 4QZHA 4NM2A 2IHOA 4WC6A 2M2WA 4E7XA 5DBAA 3B0YA 2ZHAA 4I2FA 4AT9A 4RWOA 4Z6EA 4Z6FA 3RJHA 5J0UA 1BPZA 7ICKA 2BCQA 8ICJA 1ZQJA 3AUOA 3RJGA 4KLGA 3MCRA 4I2IA 1UEVA 5HHHA 4RQ8A 4O5CA 4K8VA 1R8CA 3MDAA 3MGIA 4KLOA 1Q79A 4IQTA 4HX0A 3TFSA 1ZQXA 3V7JA 4M9NA 3RJEA 5J2AA 4JWNA 4WC0A 5BOLA 5DKWA 4X4QA 8ICGA 4M2YA 1ZQYA 3LK9A 4S3NA 2BCVA 3ER9B 5DB8A 5HRIA 5CB1A 2ZH7A 4UD5A 4KLJA 4M47A 5B3QA 1HUZA 4K4IA 2ZH5A 4I2JA 2EWRA 4E80A 4YCXA 4PGQA 5CHGA 5J0WA 2PFPA 4NKTA 3OVSA 4Z6CA 4K4HA 4EV6A 4RQ6A 2FMPA 5J2DA 4RQ3A 4M0AA 5IINA 4O9MA 1YLQA 2ZH6A 4X4OA 3WFQE 1R8AA 4O69A 4YMNA 3UXOA 4NXZA 5IIOA 4RWQA 1GPJA 2VANA 4N7RA 4NKUA 3L9DA 5DB7A 1TVAA 4MF8A 3WFPA 3C5FA 2RFFA 4XRHA 2IUBA 3OUYB 5J0TA 3JPRA 4XQ7A 5HRGA 5J2KA 2GWSA 8ICFA 4UB5A 4K96A 2HHPA 4YMOA 4PHPA 1ZQAA 3PHZA 7ICLA 1ZQLA 4IQWA 4QZGA 8ICYA 4LEYA 4M9GA 4O68A 3UPSA 7ICQA 4WOYA 4O67A 3HW8A 9ICXA 4KLLA 1FA0A 5CFTA 4OAIZ 4UAZA 5DB9A 3JPQA 4PGXA 4WC2A 8ICWA 8ICQA 2DR9A 4P4PA 4O5EA 4AT7B 3PMLA 5J2GA 2BCRA 2ZH4A 2BCUA 4XUSA 8ICSA 1ZQIA 8ICIA 2PFQA 2DR8A 4RPXA 1ZQEA 4NLNA 1V4AA 9ICSA 3CK6A 5CWRA 4X4TA 4QZ8A 4QZFA 4FHWA 4RWPA 9ICBA 3H38A 1ZQZA 2BBJA 2FMSA 3AQNA 7ICGA 5HRDA 1TFYA 5J0QA 4YMMA 9ICKA 4KLSA 7ICNA 5DB6A 9ICEA 4WC3A 9ICLA 1ZQDA 2ID1A 3JCFA 4XJEA 1ZQBA 2W9MA 1MQ2A 5DDYA 4I2BA 4M9JA 4KLEA 3ISCA 3UPQA 8ICNA 4PGYA 1JN3A 4P4OA 8ICHA 1TFWA 2B56A 4FHVA 8ICBA 4Z6DA 2M2TA 4K9BA 4X0BA 3MGHA 4UB3A 1ZQSA 4KLMA 4I0UA 3OV7A 3HIYA 2ZH9A 9ICHA 7ICRA 3WFSC 5DEDA 4WQKA 2DR5A 5J0YA 3WFRE 4LVSA 1ZQOA 4LZDA 3V72A 1ZJMA 4I2GA 4F5OA 5J2BA 5CFSA 4K4GA 2Q66A 4UB1A 4QZCA 3JZ0A 8ICZA 2PBEA 5IIMA 4K99A 2ZH8A 9ICWA 4JLXA 3H39A 4K98A 4RQ1A 4WH5A 4YD2A 1VJ7A 4AT9B 4DOCA 1KDHA 7ICSA 4F5QA 4XA5A 2HN1A 4TUSA 3C2LA 1UETA 5J2EA 4FHXA 5J0RA 4UB2A 4TUPA 4R65A 4PPXA 1ZQNA 4O5KA 1RZTA 8ICAA 4X4RA 2M2UA 2GAFD 4FO1A 4KLQA 1ZQKA 4TUQA 4KLIA 3WFOA 2B4VA 3H37A 3OWGA 1ZQTA 3OVAA 4RPYA 1TV9A 4RT3A 4KB6A 9ICMA 5IIKA 4MFAA 4MF2A 5HRBA 1RPLA 4QZIA 1MIYA 4TURA 3UXPA 5IIIA 3JPSA 9ICRA 2GA9D 4IQUA 3UXNA 4EP7A 1BPBA 3JPOA 4UAWA 1XSNA 1ZQHA 4RT2A 9ICTA 4QZAA 3ER8C 7ICIA 4EBJA 5CHEA 5D62A 2ISPA 4ATBA 1BPXA 5J2CA 4RQ5A 3C18A 4OAFA 4XQ8A 9ICNA 4M04A 3B0XA 3RJFA 4O6AA 3ISDA 5TZVA 4R64A 5DDMA 4I28A 3AU2A 9ICAA 7ICVA 5J2HA 7ICJA 4KLUA 5D46A 5HRFA 3JYYA 1NO5A 2O5AA 5J0OA 8ICCA 7ICEA 4M9HA 4X4SA 3C2KA 3ERCC 3LQCB 1BPYA 5HHIA 2B51A 3ISBA 4X4NA 2ZH1A 5J0SA 3PNCA 3K75D 1PX5A 2DR7A 5D63A 9ICQA 4F5RA 4GXIA 1VFGA 1WOTA 4I2CA 1JQRA 9ICVA 4EEBA 5HRKA 5BOMA 1KEJA 3AQMA 7ICPA 4IG8A 2BCSA 5DBCA 1JMSA 1ZQMA 5HRLA 2BE3A 5F2VO 2BBHA 3JPTA 2I9GA 2ZH3A 5J0XA 1MIWA 8ICLA 1ZQPA 2FMQA 4MKPA 2DRBA 8ICRA 1MIVA 4E8FA 4WBYA 3RH4A 4NXXA 9ICIA 4PHDA 2FCLA 5CR0A 3UQ0A 4ATBB 4GXJA 4K97A 4OAHA 5HC9A 2HN2A 1JAJA 1UEUA 2DRAA 5HREA 3RJKA 5D49A 5B3PA 4PH5A 4WC4A 4I2AA 3AU6A 3MBYA 4FO6A 3V7KA 8ICXA 1ZQFA 4FHPA 4KLDA 5CFUA 3RJJA 8ICMA 3K7DA 4NLKA 4I29A 1XSPA 3RJIA 1ZJNA 5CP2A 4WC5A 4NXVA 5HRHA 4NY8A 3PMNA 4NXTA 4DOAA 4AT8A 4UAYA 5HR9A 5J2IA 4MFCA 8ICTA 4EBKA 2PXIA 4PHAA 4WC7A 4QZ9A 4F5NA 9ICCA 4LEZA 4RQ2A 4GXKA 3AQKA 3C2MA 7ICTA 5D61A 2BPCA 4I2EA 1MQ3A 4NLZA 7ICFA 3JPNA 4R63A 2BPGA 8ICPA 4I27A 4P4MA 5IIJA 7ICMA 9ICUA 5DBBA 4RWNA 4AT8B 2O1PA 4M9LA 4WQLA 9ICFA 4EGWA 4RQ7A 3RH6A 4X4VA 1KNYA 1NOMA 2PFOA 5IILA 3NYBA 4IQVA 1R89A 3GDXA 5D4BA 2IHMA 8ICVA 4EEDA 1ZQCA 3TFRA 4WC1A 3NVOA 4LEVA 4UBCA 7ICUA 4P2HA 3UQ2A 1R8BA 4YN4A 1F5AA 3C5GA 4JLZA 4DOBA 1ZQVA 3RH5A 4X4UA 1Q78A 5EOZA 4LZGA 4LT6A 4DO9A 9ICJA 3C66A 3HJ1A 4X4PA 4KLTA 4NXUA 2ISOA 4RQ0A 4UD4A 2NRKA 8ICEA 4KLFA 9ICGA 3AQLA 1BPEA 4NM1A 5J2JA 4KLHA 5CA7A 4JWMA 4R66A 2P66A 4UB4A 4K9AA 3NKUA 9ICPA 4FH5A 4RQ4A 1ZQRA 3OUYA 4KM5A 4LEWA 4UBBA 4X0AA 4YD1A 4QZDA 1ZQGA 3NWIA 2ZH2A 3EF2A 3OVBA 1XSLA 4MFFA 4QZBA 4WCWA 1OU5A 2DVIA 7ICHA 4WBZA 4I2DA 9ICOA 4QZEA 5DECA 1ZQQA 5J29A 8ICKA 4FHYA 2ZHBA 5J2FA 2M2VA 3HWTA 4PHEA 3V7LA 3OGUA 2PFNA 4OAGA 3HJ4A 1ZQUA 4M5DA 3H3AA 5CJ7A
chains in the Genus database with same CATH topology
4I2HA 3JPPA 2BPFA 8ICUA 5J0PA 4RPZA 4AT7A 1BPDA 8ICOA 7ICOA 4F5PA 4X5VA 4NXWA 1ZQWA 5BPCA 3MDCA 4FH3A 3HX0A 1HUOA 4QZHA 4NM2A 4WC6A 2M2WA 4E7XA 5DBAA 3B0YA 2ZHAA 4I2FA 4AT9A 4RWOA 4Z6EA 4Z6FA 3RJHA 5J0UA 1BPZA 7ICKA 2BCQA 8ICJA 1ZQJA 3AUOA 3RJGA 4KLGA 4I2IA 1UEVA 5HHHA 4RQ8A 4O5CA 4K8VA 1R8CA 3MDAA 3MGIA 4KLOA 1Q79A 4IQTA 3TFSA 1ZQXA 3V7JA 4M9NA 3RJEA 5J2AA 4JWNA 4WC0A 5BOLA 5DKWA 4X4QA 8ICGA 4M2YA 1ZQYA 3LK9A 4S3NA 2BCVA 5DB8A 5HRIA 5CB1A 2ZH7A 4UD5A 4KLJA 4M47A 1HUZA 4K4IA 2ZH5A 4I2JA 4E80A 4YCXA 4PGQA 5CHGA 5J0WA 2PFPA 4NKTA 3OVSA 4Z6CA 4K4HA 4RQ6A 2FMPA 5J2DA 4RQ3A 4M0AA 5IINA 4O9MA 1YLQA 2ZH6A 4X4OA 3WFQE 1R8AA 4O69A 5IIOA 4YMNA 4NXZA 3UXOA 4RWQA 2VANA 4NKUA 3L9DA 5DB7A 1TVAA 4MF8A 3WFPA 3C5FA 2RFFA 4XRHA 3OUYB 5J0TA 3JPRA 4XQ7A 5HRGA 5J2KA 2GWSA 8ICFA 4UB5A 4K96A 2HHPA 4YMOA 4PHPA 1ZQAA 7ICLA 1ZQLA 4IQWA 4QZGA 8ICYA 4LEYA 4M9GA 4O68A 3UPSA 7ICQA 4WOYA 4O67A 3HW8A 9ICXA 4KLLA 1FA0A 4OAIZ 4UAZA 5DB9A 3JPQA 4PGXA 4WC2A 8ICWA 8ICQA 2DR9A 4P4PA 4O5EA 4AT7B 3PMLA 5J2GA 2BCRA 2ZH4A 2BCUA 4XUSA 8ICSA 1ZQIA 8ICIA 2PFQA 2DR8A 4RPXA 1ZQEA 4NLNA 1V4AA 9ICSA 5CWRA 4X4TA 4QZ8A 4QZFA 4FHWA 4RWPA 9ICBA 3H38A 1ZQZA 2FMSA 3AQNA 7ICGA 5HRDA 1TFYA 5J0QA 4YMMA 9ICKA 4KLSA 7ICNA 5DB6A 9ICEA 4WC3A 9ICLA 1ZQDA 2ID1A 1ZQBA 2W9MA 1MQ2A 5DDYA 4I2BA 4M9JA 4KLEA 3ISCA 3UPQA 8ICNA 4PGYA 1JN3A 4P4OA 8ICHA 1TFWA 2B56A 4FHVA 8ICBA 4Z6DA 2M2TA 4K9BA 4X0BA 3MGHA 4UB3A 1ZQSA 4KLMA 3OV7A 3HIYA 2ZH9A 9ICHA 7ICRA 3WFSC 5DEDA 5J0YA 2DR5A 3WFRE 4LVSA 1ZQOA 4LZDA 3V72A 1ZJMA 4I2GA 4F5OA 5J2BA 4K4GA 2Q66A 4UB1A 4QZCA 3JZ0A 8ICZA 2PBEA 5IIMA 4K99A 2ZH8A 9ICWA 4JLXA 3H39A 4K98A 4RQ1A 4YD2A 1VJ7A 4AT9B 4DOCA 1KDHA 7ICSA 4F5QA 4XA5A 4TUSA 3C2LA 1UETA 5J2EA 4FHXA 5J0RA 4UB2A 4TUPA 4R65A 4PPXA 1ZQNA 4O5KA 1RZTA 8ICAA 4X4RA 2M2UA 4KLQA 1ZQKA 4TUQA 4KLIA 3WFOA 2B4VA 3H37A 1ZQTA 3OVAA 4RPYA 1TV9A 4RT3A 4KB6A 9ICMA 5IIKA 4MFAA 4MF2A 5HRBA 1RPLA 4QZIA 1MIYA 4TURA 3UXPA 5IIIA 3JPSA 9ICRA 4IQUA 3UXNA 4EP7A 1BPBA 3JPOA 4UAWA 1XSNA 1ZQHA 4RT2A 9ICTA 4QZAA 7ICIA 4EBJA 2ISPA 4ATBA 1BPXA 5J2CA 4RQ5A 3C18A 4OAFA 4XQ8A 9ICNA 4M04A 3B0XA 3RJFA 4O6AA 3ISDA 5TZVA 4R64A 5DDMA 4I28A 3AU2A 9ICAA 7ICVA 5J2HA 7ICJA 4KLUA 5D46A 5HRFA 3JYYA 1NO5A 2O5AA 5J0OA 8ICCA 7ICEA 4M9HA 4X4SA 3C2KA 3LQCB 1BPYA 5HHIA 2B51A 3ISBA 4X4NA 2ZH1A 5J0SA 3PNCA 3K75D 1PX5A 2DR7A 9ICQA 4F5RA 4GXIA 1VFGA 1WOTA 4I2CA 1JQRA 9ICVA 5HRKA 5BOMA 1KEJA 3AQMA 7ICPA 4IG8A 2BCSA 5DBCA 1JMSA 1ZQMA 5HRLA 2BE3A 5F2VO 3JPTA 2I9GA 2ZH3A 5J0XA 1MIWA 8ICLA 1ZQPA 2FMQA 4MKPA 2DRBA 8ICRA 1MIVA 4E8FA 4WBYA 3RH4A 4NXXA 9ICIA 4PHDA 5CR0A 3UQ0A 4ATBB 4GXJA 4K97A 4OAHA 5HC9A 1JAJA 1UEUA 2DRAA 5HREA 3RJKA 5D49A 4PH5A 4WC4A 4I2AA 3AU6A 3MBYA 4FO6A 3V7KA 8ICXA 1ZQFA 4FHPA 4KLDA 3RJJA 8ICMA 4NLKA 4I29A 1XSPA 3RJIA 1ZJNA 5CP2A 4WC5A 4NXVA 5HRHA 4NY8A 3PMNA 4NXTA 4DOAA 4AT8A 4UAYA 5HR9A 5J2IA 4MFCA 8ICTA 4EBKA 2PXIA 4PHAA 4WC7A 4QZ9A 4F5NA 9ICCA 4LEZA 4RQ2A 4GXKA 3AQKA 3C2MA 7ICTA 2BPCA 4I2EA 1MQ3A 4NLZA 7ICFA 3JPNA 4R63A 2BPGA 8ICPA 4I27A 4P4MA 5IIJA 7ICMA 9ICUA 5DBBA 4RWNA 4AT8B 2O1PA 4M9LA 9ICFA 4RQ7A 3RH6A 4X4VA 1KNYA 1NOMA 2PFOA 5IILA 3NYBA 4IQVA 1R89A 3GDXA 5D4BA 2IHMA 8ICVA 1ZQCA 3TFRA 4WC1A 4LEVA 4UBCA 7ICUA 4P2HA 3UQ2A 1R8BA 4YN4A 1F5AA 3C5GA 4JLZA 4DOBA 1ZQVA 3RH5A 4X4UA 1Q78A 5EOZA 4LZGA 4LT6A 4DO9A 9ICJA 3C66A 3HJ1A 4X4PA 4KLTA 4NXUA 2ISOA 4RQ0A 4UD4A 2NRKA 8ICEA 4KLFA 9ICGA 3AQLA 1BPEA 4NM1A 5J2JA 4KLHA 5CA7A 4JWMA 4R66A 2P66A 4UB4A 4K9AA 9ICPA 4FH5A 4RQ4A 1ZQRA 3OUYA 4KM5A 4LEWA 4UBBA 4X0AA 4YD1A 4QZDA 1ZQGA 2ZH2A 3OVBA 1XSLA 4MFFA 4QZBA 4WCWA 1OU5A 2DVIA 7ICHA 4WBZA 4I2DA 9ICOA 4QZEA 5DECA 1ZQQA 5J29A 8ICKA 4FHYA 2ZHBA 5J2FA 2M2VA 3HWTA 4PHEA 3V7LA 3OGUA 2PFNA 4OAGA 3HJ4A 1ZQUA 4M5DA 3H3AA 5CJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2H A;  3JPP A;  2BPF A;  8ICU A;  5J0P A;  4RPZ A;  4AT7 A;  1BPD A;  8ICO A;  7ICO A;  4F5P A;  4X5V A;  4NXW A;  1ZQW A;  5BPC A;  3MDC A;  4FH3 A;  3HX0 A;  1HUO A;  4QZH A;  4NM2 A;  4WC6 A;  2M2W A;  4E7X A;  5DBA A;  3B0Y A;  2ZHA A;  4I2F A;  4AT9 A;  4RWO A;  4Z6E A;  4Z6F A;  3RJH A;  5J0U A;  1BPZ A;  7ICK A;  2BCQ A;  8ICJ A;  1ZQJ A;  3AUO A;  3RJG A;  4KLG A;  4I2I A;  1UEV A;  5HHH A;  4RQ8 A;  4O5C A;  4K8V A;  1R8C A;  3MDA A;  3MGI A;  4KLO A;  1Q79 A;  4IQT A;  3TFS A;  1ZQX A;  3V7J A;  4M9N A;  3RJE A;  5J2A A;  4JWN A;  4WC0 A;  5BOL A;  5DKW A;  4X4Q A;  8ICG A;  4M2Y A;  1ZQY A;  3LK9 A;  4S3N A;  2BCV A;  5DB8 A;  5HRI A;  5CB1 A;  2ZH7 A;  4UD5 A;  4KLJ A;  4M47 A;  1HUZ A;  4K4I A;  2ZH5 A;  4I2J A;  4E80 A;  4YCX A;  4PGQ A;  5CHG A;  5J0W A;  2PFP A;  4NKT A;  3OVS A;  4Z6C A;  4K4H A;  4RQ6 A;  2FMP A;  5J2D A;  4RQ3 A;  4M0A A;  5IIN A;  4O9M A;  1YLQ A;  2ZH6 A;  4X4O A;  3WFQ E;  4O69 A;  1R8A A;  5IIO A;  4YMN A;  3UXO A;  4NXZ A;  4RWQ A;  2VAN A;  4NKU A;  3L9D A;  5DB7 A;  1TVA A;  4MF8 A;  3WFP A;  3C5F A;  2RFF A;  4XRH A;  5J0T A;  3OUY B;  3JPR A;  4XQ7 A;  5HRG A;  5J2K A;  2GWS A;  8ICF A;  4UB5 A;  4K96 A;  2HHP A;  4YMO A;  4PHP A;  1ZQA A;  7ICL A;  1ZQL A;  4IQW A;  4QZG A;  8ICY A;  4LEY A;  4M9G A;  4O68 A;  3UPS A;  7ICQ A;  4WOY A;  4O67 A;  3HW8 A;  9ICX A;  4KLL A;  1FA0 A;  4OAI Z;  4UAZ A;  5DB9 A;  3JPQ A;  4PGX A;  4WC2 A;  8ICW A;  8ICQ A;  2DR9 A;  4P4P A;  4O5E A;  4AT7 B;  3PML A;  5J2G A;  2BCR A;  2ZH4 A;  2BCU A;  4XUS A;  8ICS A;  1ZQI A;  8ICI A;  2PFQ A;  2DR8 A;  4RPX A;  1ZQE A;  4NLN A;  1V4A A;  9ICS A;  5CWR A;  4QZF A;  4QZ8 A;  4X4T A;  4FHW A;  4RWP A;  9ICB A;  3H38 A;  1ZQZ A;  2FMS A;  3AQN A;  7ICG A;  5HRD A;  1TFY A;  5J0Q A;  4YMM A;  9ICK A;  4KLS A;  7ICN A;  5DB6 A;  9ICE A;  4WC3 A;  9ICL A;  1ZQD A;  2ID1 A;  1ZQB A;  2W9M A;  1MQ2 A;  5DDY A;  4I2B A;  4M9J A;  4KLE A;  3ISC A;  3UPQ A;  8ICN A;  4PGY A;  1JN3 A;  4P4O A;  8ICH A;  1TFW A;  4FHV A;  8ICB A;  4Z6D A;  2M2T A;  4K9B A;  4X0B A;  3MGH A;  4UB3 A;  1ZQS A;  4KLM A;  3OV7 A;  3HIY A;  2ZH9 A;  9ICH A;  7ICR A;  3WFS C;  5DED A;  5J0Y A;  2DR5 A;  3WFR E;  4LVS A;  1ZQO A;  4LZD A;  3V72 A;  1ZJM A;  4I2G A;  4F5O A;  5J2B A;  4K4G A;  2Q66 A;  4UB1 A;  4QZC A;  3JZ0 A;  8ICZ A;  2PBE A;  5IIM A;  4K99 A;  2ZH8 A;  9ICW A;  4JLX A;  3H39 A;  4K98 A;  4RQ1 A;  4YD2 A;  1VJ7 A;  4AT9 B;  4DOC A;  1KDH A;  7ICS A;  4F5Q A;  4XA5 A;  4TUS A;  3C2L A;  1UET A;  5J2E A;  4FHX A;  5J0R A;  4UB2 A;  4TUP A;  4R65 A;  4PPX A;  1ZQN A;  4O5K A;  1RZT A;  8ICA A;  4X4R A;  2M2U A;  4KLQ A;  1ZQK A;  4TUQ A;  4KLI A;  3WFO A;  3H37 A;  1ZQT A;  3OVA A;  4RPY A;  1TV9 A;  4RT3 A;  4KB6 A;  9ICM A;  5IIK A;  4MFA A;  4MF2 A;  5HRB A;  1RPL A;  4QZI A;  1MIY A;  4TUR A;  3UXP A;  5III A;  3JPS A;  9ICR A;  4IQU A;  3UXN A;  4EP7 A;  1BPB A;  3JPO A;  4UAW A;  1XSN A;  1ZQH A;  4RT2 A;  9ICT A;  4QZA A;  7ICI A;  4EBJ A;  2ISP A;  4ATB A;  1BPX A;  5J2C A;  4RQ5 A;  3C18 A;  4OAF A;  4XQ8 A;  9ICN A;  4M04 A;  3B0X A;  3RJF A;  4O6A A;  3ISD A;  5TZV A;  4R64 A;  5DDM A;  4I28 A;  3AU2 A;  9ICA A;  7ICV A;  5J2H A;  7ICJ A;  4KLU A;  5D46 A;  5HRF A;  3JYY A;  1NO5 A;  2O5A A;  5J0O A;  8ICC A;  7ICE A;  4M9H A;  4X4S A;  3C2K A;  3LQC B;  1BPY A;  5HHI A;  3ISB A;  4X4N A;  2ZH1 A;  5J0S A;  3PNC A;  3K75 D;  1PX5 A;  2DR7 A;  9ICQ A;  4F5R A;  4GXI A;  1VFG A;  1WOT A;  4I2C A;  1JQR A;  9ICV A;  5HRK A;  5BOM A;  1KEJ A;  3AQM A;  7ICP A;  4IG8 A;  2BCS A;  5DBC A;  1JMS A;  1ZQM A;  5HRL A;  2BE3 A;  5F2V O;  3JPT A;  2I9G A;  2ZH3 A;  5J0X A;  1MIW A;  8ICL A;  1ZQP A;  2FMQ A;  4MKP A;  2DRB A;  8ICR A;  1MIV A;  4WBY A;  4E8F A;  3RH4 A;  4NXX A;  9ICI A;  4PHD A;  5CR0 A;  3UQ0 A;  4ATB B;  4GXJ A;  4K97 A;  4OAH A;  5HC9 A;  1JAJ A;  1UEU A;  2DRA A;  5HRE A;  3RJK A;  5D49 A;  4PH5 A;  4WC4 A;  4I2A A;  3AU6 A;  3MBY A;  4FO6 A;  3V7K A;  8ICX A;  1ZQF A;  4FHP A;  4KLD A;  3RJJ A;  8ICM A;  4NLK A;  4I29 A;  1XSP A;  3RJI A;  1ZJN A;  5CP2 A;  4WC5 A;  4NXV A;  5HRH A;  4NY8 A;  3PMN A;  4NXT A;  4DOA A;  4AT8 A;  4UAY A;  5HR9 A;  5J2I A;  4MFC A;  8ICT A;  4EBK A;  2PXI A;  4PHA A;  4WC7 A;  4QZ9 A;  4F5N A;  9ICC A;  4LEZ A;  4RQ2 A;  4GXK A;  3AQK A;  3C2M A;  7ICT A;  2BPC A;  4I2E A;  1MQ3 A;  4NLZ A;  7ICF A;  3JPN A;  4R63 A;  2BPG A;  8ICP A;  4I27 A;  4P4M A;  5IIJ A;  7ICM A;  9ICU A;  5DBB A;  4RWN A;  4AT8 B;  2O1P A;  4M9L A;  9ICF A;  4RQ7 A;  3RH6 A;  2PFO A;  1KNY A;  1NOM A;  4X4V A;  5IIL A;  3NYB A;  4IQV A;  1R89 A;  3GDX A;  5D4B A;  2IHM A;  8ICV A;  1ZQC A;  3TFR A;  4WC1 A;  4LEV A;  4UBC A;  7ICU A;  4P2H A;  3UQ2 A;  1R8B A;  4YN4 A;  1F5A A;  3C5G A;  4JLZ A;  4DOB A;  1ZQV A;  3RH5 A;  5EOZ A;  1Q78 A;  4X4U A;  4LZG A;  4LT6 A;  4DO9 A;  9ICJ A;  3C66 A;  4X4P A;  3HJ1 A;  4KLT A;  4NXU A;  2ISO A;  4RQ0 A;  4UD4 A;  2NRK A;  8ICE A;  4KLF A;  9ICG A;  3AQL A;  1BPE A;  4NM1 A;  5J2J A;  4KLH A;  5CA7 A;  4JWM A;  4R66 A;  2P66 A;  4UB4 A;  4K9A A;  9ICP A;  4FH5 A;  4RQ4 A;  1ZQR A;  3OUY A;  4KM5 A;  4LEW A;  4UBB A;  4X0A A;  4YD1 A;  4QZD A;  1ZQG A;  2ZH2 A;  1XSL A;  4MFF A;  3OVB A;  4QZB A;  4WCW A;  1OU5 A;  2DVI A;  7ICH A;  4WBZ A;  4I2D A;  9ICO A;  4QZE A;  5DEC A;  1ZQQ A;  5J29 A;  8ICK A;  4FHY A;  5J2F A;  2ZHB A;  2M2V A;  3HWT A;  4PHE A;  3V7L A;  3OGU A;  2PFN A;  4OAG A;  3HJ4 A;  1ZQU A;  4M5D A;  3H3A A;  5CJ7 A; 
#chains in the Genus database with same CATH topology
 4I2H A;  3JPP A;  2BPF A;  8ICU A;  5J0P A;  4RPZ A;  5JTG A;  4AT7 A;  1BPD A;  8ICO A;  7ICO A;  4F5P A;  4X5V A;  4NXW A;  1ZQW A;  5BPC A;  3MDC A;  4FH3 A;  3HX0 A;  1HUO A;  4QZH A;  4NM2 A;  2IHO A;  4WC6 A;  2M2W A;  4E7X A;  5DBA A;  3B0Y A;  2ZHA A;  4I2F A;  4AT9 A;  4RWO A;  4Z6E A;  4Z6F A;  3RJH A;  5J0U A;  1BPZ A;  7ICK A;  2BCQ A;  8ICJ A;  1ZQJ A;  3AUO A;  3RJG A;  4KLG A;  3MCR A;  4I2I A;  1UEV A;  5HHH A;  4RQ8 A;  4O5C A;  4K8V A;  1R8C A;  3MDA A;  3MGI A;  4KLO A;  1Q79 A;  4IQT A;  4HX0 A;  3TFS A;  1ZQX A;  3V7J A;  4M9N A;  3RJE A;  5J2A A;  4JWN A;  4WC0 A;  5BOL A;  5DKW A;  4X4Q A;  8ICG A;  4M2Y A;  1ZQY A;  3LK9 A;  4S3N A;  2BCV A;  3ER9 B;  5DB8 A;  5HRI A;  5CB1 A;  2ZH7 A;  4UD5 A;  4KLJ A;  4M47 A;  5B3Q A;  1HUZ A;  4K4I A;  2ZH5 A;  4I2J A;  2EWR A;  4E80 A;  4YCX A;  4PGQ A;  5CHG A;  5J0W A;  2PFP A;  4NKT A;  3OVS A;  4Z6C A;  4K4H A;  4EV6 A;  4RQ6 A;  2FMP A;  5J2D A;  4RQ3 A;  4M0A A;  5IIN A;  4O9M A;  1YLQ A;  2ZH6 A;  4X4O A;  3WFQ E;  1R8A A;  4O69 A;  4YMN A;  3UXO A;  4NXZ A;  5IIO A;  4RWQ A;  1GPJ A;  2VAN A;  4N7R A;  4NKU A;  3L9D A;  5DB7 A;  1TVA A;  4MF8 A;  3WFP A;  3C5F A;  2RFF A;  4XRH A;  2IUB A;  3OUY B;  5J0T A;  3JPR A;  4XQ7 A;  5HRG A;  5J2K A;  2GWS A;  8ICF A;  4UB5 A;  4K96 A;  2HHP A;  4YMO A;  4PHP A;  1ZQA A;  3PHZ A;  7ICL A;  1ZQL A;  4IQW A;  4QZG A;  8ICY A;  4LEY A;  4M9G A;  4O68 A;  3UPS A;  7ICQ A;  4WOY A;  4O67 A;  3HW8 A;  9ICX A;  4KLL A;  1FA0 A;  5CFT A;  4OAI Z;  4UAZ A;  5DB9 A;  3JPQ A;  4PGX A;  4WC2 A;  8ICW A;  8ICQ A;  2DR9 A;  4P4P A;  4O5E A;  4AT7 B;  3PML A;  5J2G A;  2BCR A;  2ZH4 A;  2BCU A;  4XUS A;  8ICS A;  1ZQI A;  8ICI A;  2PFQ A;  2DR8 A;  4RPX A;  1ZQE A;  4NLN A;  1V4A A;  9ICS A;  3CK6 A;  5CWR A;  4X4T A;  4QZ8 A;  4QZF A;  4FHW A;  4RWP A;  9ICB A;  3H38 A;  1ZQZ A;  2BBJ A;  2FMS A;  3AQN A;  7ICG A;  5HRD A;  1TFY A;  5J0Q A;  4YMM A;  9ICK A;  4KLS A;  7ICN A;  5DB6 A;  9ICE A;  4WC3 A;  9ICL A;  1ZQD A;  2ID1 A;  3JCF A;  4XJE A;  1ZQB A;  2W9M A;  1MQ2 A;  5DDY A;  4I2B A;  4M9J A;  4KLE A;  3ISC A;  3UPQ A;  8ICN A;  4PGY A;  1JN3 A;  4P4O A;  8ICH A;  1TFW A;  2B56 A;  4FHV A;  8ICB A;  4Z6D A;  2M2T A;  4K9B A;  4X0B A;  3MGH A;  4UB3 A;  1ZQS A;  4KLM A;  4I0U A;  3OV7 A;  3HIY A;  2ZH9 A;  9ICH A;  7ICR A;  3WFS C;  5DED A;  4WQK A;  2DR5 A;  5J0Y A;  3WFR E;  4LVS A;  1ZQO A;  4LZD A;  3V72 A;  1ZJM A;  4I2G A;  4F5O A;  5J2B A;  5CFS A;  4K4G A;  2Q66 A;  4UB1 A;  4QZC A;  3JZ0 A;  8ICZ A;  2PBE A;  5IIM A;  4K99 A;  2ZH8 A;  9ICW A;  4JLX A;  3H39 A;  4K98 A;  4RQ1 A;  4WH5 A;  4YD2 A;  1VJ7 A;  4AT9 B;  4DOC A;  1KDH A;  7ICS A;  4F5Q A;  4XA5 A;  2HN1 A;  4TUS A;  3C2L A;  1UET A;  5J2E A;  4FHX A;  5J0R A;  4UB2 A;  4TUP A;  4R65 A;  4PPX A;  1ZQN A;  4O5K A;  1RZT A;  8ICA A;  4X4R A;  2M2U A;  2GAF D;  4FO1 A;  4KLQ A;  1ZQK A;  4TUQ A;  4KLI A;  3WFO A;  2B4V A;  3H37 A;  3OWG A;  1ZQT A;  3OVA A;  4RPY A;  1TV9 A;  4RT3 A;  4KB6 A;  9ICM A;  5IIK A;  4MFA A;  4MF2 A;  5HRB A;  1RPL A;  4QZI A;  1MIY A;  4TUR A;  3UXP A;  5III A;  3JPS A;  9ICR A;  2GA9 D;  4IQU A;  3UXN A;  4EP7 A;  1BPB A;  3JPO A;  4UAW A;  1XSN A;  1ZQH A;  4RT2 A;  9ICT A;  4QZA A;  3ER8 C;  7ICI A;  4EBJ A;  5CHE A;  5D62 A;  2ISP A;  4ATB A;  1BPX A;  5J2C A;  4RQ5 A;  3C18 A;  4OAF A;  4XQ8 A;  9ICN A;  4M04 A;  3B0X A;  3RJF A;  4O6A A;  3ISD A;  5TZV A;  4R64 A;  5DDM A;  4I28 A;  3AU2 A;  9ICA A;  7ICV A;  5J2H A;  7ICJ A;  4KLU A;  5D46 A;  5HRF A;  3JYY A;  1NO5 A;  2O5A A;  5J0O A;  8ICC A;  7ICE A;  4M9H A;  4X4S A;  3C2K A;  3ERC C;  3LQC B;  1BPY A;  5HHI A;  2B51 A;  3ISB A;  4X4N A;  2ZH1 A;  5J0S A;  3PNC A;  3K75 D;  1PX5 A;  2DR7 A;  5D63 A;  9ICQ A;  4F5R A;  4GXI A;  1VFG A;  1WOT A;  4I2C A;  1JQR A;  9ICV A;  4EEB A;  5HRK A;  5BOM A;  1KEJ A;  3AQM A;  7ICP A;  4IG8 A;  2BCS A;  5DBC A;  1JMS A;  1ZQM A;  5HRL A;  2BE3 A;  5F2V O;  2BBH A;  3JPT A;  2I9G A;  2ZH3 A;  5J0X A;  1MIW A;  8ICL A;  1ZQP A;  2FMQ A;  4MKP A;  2DRB A;  8ICR A;  1MIV A;  4E8F A;  4WBY A;  3RH4 A;  4NXX A;  9ICI A;  4PHD A;  2FCL A;  5CR0 A;  3UQ0 A;  4ATB B;  4GXJ A;  4K97 A;  4OAH A;  5HC9 A;  2HN2 A;  1JAJ A;  1UEU A;  2DRA A;  5HRE A;  3RJK A;  5D49 A;  5B3P A;  4PH5 A;  4WC4 A;  4I2A A;  3AU6 A;  3MBY A;  4FO6 A;  3V7K A;  8ICX A;  1ZQF A;  4FHP A;  4KLD A;  5CFU A;  3RJJ A;  8ICM A;  3K7D A;  4NLK A;  4I29 A;  1XSP A;  3RJI A;  1ZJN A;  5CP2 A;  4WC5 A;  4NXV A;  5HRH A;  4NY8 A;  3PMN A;  4NXT A;  4DOA A;  4AT8 A;  4UAY A;  5HR9 A;  5J2I A;  4MFC A;  8ICT A;  4EBK A;  2PXI A;  4PHA A;  4WC7 A;  4QZ9 A;  4F5N A;  9ICC A;  4LEZ A;  4RQ2 A;  4GXK A;  3AQK A;  3C2M A;  7ICT A;  5D61 A;  2BPC A;  4I2E A;  1MQ3 A;  4NLZ A;  7ICF A;  3JPN A;  4R63 A;  2BPG A;  8ICP A;  4I27 A;  4P4M A;  5IIJ A;  7ICM A;  9ICU A;  5DBB A;  4RWN A;  4AT8 B;  2O1P A;  4M9L A;  4WQL A;  9ICF A;  4EGW A;  4RQ7 A;  3RH6 A;  4X4V A;  1KNY A;  1NOM A;  2PFO A;  5IIL A;  3NYB A;  4IQV A;  1R89 A;  3GDX A;  5D4B A;  2IHM A;  8ICV A;  4EED A;  1ZQC A;  3TFR A;  4WC1 A;  3NVO A;  4LEV A;  4UBC A;  7ICU A;  4P2H A;  3UQ2 A;  1R8B A;  4YN4 A;  1F5A A;  3C5G A;  4JLZ A;  4DOB A;  1ZQV A;  3RH5 A;  4X4U A;  1Q78 A;  5EOZ A;  4LZG A;  4LT6 A;  4DO9 A;  9ICJ A;  3C66 A;  3HJ1 A;  4X4P A;  4KLT A;  4NXU A;  2ISO A;  4RQ0 A;  4UD4 A;  2NRK A;  8ICE A;  4KLF A;  9ICG A;  3AQL A;  1BPE A;  4NM1 A;  5J2J A;  4KLH A;  5CA7 A;  4JWM A;  4R66 A;  2P66 A;  4UB4 A;  4K9A A;  3NKU A;  9ICP A;  4FH5 A;  4RQ4 A;  1ZQR A;  3OUY A;  4KM5 A;  4LEW A;  4UBB A;  4X0A A;  4YD1 A;  4QZD A;  1ZQG A;  3NWI A;  2ZH2 A;  3EF2 A;  3OVB A;  1XSL A;  4MFF A;  4QZB A;  4WCW A;  1OU5 A;  2DVI A;  7ICH A;  4WBZ A;  4I2D A;  9ICO A;  4QZE A;  5DEC A;  1ZQQ A;  5J29 A;  8ICK A;  4FHY A;  2ZHB A;  5J2F A;  2M2V A;  3HWT A;  4PHE A;  3V7L A;  3OGU A;  2PFN A;  4OAG A;  3HJ4 A;  1ZQU A;  4M5D A;  3H3A A;  5CJ7 A; 
#chains in the Genus database with same CATH homology
 4I2H A;  3JPP A;  2BPF A;  8ICU A;  5J0P A;  4RPZ A;  4AT7 A;  1BPD A;  8ICO A;  7ICO A;  4F5P A;  4X5V A;  4NXW A;  1ZQW A;  5BPC A;  3MDC A;  4FH3 A;  3HX0 A;  1HUO A;  4QZH A;  4NM2 A;  4WC6 A;  2M2W A;  4E7X A;  5DBA A;  3B0Y A;  2ZHA A;  4I2F A;  4AT9 A;  4RWO A;  4Z6E A;  4Z6F A;  3RJH A;  5J0U A;  1BPZ A;  7ICK A;  2BCQ A;  8ICJ A;  1ZQJ A;  3AUO A;  3RJG A;  4KLG A;  4I2I A;  1UEV A;  5HHH A;  4RQ8 A;  4O5C A;  4K8V A;  1R8C A;  3MDA A;  3MGI A;  4KLO A;  1Q79 A;  4IQT A;  3TFS A;  1ZQX A;  3V7J A;  4M9N A;  3RJE A;  5J2A A;  4JWN A;  4WC0 A;  5BOL A;  5DKW A;  4X4Q A;  8ICG A;  4M2Y A;  1ZQY A;  3LK9 A;  4S3N A;  2BCV A;  5DB8 A;  5HRI A;  5CB1 A;  2ZH7 A;  4UD5 A;  4KLJ A;  4M47 A;  1HUZ A;  4K4I A;  2ZH5 A;  4I2J A;  4E80 A;  4YCX A;  4PGQ A;  5CHG A;  5J0W A;  2PFP A;  4NKT A;  3OVS A;  4Z6C A;  4K4H A;  4RQ6 A;  2FMP A;  5J2D A;  4RQ3 A;  4M0A A;  5IIN A;  4O9M A;  1YLQ A;  2ZH6 A;  4X4O A;  3WFQ E;  1R8A A;  4O69 A;  5IIO A;  4YMN A;  4NXZ A;  3UXO A;  4RWQ A;  2VAN A;  4NKU A;  3L9D A;  5DB7 A;  1TVA A;  4MF8 A;  3WFP A;  3C5F A;  2RFF A;  4XRH A;  3OUY B;  5J0T A;  3JPR A;  4XQ7 A;  5HRG A;  5J2K A;  2GWS A;  8ICF A;  4UB5 A;  4K96 A;  2HHP A;  4YMO A;  4PHP A;  1ZQA A;  7ICL A;  1ZQL A;  4IQW A;  4QZG A;  8ICY A;  4LEY A;  4M9G A;  4O68 A;  3UPS A;  7ICQ A;  4WOY A;  4O67 A;  3HW8 A;  9ICX A;  4KLL A;  1FA0 A;  4OAI Z;  4UAZ A;  5DB9 A;  3JPQ A;  4PGX A;  4WC2 A;  8ICW A;  8ICQ A;  2DR9 A;  4P4P A;  4O5E A;  4AT7 B;  3PML A;  5J2G A;  2BCR A;  2ZH4 A;  2BCU A;  4XUS A;  8ICS A;  1ZQI A;  8ICI A;  2PFQ A;  2DR8 A;  4RPX A;  1ZQE A;  4NLN A;  1V4A A;  9ICS A;  5CWR A;  4X4T A;  4QZ8 A;  4QZF A;  4FHW A;  4RWP A;  9ICB A;  3H38 A;  1ZQZ A;  2FMS A;  3AQN A;  7ICG A;  5HRD A;  1TFY A;  5J0Q A;  4YMM A;  9ICK A;  4KLS A;  7ICN A;  5DB6 A;  9ICE A;  4WC3 A;  9ICL A;  1ZQD A;  2ID1 A;  1ZQB A;  2W9M A;  1MQ2 A;  5DDY A;  4I2B A;  4M9J A;  4KLE A;  3ISC A;  3UPQ A;  8ICN A;  4PGY A;  1JN3 A;  4P4O A;  8ICH A;  1TFW A;  2B56 A;  4FHV A;  8ICB A;  4Z6D A;  2M2T A;  4K9B A;  4X0B A;  3MGH A;  4UB3 A;  1ZQS A;  4KLM A;  3OV7 A;  3HIY A;  2ZH9 A;  9ICH A;  7ICR A;  3WFS C;  5DED A;  5J0Y A;  2DR5 A;  3WFR E;  4LVS A;  1ZQO A;  4LZD A;  3V72 A;  1ZJM A;  4I2G A;  4F5O A;  5J2B A;  4K4G A;  2Q66 A;  4UB1 A;  4QZC A;  3JZ0 A;  8ICZ A;  2PBE A;  5IIM A;  4K99 A;  2ZH8 A;  9ICW A;  4JLX A;  3H39 A;  4K98 A;  4RQ1 A;  4YD2 A;  1VJ7 A;  4AT9 B;  4DOC A;  1KDH A;  7ICS A;  4F5Q A;  4XA5 A;  4TUS A;  3C2L A;  1UET A;  5J2E A;  4FHX A;  5J0R A;  4UB2 A;  4TUP A;  4R65 A;  4PPX A;  1ZQN A;  4O5K A;  1RZT A;  8ICA A;  4X4R A;  2M2U A;  4KLQ A;  1ZQK A;  4TUQ A;  4KLI A;  3WFO A;  2B4V A;  3H37 A;  1ZQT A;  3OVA A;  4RPY A;  1TV9 A;  4RT3 A;  4KB6 A;  9ICM A;  5IIK A;  4MFA A;  4MF2 A;  5HRB A;  1RPL A;  4QZI A;  1MIY A;  4TUR A;  3UXP A;  5III A;  3JPS A;  9ICR A;  4IQU A;  3UXN A;  4EP7 A;  1BPB A;  3JPO A;  4UAW A;  1XSN A;  1ZQH A;  4RT2 A;  9ICT A;  4QZA A;  7ICI A;  4EBJ A;  2ISP A;  4ATB A;  1BPX A;  5J2C A;  4RQ5 A;  3C18 A;  4OAF A;  4XQ8 A;  9ICN A;  4M04 A;  3B0X A;  3RJF A;  4O6A A;  3ISD A;  5TZV A;  4R64 A;  5DDM A;  4I28 A;  3AU2 A;  9ICA A;  7ICV A;  5J2H A;  7ICJ A;  4KLU A;  5D46 A;  5HRF A;  3JYY A;  1NO5 A;  2O5A A;  5J0O A;  8ICC A;  7ICE A;  4M9H A;  4X4S A;  3C2K A;  3LQC B;  1BPY A;  5HHI A;  2B51 A;  3ISB A;  4X4N A;  2ZH1 A;  5J0S A;  3PNC A;  3K75 D;  1PX5 A;  2DR7 A;  9ICQ A;  4F5R A;  4GXI A;  1VFG A;  1WOT A;  4I2C A;  1JQR A;  9ICV A;  5HRK A;  5BOM A;  1KEJ A;  3AQM A;  7ICP A;  4IG8 A;  2BCS A;  5DBC A;  1JMS A;  1ZQM A;  5HRL A;  2BE3 A;  5F2V O;  3JPT A;  2I9G A;  2ZH3 A;  5J0X A;  1MIW A;  8ICL A;  1ZQP A;  2FMQ A;  4MKP A;  2DRB A;  8ICR A;  1MIV A;  4E8F A;  4WBY A;  3RH4 A;  4NXX A;  9ICI A;  4PHD A;  5CR0 A;  3UQ0 A;  4ATB B;  4GXJ A;  4K97 A;  4OAH A;  5HC9 A;  1JAJ A;  1UEU A;  2DRA A;  5HRE A;  3RJK A;  5D49 A;  4PH5 A;  4WC4 A;  4I2A A;  3AU6 A;  3MBY A;  4FO6 A;  3V7K A;  8ICX A;  1ZQF A;  4FHP A;  4KLD A;  3RJJ A;  8ICM A;  4NLK A;  4I29 A;  1XSP A;  3RJI A;  1ZJN A;  5CP2 A;  4WC5 A;  4NXV A;  5HRH A;  4NY8 A;  3PMN A;  4NXT A;  4DOA A;  4AT8 A;  4UAY A;  5HR9 A;  5J2I A;  4MFC A;  8ICT A;  4EBK A;  2PXI A;  4PHA A;  4WC7 A;  4QZ9 A;  4F5N A;  9ICC A;  4LEZ A;  4RQ2 A;  4GXK A;  3AQK A;  3C2M A;  7ICT A;  2BPC A;  4I2E A;  1MQ3 A;  4NLZ A;  7ICF A;  3JPN A;  4R63 A;  2BPG A;  8ICP A;  4I27 A;  4P4M A;  5IIJ A;  7ICM A;  9ICU A;  5DBB A;  4RWN A;  4AT8 B;  2O1P A;  4M9L A;  9ICF A;  4RQ7 A;  3RH6 A;  4X4V A;  1KNY A;  1NOM A;  2PFO A;  5IIL A;  3NYB A;  4IQV A;  1R89 A;  3GDX A;  5D4B A;  2IHM A;  8ICV A;  1ZQC A;  3TFR A;  4WC1 A;  4LEV A;  4UBC A;  7ICU A;  4P2H A;  3UQ2 A;  1R8B A;  4YN4 A;  1F5A A;  3C5G A;  4JLZ A;  4DOB A;  1ZQV A;  3RH5 A;  4X4U A;  1Q78 A;  5EOZ A;  4LZG A;  4LT6 A;  4DO9 A;  9ICJ A;  3C66 A;  3HJ1 A;  4X4P A;  4KLT A;  4NXU A;  2ISO A;  4RQ0 A;  4UD4 A;  2NRK A;  8ICE A;  4KLF A;  9ICG A;  3AQL A;  1BPE A;  4NM1 A;  5J2J A;  4KLH A;  5CA7 A;  4JWM A;  4R66 A;  2P66 A;  4UB4 A;  4K9A A;  9ICP A;  4FH5 A;  4RQ4 A;  1ZQR A;  3OUY A;  4KM5 A;  4LEW A;  4UBB A;  4X0A A;  4YD1 A;  4QZD A;  1ZQG A;  2ZH2 A;  3OVB A;  1XSL A;  4MFF A;  4QZB A;  4WCW A;  1OU5 A;  2DVI A;  7ICH A;  4WBZ A;  4I2D A;  9ICO A;  4QZE A;  5DEC A;  1ZQQ A;  5J29 A;  8ICK A;  4FHY A;  2ZHB A;  5J2F A;  2M2V A;  3HWT A;  4PHE A;  3V7L A;  3OGU A;  2PFN A;  4OAG A;  3HJ4 A;  1ZQU A;  4M5D A;  3H3A A;  5CJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...